2CE8A

An eh1 peptide bound to the groucho-tle wd40 domain.
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
337
structure length
337
Chain Sequence
b'DYFQGAMGSKPAYSFHVTADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSDUCIN-LIKE ENHANCER PROTEIN 1
molecule tags Transcription regulation
source organism Homo sapiens
publication title Molecular Recognition of Transcriptional Repressor Motifs by the Wd Domain of the Groucho/Tle Corepressor.
pubmed doi rcsb
total genus 85
structure length 337
sequence length 337
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ce8A00
3I2NA 4L3HD 4Z8LA 4FA4D 3NVNA 5IGOA 3N0EA 4X60B 4IA9A 5CXCB 5GMKn 3OKYB 4QQEA 3MMYA 2CNXA 2P9NC 4CC9A 3EI4A 2Z2NA 1A0RB 2AGZA 3PVWB 1P22A 3EI4B 3IJ0A 4XEIC 5GSAA 1YFQA 5K19A 4J0WA 4BL0A 4H5IA 3SHFA 5EARA 2XU7A 3EI1B 2Z2PA 1PI6A 2Z2OA 3JZHA 4Y5RD 3I7OA 1RI6A 3SFZA 4PBZA 4D6VA 1ERJA 1FWXA 4JSNC 4PC0A 2MTAH 4CY1A 4FHLA 4GM9A 4JSPC 3JB9L 3B7FA 5IC7A 5TEEA 3I7PA 4CZYA 3BG0A 3GFCA 3IKOA 2H6KA 4J78A 3JRPA 4CZXA 3AFCA 5EMJB 4A2MA 3DM0A 5CYKB 5TDHB 5CXBA 4A0BB 5C9ZB 5KDOB 2OVQB 4FB1D 3SXTD 2IWKA 5I5JA 3I89A 3I8CA 3I7NA 4PBYA 5EALA 4GQ2P 2CE9A 4OWRA 3EI3B 5FLXg 3UVOA 3IIWA 4QRJA 4G56B 1SQ9A 5FKTA 4LG8A 4CY2A 4X3EA 4GGAA 2CO0A 2P9SC 4J86A 2PBIB 2H9PA 2XL3A 5TEFA 3SLED 5H17A 4J82A 4IMMA 2I0SA 3SN6B 4X61B 5HE0B 4ES0A 2PM9A 2HESX 2YBAA 3U4YA 5A2Qg 3RFHA 3UKRC 4CI1A 3SVWD 5K1CC 2IUVA 3EU7A 2AH1A 1XKSA 3JPXA 4K3ID 2AGLA 4A11B 2G9AA 2HKMA 2UZXB 4Y7RA 1TBGA 3ORVD 4QT8A 1GOTB 4TZ4A 4J77A 4ESGA 5FQDA 4FA1D 3EI1A 4J87A 1N6DA 4K3JB 5GXIA 3VA6A 5FKSA 4O1QD 3UVNA 4AEZA 3RN1D 4LG9A 4N14A 2AGWA 3OTTA 2HJBA 1XHMA 1TYQC 3MKQA 2H13A 3PXTD 5HYNB 3P4FA 4KFMB 1PBYB 1R5MA 3F3FA 1L0QA 3OW8A 2J56H 3SBRA 3V9FA 2H47A 2W18A 3ULEC 4PXWA 3CFSB 4ERZA 3RLMD 4NSXA 3J80g 1U2VC 4CI8A 2PM6B 4L9OA 3IJCA 5CXBB 2CN3A 5H1MA 4J81A 2I3SA 5FXYA 3EG6A 5C2VB 4J73A 5TF2A 1Q47A 4L3GD 3UVMA 4GZ8A 4U1EI 3SCYA 3UVKA 2AQ5A 4E54A 2BCJB 5I5IA 1PGUA 2OVRB 2AGXA 2IAAA 3MXXA 5HQGA 2J55H 4PNKB 2G99A 4ERQA 5IJ7E 4A09B 3OL2B 1PEVA 3C99A 3PE7A 2H6NA 3AL9A 5FKQA 5CYKA 3DWLC 3C9CA 4JXMA 4GQ1A 4AOWA 2I3TA 4J79A 3AL8A 3K26A 5EAMA 2H9LA 3JZGA 4A2LA 4FWWA 4D0KA 3ODTA 4GGCA 4XYIA 3SMRA 2O9KA 3FGBA 2YNPA 4A0AB 5IGQA 3ZWLB 4H5JA 5I5MA 1GG2B 4GM3A 4E54B 2AH0A 2B4EA 4ZOVA 2P9PC 2YNNA 4MK0B 4CZVA 1NEXB 3HFQA 3MZKA 5THAA 4LGNA 1U4CA 2OJYA 4CI2A 2CO0C 4XYHA 2H9MA 3N0DA 5AMSA 4A0BA 3GREA 1B9XA 5H14A 4PSWB 3DSMA 3NVXA 3DXKC 1B9YA 5AJAA 3OKTA 5HE2B 2P9IC 1K8KC 5B4WA 2YB8B 2HXCA 3UKUC 4PSXB 3JZNA 4J8BA 3KRWB 1NR0A 5GXHA 2H14A 1GP2B 3RRMC 5AFU3 4CY3A 4A08B 3L4OD 5C2WB 2PM9B 3JROA 2OK6A 4BH6A 4U7AA 2GC7A 3E0CA 2PM7B 4GGDA 4ERYA 1SHYB 3W15A 2HYEA 3EI2A 2EBSA 3SBPA 4UI9R 4JT6C 4FA9D 4YVDA 4CY5A 3SJLD 5HE3B 4O3UB 3EI3A 3I7KA 2B5MA 3OKYA 3PXSD 3RFGA 4FAVD 5EM2B 3IJ1A 5FKRA 4ZOZA 2YMUA 5EM2A 3F3GA 2I0RA 3AH8B 2GC4A 2CE8A 2P9LC 3I7HA 4JSVC 3AL8B 2UZYB 1SQJA 3UR4A 3EI2B 5HE1B 3RN0D 3PSLA 4E5ZB 5IT9g 3BG1A 4L1QD 5EMMB 2IWFA 3OL2A 3MZLA 4I79A 2H9NA 3DXMC 3BWSA 1JJUB 4A08A 2CN2A 1MG2A 2GNQA 2OVPB 4J0XA 3CIKB 4J8GA 1S4UX 1XIPA 4J84A 4ZN4A 3EWEA 3IIYA 5EMKB 4O45A 2H68A 2P9KC 2QC5A 3PXWD 3KRXB 1N6FA 1VYHC 5JWZA 3EMHA 3I8EA 2IURA 3NVQA 4FAND 5EAPA 4JT5C 2QXVA 1QNIA 5IJ8E 4O3TB 2BBKH 2IUQA 2OK4A 4ZOYA 3V5WB 3V7DB 2Q7QA 4R7AB 4E5ZA 2AGYA 5SXMA 4X63B 2B5LA 4OZUA 3UVLA 4A7JA 3J81g 2XYIA 4HDJA 3I7LA 5EMLB 3F3PA 3SWSD 1OMWB 5CXCA 4QL1A 2I0TA 3PSCB 3C5MA 2P9UC 4A0AA 5FA5B 2IUPA 3RSEC 3VGZA 3FRXA 2HKRA 3PVUB 4GQBB 3CFVA 4A11A 3JAMg 1JMXB 3FM0A 2H6QA 2B5NA 1MDAH 1K32A 1GXRA 4O9DA 2TRCB 2H3XA 3MKSB 2J57G 4EWRA 4GM8A 3L4MD 4CI3A 4GMBA 4JD2C 3C75H 2HJ4A 3VH0A 4ZOXA 1JMZB 2OIZA 2YNOA 3A0FA 1JOFA 4JSXC 1MG3A 2XL2A 3RMZD 3SBQA 4A09A 3K27A 1OLZA 1N6EA 4FA5D 4BUJC 3OKWA
