2CE8A

An eh1 peptide bound to the groucho-tle wd40 domain.
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
337
structure length
337
Chain Sequence
DYFQGAMGSKPAYSFHVTADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Recognition of Transcriptional Repressor Motifs by the Wd Domain of the Groucho/Tle Corepressor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulation
molecule keywords TRANSDUCIN-LIKE ENHANCER PROTEIN 1
total genus 85
structure length 337
sequence length 337
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ce8A00
3L4OD 4J84A 3OTTA 3RN0D 3UKRC 4N14A 4BH6A 3MMYA 5GMKn 3SVWD 5EMJB 3ULEC 4JXMA 3V5WB 2H9MA 5IJ8E 3SBQA 3E0CA 2PBIB 3C9CA 2AQ5A 2GC4A 3BWSA 5K19A 4GQBB 2HXCA 4G56B 4O9DA 1L0QA 4CI2A 4OWRA 2B5NA 3SCYA 4CZXA 2PM9B 4GGDA 3BG0A 5HE2B 4CY3A 1MG2A 3HFQA 4Z8LA 3A0FA 3V9FA 2PM9A 1SQ9A 3MZLA 5FKQA 1FWXA 2G9AA 5EALA 4J79A 3NVQA 4QQEA 1Q47A 2IAAA 4L9OA 4ERYA 3RFHA 4GQ1A 4U1EI 4A2MA 2HYEA 2H68A 3EI3A 1K32A 3MKQA 3EG6A 4QT8A 2H13A 4CI3A 4A0AA 2HJBA 1ERJA 3ORVD 5AMSA 2AGWA 3RSEC 2Z2OA 2CE9A 3IIWA 3I7HA 4X3EA 5IGQA 3EI1B 5THAA 5H1MA 2YNPA 4Y5RD 4TZ4A 3OKYB 3DXMC 2CO0A 1GP2B 2XU7A 4ZOYA 3JZNA 4K3ID 3J80g 2P9IC 3CIKB 4X61B 5IT9g 3AL8A 3CFSB 4FA5D 2J57G 4JSPC 4IA9A 3UKUC 2OVRB 3PXWD 3MKSB 5H17A 1XHMA 1OLZA 2IUPA 4GGCA 4LGNA 2IWKA 2YMUA 1QNIA 3DM0A 4D6VA 3OKYA 5TEFA 2QC5A 4KFMB 3UVNA 1PI6A 4A08B 2B5MA 2P9NC 4JSVC 3UVKA 4JSXC 4J82A 4MK0B 4CY2A 5GXHA 2H6NA 5GSAA 4FB1D 3DXKC 3JZHA 5FXYA 5TEEA 2IUVA 3SXTD 3IKOA 2W18A 2BCJB 5HQGA 4E5ZA 3KRXB 5IGOA 3I7KA 2I0SA 3PXTD 3I7OA 3DWLC 2HKMA 2YBAA 3V7DB 4YVDA 4L3HD 2HESX 4I79A 2I0RA 2H14A 3EI3B 1JOFA 4GMBA 3EI1A 3OL2B 3AFCA 4CZVA 3SBPA 4ZN4A 1B9XA 4K3JB 2XL3A 2Z2PA 3K27A 4JT5C 2OVQB 3FM0A 3K26A 5CXBA 4QL1A 3UVOA 4PXWA 2EBSA 3JROA 2AGXA 4JT6C 4ZOXA 3EMHA 5FLXg 2H3XA 5B4WA 1OMWB 3NVNA 1P22A 5A2Qg 4OZUA 1XKSA 4O45A 5EM2A 4ES0A 3I2NA 3SHFA 2I3TA 4J81A 3MXXA 4L3GD 2B5LA 5EAMA 5EM2B 4CZYA 4AEZA 5JWZA 3GFCA 5CYKB 3KRWB 4GM9A 5GXIA 4E5ZB 3EU7A 4FHLA 3C99A 2OJYA 4BL0A 1GXRA 4PC0A 4PSWB 3RN1D 3RMZD 3P4FA 3PE7A 4FWWA 4J86A 5AJAA 3VGZA 3OL2A 4A11A 2CN3A 3AH8B 4J73A 5KDOB 2IURA 5C2VB 3DSMA 4J78A 2P9SC 5EMLB 5CXCA 5K1CC 4A11B 5FA5B 4PBZA 2H6KA 5I5JA 2P9KC 2UZXB 4FAND 1U4CA 2PM6B 4JD2C 3FRXA 5FQDA 4AOWA 2MTAH 1JMXB 3U4YA 3EI2B 4A08A 4A09A 4D0KA 2Z2NA 3I7PA 3I8EA 3I7NA 3FGBA 3SFZA 2Q7QA 5CXBB 2H9PA 3C75H 4J8GA 1N6EA 3EI2A 4ESGA 2CO0C 1SQJA 3OKTA 1A0RB 4NSXA 1PGUA 2OVPB 2GC7A 3EI4B 3F3FA 4FA9D 2B4EA 2G99A 3RLMD 4PNKB 3ZWLB 4IMMA 2CN2A 4A09B 4XEIC 3GREA 4GM3A 5TDHB 4BUJC 4J77A 3C5MA 5C9ZB 5CYKA 5TF2A 4E54A 2H9NA 3W15A 2BBKH 4U7AA 2AH0A 4CI1A 4FA4D 4J8BA 5EAPA 3N0EA 4A7JA 4FA1D 3MZKA 4ZOVA 1B9YA 5FKRA 3IJCA 3PVUB 4Y7RA 3BG1A 3I7LA 4LG9A 5CXCB 1S4UX 3PVWB 2AGLA 4R7AB 1U2VC 1TYQC 4GM8A 5FKSA 3N0DA 2I3SA 2GNQA 4JSNC 2QXVA 3J81g 2P9LC 1N6DA 4A2LA 5IJ7E 1NEXB 4UI9R 5FKTA 3NVXA 1JMZB 3SBRA 5HE1B 1VYHC 4CI8A 5SXMA 3IIYA 1K8KC 3EWEA 3CFVA 3VH0A 4H5IA 4ZOZA 2YNNA 2P9UC 1MG3A 1XIPA 4O3TB 5H14A 2PM7B 4A0BB 4J0WA 4GGAA 3SMRA 3IJ1A 3OKWA 5IC7A 2AGYA 3OW8A 3I89A 3UVLA 4X63B 3SLED 5HE0B 3SJLD 2YB8B 3RRMC 4E54B 4GZ8A 4J87A 5C2WB 3PXSD 2IUQA 1TBGA 3JPXA 4QRJA 3B7FA 3JAMg 4J0XA 4ERQA 3PSCB 4O3UB 3F3PA 1GOTB 1RI6A 1YFQA 1NR0A 2AGZA 2IWFA 3I8CA 2OIZA 2O9KA 5I5MA 2H9LA 3L4MD 4FAVD 5HYNB 2YNOA 2H6QA 3SN6B 4HDJA 5HE3B 2AH1A 4CY5A 2P9PC 3AL9A 1PBYB 2UZYB 2I0TA 4EWRA 4CC9A 4XYIA 4GQ2P 4X60B 3JZGA 3F3GA 1JJUB 4H5JA 2TRCB 3ODTA 3VA6A 2OK6A 2XYIA 5EARA 2XL2A 3RFGA 4XYHA 2J55H 4L1QD 3IJ0A 3EI4A 3UR4A 5EMMB 2OK4A 1N6FA 2J56H 2HKRA 4O1QD 1PEVA 4PSXB 1R5MA 3JRPA 4ERZA 3JB9L 2H47A 3PSLA 3UVMA 3SWSD 4A0AB 2CE8A 3AL8B 5AFU3 5I5IA 1SHYB 1GG2B 4CY1A 4LG8A 4A0BA 2CNXA 5EMKB 2HJ4A 4PBYA 1MDAH
