2IUPA

Crystal structure of dithionite-reduced aromatic amine dehydrogenase (aadh) from alcaligenes faecalis
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
360
structure length
360
Chain Sequence
REVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords AROMATIC AMINE DEHYDROGENASE ALPHA SUBUNIT
publication title Atomic level insight into the oxidative half-reaction of aromatic amine dehydrogenase.
pubmed doi rcsb
total genus 95
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2iupA01
4I79A 4J84A 4D0KA 2YNPA 2IUQA 2YBAA 4GZ8A 4E5ZB 4CI1A 4BH6A 3UVMA 5I5MA 4O9DA 2PM7B 4HDJA 5B4WA 5HQGA 3I7HA 4CZVA 1SQJA 3EI1A 3EU7A 3EI1B 2CE9A 4H5JA 1JMXB 5H14A 3IJ0A 2IUVA 2CN3A 3L4MD 3PXSD 2IUPA 3DWLC 3BWSA 2EBSA 2HKRA 3E0CA 2B4EA 3SXTD 4A2LA 3EI3A 1Q47A 4FB1D 3DXKC 2AGLA 4FA1D 1PI6A 2GC7A 2Z2NA 4X60B 3K26A 2IWKA 3J80g 4L1QD 3OKYB 3MKQA 4L9OA 2IURA 2AQ5A 4J86A 4JT6C 4FAND 1TBGA 3I7OA 3V9FA 1R5MA 5FLXg 1NR0A 2HKMA 4O1QD 5TDHB 3SLED 1ERJA 5FKQA 3MZKA 4FHLA 3SBRA 4ZOZA 2CN2A 2AGZA 3JRPA 5HE1B 4J0WA 4U1EI 4ZOYA 4JSXC 4FAVD 3IIWA 3UVNA 4GM8A 5EAPA 1K8KC 1JMZB 4AEZA 3EG6A 3SVWD 2AH1A 2OK4A 4GGCA 2PBIB 4OZUA 1MG3A 2B5MA 4AOWA 1JOFA 3GFCA 4GGAA 4A09B 4GMBA 5GMKn 5A2Qg 2HESX 3OW8A 3AFCA 4ERQA 5C9ZB 2CO0A 2H3XA 3SN6B 3MZLA 2MTAH 5I5JA 4L3GD 4J87A 4CY5A 1PEVA 1S4UX 4A11A 3RSEC 3AH8B 2OJYA 3K27A 3ZWLB 2I0TA 4X3EA 4QT8A 3RRMC 3PXWD 5IGQA 3PVWB 2PM6B 5IJ8E 3C9CA 3UR4A 3UVKA 4PXWA 4O3UB 4NSXA 3UVLA 5K1CC 5TEEA 4GQBB 3FM0A 4E5ZA 2XYIA 4LG9A 5EMJB 4PBZA 4GGDA 2H9MA 3SBPA 3VGZA 4K3ID 4QL1A 3RLMD 1QNIA 3JPXA 2QXVA 5FKSA 2J56H 4ES0A 4UI9R 4ESGA 3EI2B 4JSNC 3DXMC 3EWEA 2Z2PA 2O9KA 2H47A 3I2NA 3JROA 5HE2B 3V7DB 5H1MA 4D6VA 1FWXA 4BL0A 5CYKB 2UZYB 2H9PA 4ERYA 3ODTA 5TF2A 2TRCB 2Z2OA 1P22A 3A0FA 5EARA 2UZXB 3N0DA 2P9PC 5FQDA 4JT5C 4CI2A 4PSXB 1GG2B 4G56B 3FGBA 3MXXA 4YVDA 1RI6A 4XYIA 3OKYA 3F3FA 3I89A 5H17A 3AL9A 4QQEA 3I7KA 1GP2B 2XL3A 1TYQC 5GXHA 3IIYA 2P9UC 2H14A 5EMKB 4ZOXA 5EALA 3RFGA 2BBKH 1MG2A 1L0QA 5HE0B 1GOTB 3RMZD 2CNXA 4E54B 1GXRA 3L4OD 5IJ7E 4XYHA 1MDAH 4A08B 1NEXB 4Y7RA 3OL2B 2YNOA 4CZYA 3PSCB 5HYNB 2PM9B 4U7AA 1SHYB 3ULEC 4BUJC 4J8BA 4A0BB 2OIZA 5FKRA 3RFHA 4ERZA 5EM2B 2G99A 2I3SA 3DM0A 4A09A 3JZHA 2I3TA 2G9AA 1XIPA 5C2WB 3FRXA 3SCYA 4A0AB 4XEIC 1U4CA 5THAA 5IT9g 5JWZA 2HXCA 4K3JB 3P4FA 3OKTA 3JB9L 3NVQA 4J82A 4JD2C 3W15A 1SQ9A 1U2VC 3EI4B 4X63B 2I0RA 2AGXA 2H68A 5AJAA 2OVRB 5FXYA 5AFU3 3UKUC 3MMYA 2H9LA 2J57G 4CY2A 1B9YA 3IKOA 3OKWA 5CXCA 5CXCB 4N14A 3I7LA 4O45A 5TEFA 2GC4A 4L3HD 3F3GA 3C99A 2I0SA 3SBQA 2P9IC 5I5IA 1N6EA 3SMRA 3AL8B 5IC7A 3JZGA 2P9LC 2AGWA 3NVNA 5KDOB 3PE7A 3DSMA 4JSVC 4FA4D 1XKSA 4GQ2P 4CI3A 3C75H 3EI2A 1OLZA 3I7PA 4JXMA 4J79A 4OWRA 4EWRA 3EMHA 3UKRC 2YMUA 2W18A 5CXBA 5CXBB 3VH0A 4PNKB 2CE8A 3N0EA 2Q7QA 3OTTA 4PC0A 5K19A 2P9NC 3KRXB 2IWFA 1A0RB 4J77A 3KRWB 3MKSB 5CYKA 3JAMg 4PSWB 4O3TB 2BCJB 2H6QA 2HJBA 4QRJA 2H13A 2XL2A 3BG1A 4J73A 5IGOA 4Y5RD 3CFVA 3I7NA 3U4YA 2B5LA 4J78A 5GSAA 2HYEA 4LG8A 5EAMA 3VA6A 3SJLD 3B7FA 1JJUB 4Z8LA 4KFMB 4TZ4A 4GM9A 2P9SC 4GM3A 3IJCA 2H6KA 3EI3B 4ZOVA 1YFQA 2B5NA 4FA5D 4R7AB 4CY3A 2GNQA 3GREA 3J81g 3PSLA 3SFZA 1XHMA 2YB8B 3NVXA 4FA9D 4J8GA 3SWSD 4A2MA 2AGYA 5AMSA 4E54A 3RN1D 3UVOA 1OMWB 3CIKB 4CI8A 3PVUB 4GQ1A 3V5WB 4A08A 3OL2A 1N6DA 4FWWA 2YNNA 4CZXA 2OVPB 3I8CA 5SXMA 2PM9A 4MK0B 4J0XA 4H5IA 3HFQA 4A0BA 5C2VB 2CO0C 1B9XA 2H6NA 5EMMB 3C5MA 5EM2A 4CY1A 4LGNA 2IAAA 4JSPC 4A7JA 2OK6A 3ORVD 1PBYB 2H9NA 2XU7A 4A0AA 2QC5A 4ZN4A 1N6FA 1VYHC 2OVQB 4IA9A 3EI4A 3I8EA 2P9KC 5EMLB 1PGUA 3BG0A 1K32A 3SHFA 3JZNA 5HE3B 3CFSB 5FKTA 2HJ4A 5GXIA 3IJ1A 3F3PA 4PBYA 4CC9A 4A11B 4X61B 4IMMA 3RN0D 2J55H 3AL8A 2AH0A 3PXTD 5FA5B 4J81A