chains in the Genus database with same CATH superfamily
4NAAA 3I2NA 4L3HD 4Z8LA 4FA4D 3NVNA 5IGOA 4QAMA 2VDKA 3N0EA 4X60B 4IA9A 1E8NA 4Z7OA 3MVDK 5CXCB 5GMKn 2JKXA 3OKYB 4QQEA 3MMYA 3O4GA 2CNXA 2P9NC 4CC9A 3EI4A 2Z2NA 1A0RB 2AGZA 3PVWB 1P22A 3EI4B 3IJ0A 4XEIC 5GSAA 1YFQA 5K19A 4J0WA 4BL0A 4H5IA 3SHFA 3IUMA 5EARA 2XU7A 3EI1B 2Z2PA 1PI6A 2Z2OA 3JZHA 4Y5RD 4AX4A 1T2XA 3I7OA 1RI6A 3SFZA 4PBZA 4JHPC 4D6VA 1ERJA 1FWXA 2VDRA 1H2YA 4JSNC 2HU5A 3ZE1A 4PC0A 2MTAH 4CY1A 4FHLA 4AN1A 4GM9A 4JSPC 4L1MA 3JB9L 3B7FA 1C9IA 5IC7A 5TEEA 1VE6A 3I7PA 1TYEA 4CZYA 3BG0A 4G1MA 3GFCA 3MUNA 3IKOA 2H6KA 4J78A 5E6SA 3JRPA 4CZXA 3AFCA 3FCSA 4DNWA 4WK4A 5EMJB 2VZ3A 4A2MA 3DM0A 1O6GA 4BP9A 5CYKB 5TDHB 5CXBA 4A0BB 5C9ZB 1JV2A 5KDOB 2OVQB 4FB1D 3SXTD 2IWKA 5I5JA 2XDWA 3I89A 3I8CA 3I7NA 4PBYA 5EALA 1JTDB 4GQ2P 2CE9A 4OWRA 1GOHA 3EI3B 1GOFA 5FLXg 3UVOA 3IIWA 3V4PA 4QRJA 4AN0A 4G56B 1SQ9A 5FKTA 4LG8A 4CY2A 4X3EA 4GGAA 2CO0A 2P9SC 2XE4A 3O4IA 4J86A 2PBIB 2H9PA 2XL3A 5TEFA 3SLED 5H17A 4J82A 4IMMA 2I0SA 3SN6B 3QHYB 4X61B 5HE0B 4ES0A 2PM9A 2HESX 2YBAA 3U4YA 5A2Qg 3RFHA 3UKRC 4CI1A 3SVWD 5M5SA 5K1CC 2IUVA 3EU7A 2AH1A 1XKSA 3JPXA 4K3ID 5E6RA 2AGLA 4A11B 2G9AA 2BKLA 2HKMA 2UZXB 4Y7RA 1TBGA 3ORVD 4QT8A 1GOTB 4TZ4A 4J77A 3V4VA 4ESGA 5FQDA 4FA1D 2EIBA 4RE5A 3EI1A 4J87A 1N6DA 4K3JB 5GXIA 3VA6A 5FKSA 4O1QD 4DNVA 3UVNA 2QZPA 4AEZA 3RN1D 5FFGA 1VZ2A 4LG9A 4N14A 2AGWA 1A12A 3OTTA 4MMYA 3IVMA 2HJBA 1XHMA 1TYQC 3MKQA 2H13A 3PXTD 5HYNB 3P4FA 4KFMB 1PBYB 1R5MA 3F3FA 1L0QA 3OW8A 4BCCA 2J56H 3SBRA 3V9FA 2H47A 2W18A 3ULEC 4PXWA 3CFSB 2VDQA 3IUQA 3OF7A 4ERZA 3RLMD 4NSXA 3J80g 1U2VC 4CI8A 4DNUA 2PM6B 4L9OA 3IJCA 5CXBB 2CN3A 5H1MA 4J81A 2I3SA 5FXYA 3EG6A 5C2VB 4J73A 5TF2A 1BPOA 1Q47A 3NIDA 3IURA 4L3GD 3UVMA 4GZ8A 4U1EI 3SCYA 3UVKA 2AQ5A 4E54A 3DDUA 2BCJB 5I5IA 1PGUA 2OVRB 2AGXA 2IAAA 3MXXA 5HQGA 2J55H 4PNKB 2G99A 4ERQA 5IJ7E 4A09B 3OL2B 1PEVA 3C99A 3PE7A 2H6NA 3ZDXA 3AL9A 5FKQA 5CYKA 3DWLC 3C9CA 4JXMA 3T3MA 4GQ1A 4AOWA 2I3TA 4J79A 3AL8A 3K26A 5EAMA 3MUOA 3EQ9A 2H9LA 3JZGA 4G1EA 4FWWA 3VI3A 4A2LA 4D0KA 1YR2A 3KCIA 3ODTA 4GGCA 4XYIA 3SMRA 2O9KA 1GOGA 3FGBA 2YNPA 4A0AB 5IGQA 3ZWLB 4H5JA 5I5MA 3ZDZA 1GG2B 4GM3A 4E54B 2AH0A 1O6FA 2B4EA 4ZOVA 3ZE2A 2P9PC 1E5TA 2YNNA 4MK0B 4UM9A 4CZVA 1VZ3A 1NEXB 3HFQA 4WK0A 3MZKA 5THAA 4LGNA 1U4CA 2OJYA 4CI2A 2CO0C 3EQ8A 4XYHA 4BP8A 2H9MA 3N0DA 1QFSA 3K72A 5AMSA 4A0BA 3K6SA 3GREA 2VDPA 4NBMA 1B9XA 2EIEA 2VDMA 4PSWB 3DSMA 5H14A 3NVXA 5M61A 3DXKC 4MMZA 4JHNA 1B9YA 5AJAA 3OKTA 5HE2B 2P9IC 1K8KC 5B4WA 2XZGA 2YB8B 2HXCA 3UKUC 4PSXB 3JZNA 3IUJA 5C86A 4J8BA 3KRWB 3NIGA 3O4HA 1NR0A 3ZE0A 5GXHA 1E8MA 2H14A 4NC4A 1GP2B 3RRMC 3T3PA 5AFU3 4CY3A 4A08B 3L4OD 5C2WB 4MMXA 2PM9B 3JROA 2OK6A 4BH6A 1H2XA 1M1XA 2HU7A 4U7AA 2GC7A 2QR5A 3E0CA 4WK2A 2PM7B 1UTCA 4GGDA 4ERYA 1SHYB 3W15A 3K71A 2HYEA 3EI2A 2EBSA 4O2WA 4Z7NA 3SBPA 4UI9R 4JT6C 4AMYA 3GC3B 4BCDA 4FA9D 5M5TA 4YVDA 4CY5A 3SJLD 5HE3B 4O3UB 3EI3A 3I7KA 3ZDYA 2B5MA 3OKYA 3PXSD 3RFGA 4FAVD 4BCBA 5EM2B 3IJ1A 5FKRA 4ZOZA 2YMUA 5EM2A 