chains in the Genus database with same CATH superfamily
3L4OD 4J84A 3GC3B 3OTTA 3DDUA 3RN0D 3UKRC 4N14A 4BH6A 2HU8A 3MMYA 5FFOA 5GMKn 4AN0A 4QAMA 3SVWD 3EQ9A 5EMJB 3ULEC 4JXMA 3V5WB 2H9MA 5IJ8E 3SBQA 3E0CA 4AMYA 2PBIB 3C9CA 2AQ5A 2GC4A 3BWSA 5K19A 4GQBB 2HXCA 4G56B 1E8NA 4O9DA 1L0QA 4CI2A 4OWRA 2B5NA 3SCYA 4CZXA 2PM9B 5M5VA 4Z7NA 4GGDA 3BG0A 5HE2B 4CY3A 1MG2A 3HFQA 4Z8LA 3A0FA 3V9FA 2PM9A 1SQ9A 3MZLA 5FKQA 1FWXA 2VDQA 3NIFA 3ZE1A 2G9AA 4MMXA 5EALA 4J79A 3NVQA 4QQEA 1Q47A 2IAAA 4L9OA 4ERYA 4G1MA 3RFHA 4GQ1A 4U1EI 4A2MA 2HYEA 2H68A 3EI3A 1O6GA 1K32A 3MKQA 3EG6A 4QT8A 4RE5A 2H13A 4CI3A 4A0AA 2HJBA 3ZE2A 2VDPA 1ERJA 3ORVD 1H2YA 5AMSA 2AGWA 3KCIA 2Z2OA 2CE9A 3IIWA 3I7HA 3IUJA 4X3EA 3RSEC 5IGQA 3EI1B 5THAA 5H1MA 2YNPA 4Y5RD 4TZ4A 3OKYB 3DXMC 2CO0A 1GP2B 2XU7A 4ZOYA 3JZNA 4K3ID 3J80g 2P9IC 3CIKB 4X61B 5IT9g 3AL8A 4D9SA 3CFSB 5M61A 2J57G 4FA5D 4JSPC 4IA9A 5HDBA 3UKUC 2OVRB 1UOOA 3PXWD 3MKSB 5H17A 1XHMA 1OLZA 2IUPA 4GGCA 4LGNA 5FFGA 2IWKA 2YMUA 1QNIA 3DM0A 3ZE0A 3ZDYA 1VE6A 4D6VA 3OKYA 5TEFA 2QC5A 4RE6A 4KFMB 3UVNA 1PI6A 4A08B 2B5MA 2VDLA 2P9NC 4JSVC 3UVKA 3NIDA 2EIDA 4WK4A 3MUNA 1H2XA 4J82A 4JSXC 4MK0B 4Z7OA 4CY2A 5GXHA 2H6NA 5GSAA 4FB1D 3DXKC 3O4IA 3JZHA 3V4PA 5FXYA 5TEEA 1JTDB 2IUVA 3SXTD 3IKOA 2W18A 2BCJB 5HQGA 4E5ZA 3KRXB 5IGOA 3I7KA 2I0SA 3PXTD 3I7OA 4BP8A 3IULA 1U8CA 3DWLC 3VI3A 2WQ8A 5M5TA 2HKMA 3IUNA 2YBAA 3V7DB 4YVDA 2VDOA 4L3HD 5C92A 2HESX 4I79A 2I0RA 2H14A 3EI3B 1JOFA 4GMBA 3EI1A 3OL2B 3AFCA 4CZVA 3SBPA 4ZN4A 1B9XA 4UM8A 1I2MB 4K3JB 3K6SA 1JV2A 2XL3A 2Z2PA 3K27A 4JT5C 2OVQB 3FM0A 3K26A 4NBMA 4L1MA 1VE7A 5E6RA 5CXBA 4IRZA 4QL1A 4DNWA 3UVOA 4PXWA 2EBSA 3JROA 1UTCA 2VDRA 2AGXA 4JT6C 4ZOXA 3EMHA 5FLXg 2H3XA 5B4WA 1OMWB 3NVNA 4AMZA 3FCSA 1GOGA 1P22A 5A2Qg 4OZUA 1XKSA 1GOHA 4UM9A 4O45A 5EM2A 4ES0A 3I2NA 3SHFA 2I3TA 4J81A 3MXXA 4L3GD 2B5LA 5EAMA 5EM2B 4CZYA 4AEZA 4MMZA 5JWZA 3GFCA 1H2WA 5CYKB 1L5GA 3KRWB 2EICA 4GM9A 5GXIA 4E5ZB 3EU7A 4FHLA 3C99A 2XE4A 4DNUA 2EIBA 2OJYA 4BL0A 4G1EA 1GXRA 4PC0A 4PSWB 3RN1D 3RMZD 3P4FA 3PE7A 4FWWA 4J86A 5AJAA 1M1XA 3VGZA 2VC2A 3OL2A 4WK0A 2JKXA 1O6FA 2CN3A 3AH8B 4A11A 4J73A 5M5RA 5KDOB 2IURA 1QFSA 5C86A 5C2VB 2VDMA 3DSMA 4J78A 2P9SC 5EMLB 5CXCA 5K1CC 4A11B 5FA5B 4PBZA 2H6KA 3EQ7A 5I5JA 2P9KC 2UZXB 4FAND 1U4CA 3MUOA 1C9LA 2PM6B 4BCBA 1GOFA 5M5UA 4JD2C 3FRXA 5FQDA 4AOWA 2MTAH 3GD1I 1JMXB 3U4YA 2HU5A 3EI2B 4A08A 4A09A 4D0KA 4O02A 2Z2NA 3I7PA 3I8EA 3I7NA 3T3PA 3FGBA 1BPOA 3SFZA 2Q7QA 5CXBB 2H9PA 1VZ2A 3C75H 4J8GA 1N6EA 3EI2A 4NAAA 4ESGA 2QR5A 2CO0C 1SQJA 3OKTA 1A0RB 1PGUA 4NSXA 3ZDZA 2OVPB 2GC7A 3EI4B 3QHYB 2EIEA 3K71A 4JHPC 4FA9D 2B4EA 2G99A 3IJEA 3RLMD 4PNKB 5E6UA 3ZWLB 4IMMA 2CN2A 4A09B 4XEIC 1A12A 3GREA 4BP9A 4GM3A 5TDHB 4BUJC 3O4HA 5M5SA 4J77A 2QZPA 3C5MA 5C9ZB 4JHNA 5CYKA 5TF2A 4E54A 2H9NA 3W15A 2BBKH 4U7AA 3EQ8A 2AH0A 4CI1A 3IVMA 4FA4D 4NC4A 4J8BA 4MMYA 5EAPA 3N0EA 3OF7A 4BCCA 4A7JA 4FA1D 3MZKA 4ZOVA 1B9YA 5FKRA 3IJCA 3PVUB 4LG9A 3BG1A 3I7LA 4Y7RA 4DNVA 5CXCB 1S4UX 1H2ZA 4WK2A 3PVWB 2AGLA 4R7AB 1U2VC 1TYQC 4GM8A 5FKSA 3N0DA 