chains in the Genus database with same CATH superfamily
4I79A 4J84A 4D0KA 2YNPA 1A12A 2IUQA 2YBAA 4GZ8A 4E5ZB 4CI1A 3EQ7A 4BH6A 4Z7QA 3UVMA 5I5MA 2XDWA 1E8MA 4O9DA 2PM7B 4HDJA 4DNUA 4AN0A 3IJEA 5B4WA 5HQGA 3I7HA 4CZVA 1SQJA 3EI1A 3EU7A 3EI1B 2CE9A 4H5JA 3ZE2A 1JMXB 5H14A 3IJ0A 2IUVA 2CN3A 3L4MD 3PXSD 2IUPA 1C9LA 3DWLC 3BWSA 2EBSA 3OF7A 2HKRA 3E0CA 3VI4A 3QHYB 2B4EA 3SXTD 4A2LA 3EI3A 3IUNA 1VZ2A 1Q47A 4FB1D 3DXKC 2AGLA 4FA1D 4NC4A 1PI6A 2GC7A 2Z2NA 4X60B 3K26A 1VE7A 2IWKA 3J80g 4L1QD 5M5SA 5C86A 3OKYB 3MKQA 4JHNA 4L9OA 2IURA 2AQ5A 3FCUA 4J86A 4JT6C 4FAND 1TBGA 3I7OA 3V9FA 1R5MA 5FLXg 4DNVA 1NR0A 2HKMA 3V4PA 4O1QD 5TDHB 1E8NA 3SLED 1ERJA 5FKQA 3MZKA 4FHLA 3SBRA 4ZOZA 2CN2A 2AGZA 3JRPA 5HE1B 3MUNA 4J0WA 3ZE0A 1L5GA 4U1EI 4ZOYA 4JSXC 2VDNA 1C9IA 4FAVD 3IIWA 3UVNA 4GM8A 5EAPA 1K8KC 4BCDA 1GOGA 1VE6A 1JMZB 4AEZA 3EG6A 3SVWD 2AH1A 5FFOA 2OK4A 1U8CA 4GGCA 2PBIB 4OZUA 4AMZA 1MG3A 2B5MA 4AOWA 1JOFA 3EQ9A 4UM9A 2EIEA 3V4VA 3GFCA 4GGAA 4A09B 4GMBA 5GMKn 5A2Qg 2HESX 3OW8A 3O4IA 3AFCA 4ERQA 5C9ZB 2CO0A 5M5TA 2H3XA 3SN6B 4DNWA 3MZLA 4NBMA 2MTAH 5I5JA 4L3GD 2VDMA 4J87A 1PEVA 4CY5A 1S4UX 4A11A 3RSEC 3AH8B 1QFMA 2OJYA 3K27A 1H2ZA 4WK2A 3ZWLB 2I0TA 4X3EA 4QT8A 3RRMC 3PXWD 5IGQA 3PVWB 2PM6B 5IJ8E 3C9CA 3UR4A 3UVKA 4PXWA 4G1EA 4O3UB 4NSXA 3UVLA 5K1CC 5TEEA 4GQBB 3FM0A 4E5ZA 3NIGA 2XYIA 4LG9A 5EMJB 4PBZA 4GGDA 2H9MA 3SBPA 3VGZA 4K3ID 4BCBA 3T3PA 4MMYA 4QAMA 4QL1A 2VC2A 2VDQA 3RLMD 1O6GA 1QNIA 3JPXA 2QXVA 5FKSA 2J56H 4ES0A 5E6SA 4UI9R 4ESGA 3EI2B 3IUQA 4JSNC 5FFGA 3DXMC 2VZ3A 3EWEA 1M1XA 3GD1I 4BCCA 2Z2PA 2O9KA 2H47A 3MVDK 1YR2A 3I2NA 3ZDYA 3JROA 2EIDA 5HE2B 3KCIA 3V7DB 5H1MA 4D6VA 3T3MA 1FWXA 4BL0A 5CYKB 2UZYB 2H9PA 1UOPA 2EICA 4ERYA 3ODTA 1VZ3A 5TF2A 2TRCB 2Z2OA 1P22A 3A0FA 5EARA 1H2XA 2UZXB 3N0DA 4G55A 2P9PC 5FQDA 4L1MA 4JT5C 4CI2A 4IRZA 4PSXB 1GG2B 4G56B 4D9SA 3FGBA 3MXXA 4YVDA 1RI6A 4XYIA 3EQ8A 3OKYA 3F3FA 3I89A 2HU5A 3VI3A 1QFSA 5H17A 3O4HA 3AL9A 4QQEA 3I7KA 1GP2B 2XL3A 1TYQC 5GXHA 3IIYA 2P9UC 2H14A 5EMKB 4ZOXA 5EALA 3RFGA 2BBKH 1MG2A 3ZE1A 1L0QA 5HE0B 1GOTB 3RMZD 2CNXA 4E54B 1GXRA 3L4OD 5IJ7E 4XYHA 1MDAH 4O2WA 3IVMA 4A08B 1NEXB 4Y7RA 3OL2B 2VDPA 2YNOA 4CZYA 3PSCB 4AN1A 3ZDZA 5HYNB 3IULA 2PM9B 4U7AA 4UM8A 4NENA 1SHYB 3ULEC 5M5VA 2XE4A 2WQ8A 4BUJC 4J8BA 4A0BB 2OIZA 5FKRA 3RFHA 1UTCA 4ERZA 4BP9A 5EM2B 3K72A 2G99A 2I3SA 3DM0A 4A09A 3JZHA 3NIFA 2I3TA 1UOOA 2G9AA 1XIPA 5C2WB 3FRXA 3SCYA 4A0AB 4XEIC 1U4CA 5THAA 5IT9g 5JWZA 2QR5A 2HXCA 4K3JB 3P4FA 4Z7OA 2BKLA 3OKTA 3JB9L 3NVQA 4J82A 4JD2C 3W15A 2HU7A 1SQ9A 1U2VC 3EI4B 4X63B 2XZGA 1O6FA 2I0RA 2AGXA 2H68A 5AJAA 2OVRB 5FXYA 1H2WA 5AFU3 3UKUC 2VZ1A 3MMYA 2H9LA 2J57G 5E6RA 1B9YA 4WJKA 4CY2A 3IKOA 3OKWA 3NIDA 5CXCA 5CXCB 4N14A 3I7LA 4O02A 1TYEA 4O45A 5TEFA 2GC4A 4L3HD 3F3GA 3C99A 2I0SA 3SBQA 4MMXA 2P9IC 2VDLA 1N6EA 5I5IA 3SMRA 3AL8B 5IC7A 5M5UA 3JZGA 2P9LC 1JV2A 2AGWA 3NVNA 5KDOB 3PE7A 3DSMA 4RE6A 4JSVC 4FA4D 1XKSA 4GQ2P 4CI3A 3C75H 3EI2A 1OLZA 3I7PA 4JXMA 4J79A 4OWRA 4EWRA 2QZPA 3EMHA 3UKRC 3ZDXA 5C92A 2YMUA 2W18A 5CXBA 5CXBB 3VH0A 4PNKB 3DDUA 3FCSA 2CE8A 3N0EA 5HDBA 