3F3GA 2I0RA 3NIFA 5HDBA 3AH8B 2GC4A 2CE8A 3FCUA 2P9LC 2WQ8A 3I7HA 4JSVC 1L5GA 2UZYB 1U8CA 3AL8B 1SQJA 3UR4A 3EI2B 3IULA 5HE1B 3RN0D 3PSLA 4AMZA 4E5ZB 5IT9g 3BG1A 4L1QD 5EMMB 2IWFA 1UOPA 3OL2A 5FFOA 3MZLA 4I79A 1I2MB 2H9NA 3DXMC 3IJEA 3BWSA 1JJUB 4A08A 2CN2A 1MG2A 2GNQA 2OVPB 4J0XA 3CIKB 4J8GA 1S4UX 1XIPA 4J84A 4ZN4A 5M5VA 3EWEA 3IIYA 5EMKB 4O45A 2H68A 1K3IA 2P9KC 2QC5A 3PXWD 3KRXB 1N6FA 1VYHC 5JWZA 1QFMA 3EMHA 3I8EA 2IURA 3NVQA 3IUNA 4FAND 5EAPA 4JT5C 2QXVA 1QNIA 3QI0A 5IJ8E 4O3TB 2BBKH 3O4JA 2VDOA 4D9SA 4G55A 2IUQA 2OK4A 4ZOYA 3V5WB 2VDLA 3V7DB 2Q7QA 4R7AB 4E5ZA 2AGYA 1UOQA 5SXMA 4X63B 4IRZA 2B5LA 4OZUA 3UVLA 4A7JA 3J81g 1H2ZA 2XYIA 2VDNA 4HDJA 3I7LA 5EMLB 3F3PA 3SWSD 3VI4A 1OMWB 5CXCA 4QL1A 2I0TA 1UOOA 3EQ7A 4NENA 3PSCB 3C5MA 1VE7A 2P9UC 2HU8A 4A0AA 5FA5B 2IUPA 3RSEC 4UM8A 3VGZA 3FRXA 2HKRA 3GD1I 3PVUB 4GQBB 3CFVA 1C9LA 4A11A 4O02A 4RE6A 1JMXB 3JAMg 3FM0A 2H6QA 2B5NA 1MDAH 4WJKA 1K32A 1GXRA 4O9DA 2TRCB 1H2WA 2VC2A 5M5RA 2VZ1A 2H3XA 3MKSB 5M5UA 2J57G 4EWRA 4GM8A 3L4MD 4CI3A 4GMBA 4Z7QA 4JD2C 3C75H 2HJ4A 3VH0A 4ZOXA 2EIDA 1JMZB 2OIZA 5E6UA 5C92A 2YNOA 3A0FA 1JOFA 4JSXC 1MG3A 2XL2A 3RMZD 3SBQA 4A09A 3K27A 1OLZA 1N6EA 4FA5D 4BUJC 2EICA 3OKWA
chains in the Genus database with same CATH topology
3I2NA 4L3HD 4Z8LA 4FA4D 3NVNA 5IGOA 3N0EA 4X60B 4IA9A 5CXCB 5GMKn 3OKYB 4QQEA 3MMYA 2CNXA 2P9NC 4CC9A 3EI4A 2Z2NA 1A0RB 2AGZA 3PVWB 1P22A 3EI4B 3IJ0A 4XEIC 5GSAA 1YFQA 5K19A 4J0WA 4BL0A 4H5IA 3SHFA 5EARA 2XU7A 3EI1B 2Z2PA 1PI6A 2Z2OA 3JZHA 4Y5RD 3I7OA 1RI6A 3SFZA 4PBZA 4D6VA 1ERJA 1FWXA 4JSNC 4PC0A 2MTAH 4CY1A 4FHLA 4GM9A 4JSPC 3JB9L 3B7FA 5IC7A 5TEEA 3I7PA 4CZYA 3BG0A 3GFCA 3IKOA 2H6KA 4J78A 3JRPA 4CZXA 3AFCA 5EMJB 4A2MA 3DM0A 5CYKB 5TDHB 5CXBA 4A0BB 5C9ZB 5KDOB 2OVQB 4FB1D 3SXTD 2IWKA 5I5JA 3I89A 3I8CA 3I7NA 4PBYA 5EALA 4GQ2P 2CE9A 4OWRA 3EI3B 5FLXg 3UVOA 3IIWA 4QRJA 4G56B 1SQ9A 5FKTA 4LG8A 4CY2A 4X3EA 4GGAA 2CO0A 2P9SC 4J86A 2PBIB 2H9PA 2XL3A 5TEFA 3SLED 5H17A 4J82A 4IMMA 2I0SA 3SN6B 4X61B 5HE0B 4ES0A 2PM9A 2HESX 2YBAA 3U4YA 5A2Qg 3RFHA 3UKRC 4CI1A 3SVWD 5K1CC 2IUVA 3EU7A 2AH1A 1XKSA 3JPXA 4K3ID 2AGLA 4A11B 2G9AA 2HKMA 2UZXB 4Y7RA 1TBGA 3ORVD 4QT8A 1GOTB 4TZ4A 4J77A 4ESGA 5FQDA 4FA1D 3EI1A 4J87A 1N6DA 4K3JB 5GXIA 3VA6A 5FKSA 4O1QD 3UVNA 4AEZA 3RN1D 4LG9A 4N14A 2AGWA 3OTTA 2HJBA 1XHMA 1TYQC 3MKQA 2H13A 3PXTD 5HYNB 3P4FA 4KFMB 1PBYB 1R5MA 3F3FA 1L0QA 3OW8A 2J56H 3SBRA 3V9FA 2H47A 2W18A 3ULEC 4PXWA 3CFSB 4ERZA 3RLMD 4NSXA 3J80g 1U2VC 4CI8A 2PM6B 4L9OA 3IJCA 5CXBB 2CN3A 5H1MA 4J81A 2I3SA 5FXYA 3EG6A 5C2VB 4J73A 5TF2A 1Q47A 4L3GD 3UVMA 4GZ8A 4U1EI 3SCYA 3UVKA 2AQ5A 4E54A 2BCJB 5I5IA 1PGUA 2OVRB 2AGXA 2IAAA 3MXXA 5HQGA 2J55H 4PNKB 2G99A 4ERQA 5IJ7E 4A09B 3OL2B 1PEVA 3C99A 3PE7A 2H6NA 3AL9A 5FKQA 5CYKA 3DWLC 3C9CA 4JXMA 4GQ1A 4AOWA 2I3TA 4J79A 3AL8A 3K26A 5EAMA 2H9LA 3JZGA 4A2LA 4FWWA 4D0KA 3ODTA 4GGCA 4XYIA 3SMRA 2O9KA 3FGBA 2YNPA 4A0AB 5IGQA 3ZWLB 4H5JA 5I5MA 1GG2B 4GM3A 4E54B 2AH0A 2B4EA 4ZOVA 2P9PC 2YNNA 4MK0B 4CZVA 1NEXB 3HFQA 3MZKA 5THAA 4LGNA 1U4CA 2OJYA 4CI2A 2CO0C 4XYHA 2H9MA 3N0DA 5AMSA 4A0BA 3GREA 1B9XA 5H14A 4PSWB 3DSMA 3NVXA 3DXKC 1B9YA 5AJAA 3OKTA 5HE2B 2P9IC 1K8KC 5B4WA 2YB8B 2HXCA 3UKUC 4PSXB 3JZNA 4J8BA 3KRWB 1NR0A 5GXHA 2H14A 1GP2B 3RRMC 5AFU3 4CY3A 4A08B 3L4OD 5C2WB 2PM9B 3JROA 2OK6A 4BH6A 4U7AA 2GC7A 3E0CA 2PM7B 4GGDA 4ERYA 1SHYB 3W15A 2HYEA 3EI2A 2EBSA 3SBPA 4UI9R 4JT6C 4FA9D 