2I3SA 2GNQA 2VZ3A 4JSNC 2QXVA 3J81g 2P9LC 1N6DA 4A2LA 3IUMA 4AN1A 5IJ7E 1NEXB 4UI9R 5FKTA 3NVXA 1JMZB 3SBRA 5HE1B 1VYHC 4CI8A 5SXMA 3IIYA 1K8KC 3EWEA 3CFVA 3VH0A 4H5IA 4ZOZA 4G55A 2YNNA 3V4VA 2P9UC 1MG3A 1XIPA 3FCUA 4O3TB 5E6SA 5H14A 2PM7B 1E8MA 1UOQA 4BCDA 3T3MA 4A0BB 4J0WA 4GGAA 3SMRA 3IJ1A 3OKWA 1E5TA 5IC7A 3MVDK 2AGYA 3OW8A 3I89A 3UVLA 4X63B 3SLED 3K72A 5HE0B 3SJLD 1TYEA 2YB8B 3RRMC 4E54B 4GZ8A 4J87A 5C2WB 3PXSD 2IUQA 1TBGA 3JPXA 4QRJA 3B7FA 4WJKA 3JAMg 4J0XA 4ERQA 3PSCB 4O3UB 3F3PA 3NIGA 1GOTB 3VI4A 1RI6A 1YFQA 1NR0A 2AGZA 2IWFA 3I8CA 2OIZA 2O9KA 3ZDXA 5I5MA 2H9LA 3L4MD 4FAVD 5HYNB 3IURA 2YNOA 2H6QA 3SN6B 4HDJA 3O4JA 2VDKA 5HE3B 2AH1A 4CY5A 2P9PC 3AL9A 1PBYB 2UZYB 2I0TA 4EWRA 4CC9A 1YR2A 4XYIA 4GQ2P 4X60B 1T2XA 3JZGA 3F3GA 1JJUB 1K3IA 4H5JA 2TRCB 3ODTA 3VA6A 2OK6A 2BKLA 2XYIA 5EARA 2VDNA 2XL2A 3RFGA 4XYHA 2HU7A 2J55H 4L1QD 3IJ0A 3EI4A 3UR4A 5EMMB 2OK4A 1N6FA 2J56H 2HKRA 4O1QD 1PEVA 1UOPA 4PSXB 1R5MA 3JRPA 1QFMA 2XDWA 4ERZA 3JB9L 2H47A 3O4GA 2VZ1A 3PSLA 3UVMA 3SWSD 4A0AB 2CE8A 3AL8B 5AFU3 5I5IA 1SHYB 2XZGA 3QI0A 1GG2B 4Z7QA 4CY1A 4LG8A 1VZ3A 1C9IA 4A0BA 4PBYA 4NENA 2CNXA 4AX4A 3IUQA 4O2WA 5EMKB 2HJ4A 3F3FA 1MDAH
chains in the Genus database with same CATH topology
3L4OD 4J84A 3OTTA 3RN0D 3UKRC 4N14A 4BH6A 3MMYA 5GMKn 3SVWD 5EMJB 3ULEC 4JXMA 3V5WB 2H9MA 5IJ8E 3SBQA 3E0CA 2PBIB 3C9CA 2AQ5A 2GC4A 3BWSA 5K19A 4GQBB 2HXCA 4G56B 4O9DA 1L0QA 4CI2A 4OWRA 2B5NA 3SCYA 4CZXA 2PM9B 4GGDA 3BG0A 5HE2B 4CY3A 1MG2A 3HFQA 4Z8LA 3A0FA 3V9FA 2PM9A 1SQ9A 3MZLA 5FKQA 1FWXA 2G9AA 5EALA 4J79A 3NVQA 4QQEA 1Q47A 2IAAA 4L9OA 4ERYA 3RFHA 4GQ1A 4U1EI 4A2MA 2HYEA 2H68A 3EI3A 1K32A 3MKQA 3EG6A 4QT8A 2H13A 4CI3A 4A0AA 2HJBA 1ERJA 3ORVD 5AMSA 2AGWA 3RSEC 2Z2OA 2CE9A 3IIWA 3I7HA 4X3EA 5IGQA 3EI1B 5THAA 5H1MA 2YNPA 4Y5RD 4TZ4A 3OKYB 3DXMC 2CO0A 1GP2B 2XU7A 4ZOYA 3JZNA 4K3ID 3J80g 2P9IC 3CIKB 4X61B 5IT9g 3AL8A 3CFSB 4FA5D 2J57G 4JSPC 4IA9A 3UKUC 2OVRB 3PXWD 3MKSB 5H17A 1XHMA 1OLZA 2IUPA 4GGCA 4LGNA 2IWKA 2YMUA 1QNIA 3DM0A 4D6VA 3OKYA 5TEFA 2QC5A 4KFMB 3UVNA 1PI6A 4A08B 2B5MA 2P9NC 4JSVC 3UVKA 4JSXC 4J82A 4MK0B 4CY2A 5GXHA 2H6NA 5GSAA 4FB1D 3DXKC 3JZHA 5FXYA 5TEEA 2IUVA 3SXTD 3IKOA 2W18A 2BCJB 5HQGA 4E5ZA 3KRXB 5IGOA 3I7KA 2I0SA 3PXTD 3I7OA 3DWLC 2HKMA 2YBAA 3V7DB 4YVDA 4L3HD 2HESX 4I79A 2I0RA 2H14A 3EI3B 1JOFA 4GMBA 3EI1A 3OL2B 3AFCA 4CZVA 3SBPA 4ZN4A 1B9XA 4K3JB 2XL3A 2Z2PA 3K27A 4JT5C 2OVQB 3FM0A 3K26A 5CXBA 4QL1A 3UVOA 4PXWA 2EBSA 3JROA 2AGXA 4JT6C 4ZOXA 3EMHA 5FLXg 2H3XA 5B4WA 1OMWB 3NVNA 1P22A 5A2Qg 4OZUA 1XKSA 4O45A 5EM2A 4ES0A 3I2NA 3SHFA 2I3TA 4J81A 3MXXA 4L3GD 2B5LA 5EAMA 5EM2B 4CZYA 4AEZA 5JWZA 3GFCA 5CYKB 3KRWB 4GM9A 5GXIA 4E5ZB 3EU7A 4FHLA 3C99A 2OJYA 4BL0A 1GXRA 4PC0A 4PSWB 3RN1D 3RMZD 3P4FA 3PE7A 4FWWA 4J86A 5AJAA 3VGZA 3OL2A 4A11A 2CN3A 3AH8B 4J73A 5KDOB 2IURA 5C2VB 3DSMA 4J78A 2P9SC 5EMLB 5CXCA 5K1CC 4A11B 5FA5B 4PBZA 2H6KA 5I5JA 2P9KC 2UZXB 4FAND 1U4CA 2PM6B 4JD2C 3FRXA 5FQDA 4AOWA 2MTAH 1JMXB 3U4YA 3EI2B 4A08A 4A09A 4D0KA 2Z2NA 3I7PA 3I8EA 3I7NA 3FGBA 3SFZA 2Q7QA 5CXBB 2H9PA 3C75H 4J8GA 1N6EA 3EI2A 4ESGA 2CO0C 1SQJA 3OKTA 1A0RB 4NSXA 1PGUA 2OVPB 2GC7A 3EI4B 3F3FA 4FA9D 2B4EA 2G99A 3RLMD 4PNKB 3ZWLB 4IMMA 2CN2A 4A09B 4XEIC 3GREA 4GM3A 5TDHB 4BUJC 4J77A 3C5MA 5C9ZB 5CYKA 5TF2A 4E54A 2H9NA 3W15A 2BBKH 4U7AA 2AH0A 4CI1A 4FA4D 4J8BA 5EAPA 3N0EA 4A7JA 4FA1D 3MZKA 4ZOVA 1B9YA 5FKRA 3IJCA 3PVUB 