2CE8A

An eh1 peptide bound to the groucho-tle wd40 domain.
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
337
structure length
337
Chain Sequence
b'DYFQGAMGSKPAYSFHVTADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSDUCIN-LIKE ENHANCER PROTEIN 1
publication title Molecular Recognition of Transcriptional Repressor Motifs by the Wd Domain of the Groucho/Tle Corepressor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulation
total genus 85
structure length 337
sequence length 337
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ce8A00
3OKYB 3SFZA 4L9OA 4O3UB 4D6VA 3GREA 4HDJA 3AFCA 3JB9L 1N6EA 5EMJB 4GM9A 2QC5A 4K3ID 4CY2A 4ZOYA 2TRCB 2HKRA 4MK0B 3V7DB 2OK4A 4FAND 2PM9B 1JOFA 4JSXC 3EI3A 5GSAA 5HE0B 3DXMC 3C99A 3UKUC 4LG8A 4O1QD 4JSVC 5K19A 3F3GA 4GQ2P 4FHLA 4J84A 3SN6B 1MG3A 3UVKA 1K32A 2PM6B 3MKSB 2GC7A 2AGLA 4O45A 1N6FA 1MDAH 1N6DA 1U4CA 1XHMA 4XYIA 4FAVD 4CI1A 3F3FA 4ERYA 5HQGA 4N14A 5GXIA 3HFQA 1GOTB 3J81g 3EI2B 1TYQC 4JXMA 3V5WB 4ZN4A 3L4OD 4ZOVA 1OLZA 2H9MA 4ZOZA 3NVQA 2HESX 3ORVD 4A09A 2B4EA 2XL3A 2AH0A 3OW8A 5EALA 2QXVA 4QRJA 2H9PA 4XYHA 4A2LA 4CY1A 4BH6A 1L0QA 4A2MA 3I7KA 2G99A 3NVNA 3EG6A 5IGQA 2H13A 4PBYA 5K1CC 1TBGA 1ERJA 3SBPA 4KFMB 4PBZA 4G56B 3V9FA 2XU7A 2IWKA 3IIWA 1Q47A 3ODTA 4R7AB 1SQJA 3PXTD 3PXSD 4IMMA 3KRXB 4A08A 2J55H 3UVLA 3RN0D 4TZ4A 3F3PA 3EI4A 3RN1D 4H5JA 2IUVA 4PNKB 2AQ5A 5I5JA 3RFHA 3PE7A 4ERZA 5HE2B 5TEEA 4CI3A 3U4YA 5CYKB 3K27A 4E5ZB 4PC0A 2HJ4A 4GGDA 1PBYB 4A11B 2YMUA 3P4FA 3SHFA 4Y7RA 4FB1D 2H9LA 2I0SA 1GXRA 2I0TA 3FM0A 4J82A 4ESGA 4A7JA 4UI9R 1R5MA 3NVXA 4BL0A 1JJUB 2P9NC 4JD2C 4JT5C 4GMBA 2H9NA 3IKOA 3SCYA 3MZLA 3JZNA 4J78A 1NR0A 3OKWA 5C2VB 2J56H 4OZUA 3I8EA 4A0BA 3CFVA 4IA9A 4GZ8A 3RMZD 1YFQA 3EI3B 3C9CA 4GM3A 3BG1A 3IJ1A 4H5IA 2P9LC 4U1EI 3W15A 2H14A 4JT6C 2P9IC 2IWFA 4AOWA 2W18A 4CZXA 2AH1A 5C2WB 