2Q7QA 3OTTA 4PC0A 3MUOA 2P9NC 5K19A 3KRXB 2IWFA 1A0RB 4J77A 5E6UA 3KRWB 1K3IA 3MKSB 5CYKA 3JAMg 4PSWB 4O3TB 1E5TA 2BCJB 2H6QA 5M61A 2HJBA 4QRJA 2H13A 2XL2A 3BG1A 4Z7NA 4J73A 5IGOA 4Y5RD 3CFVA 1GOFA 2EIBA 3I7NA 3U4YA 2B5LA 4J78A 5GSAA 2HYEA 4LG8A 5EAMA 3VA6A 4NAAA 3SJLD 3B7FA 1JJUB 4Z8LA 3O4GA 4KFMB 4TZ4A 4GM9A 2P9SC 4GM3A 3IJCA 2H6KA 3EI3B 4ZOVA 4MMZA 1YFQA 2B5NA 4FA5D 4R7AB 4CY3A 2GNQA 3GREA 3J81g 3PSLA 3SFZA 1XHMA 4JHPC 2YB8B 2JKXA 2VDKA 3NVXA 4AX4A 4J8GA 4FA9D 3SWSD 3GC3B 3K71A 4A2MA 2AGYA 5AMSA 4E54A 3RN1D 3UVOA 1OMWB 3CIKB 4CI8A 3PVUB 4GQ1A 3V5WB 3IUJA 4A08A 3OL2A 1N6DA 2HU8A 3QI0A 2YNNA 4FWWA 3IUMA 4CZXA 2OVPB 3I8CA 5SXMA 2PM9A 4MK0B 4J0XA 4H5IA 3HFQA 4A0BA 5C2VB 2CO0C 1B9XA 2H6NA 4RE5A 5EMMB 3C5MA 5EM2A 4CY1A 4LGNA 3IURA 1I2MB 2IAAA 1T2XA 4JSPC 4A7JA 2OK6A 3ORVD 1PBYB 2H9NA 2XU7A 4A0AA 4BP8A 4WK4A 2QC5A 4ZN4A 1N6FA 1VYHC 2OVQB 4IA9A 3EI4A 3I8EA 2P9KC 4AMYA 2VDOA 5EMLB 1PGUA 3BG0A 1K32A 3SHFA 3JZNA 1GOHA 5HE3B 1H2YA 3CFSB 5FKTA 2HJ4A 5GXIA 3IJ1A 1BPOA 3F3PA 4PBYA 1UOQA 5M5RA 4CC9A 4A11B 4X61B 4G1MA 4WK0A 4IMMA 3RN0D 3K6SA 2J55H 3AL8A 2AH0A 3O4JA 2VDRA 1JTDB 3PXTD 5FA5B 4J81A
chains in the Genus database with same CATH topology
4I79A 4J84A 4D0KA 2YNPA 2IUQA 2YBAA 4GZ8A 4E5ZB 4CI1A 4BH6A 3UVMA 5I5MA 4O9DA 2PM7B 4HDJA 5B4WA 5HQGA 3I7HA 4CZVA 1SQJA 3EI1A 3EU7A 3EI1B 2CE9A 4H5JA 1JMXB 5H14A 3IJ0A 2IUVA 2CN3A 3L4MD 3PXSD 2IUPA 3DWLC 3BWSA 2EBSA 2HKRA 3E0CA 2B4EA 3SXTD 4A2LA 3EI3A 1Q47A 4FB1D 3DXKC 2AGLA 4FA1D 1PI6A 2GC7A 2Z2NA 4X60B 3K26A 2IWKA 3J80g 4L1QD 3OKYB 3MKQA 4L9OA 2IURA 2AQ5A 4J86A 4JT6C 4FAND 1TBGA 3I7OA 3V9FA 1R5MA 5FLXg 1NR0A 2HKMA 4O1QD 5TDHB 3SLED 1ERJA 5FKQA 3MZKA 4FHLA 3SBRA 4ZOZA 2CN2A 2AGZA 3JRPA 5HE1B 4J0WA 4U1EI 4ZOYA 4JSXC 4FAVD 3IIWA 3UVNA 4GM8A 5EAPA 1K8KC 1JMZB 4AEZA 3EG6A 3SVWD 2AH1A 2OK4A 4GGCA 2PBIB 4OZUA 1MG3A 2B5MA 4AOWA 1JOFA 3GFCA 4GGAA 4A09B 4GMBA 5GMKn 5A2Qg 2HESX 3OW8A 3AFCA 4ERQA 5C9ZB 2CO0A 2H3XA 3SN6B 3MZLA 2MTAH 5I5JA 4L3GD 4J87A 4CY5A 1PEVA 1S4UX 4A11A 3RSEC 3AH8B 2OJYA 3K27A 3ZWLB 2I0TA 4X3EA 4QT8A 3RRMC 3PXWD 5IGQA 3PVWB 2PM6B 5IJ8E 3C9CA 3UR4A 3UVKA 4PXWA 4O3UB 4NSXA 3UVLA 5K1CC 5TEEA 4GQBB 3FM0A 4E5ZA 2XYIA 4LG9A 5EMJB 4PBZA 4GGDA 2H9MA 3SBPA 3VGZA 4K3ID 4QL1A 3RLMD 1QNIA 3JPXA 2QXVA 5FKSA 2J56H 4ES0A 4UI9R 4ESGA 3EI2B 4JSNC 3DXMC 3EWEA 2Z2PA 2O9KA 2H47A 3I2NA 3JROA 5HE2B 3V7DB 5H1MA 4D6VA 1FWXA 4BL0A 5CYKB 2UZYB 2H9PA 4ERYA 3ODTA 5TF2A 2TRCB 2Z2OA 1P22A 3A0FA 5EARA 2UZXB 3N0DA 2P9PC 5FQDA 4JT5C 4CI2A 4PSXB 1GG2B 4G56B 3FGBA 3MXXA 4YVDA 1RI6A 4XYIA 3OKYA 3F3FA 3I89A 5H17A 3AL9A 4QQEA 3I7KA 1GP2B 2XL3A 1TYQC 5GXHA 3IIYA 2P9UC 2H14A 5EMKB 4ZOXA 5EALA 3RFGA 2BBKH 1MG2A 1L0QA 5HE0B 1GOTB 3RMZD 2CNXA 4E54B 1GXRA 3L4OD 5IJ7E 4XYHA 1MDAH 4A08B 1NEXB 4Y7RA 3OL2B 2YNOA 4CZYA 3PSCB 5HYNB 2PM9B 4U7AA 1SHYB 3ULEC 4BUJC 4J8BA 4A0BB 2OIZA 5FKRA 3RFHA 4ERZA 5EM2B 2G99A 2I3SA 3DM0A 4A09A 3JZHA 2I3TA 2G9AA 1XIPA 5C2WB 3FRXA 3SCYA 4A0AB 4XEIC 1U4CA 5THAA 5IT9g 5JWZA 2HXCA 4K3JB 3P4FA 3OKTA 3JB9L 3NVQA 4J82A 4JD2C 3W15A 1SQ9A 1U2VC 3EI4B 4X63B 2I0RA 2AGXA 2H68A 5AJAA 2OVRB 5FXYA 5AFU3 3UKUC 3MMYA 2H9LA 2J57G 4CY2A 1B9YA 3IKOA 3OKWA 5CXCA 5CXCB 4N14A 3I7LA 4O45A 5TEFA 2GC4A 4L3HD 3F3GA 3C99A 2I0SA 3SBQA 2P9IC 5I5IA 1N6EA 3SMRA 3AL8B 5IC7A 3JZGA 2P9LC 2AGWA 3NVNA 5KDOB 3PE7A 3DSMA 4JSVC 4FA4D 1XKSA 4GQ2P 4CI3A 3C75H 3EI2A 1OLZA 3I7PA 4JXMA 4J79A 