4Y7RA 3BG1A 3I7LA 4LG9A 5CXCB 1S4UX 3PVWB 2AGLA 4R7AB 1U2VC 1TYQC 4GM8A 5FKSA 3N0DA 2I3SA 2GNQA 4JSNC 2QXVA 3J81g 2P9LC 1N6DA 4A2LA 5IJ7E 1NEXB 4UI9R 5FKTA 3NVXA 1JMZB 3SBRA 5HE1B 1VYHC 4CI8A 5SXMA 3IIYA 1K8KC 3EWEA 3CFVA 3VH0A 4H5IA 4ZOZA 2YNNA 2P9UC 1MG3A 1XIPA 4O3TB 5H14A 2PM7B 4A0BB 4J0WA 4GGAA 3SMRA 3IJ1A 3OKWA 5IC7A 2AGYA 3OW8A 3I89A 3UVLA 4X63B 3SLED 5HE0B 3SJLD 2YB8B 3RRMC 4E54B 4GZ8A 4J87A 5C2WB 3PXSD 2IUQA 1TBGA 3JPXA 4QRJA 3B7FA 3JAMg 4J0XA 4ERQA 3PSCB 4O3UB 3F3PA 1GOTB 1RI6A 1YFQA 1NR0A 2AGZA 2IWFA 3I8CA 2OIZA 2O9KA 5I5MA 2H9LA 3L4MD 4FAVD 5HYNB 2YNOA 2H6QA 3SN6B 4HDJA 5HE3B 2AH1A 4CY5A 2P9PC 3AL9A 1PBYB 2UZYB 2I0TA 4EWRA 4CC9A 4XYIA 4GQ2P 4X60B 3JZGA 3F3GA 1JJUB 4H5JA 2TRCB 3ODTA 3VA6A 2OK6A 2XYIA 5EARA 2XL2A 3RFGA 4XYHA 2J55H 4L1QD 3IJ0A 3EI4A 3UR4A 5EMMB 2OK4A 1N6FA 2J56H 2HKRA 4O1QD 1PEVA 4PSXB 1R5MA 3JRPA 4ERZA 3JB9L 2H47A 3PSLA 3UVMA 3SWSD 4A0AB 2CE8A 3AL8B 5AFU3 5I5IA 1SHYB 1GG2B 4CY1A 4LG8A 4A0BA 2CNXA 5EMKB 2HJ4A 4PBYA 1MDAH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L4O D;  4J84 A;  3OTT A;  3RN0 D;  3UKR C;  4N14 A;  4BH6 A;  3MMY A;  5GMK n;  3SVW D;  5EMJ B;  3ULE C;  4JXM A;  3V5W B;  2H9M A;  5IJ8 E;  3SBQ A;  3E0C A;  2PBI B;  3C9C A;  2AQ5 A;  2GC4 A;  3BWS A;  5K19 A;  4GQB B;  2HXC A;  4G56 B;  4O9D A;  1L0Q A;  4CI2 A;  4OWR A;  2B5N A;  3SCY A;  4CZX A;  2PM9 B;  4GGD A;  3BG0 A;  5HE2 B;  4CY3 A;  1MG2 A;  3HFQ A;  4Z8L A;  3A0F A;  3V9F A;  2PM9 A;  1SQ9 A;  3MZL A;  5FKQ A;  1FWX A;  2G9A A;  5EAL A;  4J79 A;  3NVQ A;  4QQE A;  1Q47 A;  2IAA A;  4L9O A;  4ERY A;  3RFH A;  4GQ1 A;  4U1E I;  4A2M A;  2HYE A;  2H68 A;  3EI3 A;  1K32 A;  3MKQ A;  3EG6 A;  4QT8 A;  2H13 A;  4CI3 A;  4A0A A;  2HJB A;  1ERJ A;  3ORV D;  5AMS A;  2AGW A;  3RSE C;  2Z2O A;  2CE9 A;  3IIW A;  3I7H A;  4X3E A;  5IGQ A;  3EI1 B;  5THA A;  5H1M A;  2YNP A;  4Y5R D;  4TZ4 A;  3OKY B;  3DXM C;  2CO0 A;  1GP2 B;  2XU7 A;  4ZOY A;  3JZN A;  4K3I D;  3J80 g;  2P9I C;  3CIK B;  4X61 B;  5IT9 g;  3AL8 A;  3CFS B;  4FA5 D;  2J57 G;  4JSP C;  4IA9 A;  3UKU C;  2OVR B;  3PXW D;  3MKS B;  5H17 A;  1XHM A;  1OLZ A;  2IUP A;  4GGC A;  4LGN A;  2IWK A;  2YMU A;  1QNI A;  3DM0 A;  4D6V A;  3OKY A;  5TEF A;  2QC5 A;  4KFM B;  3UVN A;  1PI6 A;  4A08 B;  2B5M A;  2P9N C;  4JSV C;  3UVK A;  4JSX C;  4J82 A;  4MK0 B;  4CY2 A;  5GXH A;  2H6N A;  5GSA A;  4FB1 D;  3DXK C;  3JZH A;  5FXY A;  5TEE A;  2IUV A;  3SXT D;  3IKO A;  2W18 A;  2BCJ B;  5HQG A;  4E5Z A;  3KRX B;  5IGO A;  3I7K A;  2I0S A;  3PXT D;  3I7O A;  3DWL C;  2HKM A;  2YBA A;  3V7D B;  4YVD A;  4L3H D;  2HES X;  4I79 A;  2I0R A;  2H14 A;  3EI3 B;  1JOF A;  4GMB A;  3EI1 A;  3OL2 B;  3AFC A;  4CZV A;  3SBP A;  4ZN4 A;  1B9X A;  4K3J B;  2XL3 A;  2Z2P A;  3K27 A;  4JT5 C;  2OVQ B;  3FM0 A;  3K26 A;  5CXB A;  4QL1 A;  3UVO A;  4PXW A;  2EBS A;  3JRO A;  2AGX A;  4JT6 C;  4ZOX A;  3EMH A;  5FLX g;  2H3X A;  5B4W A;  1OMW B;  3NVN A;  1P22 A;  5A2Q g;  4OZU A;  1XKS A;  4O45 A;  5EM2 A;  4ES0 A;  3I2N A;  3SHF A;  2I3T A;  4J81 A;  3MXX A;  4L3G D;  2B5L A;  5EAM A;  5EM2 B;  4CZY A;  4AEZ A;  5JWZ A;  3GFC A;  5CYK B;  3KRW B;  4GM9 A;  5GXI A;  4E5Z B;  3EU7 A;  4FHL A;  3C99 A;  2OJY A;  4BL0 A;  1GXR A;  4PC0 A;  4PSW B;  3RN1 D;  3RMZ D;  3P4F A;  3PE7 A;  4FWW A;  4J86 A;  5AJA A;  3VGZ A;  3OL2 A;  4A11 A;  2CN3 A;  