2AGZA 2OVRB 5H17A 5FLXg 3ZWLB 3PVUB 4A0AA 5C9ZB 3J80g 5B4WA 1XKSA 3I7OA 2EBSA 2H3XA 4J8BA 4AEZA 3RFGA 5SXMA 1B9YA 3SWSD 4GM8A 4FA4D 4Z8LA 2AGWA 1JMXB 1P22A 2CN3A 2OK6A 3RLMD 5KDOB 3AL8A 3K26A 4A09B 2B5MA 4QL1A 5EMMB 3I7HA 5FKSA 1K8KC 2H6NA 2HJBA 3IJCA 5I5MA 1PEVA 4ERQA 1SHYB 4FWWA 5EMLB 2IAAA 4J81A 2OVPB 2H68A 4JSNC 3JZHA 2O9KA 5CXBA 4J73A 4D0KA 2I3TA 1RI6A 2YNNA 4CZYA 2P9SC 3PSLA 4LGNA 3OL2A 4A08B 3C5MA 2H6QA 3DM0A 1GG2B 3OKTA 4JSPC 5HE1B 3JPXA 3PXWD 2YB8B 4J0XA 3I7PA 4CI2A 2CO0A 3EI4B 4FA5D 5EM2A 4L1QD 4X60B 2Q7QA 4J8GA 3SBRA 5EM2B 2IUQA 3RSEC 4K3JB 3JRPA 3JZGA 2P9PC 3N0EA 3MZKA 3E0CA 4QT8A 3CIKB 5H1MA 3SJLD 4J79A 3KRWB 3DSMA 2MTAH 2J57G 1SQ9A 3I89A 4CI8A 5EAMA 1FWXA 4PXWA 5IC7A 1NEXB 2UZYB 5I5IA 3SBQA 3SVWD 4Y5RD 3I7NA 2IURA 3I7LA 4PSXB 3EWEA 3SLED 1PI6A 2P9KC 2Z2NA 2CE8A 2HXCA 5AFU3 3VA6A 3UKRC 3OKYA 3BG0A 2HYEA 4A0BB 3EU7A 4I79A 4QQEA 3PSCB 2OVQB 5JWZA 3AL9A 2H47A 4FA9D 5A2Qg 4E54A 2BCJB 2G9AA 4OWRA 5EAPA 2Z2PA 5FKQA 4E54B 4X3EA 3IJ0A 2PM7B 3A0FA 4X61B 5CXCA 5IJ8E 4CC9A 1OMWB 2PM9A 5FKTA 5CXCB 2YBAA 4L3HD 4GQBB 4A0AB 5IGOA 4CZVA 3RRMC 4LG9A 3AH8B 4ZOXA 5EMKB 3OTTA 5H14A 5TEFA 3DXKC 4J86A 4J87A 4GQ1A 3JAMg 2HKMA 1PGUA 4BUJC 1GP2B 2IUPA 2UZXB 3AL8B 5FA5B 3I2NA 2AGYA 2CO0C 3EI2A 4GGCA 5GXHA 5IT9g 4X63B 5FQDA 3FRXA 2XL2A 2CN2A 2OJYA 3UR4A 3MKQA 5TDHB 2I3SA 2CE9A 3SMRA 1QNIA 4J0WA 5IJ7E 3IIYA 3VH0A 3EMHA 4L3GD 2B5NA 2GNQA 5CXBB 2Z2OA 3EI1A 3FGBA 5HYNB 3EI1B 3MMYA 2BBKH 2YNPA 3GFCA 5THAA 5GMKn 1S4UX 2I0RA 3OL2B 3MXXA 4FA1D 2OIZA 4ES0A 3N0DA 3DWLC 4GGAA 4O9DA 1U2VC 4PSWB 3PVWB 1MG2A 4CY3A 1VYHC 2XYIA 3B7FA 3CFSB 4U7AA 2PBIB 5FKRA 3ULEC 4XEIC 4YVDA 2GC4A 5TF2A 5AJAA 3JROA 2B5LA 4O3TB 4J77A 1XIPA 5FXYA 4NSXA 3SXTD 4CY5A 5CYKA 4E5ZA 3C75H 3UVOA 5HE3B 3I8CA 3L4MD 5EARA 1JMZB 2P9UC 2H6KA 4A11A 2AGXA 3UVMA 3UVNA 3VGZA 1B9XA 4EWRA 3BWSA 2YNOA 2CNXA 5AMSA 1A0RB