4YVDA 4CY5A 3SJLD 5HE3B 4O3UB 3EI3A 3I7KA 2B5MA 3OKYA 3PXSD 3RFGA 4FAVD 5EM2B 3IJ1A 5FKRA 4ZOZA 2YMUA 5EM2A 3F3GA 2I0RA 3AH8B 2GC4A 2CE8A 2P9LC 3I7HA 4JSVC 3AL8B 2UZYB 1SQJA 3UR4A 3EI2B 5HE1B 3RN0D 3PSLA 4E5ZB 5IT9g 3BG1A 4L1QD 5EMMB 2IWFA 3OL2A 3MZLA 4I79A 2H9NA 3DXMC 3BWSA 1JJUB 4A08A 2CN2A 1MG2A 2GNQA 2OVPB 4J0XA 3CIKB 4J8GA 1S4UX 1XIPA 4J84A 4ZN4A 3EWEA 3IIYA 5EMKB 4O45A 2H68A 2P9KC 2QC5A 3PXWD 3KRXB 1N6FA 1VYHC 5JWZA 3EMHA 3I8EA 2IURA 3NVQA 4FAND 5EAPA 4JT5C 2QXVA 1QNIA 5IJ8E 4O3TB 2BBKH 2IUQA 2OK4A 4ZOYA 3V5WB 3V7DB 2Q7QA 4R7AB 4E5ZA 2AGYA 5SXMA 4X63B 2B5LA 4OZUA 3UVLA 4A7JA 3J81g 2XYIA 4HDJA 3I7LA 5EMLB 3F3PA 3SWSD 1OMWB 5CXCA 4QL1A 2I0TA 3PSCB 3C5MA 2P9UC 4A0AA 5FA5B 2IUPA 3RSEC 3VGZA 3FRXA 2HKRA 3PVUB 4GQBB 3CFVA 4A11A 3JAMg 1JMXB 3FM0A 2H6QA 2B5NA 1MDAH 1K32A 1GXRA 4O9DA 2TRCB 2H3XA 3MKSB 2J57G 4EWRA 4GM8A 3L4MD 4CI3A 4GMBA 4JD2C 3C75H 2HJ4A 3VH0A 4ZOXA 1JMZB 2OIZA 2YNOA 3A0FA 1JOFA 4JSXC 1MG3A 2XL2A 3RMZD 3SBQA 4A09A 3K27A 1OLZA 1N6EA 4FA5D 4BUJC 3OKWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I2N A;  4L3H D;  4Z8L A;  4FA4 D;  3NVN A;  5IGO A;  3N0E A;  4X60 B;  4IA9 A;  5CXC B;  5GMK n;  3OKY B;  4QQE A;  3MMY A;  2CNX A;  2P9N C;  4CC9 A;  3EI4 A;  2Z2N A;  1A0R B;  2AGZ A;  3PVW B;  1P22 A;  3EI4 B;  3IJ0 A;  4XEI C;  5GSA A;  1YFQ A;  5K19 A;  4J0W A;  4BL0 A;  4H5I A;  3SHF A;  5EAR A;  2XU7 A;  3EI1 B;  2Z2P A;  1PI6 A;  2Z2O A;  3JZH A;  4Y5R D;  3I7O A;  1RI6 A;  3SFZ A;  4PBZ A;  4D6V A;  1ERJ A;  1FWX A;  4JSN C;  4PC0 A;  2MTA H;  4CY1 A;  4FHL A;  4GM9 A;  4JSP C;  3JB9 L;  3B7F A;  5IC7 A;  5TEE A;  3I7P A;  4CZY A;  3BG0 A;  3GFC A;  3IKO A;  2H6K A;  4J78 A;  3JRP A;  4CZX A;  3AFC A;  5EMJ B;  4A2M A;  3DM0 A;  5CYK B;  5TDH B;  5CXB A;  4A0B B;  5C9Z B;  5KDO B;  2OVQ B;  4FB1 D;  3SXT D;  2IWK A;  5I5J A;  3I89 A;  3I8C A;  3I7N A;  4PBY A;  5EAL A;  4GQ2 P;  2CE9 A;  4OWR A;  3EI3 B;  5FLX g;  3UVO A;  3IIW A;  4QRJ A;  4G56 B;  1SQ9 A;  5FKT A;  4LG8 A;  4CY2 A;  4X3E A;  4GGA A;  2CO0 A;  2P9S C;  4J86 A;  2PBI B;  2H9P A;  2XL3 A;  5TEF A;  3SLE D;  5H17 A;  4J82 A;  4IMM A;  2I0S A;  3SN6 B;  4X61 B;  5HE0 B;  4ES0 A;  2PM9 A;  2HES X;  2YBA A;  3U4Y A;  5A2Q g;  3RFH A;  3UKR C;  4CI1 A;  3SVW D;  5K1C C;  2IUV A;  3EU7 A;  2AH1 A;  1XKS A;  3JPX A;  4K3I D;  2AGL A;  4A11 B;  2G9A A;  2HKM A;  2UZX B;  4Y7R A;  1TBG A;  3ORV D;  4QT8 A;  1GOT B;  4TZ4 A;  4J77 A;  4ESG A;  5FQD A;  4FA1 D;  3EI1 A;  4J87 A;  1N6D A;  4K3J B;  5GXI A;  3VA6 A;  5FKS A;  4O1Q D;  3UVN A;  4AEZ A;  3RN1 D;  4LG9 A;  4N14 A;  2AGW A;  3OTT A;  2HJB A;  1XHM A;  1TYQ C;  3MKQ A;  2H13 A;  3PXT D;  5HYN B;  3P4F A;  4KFM B;  1PBY B;  1R5M A;  3F3F A;  1L0Q A;  3OW8 A;  2J56 H;  3SBR A;  3V9F A;  2H47 A;  2W18 A;  3ULE C;  4PXW A;  3CFS B;  4ERZ A;  3RLM D;  4NSX A;  3J80 g;  1U2V C;  4CI8 A;  2PM6 B;  4L9O A;  3IJC A;  5CXB B;  2CN3 A;  5H1M A;  4J81 A;  2I3S A;  5FXY A;  3EG6 A;  5C2V B;  4J73 A;  5TF2 A;  1Q47 A;  4L3G D;  3UVM A;  4GZ8 A;  4U1E I;  3SCY A;  3UVK A;  2AQ5 A;  4E54 A;  2BCJ B;  5I5I A;  1PGU A;  2OVR B;  2AGX A;  2IAA A;  3MXX A;  5HQG A;  2J55 H;  4PNK B;  2G99 A;  4ERQ A;  5IJ7 E;  4A09 B;  3OL2 B;  1PEV A;  3C99 A;  3PE7 A;  2H6N A;  3AL9 A;  5FKQ A;  5CYK A;  3DWL C;  3C9C A;  4JXM A;  4GQ1 A;  4AOW A;  2I3T A;  4J79 A;  3AL8 A;  