3AH8 B;  4J73 A;  5KDO B;  2IUR A;  5C2V B;  3DSM A;  4J78 A;  2P9S C;  5EML B;  5CXC A;  5K1C C;  4A11 B;  5FA5 B;  4PBZ A;  2H6K A;  5I5J A;  2P9K C;  2UZX B;  4FAN D;  1U4C A;  2PM6 B;  4JD2 C;  3FRX A;  5FQD A;  4AOW A;  2MTA H;  1JMX B;  3U4Y A;  3EI2 B;  4A08 A;  4A09 A;  4D0K A;  2Z2N A;  3I7P A;  3I8E A;  3I7N A;  3FGB A;  3SFZ A;  2Q7Q A;  5CXB B;  2H9P A;  3C75 H;  4J8G A;  1N6E A;  3EI2 A;  4ESG A;  2CO0 C;  1SQJ A;  3OKT A;  1A0R B;  4NSX A;  1PGU A;  2OVP B;  2GC7 A;  3EI4 B;  3F3F A;  4FA9 D;  2B4E A;  2G99 A;  3RLM D;  4PNK B;  3ZWL B;  4IMM A;  2CN2 A;  4A09 B;  4XEI C;  3GRE A;  4GM3 A;  5TDH B;  4BUJ C;  4J77 A;  3C5M A;  5C9Z B;  5CYK A;  5TF2 A;  4E54 A;  2H9N A;  3W15 A;  2BBK H;  4U7A A;  2AH0 A;  4CI1 A;  4FA4 D;  4J8B A;  5EAP A;  3N0E A;  4A7J A;  4FA1 D;  3MZK A;  4ZOV A;  1B9Y A;  5FKR A;  3IJC A;  3PVU B;  4Y7R A;  3BG1 A;  3I7L A;  4LG9 A;  5CXC B;  1S4U X;  3PVW B;  2AGL A;  4R7A B;  1U2V C;  1TYQ C;  4GM8 A;  5FKS A;  3N0D A;  2I3S A;  2GNQ A;  4JSN C;  2QXV A;  3J81 g;  2P9L C;  1N6D A;  4A2L A;  5IJ7 E;  1NEX B;  4UI9 R;  5FKT A;  3NVX A;  1JMZ B;  3SBR A;  5HE1 B;  1VYH C;  4CI8 A;  5SXM A;  3IIY A;  1K8K C;  3EWE A;  3CFV A;  3VH0 A;  4H5I A;  4ZOZ A;  2YNN A;  2P9U C;  1MG3 A;  1XIP A;  4O3T B;  5H14 A;  2PM7 B;  4A0B B;  4J0W A;  4GGA A;  3SMR A;  3IJ1 A;  3OKW A;  5IC7 A;  2AGY A;  3OW8 A;  3I89 A;  3UVL A;  4X63 B;  3SLE D;  5HE0 B;  3SJL D;  2YB8 B;  3RRM C;  4E54 B;  4GZ8 A;  4J87 A;  5C2W B;  3PXS D;  2IUQ A;  1TBG A;  3JPX A;  4QRJ A;  3B7F A;  3JAM g;  4J0X A;  4ERQ A;  3PSC B;  4O3U B;  3F3P A;  1GOT B;  1RI6 A;  1YFQ A;  1NR0 A;  2AGZ A;  2IWF A;  3I8C A;  2OIZ A;  2O9K A;  5I5M A;  2H9L A;  3L4M D;  4FAV D;  5HYN B;  2YNO A;  2H6Q A;  3SN6 B;  4HDJ A;  5HE3 B;  2AH1 A;  4CY5 A;  2P9P C;  3AL9 A;  1PBY B;  2UZY B;  2I0T A;  4EWR A;  4CC9 A;  4XYI A;  4GQ2 P;  4X60 B;  3JZG A;  3F3G A;  1JJU B;  4H5J A;  2TRC B;  3ODT A;  3VA6 A;  2OK6 A;  2XYI A;  5EAR A;  2XL2 A;  3RFG A;  4XYH A;  2J55 H;  4L1Q D;  3IJ0 A;  3EI4 A;  3UR4 A;  5EMM B;  2OK4 A;  1N6F A;  2J56 H;  2HKR A;  4O1Q D;  1PEV A;  4PSX B;  1R5M A;  3JRP A;  4ERZ A;  3JB9 L;  2H47 A;  3PSL A;  3UVM A;  3SWS D;  4A0A B;  2CE8 A;  3AL8 B;  5AFU 3;  5I5I A;  1SHY B;  1GG2 B;  4CY1 A;  4LG8 A;  4A0B A;  2CNX A;  5EMK B;  2HJ4 A;  4PBY A;  1MDA H; 
#chains in the Genus database with same CATH topology
 3L4O D;  4J84 A;  3GC3 B;  3OTT A;  3DDU A;  3RN0 D;  3UKR C;  4N14 A;  4BH6 A;  2HU8 A;  3MMY A;  5FFO A;  5GMK n;  4AN0 A;  4QAM A;  3SVW D;  3EQ9 A;  5EMJ B;  3ULE C;  4JXM A;  3V5W B;  2H9M A;  5IJ8 E;  3SBQ A;  3E0C A;  4AMY A;  2PBI B;  3C9C A;  2AQ5 A;  2GC4 A;  3BWS A;  5K19 A;  4GQB B;  2HXC A;  4G56 B;  1E8N A;  4O9D A;  1L0Q A;  4CI2 A;  4OWR A;  2B5N A;  3SCY A;  4CZX A;  2PM9 B;  5M5V A;  4Z7N A;  4GGD A;  3BG0 A;  5HE2 B;  4CY3 A;  1MG2 A;  3HFQ A;  4Z8L A;  3A0F A;  3V9F A;  2PM9 A;  1SQ9 A;  3MZL A;  5FKQ A;  1FWX A;  2VDQ A;  3NIF A;  3ZE1 A;  2G9A A;  4MMX A;  5EAL A;  4J79 A;  3NVQ A;  4QQE A;  1Q47 A;  2IAA A;  4L9O A;  4ERY A;  4G1M A;  3RFH A;  4GQ1 A;  4U1E I;  4A2M A;  2HYE A;  2H68 A;  3EI3 A;  1O6G A;  1K32 A;  3MKQ A;  3EG6 A;  4QT8 A;  4RE5 A;  2H13 A;  4CI3 A;  4A0A A;  2HJB A;  3ZE2 A;  2VDP A;  1ERJ A;  3ORV D;  1H2Y A;  5AMS A;  2AGW A;  3KCI A;  2Z2O