4OWRA 4EWRA 3EMHA 3UKRC 2YMUA 2W18A 5CXBA 5CXBB 3VH0A 4PNKB 2CE8A 3N0EA 2Q7QA 3OTTA 4PC0A 5K19A 2P9NC 3KRXB 2IWFA 1A0RB 4J77A 3KRWB 3MKSB 5CYKA 3JAMg 4PSWB 4O3TB 2BCJB 2H6QA 2HJBA 4QRJA 2H13A 2XL2A 3BG1A 4J73A 5IGOA 4Y5RD 3CFVA 3I7NA 3U4YA 2B5LA 4J78A 5GSAA 2HYEA 4LG8A 5EAMA 3VA6A 3SJLD 3B7FA 1JJUB 4Z8LA 4KFMB 4TZ4A 4GM9A 2P9SC 4GM3A 3IJCA 2H6KA 3EI3B 4ZOVA 1YFQA 2B5NA 4FA5D 4R7AB 4CY3A 2GNQA 3GREA 3J81g 3PSLA 3SFZA 1XHMA 2YB8B 3NVXA 4FA9D 4J8GA 3SWSD 4A2MA 2AGYA 5AMSA 4E54A 3RN1D 3UVOA 1OMWB 3CIKB 4CI8A 3PVUB 4GQ1A 3V5WB 4A08A 3OL2A 1N6DA 4FWWA 2YNNA 4CZXA 2OVPB 3I8CA 5SXMA 2PM9A 4MK0B 4J0XA 4H5IA 3HFQA 4A0BA 5C2VB 2CO0C 1B9XA 2H6NA 5EMMB 3C5MA 5EM2A 4CY1A 4LGNA 2IAAA 4JSPC 4A7JA 2OK6A 3ORVD 1PBYB 2H9NA 2XU7A 4A0AA 2QC5A 4ZN4A 1N6FA 1VYHC 2OVQB 4IA9A 3EI4A 3I8EA 2P9KC 5EMLB 1PGUA 3BG0A 1K32A 3SHFA 3JZNA 5HE3B 3CFSB 5FKTA 2HJ4A 5GXIA 3IJ1A 3F3PA 4PBYA 4CC9A 4A11B 4X61B 4IMMA 3RN0D 2J55H 3AL8A 2AH0A 3PXTD 5FA5B 4J81A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I79 A;  4J84 A;  4D0K A;  2YNP A;  2IUQ A;  2YBA A;  4GZ8 A;  4E5Z B;  4CI1 A;  4BH6 A;  3UVM A;  5I5M A;  4O9D A;  2PM7 B;  4HDJ A;  5B4W A;  5HQG A;  3I7H A;  4CZV A;  1SQJ A;  3EI1 A;  3EU7 A;  3EI1 B;  2CE9 A;  4H5J A;  1JMX B;  5H14 A;  3IJ0 A;  2IUV A;  2CN3 A;  3L4M D;  3PXS D;  2IUP A;  3DWL C;  3BWS A;  2EBS A;  2HKR A;  3E0C A;  2B4E A;  3SXT D;  4A2L A;  3EI3 A;  1Q47 A;  4FB1 D;  3DXK C;  2AGL A;  4FA1 D;  1PI6 A;  2GC7 A;  2Z2N A;  4X60 B;  3K26 A;  2IWK A;  3J80 g;  4L1Q D;  3OKY B;  3MKQ A;  4L9O A;  2IUR A;  2AQ5 A;  4J86 A;  4JT6 C;  4FAN D;  1TBG A;  3I7O A;  3V9F A;  1R5M A;  5FLX g;  1NR0 A;  2HKM A;  4O1Q D;  5TDH B;  3SLE D;  1ERJ A;  5FKQ A;  3MZK A;  4FHL A;  3SBR A;  4ZOZ A;  2CN2 A;  2AGZ A;  3JRP A;  5HE1 B;  4J0W A;  4U1E I;  4ZOY A;  4JSX C;  4FAV D;  3IIW A;  3UVN A;  4GM8 A;  5EAP A;  1K8K C;  1JMZ B;  4AEZ A;  3EG6 A;  3SVW D;  2AH1 A;  2OK4 A;  4GGC A;  2PBI B;  4OZU A;  1MG3 A;  2B5M A;  4AOW A;  1JOF A;  3GFC A;  4GGA A;  4A09 B;  4GMB A;  5GMK n;  5A2Q g;  2HES X;  3OW8 A;  3AFC A;  4ERQ A;  5C9Z B;  2CO0 A;  2H3X A;  3SN6 B;  3MZL A;  2MTA H;  5I5J A;  4L3G D;  4J87 A;  4CY5 A;  1PEV A;  1S4U X;  4A11 A;  3RSE C;  3AH8 B;  2OJY A;  3K27 A;  3ZWL B;  2I0T A;  4X3E A;  4QT8 A;  3RRM C;  3PXW D;  5IGQ A;  3PVW B;  2PM6 B;  5IJ8 E;  3C9C A;  3UR4 A;  3UVK A;  4PXW A;  4O3U B;  4NSX A;  3UVL A;  5K1C C;  5TEE A;  4GQB B;  3FM0 A;  4E5Z A;  2XYI A;  4LG9 A;  5EMJ B;  4PBZ A;  4GGD A;  2H9M A;  3SBP A;  3VGZ A;  4K3I D;  4QL1 A;  3RLM D;  1QNI A;  3JPX A;  2QXV A;  5FKS A;  2J56 H;  4ES0 A;  4UI9 R;  4ESG A;  3EI2 B;  4JSN C;  3DXM C;  3EWE A;  2Z2P A;  2O9K A;  2H47 A;  3I2N A;  3JRO A;  5HE2 B;  3V7D B;  5H1M A;  4D6V A;  1FWX A;  4BL0 A;  5CYK B;  2UZY B;  2H9P A;  4ERY A;  3ODT A;  5TF2 A;  2TRC B;  2Z2O A;  1P22 A;  3A0F A;  5EAR A;  2UZX B;  3N0D A;  2P9P C;  5FQD A;  4JT5 C;  4CI2 A;  4PSX B;  1GG2 B;  4G56 B;  3FGB A;  3MXX A;  4YVD A;  1RI6 A;  4XYI A;  3OKY A;  3F3F A;  3I89 A;  5H17 A;  3AL9 A;  4QQE A;  3I7K A;  1GP2 B;  2XL3 A;  1TYQ C;  5GXH A;  3IIY A;  2P9U C;  2H14 A;  5EMK B;  4ZOX A;  5EAL A;  3RFG A;  2BBK H;  1MG2 A;  1L0Q A;  5HE0 B;  1GOT B;  3RMZ D;  2CNX A;  4E54 B;  1GXR A;  3L4O D;  5IJ7 E;  4XYH A;  1MDA H;  4A08 B;  1NEX B;  4Y7R A;  3OL2 B;  2YNO