3K26 A;  5EAM A;  2H9L A;  3JZG A;  4A2L A;  4FWW A;  4D0K A;  3ODT A;  4GGC A;  4XYI A;  3SMR A;  2O9K A;  3FGB A;  2YNP A;  4A0A B;  5IGQ A;  3ZWL B;  4H5J A;  5I5M A;  1GG2 B;  4GM3 A;  4E54 B;  2AH0 A;  2B4E A;  4ZOV A;  2P9P C;  2YNN A;  4MK0 B;  4CZV A;  1NEX B;  3HFQ A;  3MZK A;  5THA A;  4LGN A;  1U4C A;  2OJY A;  4CI2 A;  2CO0 C;  4XYH A;  2H9M A;  3N0D A;  5AMS A;  4A0B A;  3GRE A;  1B9X A;  5H14 A;  4PSW B;  3DSM A;  3NVX A;  3DXK C;  1B9Y A;  5AJA A;  3OKT A;  5HE2 B;  2P9I C;  1K8K C;  5B4W A;  2YB8 B;  2HXC A;  3UKU C;  4PSX B;  3JZN A;  4J8B A;  3KRW B;  1NR0 A;  5GXH A;  2H14 A;  1GP2 B;  3RRM C;  5AFU 3;  4CY3 A;  4A08 B;  3L4O D;  5C2W B;  2PM9 B;  3JRO A;  2OK6 A;  4BH6 A;  4U7A A;  2GC7 A;  3E0C A;  2PM7 B;  4GGD A;  4ERY A;  1SHY B;  3W15 A;  2HYE A;  3EI2 A;  2EBS A;  3SBP A;  4UI9 R;  4JT6 C;  4FA9 D;  4YVD A;  4CY5 A;  3SJL D;  5HE3 B;  4O3U B;  3EI3 A;  3I7K A;  2B5M A;  3OKY A;  3PXS D;  3RFG A;  4FAV D;  5EM2 B;  3IJ1 A;  5FKR A;  4ZOZ A;  2YMU A;  5EM2 A;  3F3G A;  2I0R A;  3AH8 B;  2GC4 A;  2CE8 A;  2P9L C;  3I7H A;  4JSV C;  3AL8 B;  2UZY B;  1SQJ A;  3UR4 A;  3EI2 B;  5HE1 B;  3RN0 D;  3PSL A;  4E5Z B;  5IT9 g;  3BG1 A;  4L1Q D;  5EMM B;  2IWF A;  3OL2 A;  3MZL A;  4I79 A;  2H9N A;  3DXM C;  3BWS A;  1JJU B;  4A08 A;  2CN2 A;  1MG2 A;  2GNQ A;  2OVP B;  4J0X A;  3CIK B;  4J8G A;  1S4U X;  1XIP A;  4J84 A;  4ZN4 A;  3EWE A;  3IIY A;  5EMK B;  4O45 A;  2H68 A;  2P9K C;  2QC5 A;  3PXW D;  3KRX B;  1N6F A;  1VYH C;  5JWZ A;  3EMH A;  3I8E A;  2IUR A;  3NVQ A;  4FAN D;  5EAP A;  4JT5 C;  2QXV A;  1QNI A;  5IJ8 E;  4O3T B;  2BBK H;  2IUQ A;  2OK4 A;  4ZOY A;  3V5W B;  3V7D B;  2Q7Q A;  4R7A B;  4E5Z A;  2AGY A;  5SXM A;  4X63 B;  2B5L A;  4OZU A;  3UVL A;  4A7J A;  3J81 g;  2XYI A;  4HDJ A;  3I7L A;  5EML B;  3F3P A;  3SWS D;  1OMW B;  5CXC A;  4QL1 A;  2I0T A;  3PSC B;  3C5M A;  2P9U C;  4A0A A;  5FA5 B;  2IUP A;  3RSE C;  3VGZ A;  3FRX A;  2HKR A;  3PVU B;  4GQB B;  3CFV A;  4A11 A;  3JAM g;  1JMX B;  3FM0 A;  2H6Q A;  2B5N A;  1MDA H;  1K32 A;  1GXR A;  4O9D A;  2TRC B;  2H3X A;  3MKS B;  2J57 G;  4EWR A;  4GM8 A;  3L4M D;  4CI3 A;  4GMB A;  4JD2 C;  3C75 H;  2HJ4 A;  3VH0 A;  4ZOX A;  1JMZ B;  2OIZ A;  2YNO A;  3A0F A;  1JOF A;  4JSX C;  1MG3 A;  2XL2 A;  3RMZ D;  3SBQ A;  4A09 A;  3K27 A;  1OLZ A;  1N6E A;  4FA5 D;  4BUJ C;  3OKW A; 
#chains in the Genus database with same CATH topology
 4NAA A;  3I2N A;  4L3H D;  4Z8L A;  4FA4 D;  3NVN A;  5IGO A;  4QAM A;  2VDK A;  3N0E A;  4X60 B;  4IA9 A;  1E8N A;  4Z7O A;  3MVD K;  5CXC B;  5GMK n;  2JKX A;  3OKY B;  4QQE A;  3MMY A;  3O4G A;  2CNX A;  2P9N C;  4CC9 A;  3EI4 A;  2Z2N A;  1A0R B;  2AGZ A;  3PVW B;  1P22 A;  3EI4 B;  3IJ0 A;  4XEI C;  5GSA A;  1YFQ A;  5K19 A;  4J0W A;  4BL0 A;  4H5I A;  3SHF A;  3IUM A;  5EAR A;  2XU7 A;  3EI1 B;  2Z2P A;  1PI6 A;  2Z2O A;  3JZH A;  4Y5R D;  4AX4 A;  1T2X A;  3I7O A;  1RI6 A;  3SFZ A;  4PBZ A;  4JHP C;  4D6V A;  1ERJ A;  1FWX A;  2VDR A;  1H2Y A;  4JSN C;  2HU5 A;  3ZE1 A;  4PC0 A;  2MTA H;  4CY1 A;  4FHL A;  4AN1 A;  4GM9 A;  4JSP C;  4L1M A;  3JB9 L;  3B7F A;  1C9I A;  5IC7 A;  5TEE A;  1VE6 A;  3I7P A;  1TYE A;  4CZY A;  3BG0 A;  4G1M A;  3GFC A;  3MUN A;  3IKO A;  2H6K A;  4J78 A;  5E6S A;  3JRP A;  4CZX A;  3AFC A;  3FCS A;  4DNW A;  4WK4 A;  5EMJ B;  2VZ3 A;  