A;  2CE9 A;  3IIW A;  3I7H A;  3IUJ A;  4X3E A;  3RSE C;  5IGQ A;  3EI1 B;  5THA A;  5H1M A;  2YNP A;  4Y5R D;  4TZ4 A;  3OKY B;  3DXM C;  2CO0 A;  1GP2 B;  2XU7 A;  4ZOY A;  3JZN A;  4K3I D;  3J80 g;  2P9I C;  3CIK B;  4X61 B;  5IT9 g;  3AL8 A;  4D9S A;  3CFS B;  5M61 A;  2J57 G;  4FA5 D;  4JSP C;  4IA9 A;  5HDB A;  3UKU C;  2OVR B;  1UOO A;  3PXW D;  3MKS B;  5H17 A;  1XHM A;  1OLZ A;  2IUP A;  4GGC A;  4LGN A;  5FFG A;  2IWK A;  2YMU A;  1QNI A;  3DM0 A;  3ZE0 A;  3ZDY A;  1VE6 A;  4D6V A;  3OKY A;  5TEF A;  2QC5 A;  4RE6 A;  4KFM B;  3UVN A;  1PI6 A;  4A08 B;  2B5M A;  2VDL A;  2P9N C;  4JSV C;  3UVK A;  3NID A;  2EID A;  4WK4 A;  3MUN A;  1H2X A;  4J82 A;  4JSX C;  4MK0 B;  4Z7O A;  4CY2 A;  5GXH A;  2H6N A;  5GSA A;  4FB1 D;  3DXK C;  3O4I A;  3JZH A;  3V4P A;  5FXY A;  5TEE A;  1JTD B;  2IUV A;  3SXT D;  3IKO A;  2W18 A;  2BCJ B;  5HQG A;  4E5Z A;  3KRX B;  5IGO A;  3I7K A;  2I0S A;  3PXT D;  3I7O A;  4BP8 A;  3IUL A;  1U8C A;  3DWL C;  3VI3 A;  2WQ8 A;  5M5T A;  2HKM A;  3IUN A;  2YBA A;  3V7D B;  4YVD A;  2VDO A;  4L3H D;  5C92 A;  2HES X;  4I79 A;  2I0R A;  2H14 A;  3EI3 B;  1JOF A;  4GMB A;  3EI1 A;  3OL2 B;  3AFC A;  4CZV A;  3SBP A;  4ZN4 A;  1B9X A;  4UM8 A;  1I2M B;  4K3J B;  3K6S A;  1JV2 A;  2XL3 A;  2Z2P A;  3K27 A;  4JT5 C;  2OVQ B;  3FM0 A;  3K26 A;  4NBM A;  4L1M A;  1VE7 A;  5E6R A;  5CXB A;  4IRZ A;  4QL1 A;  4DNW A;  3UVO A;  4PXW A;  2EBS A;  3JRO A;  1UTC A;  2VDR A;  2AGX A;  4JT6 C;  4ZOX A;  3EMH A;  5FLX g;  2H3X A;  5B4W A;  1OMW B;  3NVN A;  4AMZ A;  3FCS A;  1GOG A;  1P22 A;  5A2Q g;  4OZU A;  1XKS A;  1GOH A;  4UM9 A;  4O45 A;  5EM2 A;  4ES0 A;  3I2N A;  3SHF A;  2I3T A;  4J81 A;  3MXX A;  4L3G D;  2B5L A;  5EAM A;  5EM2 B;  4CZY A;  4AEZ A;  4MMZ A;  5JWZ A;  3GFC A;  1H2W A;  5CYK B;  1L5G A;  3KRW B;  2EIC A;  4GM9 A;  5GXI A;  4E5Z B;  3EU7 A;  4FHL A;  3C99 A;  2XE4 A;  4DNU A;  2EIB A;  2OJY A;  4BL0 A;  4G1E A;  1GXR A;  4PC0 A;  4PSW B;  3RN1 D;  3RMZ D;  3P4F A;  3PE7 A;  4FWW A;  4J86 A;  5AJA A;  1M1X A;  3VGZ A;  2VC2 A;  3OL2 A;  4WK0 A;  2JKX A;  1O6F A;  2CN3 A;  3AH8 B;  4A11 A;  4J73 A;  5M5R A;  5KDO B;  2IUR A;  1QFS A;  5C86 A;  5C2V B;  2VDM A;  3DSM A;  4J78 A;  2P9S C;  5EML B;  5CXC A;  5K1C C;  4A11 B;  5FA5 B;  4PBZ A;  2H6K A;  3EQ7 A;  5I5J A;  2P9K C;  2UZX B;  4FAN D;  1U4C A;  3MUO A;  1C9L A;  2PM6 B;  4BCB A;  1GOF A;  5M5U A;  4JD2 C;  3FRX A;  5FQD A;  4AOW A;  2MTA H;  3GD1 I;  1JMX B;  3U4Y A;  2HU5 A;  3EI2 B;  4A08 A;  4A09 A;  4D0K A;  4O02 A;  2Z2N A;  3I7P A;  3I8E A;  3I7N A;  3T3P A;  3FGB A;  1BPO A;  3SFZ A;  2Q7Q A;  5CXB B;  2H9P A;  1VZ2 A;  3C75 H;  4J8G A;  1N6E A;  3EI2 A;  4NAA A;  4ESG A;  2QR5 A;  2CO0 C;  1SQJ A;  3OKT A;  1A0R B;  1PGU A;  4NSX A;  3ZDZ A;  2OVP B;  2GC7 A;  3EI4 B;  3QHY B;  2EIE A;  3K71 A;  4JHP C;  4FA9 D;  2B4E A;  2G99 A;  3IJE A;  3RLM D;  4PNK B;  5E6U A;  3ZWL B;  4IMM A;  2CN2 A;  4A09 B;  4XEI C;  1A12 A;  3GRE A;  4BP9 A;  4GM3 A;  5TDH B;  4BUJ C;  3O4H A;  5M5S A;  4J77 A;  2QZP A;  3C5M A;  5C9Z B;  4JHN A;  5CYK A;  5TF2 A;  4E54 A;  2H9N A;  3W15 A;  2BBK H;  4U7A A;  3EQ8 A;  2AH0 A;  4CI1 A;  3IVM A;  4FA4 D;  4NC4 A;  4J8B A;  4MMY A;  5EAP A;  3N0E A;  3OF7 A;  4BCC A;  4A7J A;  4FA1 D;  3MZK A;  4ZOV A;  1B9Y A;  5FKR A;  3IJC A;  3PVU B;  4LG9 