A;  4CZY A;  3PSC B;  5HYN B;  2PM9 B;  4U7A A;  1SHY B;  3ULE C;  4BUJ C;  4J8B A;  4A0B B;  2OIZ A;  5FKR A;  3RFH A;  4ERZ A;  5EM2 B;  2G99 A;  2I3S A;  3DM0 A;  4A09 A;  3JZH A;  2I3T A;  2G9A A;  1XIP A;  5C2W B;  3FRX A;  3SCY A;  4A0A B;  4XEI C;  1U4C A;  5THA A;  5IT9 g;  5JWZ A;  2HXC A;  4K3J B;  3P4F A;  3OKT A;  3JB9 L;  3NVQ A;  4J82 A;  4JD2 C;  3W15 A;  1SQ9 A;  1U2V C;  3EI4 B;  4X63 B;  2I0R A;  2AGX A;  2H68 A;  5AJA A;  2OVR B;  5FXY A;  5AFU 3;  3UKU C;  3MMY A;  2H9L A;  2J57 G;  4CY2 A;  1B9Y A;  3IKO A;  3OKW A;  5CXC A;  5CXC B;  4N14 A;  3I7L A;  4O45 A;  5TEF A;  2GC4 A;  4L3H D;  3F3G A;  3C99 A;  2I0S A;  3SBQ A;  2P9I C;  5I5I A;  1N6E A;  3SMR A;  3AL8 B;  5IC7 A;  3JZG A;  2P9L C;  2AGW A;  3NVN A;  5KDO B;  3PE7 A;  3DSM A;  4JSV C;  4FA4 D;  1XKS A;  4GQ2 P;  4CI3 A;  3C75 H;  3EI2 A;  1OLZ A;  3I7P A;  4JXM A;  4J79 A;  4OWR A;  4EWR A;  3EMH A;  3UKR C;  2YMU A;  2W18 A;  5CXB A;  5CXB B;  3VH0 A;  4PNK B;  2CE8 A;  3N0E A;  2Q7Q A;  3OTT A;  4PC0 A;  5K19 A;  2P9N C;  3KRX B;  2IWF A;  1A0R B;  4J77 A;  3KRW B;  3MKS B;  5CYK A;  3JAM g;  4PSW B;  4O3T B;  2BCJ B;  2H6Q A;  2HJB A;  4QRJ A;  2H13 A;  2XL2 A;  3BG1 A;  4J73 A;  5IGO A;  4Y5R D;  3CFV A;  3I7N A;  3U4Y A;  2B5L A;  4J78 A;  5GSA A;  2HYE A;  4LG8 A;  5EAM A;  3VA6 A;  3SJL D;  3B7F A;  1JJU B;  4Z8L A;  4KFM B;  4TZ4 A;  4GM9 A;  2P9S C;  4GM3 A;  3IJC A;  2H6K A;  3EI3 B;  4ZOV A;  1YFQ A;  2B5N A;  4FA5 D;  4R7A B;  4CY3 A;  2GNQ A;  3GRE A;  3J81 g;  3PSL A;  3SFZ A;  1XHM A;  2YB8 B;  3NVX A;  4FA9 D;  4J8G A;  3SWS D;  4A2M A;  2AGY A;  5AMS A;  4E54 A;  3RN1 D;  3UVO A;  1OMW B;  3CIK B;  4CI8 A;  3PVU B;  4GQ1 A;  3V5W B;  4A08 A;  3OL2 A;  1N6D A;  4FWW A;  2YNN A;  4CZX A;  2OVP B;  3I8C A;  5SXM A;  2PM9 A;  4MK0 B;  4J0X A;  4H5I A;  3HFQ A;  4A0B A;  5C2V B;  2CO0 C;  1B9X A;  2H6N A;  5EMM B;  3C5M A;  5EM2 A;  4CY1 A;  4LGN A;  2IAA A;  4JSP C;  4A7J A;  2OK6 A;  3ORV D;  1PBY B;  2H9N A;  2XU7 A;  4A0A A;  2QC5 A;  4ZN4 A;  1N6F A;  1VYH C;  2OVQ B;  4IA9 A;  3EI4 A;  3I8E A;  2P9K C;  5EML B;  1PGU A;  3BG0 A;  1K32 A;  3SHF A;  3JZN A;  5HE3 B;  3CFS B;  5FKT A;  2HJ4 A;  5GXI A;  3IJ1 A;  3F3P A;  4PBY A;  4CC9 A;  4A11 B;  4X61 B;  4IMM A;  3RN0 D;  2J55 H;  3AL8 A;  2AH0 A;  3PXT D;  5FA5 B;  4J81 A; 
#chains in the Genus database with same CATH topology
 4I79 A;  4J84 A;  4D0K A;  2YNP A;  1A12 A;  2IUQ A;  2YBA A;  4GZ8 A;  4E5Z B;  4CI1 A;  3EQ7 A;  4BH6 A;  4Z7Q A;  3UVM A;  5I5M A;  2XDW A;  1E8M A;  4O9D A;  2PM7 B;  4HDJ A;  4DNU A;  4AN0 A;  3IJE A;  5B4W A;  5HQG A;  3I7H A;  4CZV A;  1SQJ A;  3EI1 A;  3EU7 A;  3EI1 B;  2CE9 A;  4H5J A;  3ZE2 A;  1JMX B;  5H14 A;  3IJ0 A;  2IUV A;  2CN3 A;  3L4M D;  3PXS D;  2IUP A;  1C9L A;  3DWL C;  3BWS A;  2EBS A;  3OF7 A;  2HKR A;  3E0C A;  3VI4 A;  3QHY B;  2B4E A;  3SXT D;  4A2L A;  3EI3 A;  3IUN A;  1VZ2 A;  1Q47 A;  4FB1 D;  3DXK C;  2AGL A;  4FA1 D;  4NC4 A;  1PI6 A;  2GC7 A;  2Z2N A;  4X60 B;  3K26 A;  1VE7 A;  2IWK A;  3J80 g;  4L1Q D;  5M5S A;  5C86 A;  3OKY B;  3MKQ A;  4JHN A;  4L9O A;  2IUR A;  2AQ5 A;  3FCU A;  4J86 A;  4JT6 C;  4FAN D;  1TBG A;  3I7O A;  3V9F A;  1R5M A;  5FLX g;  4DNV A;  1NR0 A;  2HKM A;  3V4P A;  4O1Q D;  5TDH B;  1E8N A;  3SLE D;  1ERJ A;  5FKQ A;  3MZK A;  4FHL A;  