4A2M A;  3DM0 A;  1O6G A;  4BP9 A;  5CYK B;  5TDH B;  5CXB A;  4A0B B;  5C9Z B;  1JV2 A;  5KDO B;  2OVQ B;  4FB1 D;  3SXT D;  2IWK A;  5I5J A;  2XDW A;  3I89 A;  3I8C A;  3I7N A;  4PBY A;  5EAL A;  1JTD B;  4GQ2 P;  2CE9 A;  4OWR A;  1GOH A;  3EI3 B;  1GOF A;  5FLX g;  3UVO A;  3IIW A;  3V4P A;  4QRJ A;  4AN0 A;  4G56 B;  1SQ9 A;  5FKT A;  4LG8 A;  4CY2 A;  4X3E A;  4GGA A;  2CO0 A;  2P9S C;  2XE4 A;  3O4I A;  4J86 A;  2PBI B;  2H9P A;  2XL3 A;  5TEF A;  3SLE D;  5H17 A;  4J82 A;  4IMM A;  2I0S A;  3SN6 B;  3QHY B;  4X61 B;  5HE0 B;  4ES0 A;  2PM9 A;  2HES X;  2YBA A;  3U4Y A;  5A2Q g;  3RFH A;  3UKR C;  4CI1 A;  3SVW D;  5M5S A;  5K1C C;  2IUV A;  3EU7 A;  2AH1 A;  1XKS A;  3JPX A;  4K3I D;  5E6R A;  2AGL A;  4A11 B;  2G9A A;  2BKL A;  2HKM A;  2UZX B;  4Y7R A;  1TBG A;  3ORV D;  4QT8 A;  1GOT B;  4TZ4 A;  4J77 A;  3V4V A;  4ESG A;  5FQD A;  4FA1 D;  2EIB A;  4RE5 A;  3EI1 A;  4J87 A;  1N6D A;  4K3J B;  5GXI A;  3VA6 A;  5FKS A;  4O1Q D;  4DNV A;  3UVN A;  2QZP A;  4AEZ A;  3RN1 D;  5FFG A;  1VZ2 A;  4LG9 A;  4N14 A;  2AGW A;  1A12 A;  3OTT A;  4MMY A;  3IVM A;  2HJB A;  1XHM A;  1TYQ C;  3MKQ A;  2H13 A;  3PXT D;  5HYN B;  3P4F A;  4KFM B;  1PBY B;  1R5M A;  3F3F A;  1L0Q A;  3OW8 A;  4BCC A;  2J56 H;  3SBR A;  3V9F A;  2H47 A;  2W18 A;  3ULE C;  4PXW A;  3CFS B;  2VDQ A;  3IUQ A;  3OF7 A;  4ERZ A;  3RLM D;  4NSX A;  3J80 g;  1U2V C;  4CI8 A;  4DNU A;  2PM6 B;  4L9O A;  3IJC A;  5CXB B;  2CN3 A;  5H1M A;  4J81 A;  2I3S A;  5FXY A;  3EG6 A;  5C2V B;  4J73 A;  5TF2 A;  1BPO A;  1Q47 A;  3NID A;  3IUR A;  4L3G D;  3UVM A;  4GZ8 A;  4U1E I;  3SCY A;  3UVK A;  2AQ5 A;  4E54 A;  3DDU A;  2BCJ B;  5I5I A;  1PGU A;  2OVR B;  2AGX A;  2IAA A;  3MXX A;  5HQG A;  2J55 H;  4PNK B;  2G99 A;  4ERQ A;  5IJ7 E;  4A09 B;  3OL2 B;  1PEV A;  3C99 A;  3PE7 A;  2H6N A;  3ZDX A;  3AL9 A;  5FKQ A;  5CYK A;  3DWL C;  3C9C A;  4JXM A;  3T3M A;  4GQ1 A;  4AOW A;  2I3T A;  4J79 A;  3AL8 A;  3K26 A;  5EAM A;  3MUO A;  3EQ9 A;  2H9L A;  3JZG A;  4G1E A;  4FWW A;  3VI3 A;  4A2L A;  4D0K A;  1YR2 A;  3KCI A;  3ODT A;  4GGC A;  4XYI A;  3SMR A;  2O9K A;  1GOG A;  3FGB A;  2YNP A;  4A0A B;  5IGQ A;  3ZWL B;  4H5J A;  5I5M A;  3ZDZ A;  1GG2 B;  4GM3 A;  4E54 B;  2AH0 A;  1O6F A;  2B4E A;  4ZOV A;  3ZE2 A;  2P9P C;  1E5T A;  2YNN A;  4MK0 B;  4UM9 A;  4CZV A;  1VZ3 A;  1NEX B;  3HFQ A;  4WK0 A;  3MZK A;  5THA A;  4LGN A;  1U4C A;  2OJY A;  4CI2 A;  2CO0 C;  3EQ8 A;  4XYH A;  4BP8 A;  2H9M A;  3N0D A;  1QFS A;  3K72 A;  5AMS A;  4A0B A;  3K6S A;  3GRE A;  2VDP A;  4NBM A;  1B9X A;  2EIE A;  2VDM A;  4PSW B;  3DSM A;  5H14 A;  3NVX A;  5M61 A;  3DXK C;  4MMZ A;  4JHN A;  1B9Y A;  5AJA A;  3OKT A;  5HE2 B;  2P9I C;  1K8K C;  5B4W A;  2XZG A;  2YB8 B;  2HXC A;  3UKU C;  4PSX B;  3JZN A;  3IUJ A;  5C86 A;  4J8B A;  3KRW B;  3NIG A;  3O4H A;  1NR0 A;  3ZE0 A;  5GXH A;  1E8M A;  2H14 A;  4NC4 A;  1GP2 B;  3RRM C;  3T3P A;  5AFU 3;  4CY3 A;  4A08 B;  3L4O D;  5C2W B;  4MMX A;  2PM9 B;  3JRO A;  2OK6 A;  4BH6 A;  1H2X A;  1M1X A;  2HU7 A;  4U7A A;  2GC7 A;  2QR5 A;  3E0C A;  4WK2 A;  2PM7 B;  1UTC A;  4GGD A;  4ERY A;  1SHY B;  3W15 A;  3K71 A;  2HYE A;  3EI2 A;  2EBS A;  4O2W A;  4Z7N A;  3SBP A;  4UI9 R;  4JT6 C;  4AMY A;  3GC3 B;  4BCD A;  4FA9 D;  5M5T A;  4YVD A;  4CY5 A;  3SJL D;  5HE3 B;  4O3U B;  3EI3 A;  3I7K A;  3ZDY A;  2B5M A;  3OKY A;  3PXS D;  3RFG A;  4FAV D;  4BCB A;  5EM2 B;  3IJ1 A;  5FKR A;  4ZOZ A;  2YMU A;  5EM2 A;  3F3G A;  2I0R A;  3NIF A;  5HDB A;  3AH8 B;  2GC4 A;  2CE8 A;  3FCU A;  2P9L C;  2WQ8 A;  3I7H A;  4JSV C;  1L5G A;  2UZY B;  1U8C A;  3AL8 B;  1SQJ A;  3UR4 A;  3EI2 B;  3IUL A;  5HE1 B;  3RN0 D;  3PSL A;  4AMZ A;  4E5Z B;  5IT9 g;  3BG1 A;  4L1Q D;  5EMM B;  2IWF A;  1UOP A;  3OL2 A;  5FFO A;  3MZL A;  4I79 A;  1I2M B;  2H9N A;  3DXM C;  3IJE A;  3BWS A;  1JJU B;  4A08 A;  2CN2 A;  1MG2 A;  2GNQ A;  2OVP B;  4J0X A;  3CIK B;  4J8G A;  1S4U X;  1XIP A;  4J84 A;  4ZN4 A;  5M5V A;  3EWE A;  3IIY A;  5EMK B;  4O45 A;  2H68 A;  1K3I A;  2P9K C;  2QC5 A;  3PXW D;  3KRX B;  1N6F A;  1VYH C;  5JWZ A;  1QFM A;  3EMH A;  3I8E A;  2IUR A;  3NVQ A;  3IUN A;  4FAN D;  5EAP A;  4JT5 C;  2QXV A;  1QNI A;  3QI0 A;  5IJ8 E;  4O3T B;  2BBK H;  3O4J A;  2VDO A;  4D9S A;  4G55 A;  2IUQ A;  2OK4 A;  4ZOY A;  3V5W B;  2VDL A;  3V7D B;  2Q7Q A;  4R7A B;  4E5Z A;  2AGY A;  1UOQ A;  5SXM A;  4X63 B;  4IRZ A;  2B5L A;  4OZU A;  3UVL A;  4A7J A;  3J81 g;  1H2Z A;  2XYI A;  2VDN A;  4HDJ A;  3I7L A;  5EML B;  3F3P A;  3SWS D;  3VI4 A;  1OMW B;  5CXC A;  4QL1 A;  2I0T A;  1UOO A;  3EQ7 A;  4NEN A;  3PSC B;  3C5M A;  1VE7 A;  2P9U C;  2HU8 A;  4A0A A;  5FA5 B;  2IUP A;  3RSE C;  4UM8 A;  3VGZ A;  3FRX A;  2HKR A;  3GD1 I;  3PVU B;  4GQB B;  3CFV A;  1C9L A;  4A11 A;  4O02 A;  4RE6 A;  1JMX B;  3JAM g;  3FM0 A;  2H6Q A;  2B5N A;  1MDA H;  4WJK A;  1K32 A;  1GXR A;  4O9D A;  2TRC B;  1H2W A;  2VC2 A;  5M5R A;  2VZ1 A;  2H3X A;  3MKS B;  5M5U A;  2J57 G;  4EWR A;  4GM8 A;  3L4M D;  4CI3 A;  4GMB A;  4Z7Q A;  4JD2 C;  3C75 H;  2HJ4 A;  3VH0 A;  4ZOX A;  2EID A;  1JMZ B;  2OIZ A;  5E6U A;  5C92 A;  2YNO A;  3A0F A;  1JOF A;  4JSX C;  1MG3 A;  2XL2 A;  3RMZ D;  3SBQ A;  4A09 A;  3K27 A;  1OLZ A;  1N6E A;  4FA5 D;  4BUJ C;  2EIC A;  3OKW A; 
#chains in the Genus database with same CATH homology
 3I2N A;  4L3H D;  4Z8L A;  4FA4 D;  3NVN A;  5IGO A;  3N0E A;  4X60 B;  4IA9 A;  5CXC B;  5GMK n;  3OKY B;  4QQE A;  3MMY A;  2CNX A;  2P9N C;  4CC9 A;  3EI4 A;  2Z2N A;  1A0R B;  2AGZ A;  3PVW B;  1P22 A;  3EI4 B;  3IJ0 A;  4XEI C;  5GSA A;  1YFQ A;  5K19 A;  4J0W A;  4BL0 A;  4H5I A;  3SHF A;  5EAR A;  2XU7 A;  3EI1 B;  2Z2P A;  1PI6 A;  2Z2O A;  3JZH A;  4Y5R D;  3I7O A;  1RI6 A;  3SFZ A;  4PBZ A;  4D6V A;  1ERJ A;  1FWX A;  4JSN C;  4PC0 A;  2MTA H;  4CY1 A;  4FHL A;  4GM9 A;  4JSP C;  3JB9 L;  3B7F A;  5IC7 A;  5TEE A;  3I7P A;  4CZY A;  3BG0 A;  3GFC A;  3IKO A;  2H6K A;  4J78 A;  3JRP A;  4CZX A;  3AFC A;  5EMJ B;  4A2M A;  3DM0 A;  5CYK B;  5TDH B;  5CXB A;  4A0B B;  5C9Z B;  5KDO B;  2OVQ B;  4FB1 D;  3SXT D;  2IWK A;  5I5J A;  3I89 A;  3I8C A;  3I7N A;  4PBY A;  5EAL A;  4GQ2 P;  2CE9 A;  4OWR A;  3EI3 B;  5FLX g;  3UVO A;  3IIW A;  4QRJ A;  4G56 B;  1SQ9 A;  5FKT A;  4LG8 A;  4CY2 A;  4X3E A;  4GGA A;  2CO0 A;  2P9S C;  4J86 A;  2PBI B;  2H9P A;  2XL3 A;  5TEF A;  3SLE D;  5H17 A;  4J82 A;  4IMM A;  2I0S A;  3SN6 B;  4X61 B;  5HE0 B;  4ES0 A;  2PM9 A;  2HES X;  2YBA A;  3U4Y A;  5A2Q g;  3RFH A;  3UKR C;  4CI1 A;  3SVW D;  5K1C C;  2IUV A;  3EU7 A;  2AH1 A;  1XKS A;  3JPX A;  4K3I D;  2AGL A;  4A11 B;  2G9A A;  2HKM A;  2UZX B;  4Y7R A;  1TBG A;  3ORV D;  4QT8 A;  1GOT B;  4TZ4 A;  4J77 A;  