chains in the Genus database with same CATH superfamily
3OKYB 3SFZA 4L9OA 4O3UB 4D6VA 2HU5A 3GREA 4WK2A 1VE6A 3GD1I 4HDJA 3AFCA 3JB9L 1N6EA 4NENA 5EMJB 4GM9A 2QC5A 4K3ID 3KCIA 4CY2A 3EQ9A 4ZOYA 2TRCB 5M61A 2HKRA 4MK0B 3V7DB 2OK4A 4FAND 2PM9B 1JOFA 4JSXC 3EI3A 5C92A 5GSAA 3FCUA 3T3PA 5HE0B 3DXMC 3C99A 3UKUC 4LG8A 4O02A 4O1QD 4JSVC 3GC3B 5K19A 3F3GA 1H2WA 3IUQA 4GQ2P 4FHLA 4J84A 3SN6B 1MG3A 2QZPA 3UVKA 1QFMA 1K32A 2PM6B 3IURA 3MKSB 2GC7A 2AGLA 4O45A 1N6FA 1MDAH 1N6DA 1U4CA 4WK0A 1XHMA 4XYIA 3NIDA 2VDLA 4FAVD 2VZ3A 4CI1A 3F3FA 4ERYA 5HQGA 4N14A 5GXIA 2HU8A 3HFQA 1GOTB 1JTDB 3J81g 3EI2B 1TYQC 4JXMA 3V5WB 4ZN4A 3L4OD 4ZOVA 3IJEA 1OLZA 4IRZA 2H9MA 4ZOZA 1O6GA 3NVQA 2HESX 3ORVD 4A09A 2B4EA 2XL3A 2AH0A 3OW8A 4JHPC 5EALA 2QXVA 4QRJA 2H9PA 4XYHA 4A2LA 4CY1A 4BH6A 1L0QA 4BP9A 4A2MA 3I7KA 2G99A 4BCDA 3NVNA 2EIEA 3EG6A 3T3MA 5IGQA 2H13A 4PBYA 3MVDK 5K1CC 1TBGA 1ERJA 3SBPA 4KFMB 4PBZA 4G56B 3V9FA 5M5UA 2XU7A 1GOGA 2IWKA 1E8NA 3IIWA 1Q47A 3ODTA 3QHYB 4R7AB 1SQJA 3PXTD 1BPOA 3PXSD 2VZ1A 4IMMA 4WK4A 3KRXB 4A08A 2J55H 1M1XA 3UVLA 3RN0D 4AMZA 3K71A 4TZ4A 3F3PA 4UM9A 3EI4A 4DNUA 3RN1D 4H5JA 2IUVA 4PNKB 4NBMA 2AQ5A 5I5JA 3RFHA 3DDUA 4WJKA 3O4GA 2EIDA 3PE7A 3K72A 4ERZA 5HE2B 5TEEA 3O4HA 4CI3A 3U4YA 5CYKB 3K27A 4E5ZB 4PC0A 2HJ4A 1UOOA 2XDWA 4GGDA 3ZDZA 1PBYB 4A11B 2YMUA 3P4FA 3IULA 4NAAA 3SHFA 4NC4A 2VDRA 4Y7RA 4RE5A 4FB1D 2H9LA 1E5TA 2I0SA 1GXRA 2I0TA 3FM0A 4J82A 4ESGA 4A7JA 4UI9R 4MMYA 1R5MA 3NVXA 4BL0A 1JJUB 2P9NC 4JD2C 4JT5C 4GMBA 2H9NA 3IKOA 3SCYA 3MZLA 3JZNA 4J78A 1NR0A 2VDKA 3OKWA 4G1MA 5C2VB 2JKXA 2J56H 4OZUA 3I8EA 4A0BA 2EICA 3CFVA 4IA9A 4GZ8A 4MMZA 3RMZD 1YFQA 3EI3B 3C9CA 4GM3A 3BG1A 1U8CA 3IJ1A 4H5IA 2P9LC 5C86A 4U1EI 3W15A 2H14A 1GOFA 2P9IC 2VDOA 4JT6C 2IWFA 3O4IA 4RE6A 4AOWA 2W18A 4G1EA 4CZXA 2AH1A 1YR2A 4D9SA 4O2WA 5C2WB 2AGZA 2OVRB 5H17A 5FLXg 3ZWLB 3PVUB 