3SBR A;  4ZOZ A;  2CN2 A;  2AGZ A;  3JRP A;  5HE1 B;  3MUN A;  4J0W A;  3ZE0 A;  1L5G A;  4U1E I;  4ZOY A;  4JSX C;  2VDN A;  1C9I A;  4FAV D;  3IIW A;  3UVN A;  4GM8 A;  5EAP A;  1K8K C;  4BCD A;  1GOG A;  1VE6 A;  1JMZ B;  4AEZ A;  3EG6 A;  3SVW D;  2AH1 A;  5FFO A;  2OK4 A;  1U8C A;  4GGC A;  2PBI B;  4OZU A;  4AMZ A;  1MG3 A;  2B5M A;  4AOW A;  1JOF A;  3EQ9 A;  4UM9 A;  2EIE A;  3V4V A;  3GFC A;  4GGA A;  4A09 B;  4GMB A;  5GMK n;  5A2Q g;  2HES X;  3OW8 A;  3O4I A;  3AFC A;  4ERQ A;  5C9Z B;  2CO0 A;  5M5T A;  2H3X A;  3SN6 B;  4DNW A;  3MZL A;  4NBM A;  2MTA H;  5I5J A;  4L3G D;  2VDM A;  4J87 A;  1PEV A;  4CY5 A;  1S4U X;  4A11 A;  3RSE C;  3AH8 B;  1QFM A;  2OJY A;  3K27 A;  1H2Z A;  4WK2 A;  3ZWL B;  2I0T A;  4X3E A;  4QT8 A;  3RRM C;  3PXW D;  5IGQ A;  3PVW B;  2PM6 B;  5IJ8 E;  3C9C A;  3UR4 A;  3UVK A;  4PXW A;  4G1E A;  4O3U B;  4NSX A;  3UVL A;  5K1C C;  5TEE A;  4GQB B;  3FM0 A;  4E5Z A;  3NIG A;  2XYI A;  4LG9 A;  5EMJ B;  4PBZ A;  4GGD A;  2H9M A;  3SBP A;  3VGZ A;  4K3I D;  4BCB A;  3T3P A;  4MMY A;  4QAM A;  4QL1 A;  2VC2 A;  2VDQ A;  3RLM D;  1O6G A;  1QNI A;  3JPX A;  2QXV A;  5FKS A;  2J56 H;  4ES0 A;  5E6S A;  4UI9 R;  4ESG A;  3EI2 B;  3IUQ A;  4JSN C;  5FFG A;  3DXM C;  2VZ3 A;  3EWE A;  1M1X A;  3GD1 I;  4BCC A;  2Z2P A;  2O9K A;  2H47 A;  3MVD K;  1YR2 A;  3I2N A;  3ZDY A;  3JRO A;  2EID A;  5HE2 B;  3KCI A;  3V7D B;  5H1M A;  4D6V A;  3T3M A;  1FWX A;  4BL0 A;  5CYK B;  2UZY B;  2H9P A;  1UOP A;  2EIC A;  4ERY A;  3ODT A;  1VZ3 A;  5TF2 A;  2TRC B;  2Z2O A;  1P22 A;  3A0F A;  5EAR A;  1H2X A;  2UZX B;  3N0D A;  4G55 A;  2P9P C;  5FQD A;  4L1M A;  4JT5 C;  4CI2 A;  4IRZ A;  4PSX B;  1GG2 B;  4G56 B;  4D9S A;  3FGB A;  3MXX A;  4YVD A;  1RI6 A;  4XYI A;  3EQ8 A;  3OKY A;  3F3F A;  3I89 A;  2HU5 A;  3VI3 A;  1QFS A;  5H17 A;  3O4H A;  3AL9 A;  4QQE A;  3I7K A;  1GP2 B;  2XL3 A;  1TYQ C;  5GXH A;  3IIY A;  2P9U C;  2H14 A;  5EMK B;  4ZOX A;  5EAL A;  3RFG A;  2BBK H;  1MG2 A;  3ZE1 A;  1L0Q A;  5HE0 B;  1GOT B;  3RMZ D;  2CNX A;  4E54 B;  1GXR A;  3L4O D;  5IJ7 E;  4XYH A;  1MDA H;  4O2W A;  3IVM A;  4A08 B;  1NEX B;  4Y7R A;  3OL2 B;  2VDP A;  2YNO A;  4CZY A;  3PSC B;  4AN1 A;  3ZDZ A;  5HYN B;  3IUL A;  2PM9 B;  4U7A A;  4UM8 A;  4NEN A;  1SHY B;  3ULE C;  5M5V A;  2XE4 A;  2WQ8 A;  4BUJ C;  4J8B A;  4A0B B;  2OIZ A;  5FKR A;  3RFH A;  1UTC A;  4ERZ A;  4BP9 A;  5EM2 B;  3K72 A;  2G99 A;  2I3S A;  3DM0 A;  4A09 A;  3JZH A;  3NIF A;  2I3T A;  1UOO A;  2G9A A;  1XIP A;  5C2W B;  3FRX A;  3SCY A;  4A0A B;  4XEI C;  1U4C A;  5THA A;  5IT9 g;  5JWZ A;  2QR5 A;  2HXC A;  4K3J B;  3P4F A;  4Z7O A;  2BKL A;  3OKT A;  3JB9 L;  3NVQ A;  4J82 A;  4JD2 C;  3W15 A;  2HU7 A;  1SQ9 A;  1U2V C;  3EI4 B;  4X63 B;  2XZG A;  1O6F A;  2I0R A;  2AGX A;  2H68 A;  5AJA A;  2OVR B;  5FXY A;  1H2W A;  5AFU 3;  3UKU C;  2VZ1 A;  3MMY A;  2H9L A;  2J57 G;  5E6R A;  1B9Y A;  4WJK A;  4CY2 A;  3IKO A;  3OKW A;  3NID A;  5CXC A;  5CXC B;  4N14 A;  3I7L A;  4O02 A;  1TYE A;  4O45 A;  5TEF A;  2GC4 A;  4L3H D;  3F3G A;  3C99 A;  2I0S A;  3SBQ A;  4MMX A;  2P9I C;  2VDL A;  1N6E A;  5I5I A;  3SMR A;  3AL8 B;  5IC7 A;  5M5U A;  3JZG A;  2P9L C;  1JV2 A;  2AGW A;  3NVN A;  5KDO B;  3PE7 A;  3DSM A;  4RE6 A;  4JSV C;  4FA4 D;  1XKS A;  4GQ2 P;  4CI3 A;  3C75 H;  3EI2 A;  1OLZ A;  3I7P A;  4JXM A;  4J79 A;  4OWR A;  4EWR A;  2QZP A;  3EMH A;  3UKR C;  3ZDX A;  5C92 A;  2YMU A;  2W18 A;  5CXB A;  5CXB B;  3VH0 A;  4PNK B;  3DDU A;  3FCS A;  2CE8 A;  3N0E A;  5HDB A;  2Q7Q A;  3OTT A;  4PC0 A;  3MUO A;  2P9N C;  5K19 A;  3KRX B;  2IWF A;  1A0R B;  4J77 A;  5E6U A;  3KRW B;  1K3I A;  3MKS B;  5CYK A;  3JAM g;  4PSW B;  4O3T B;  1E5T A;  2BCJ B;  2H6Q A;  5M61 A;  2HJB A;  4QRJ A;  2H13 A;  2XL2 A;  3BG1 A;  4Z7N A;  4J73 A;  5IGO A;  4Y5R D;  3CFV A;  1GOF A;  2EIB A;  3I7N A;  3U4Y A;  2B5L A;  4J78 A;  5GSA A;  2HYE A;  4LG8 A;  5EAM A;  3VA6 A;  4NAA A;  3SJL D;  3B7F A;  1JJU B;  4Z8L A;  3O4G A;  4KFM B;  4TZ4 A;  4GM9 A;  2P9S C;  4GM3 A;  3IJC A;  2H6K A;  3EI3 B;  4ZOV A;  4MMZ A;  1YFQ A;  2B5N A;  4FA5 D;  4R7A B;  4CY3 A;  2GNQ A;  3GRE A;  3J81 g;  3PSL A;  3SFZ A;  1XHM A;  4JHP C;  2YB8 B;  2JKX A;  2VDK A;  3NVX A;  4AX4 A;  4J8G A;  4FA9 D;  3SWS D;  3GC3 B;  3K71 A;  4A2M A;  2AGY A;  5AMS A;  4E54 A;  3RN1 D;  3UVO A;  1OMW B;  3CIK B;  4CI8 A;  3PVU B;  4GQ1 A;  3V5W B;  3IUJ A;  4A08 A;  3OL2 A;  1N6D A;  2HU8 A;  3QI0 A;  2YNN A;  4FWW A;  3IUM A;  4CZX A;  2OVP B;  3I8C A;  5SXM A;  2PM9 A;  4MK0 B;  4J0X A;  4H5I A;  3HFQ A;  4A0B A;  5C2V B;  2CO0 C;  1B9X A;  2H6N A;  4RE5 A;  5EMM B;  3C5M A;  5EM2 A;  4CY1 A;  4LGN A;  3IUR A;  1I2M B;  2IAA A;  1T2X A;  4JSP C;  4A7J A;  2OK6 A;  3ORV D;  1PBY B;  2H9N A;  2XU7 A;  4A0A A;  4BP8 A;  4WK4 A;  2QC5 A;  4ZN4 A;  1N6F A;  1VYH C;  2OVQ B;  4IA9 A;  3EI4 A;  3I8E A;  2P9K C;  4AMY A;  2VDO A;  5EML B;  1PGU A;  3BG0 A;  1K32 A;  3SHF A;  3JZN A;  1GOH A;  5HE3 B;  1H2Y A;  3CFS B;  5FKT A;  2HJ4 A;  5GXI A;  3IJ1 A;  1BPO A;  3F3P A;  4PBY A;  1UOQ A;  5M5R A;  4CC9 A;  4A11 B;  4X61 B;  4G1M A;  4WK0 A;  4IMM A;  3RN0 D;  3K6S A;  2J55 H;  3AL8 A;  2AH0 A;  3O4J A;  2VDR A;  1JTD B;  3PXT D;  5FA5 B;  4J81 A; 
#chains in the Genus database with same CATH homology
 4I79 A;  4J84 A;  4D0K A;  2YNP A;  2IUQ A;  2YBA A;  4GZ8 A;  4E5Z B;  4CI1 A;  4BH6 A;  3UVM A;  5I5M A;  4O9D A;  2PM7 B;  4HDJ A;  5B4W A;  5HQG A;  3I7H A;  4CZV A;  1SQJ A;  3EI1 A;  3EU7 A;  3EI1 B;  2CE9 A;  4H5J A;  1JMX B;  5H14 A;  3IJ0 A;  2IUV A;  2CN3 A;  3L4M D;  3PXS D;  2IUP A;  3DWL C;  3BWS A;  2EBS A;  2HKR A;  3E0C A;  2B4E A;  3SXT D;  4A2L A;  3EI3 A;  1Q47 A;  4FB1 D;  3DXK C;  2AGL A;  4FA1 D;  1PI6 A;  2GC7 A;  2Z2N A;  4X60 B;  3K26 A;  2IWK A;  3J80 g;  4L1Q D;  3OKY B;  3MKQ A;  4L9O A;  2IUR A;  2AQ5 A;  4J86 A;  4JT6 C;  4FAN D;  1TBG A;  3I7O A;  3V9F A;  1R5M A;  5FLX g;  1NR0 A;  2HKM A;  4O1Q D;  5TDH B;  3SLE D;  1ERJ A;  5FKQ A;  3MZK A;  4FHL A;  3SBR A;  4ZOZ A;  2CN2 A;  2AGZ A;  3JRP A;  5HE1 B;  4J0W A;  4U1E I;  4ZOY A;  4JSX C;  4FAV D;  3IIW A;  3UVN A;  4GM8 A;  5EAP A;  1K8K C;  1JMZ B;  4AEZ A;  3EG6 A;  3SVW D;  2AH1 A;  2OK4 A;  4GGC A;  2PBI B;  4OZU A;  1MG3 A;  2B5M A;  4AOW A;  1JOF A;  3GFC A;  4GGA A;  4A09 B;  4GMB A;  5GMK n;  5A2Q g;  2HES X;  3OW8 A;  3AFC A;  4ERQ A;  5C9Z B;  2CO0 A;  2H3X A;  3SN6 B;  3MZL A;  2MTA H;  5I5J A;  4L3G D;  4J87 A;  4CY5 A;  1PEV A;  1S4U X;  4A11 A;  3RSE C;  3AH8 B;  2OJY A;  3K27 A;  3ZWL B;  2I0T A;  4X3E A;  4QT8 A;  3RRM C;  3PXW D;  5IGQ A;  3PVW B;  2PM6 B;  5IJ8 E;  3C9C A;  3UR4 A;  3UVK A;  4PXW A;  4O3U B;  