A;  3BG1 A;  3I7L A;  4Y7R A;  4DNV A;  5CXC B;  1S4U X;  1H2Z A;  4WK2 A;  3PVW B;  2AGL A;  4R7A B;  1U2V C;  1TYQ C;  4GM8 A;  5FKS A;  3N0D A;  2I3S A;  2GNQ A;  2VZ3 A;  4JSN C;  2QXV A;  3J81 g;  2P9L C;  1N6D A;  4A2L A;  3IUM A;  4AN1 A;  5IJ7 E;  1NEX B;  4UI9 R;  5FKT A;  3NVX A;  1JMZ B;  3SBR A;  5HE1 B;  1VYH C;  4CI8 A;  5SXM A;  3IIY A;  1K8K C;  3EWE A;  3CFV A;  3VH0 A;  4H5I A;  4ZOZ A;  4G55 A;  2YNN A;  3V4V A;  2P9U C;  1MG3 A;  1XIP A;  3FCU A;  4O3T B;  5E6S A;  5H14 A;  2PM7 B;  1E8M A;  1UOQ A;  4BCD A;  3T3M A;  4A0B B;  4J0W A;  4GGA A;  3SMR A;  3IJ1 A;  3OKW A;  1E5T A;  5IC7 A;  3MVD K;  2AGY A;  3OW8 A;  3I89 A;  3UVL A;  4X63 B;  3SLE D;  3K72 A;  5HE0 B;  3SJL D;  1TYE A;  2YB8 B;  3RRM C;  4E54 B;  4GZ8 A;  4J87 A;  5C2W B;  3PXS D;  2IUQ A;  1TBG A;  3JPX A;  4QRJ A;  3B7F A;  4WJK A;  3JAM g;  4J0X A;  4ERQ A;  3PSC B;  4O3U B;  3F3P A;  3NIG A;  1GOT B;  3VI4 A;  1RI6 A;  1YFQ A;  1NR0 A;  2AGZ A;  2IWF A;  3I8C A;  2OIZ A;  2O9K A;  3ZDX A;  5I5M A;  2H9L A;  3L4M D;  4FAV D;  5HYN B;  3IUR A;  2YNO A;  2H6Q A;  3SN6 B;  4HDJ A;  3O4J A;  2VDK A;  5HE3 B;  2AH1 A;  4CY5 A;  2P9P C;  3AL9 A;  1PBY B;  2UZY B;  2I0T A;  4EWR A;  4CC9 A;  1YR2 A;  4XYI A;  4GQ2 P;  4X60 B;  1T2X A;  3JZG A;  3F3G A;  1JJU B;  1K3I A;  4H5J A;  2TRC B;  3ODT A;  3VA6 A;  2OK6 A;  2BKL A;  2XYI A;  5EAR A;  2VDN A;  2XL2 A;  3RFG A;  4XYH A;  2HU7 A;  2J55 H;  4L1Q D;  3IJ0 A;  3EI4 A;  3UR4 A;  5EMM B;  2OK4 A;  1N6F A;  2J56 H;  2HKR A;  4O1Q D;  1PEV A;  1UOP A;  4PSX B;  1R5M A;  3JRP A;  1QFM A;  2XDW A;  4ERZ A;  3JB9 L;  2H47 A;  3O4G A;  2VZ1 A;  3PSL A;  3UVM A;  3SWS D;  4A0A B;  2CE8 A;  3AL8 B;  5AFU 3;  5I5I A;  1SHY B;  2XZG A;  3QI0 A;  1GG2 B;  4Z7Q A;  4CY1 A;  4LG8 A;  1VZ3 A;  1C9I A;  4A0B A;  4PBY A;  4NEN A;  2CNX A;  4AX4 A;  3IUQ A;  4O2W A;  5EMK B;  2HJ4 A;  3F3F A;  1MDA H; 
#chains in the Genus database with same CATH homology
 3L4O D;  4J84 A;  3OTT A;  3RN0 D;  3UKR C;  4N14 A;  4BH6 A;  3MMY A;  5GMK n;  3SVW D;  5EMJ B;  3ULE C;  4JXM A;  3V5W B;  2H9M A;  5IJ8 E;  3SBQ A;  3E0C A;  2PBI B;  3C9C A;  2AQ5 A;  2GC4 A;  3BWS A;  5K19 A;  4GQB B;  2HXC A;  4G56 B;  4O9D A;  1L0Q A;  4CI2 A;  4OWR A;  2B5N A;  3SCY A;  4CZX A;  2PM9 B;  4GGD A;  3BG0 A;  5HE2 B;  4CY3 A;  1MG2 A;  3HFQ A;  4Z8L A;  3A0F A;  3V9F A;  2PM9 A;  1SQ9 A;  3MZL A;  5FKQ A;  1FWX A;  2G9A A;  5EAL A;  4J79 A;  3NVQ A;  4QQE A;  1Q47 A;  2IAA A;  4L9O A;  4ERY A;  3RFH A;  4GQ1 A;  4U1E I;  4A2M A;  2HYE A;  2H68 A;  3EI3 A;  1K32 A;  3MKQ A;  3EG6 A;  4QT8 A;  2H13 A;  4CI3 A;  4A0A A;  2HJB A;  1ERJ A;  3ORV D;  5AMS A;  2AGW A;  3RSE C;  2Z2O A;  2CE9 A;  3IIW A;  3I7H A;  4X3E A;  5IGQ A;  3EI1 B;  5THA A;  5H1M A;  2YNP A;  4Y5R D;  4TZ4 A;  3OKY B;  3DXM C;  2CO0 A;  1GP2 B;  2XU7 A;  4ZOY A;  3JZN A;  4K3I D;  3J80 g;  2P9I C;  3CIK B;  4X61 B;  5IT9 g;  3AL8 A;  3CFS B;  4FA5 D;  2J57 G;  4JSP C;  4IA9 A;  3UKU C;  2OVR B;  3PXW D;  3MKS B;  5H17 A;  1XHM A;  1OLZ A;  2IUP A;  4GGC A;  4LGN A;  2IWK A;  2YMU A;  1QNI A;  3DM0 A;  4D6V A;  3OKY A;  5TEF A;  2QC5 A;  4KFM B;  3UVN A;  1PI6 A;  4A08 B;  2B5M A;  2P9N C;  4JSV C;  3UVK A;  4JSX C;  4J82 A;  4MK0 B;  4CY2 A;  5GXH A;  2H6N A;  5GSA A;  4FB1 D;  3DXK C;  3JZH A;  5FXY A;  5TEE A;  2IUV