4ESG A;  5FQD A;  4FA1 D;  3EI1 A;  4J87 A;  1N6D A;  4K3J B;  5GXI A;  3VA6 A;  5FKS A;  4O1Q D;  3UVN A;  4AEZ A;  3RN1 D;  4LG9 A;  4N14 A;  2AGW A;  3OTT A;  2HJB A;  1XHM A;  1TYQ C;  3MKQ A;  2H13 A;  3PXT D;  5HYN B;  3P4F A;  4KFM B;  1PBY B;  1R5M A;  3F3F A;  1L0Q A;  3OW8 A;  2J56 H;  3SBR A;  3V9F A;  2H47 A;  2W18 A;  3ULE C;  4PXW A;  3CFS B;  4ERZ A;  3RLM D;  4NSX A;  3J80 g;  1U2V C;  4CI8 A;  2PM6 B;  4L9O A;  3IJC A;  5CXB B;  2CN3 A;  5H1M A;  4J81 A;  2I3S A;  5FXY A;  3EG6 A;  5C2V B;  4J73 A;  5TF2 A;  1Q47 A;  4L3G D;  3UVM A;  4GZ8 A;  4U1E I;  3SCY A;  3UVK A;  2AQ5 A;  4E54 A;  2BCJ B;  5I5I A;  1PGU A;  2OVR B;  2AGX A;  2IAA A;  3MXX A;  5HQG A;  2J55 H;  4PNK B;  2G99 A;  4ERQ A;  5IJ7 E;  4A09 B;  3OL2 B;  1PEV A;  3C99 A;  3PE7 A;  2H6N A;  3AL9 A;  5FKQ A;  5CYK A;  3DWL C;  3C9C A;  4JXM A;  4GQ1 A;  4AOW A;  2I3T A;  4J79 A;  3AL8 A;  3K26 A;  5EAM A;  2H9L A;  3JZG A;  4A2L A;  4FWW A;  4D0K A;  3ODT A;  4GGC A;  4XYI A;  3SMR A;  2O9K A;  3FGB A;  2YNP A;  4A0A B;  5IGQ A;  3ZWL B;  4H5J A;  5I5M A;  1GG2 B;  4GM3 A;  4E54 B;  2AH0 A;  2B4E A;  4ZOV A;  2P9P C;  2YNN A;  4MK0 B;  4CZV A;  1NEX B;  3HFQ A;  3MZK A;  5THA A;  4LGN A;  1U4C A;  2OJY A;  4CI2 A;  2CO0 C;  4XYH A;  2H9M A;  3N0D A;  5AMS A;  4A0B A;  3GRE A;  1B9X A;  5H14 A;  4PSW B;  3DSM A;  3NVX A;  3DXK C;  1B9Y A;  5AJA A;  3OKT A;  5HE2 B;  2P9I C;  1K8K C;  5B4W A;  2YB8 B;  2HXC A;  3UKU C;  4PSX B;  3JZN A;  4J8B A;  3KRW B;  1NR0 A;  5GXH A;  2H14 A;  1GP2 B;  3RRM C;  5AFU 3;  4CY3 A;  4A08 B;  3L4O D;  5C2W B;  2PM9 B;  3JRO A;  2OK6 A;  4BH6 A;  4U7A A;  2GC7 A;  3E0C A;  2PM7 B;  4GGD A;  4ERY A;  1SHY B;  3W15 A;  2HYE A;  3EI2 A;  2EBS A;  3SBP A;  4UI9 R;  4JT6 C;  4FA9 D;  4YVD A;  4CY5 A;  3SJL D;  5HE3 B;  4O3U B;  3EI3 A;  3I7K A;  2B5M A;  3OKY A;  3PXS D;  3RFG A;  4FAV D;  5EM2 B;  3IJ1 A;  5FKR A;  4ZOZ A;  2YMU A;  5EM2 A;  3F3G A;  2I0R A;  3AH8 B;  2GC4 A;  2CE8 A;  2P9L C;  3I7H A;  4JSV C;  3AL8 B;  2UZY B;  1SQJ A;  3UR4 A;  3EI2 B;  5HE1 B;  3RN0 D;  3PSL A;  4E5Z B;  5IT9 g;  3BG1 A;  4L1Q D;  5EMM B;  2IWF A;  3OL2 A;  3MZL A;  4I79 A;  2H9N A;  3DXM C;  3BWS A;  1JJU B;  4A08 A;  2CN2 A;  1MG2 A;  2GNQ A;  2OVP B;  4J0X A;  3CIK B;  4J8G A;  1S4U X;  1XIP A;  4J84 A;  4ZN4 A;  3EWE A;  3IIY A;  5EMK B;  4O45 A;  2H68 A;  2P9K C;  2QC5 A;  3PXW D;  3KRX B;  1N6F A;  1VYH C;  5JWZ A;  3EMH A;  3I8E A;  2IUR A;  3NVQ A;  4FAN D;  5EAP A;  4JT5 C;  2QXV A;  1QNI A;  5IJ8 E;  4O3T B;  2BBK H;  2IUQ A;  2OK4 A;  4ZOY A;  3V5W B;  3V7D B;  2Q7Q A;  4R7A B;  4E5Z A;  2AGY A;  5SXM A;  4X63 B;  2B5L A;  4OZU A;  3UVL A;  4A7J A;  3J81 g;  2XYI A;  4HDJ A;  3I7L A;  5EML B;  3F3P A;  3SWS D;  1OMW B;  5CXC A;  4QL1 A;  2I0T A;  3PSC B;  3C5M A;  2P9U C;  4A0A A;  5FA5 B;  2IUP A;  3RSE C;  3VGZ A;  3FRX A;  2HKR A;  3PVU B;  4GQB B;  3CFV A;  4A11 A;  3JAM g;  1JMX B;  3FM0 A;  2H6Q A;  2B5N A;  1MDA H;  1K32 A;  1GXR A;  4O9D A;  2TRC B;  2H3X A;  3MKS B;  2J57 G;  4EWR A;  4GM8 A;  3L4M D;  4CI3 A;  4GMB A;  4JD2 C;  3C75 H;  2HJ4 A;  3VH0 A;  4ZOX A;  1JMZ B;  2OIZ A;  2YNO A;  3A0F A;  1JOF A;  4JSX C;  1MG3 A;  2XL2 A;  3RMZ D;  3SBQ A;  4A09 A;  3K27 A;  1OLZ A;  1N6E A;  4FA5 D;  4BUJ C;  3OKW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...