4NSX A;  3UVL A;  5K1C C;  5TEE A;  4GQB B;  3FM0 A;  4E5Z A;  2XYI A;  4LG9 A;  5EMJ B;  4PBZ A;  4GGD A;  2H9M A;  3SBP A;  3VGZ A;  4K3I D;  4QL1 A;  3RLM D;  1QNI A;  3JPX A;  2QXV A;  5FKS A;  2J56 H;  4ES0 A;  4UI9 R;  4ESG A;  3EI2 B;  4JSN C;  3DXM C;  3EWE A;  2Z2P A;  2O9K A;  2H47 A;  3I2N A;  3JRO A;  5HE2 B;  3V7D B;  5H1M A;  4D6V A;  1FWX A;  4BL0 A;  5CYK B;  2UZY B;  2H9P A;  4ERY A;  3ODT A;  5TF2 A;  2TRC B;  2Z2O A;  1P22 A;  3A0F A;  5EAR A;  2UZX B;  3N0D A;  2P9P C;  5FQD A;  4JT5 C;  4CI2 A;  4PSX B;  1GG2 B;  4G56 B;  3FGB A;  3MXX A;  4YVD A;  1RI6 A;  4XYI A;  3OKY A;  3F3F A;  3I89 A;  5H17 A;  3AL9 A;  4QQE A;  3I7K A;  1GP2 B;  2XL3 A;  1TYQ C;  5GXH A;  3IIY A;  2P9U C;  2H14 A;  5EMK B;  4ZOX A;  5EAL A;  3RFG A;  2BBK H;  1MG2 A;  1L0Q A;  5HE0 B;  1GOT B;  3RMZ D;  2CNX A;  4E54 B;  1GXR A;  3L4O D;  5IJ7 E;  4XYH A;  1MDA H;  4A08 B;  1NEX B;  4Y7R A;  3OL2 B;  2YNO A;  4CZY A;  3PSC B;  5HYN B;  2PM9 B;  4U7A A;  1SHY B;  3ULE C;  4BUJ C;  4J8B A;  4A0B B;  2OIZ A;  5FKR A;  3RFH A;  4ERZ A;  5EM2 B;  2G99 A;  2I3S A;  3DM0 A;  4A09 A;  3JZH A;  2I3T A;  2G9A A;  1XIP A;  5C2W B;  3FRX A;  3SCY A;  4A0A B;  4XEI C;  1U4C A;  5THA A;  5IT9 g;  5JWZ A;  2HXC A;  4K3J B;  3P4F A;  3OKT A;  3JB9 L;  3NVQ A;  4J82 A;  4JD2 C;  3W15 A;  1SQ9 A;  1U2V C;  3EI4 B;  4X63 B;  2I0R A;  2AGX A;  2H68 A;  5AJA A;  2OVR B;  5FXY A;  5AFU 3;  3UKU C;  3MMY A;  2H9L A;  2J57 G;  4CY2 A;  1B9Y A;  3IKO A;  3OKW A;  5CXC A;  5CXC B;  4N14 A;  3I7L A;  4O45 A;  5TEF A;  2GC4 A;  4L3H D;  3F3G A;  3C99 A;  2I0S A;  3SBQ A;  2P9I C;  5I5I A;  1N6E A;  3SMR A;  3AL8 B;  5IC7 A;  3JZG A;  2P9L C;  2AGW A;  3NVN A;  5KDO B;  3PE7 A;  3DSM A;  4JSV C;  4FA4 D;  1XKS A;  4GQ2 P;  4CI3 A;  3C75 H;  3EI2 A;  1OLZ A;  3I7P A;  4JXM A;  4J79 A;  4OWR A;  4EWR A;  3EMH A;  3UKR C;  2YMU A;  2W18 A;  5CXB A;  5CXB B;  3VH0 A;  4PNK B;  2CE8 A;  3N0E A;  2Q7Q A;  3OTT A;  4PC0 A;  5K19 A;  2P9N C;  3KRX B;  2IWF A;  1A0R B;  4J77 A;  3KRW B;  3MKS B;  5CYK A;  3JAM g;  4PSW B;  4O3T B;  2BCJ B;  2H6Q A;  2HJB A;  4QRJ A;  2H13 A;  2XL2 A;  3BG1 A;  4J73 A;  5IGO A;  4Y5R D;  3CFV A;  3I7N A;  3U4Y A;  2B5L A;  4J78 A;  5GSA A;  2HYE A;  4LG8 A;  5EAM A;  3VA6 A;  3SJL D;  3B7F A;  1JJU B;  4Z8L A;  4KFM B;  4TZ4 A;  4GM9 A;  2P9S C;  4GM3 A;  3IJC A;  2H6K A;  3EI3 B;  4ZOV A;  1YFQ A;  2B5N A;  4FA5 D;  4R7A B;  4CY3 A;  2GNQ A;  3GRE A;  3J81 g;  3PSL A;  3SFZ A;  1XHM A;  2YB8 B;  3NVX A;  4FA9 D;  4J8G A;  3SWS D;  4A2M A;  2AGY A;  5AMS A;  4E54 A;  3RN1 D;  3UVO A;  1OMW B;  3CIK B;  4CI8 A;  3PVU B;  4GQ1 A;  3V5W B;  4A08 A;  3OL2 A;  1N6D A;  4FWW A;  2YNN A;  4CZX A;  2OVP B;  3I8C A;  5SXM A;  2PM9 A;  4MK0 B;  4J0X A;  4H5I A;  3HFQ A;  4A0B A;  5C2V B;  2CO0 C;  1B9X A;  2H6N A;  5EMM B;  3C5M A;  5EM2 A;  4CY1 A;  4LGN A;  2IAA A;  4JSP C;  4A7J A;  2OK6 A;  3ORV D;  1PBY B;  2H9N A;  2XU7 A;  4A0A A;  2QC5 A;  4ZN4 A;  1N6F A;  1VYH C;  2OVQ B;  4IA9 A;  3EI4 A;  3I8E A;  2P9K C;  5EML B;  1PGU A;  3BG0 A;  1K32 A;  3SHF A;  3JZN A;  5HE3 B;  3CFS B;  5FKT A;  2HJ4 A;  5GXI A;  3IJ1 A;  3F3P A;  4PBY A;  4CC9 A;  4A11 B;  4X61 B;  4IMM A;  3RN0 D;  2J55 H;  3AL8 A;  2AH0 A;  3PXT D;  5FA5 B;  4J81 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...