A;  3SXT D;  3IKO A;  2W18 A;  2BCJ B;  5HQG A;  4E5Z A;  3KRX B;  5IGO A;  3I7K A;  2I0S A;  3PXT D;  3I7O A;  3DWL C;  2HKM A;  2YBA A;  3V7D B;  4YVD A;  4L3H D;  2HES X;  4I79 A;  2I0R A;  2H14 A;  3EI3 B;  1JOF A;  4GMB A;  3EI1 A;  3OL2 B;  3AFC A;  4CZV A;  3SBP A;  4ZN4 A;  1B9X A;  4K3J B;  2XL3 A;  2Z2P A;  3K27 A;  4JT5 C;  2OVQ B;  3FM0 A;  3K26 A;  5CXB A;  4QL1 A;  3UVO A;  4PXW A;  2EBS A;  3JRO A;  2AGX A;  4JT6 C;  4ZOX A;  3EMH A;  5FLX g;  2H3X A;  5B4W A;  1OMW B;  3NVN A;  1P22 A;  5A2Q g;  4OZU A;  1XKS A;  4O45 A;  5EM2 A;  4ES0 A;  3I2N A;  3SHF A;  2I3T A;  4J81 A;  3MXX A;  4L3G D;  2B5L A;  5EAM A;  5EM2 B;  4CZY A;  4AEZ A;  5JWZ A;  3GFC A;  5CYK B;  3KRW B;  4GM9 A;  5GXI A;  4E5Z B;  3EU7 A;  4FHL A;  3C99 A;  2OJY A;  4BL0 A;  1GXR A;  4PC0 A;  4PSW B;  3RN1 D;  3RMZ D;  3P4F A;  3PE7 A;  4FWW A;  4J86 A;  5AJA A;  3VGZ A;  3OL2 A;  4A11 A;  2CN3 A;  3AH8 B;  4J73 A;  5KDO B;  2IUR A;  5C2V B;  3DSM A;  4J78 A;  2P9S C;  5EML B;  5CXC A;  5K1C C;  4A11 B;  5FA5 B;  4PBZ A;  2H6K A;  5I5J A;  2P9K C;  2UZX B;  4FAN D;  1U4C A;  2PM6 B;  4JD2 C;  3FRX A;  5FQD A;  4AOW A;  2MTA H;  1JMX B;  3U4Y A;  3EI2 B;  4A08 A;  4A09 A;  4D0K A;  2Z2N A;  3I7P A;  3I8E A;  3I7N A;  3FGB A;  3SFZ A;  2Q7Q A;  5CXB B;  2H9P A;  3C75 H;  4J8G A;  1N6E A;  3EI2 A;  4ESG A;  2CO0 C;  1SQJ A;  3OKT A;  1A0R B;  4NSX A;  1PGU A;  2OVP B;  2GC7 A;  3EI4 B;  3F3F A;  4FA9 D;  2B4E A;  2G99 A;  3RLM D;  4PNK B;  3ZWL B;  4IMM A;  2CN2 A;  4A09 B;  4XEI C;  3GRE A;  4GM3 A;  5TDH B;  4BUJ C;  4J77 A;  3C5M A;  5C9Z B;  5CYK A;  5TF2 A;  4E54 A;  2H9N A;  3W15 A;  2BBK H;  4U7A A;  2AH0 A;  4CI1 A;  4FA4 D;  4J8B A;  5EAP A;  3N0E A;  4A7J A;  4FA1 D;  3MZK A;  4ZOV A;  1B9Y A;  5FKR A;  3IJC A;  3PVU B;  4Y7R A;  3BG1 A;  3I7L A;  4LG9 A;  5CXC B;  1S4U X;  3PVW B;  2AGL A;  4R7A B;  1U2V C;  1TYQ C;  4GM8 A;  5FKS A;  3N0D A;  2I3S A;  2GNQ A;  4JSN C;  2QXV A;  3J81 g;  2P9L C;  1N6D A;  4A2L A;  5IJ7 E;  1NEX B;  4UI9 R;  5FKT A;  3NVX A;  1JMZ B;  3SBR A;  5HE1 B;  1VYH C;  4CI8 A;  5SXM A;  3IIY A;  1K8K C;  3EWE A;  3CFV A;  3VH0 A;  4H5I A;  4ZOZ A;  2YNN A;  2P9U C;  1MG3 A;  1XIP A;  4O3T B;  5H14 A;  2PM7 B;  4A0B B;  4J0W A;  4GGA A;  3SMR A;  3IJ1 A;  3OKW A;  5IC7 A;  2AGY A;  3OW8 A;  3I89 A;  3UVL A;  4X63 B;  3SLE D;  5HE0 B;  3SJL D;  2YB8 B;  3RRM C;  4E54 B;  4GZ8 A;  4J87 A;  5C2W B;  3PXS D;  2IUQ A;  1TBG A;  3JPX A;  4QRJ A;  3B7F A;  3JAM g;  4J0X A;  4ERQ A;  3PSC B;  4O3U B;  3F3P A;  1GOT B;  1RI6 A;  1YFQ A;  1NR0 A;  2AGZ A;  2IWF A;  3I8C A;  2OIZ A;  2O9K A;  5I5M A;  2H9L A;  3L4M D;  4FAV D;  5HYN B;  2YNO A;  2H6Q A;  3SN6 B;  4HDJ A;  5HE3 B;  2AH1 A;  4CY5 A;  2P9P C;  3AL9 A;  1PBY B;  2UZY B;  2I0T A;  4EWR A;  4CC9 A;  4XYI A;  4GQ2 P;  4X60 B;  3JZG A;  3F3G A;  1JJU B;  4H5J A;  2TRC B;  3ODT A;  3VA6 A;  2OK6 A;  2XYI A;  5EAR A;  2XL2 A;  3RFG A;  4XYH A;  2J55 H;  4L1Q D;  3IJ0 A;  3EI4 A;  3UR4 A;  5EMM B;  2OK4 A;  1N6F A;  2J56 H;  2HKR A;  4O1Q D;  1PEV A;  4PSX B;  1R5M A;  3JRP A;  4ERZ A;  3JB9 L;  2H47 A;  3PSL A;  3UVM A;  3SWS D;  4A0A B;  2CE8 A;  3AL8 B;  5AFU 3;  5I5I A;  1SHY B;  1GG2 B;  4CY1 A;  4LG8 A;  4A0B A;  2CNX A;  5EMK B;  2HJ4 A;  4PBY A;  1MDA H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...