4Z7NA 4A0AA 5M5RA 5M5VA 5C9ZB 3J80g 5B4WA 1XKSA 3I7OA 2EBSA 2H3XA 4J8BA 4AEZA 4DNVA 3NIGA 3RFGA 5SXMA 1B9YA 3IUJA 3SWSD 4GM8A 4FA4D 4Z8LA 2AGWA 4G55A 4AX4A 1JMXB 1P22A 2CN3A 1H2XA 2OK6A 5E6SA 3RLMD 4BCCA 5KDOB 3AL8A 3K6SA 3ZDXA 3K26A 4A09B 2B5MA 4QL1A 5EMMB 1VZ3A 3I7HA 2QR5A 5FKSA 1K8KC 2H6NA 2HJBA 3IJCA 5I5MA 1PEVA 3OF7A 5M5SA 4ERQA 1SHYB 4FWWA 5EMLB 2IAAA 4J81A 2OVPB 1L5GA 1JV2A 1A12A 2H68A 1C9LA 4JSNC 1C9IA 3JZHA 2O9KA 5CXBA 3ZDYA 4J73A 4D0KA 2I3TA 1T2XA 1RI6A 2YNNA 1VE7A 3FCSA 4CZYA 2P9SC 3PSLA 4LGNA 3OL2A 4A08B 3C5MA 2H6QA 2HU7A 1GG2B 3DM0A 3OKTA 4JSPC 5HE1B 3JPXA 3MUOA 3PXWD 2VC2A 2YB8B 4J0XA 3I7PA 4CI2A 2CO0A 3EI4B 5FFGA 4FA5D 5EM2A 4L1QD 4X60B 2Q7QA 4J8GA 3SBRA 5EM2B 2IUQA 3RSEC 3QI0A 4K3JB 3JRPA 3JZGA 2P9PC 3VI4A 3N0EA 3MZKA 4L1MA 4Z7QA 3E0CA 4QT8A 3CIKB 5H1MA 4AMYA 3SJLD 4J79A 3KRWB 3DSMA 2MTAH 2J57G 1H2YA 1SQ9A 3MUNA 3I89A 4CI8A 5EAMA 1FWXA 4PXWA 5IC7A 1NEXB 2UZYB 3EQ8A 5I5IA 3SBQA 3SVWD 4Y5RD 3I7NA 1E8MA 2IURA 3I7LA 4AN0A 4PSXB 2VDNA 3EWEA 3SLED 3VI3A 1PI6A 2P9KC 2VDQA 2Z2NA 2CE8A 1K3IA 2HXCA 5AFU3 1UOPA 3VA6A 2XZGA 3UKRC 3OKYA 2EIBA 3BG0A 2HYEA 4A0BB 3EU7A 4I79A 4QQEA 3PSCB 3V4VA 2OVQB 5JWZA 3AL9A 2H47A 4FA9D 5A2Qg 4E54A 2BCJB 2G9AA 4JHNA 4OWRA 5EAPA 2Z2PA 5FKQA 3V4PA 4E54B 1UOQA 1UTCA 3IUNA 4X3EA 4Z7OA 3O4JA 3IJ0A 2PM7B 3A0FA 4X61B 5CXCA 5IJ8E 4CC9A 1OMWB 2PM9A 5FKTA 5CXCB 2YBAA 4L3HD 4GQBB 4A0AB 5IGOA 4UM8A 3ZE0A 4BCBA 3RRMC 4CZVA 4LG9A 3AH8B 4ZOXA 1O6FA 3IVMA 5EMKB 3OTTA 4QAMA 5H14A 5TEFA 3DXKC 4J86A 4J87A 4GQ1A 3JAMg 2HKMA 1PGUA 4BUJC 1GP2B 2IUPA 2UZXB 3AL8B 5FA5B 4MMXA 3I2NA 2BKLA 2AGYA 2CO0C 3EI2A 4GGCA 5GXHA 5IT9g 4X63B 1H2ZA 5FQDA 2WQ8A 3FRXA 1VZ2A 2CN2A 2XL2A 2OJYA 1TYEA 3UR4A 3MKQA 5HDBA 5TDHB 2I3SA 2CE9A 3EQ7A 3SMRA 4BP8A 1QNIA 4J0WA 5IJ7E 1QFSA 3IIYA 3VH0A 3EMHA 4L3GD 2B5NA 2GNQA 5CXBB 2Z2OA 3EI1A 3FGBA 5HYNB 3EI1B 3IUMA 3MMYA 2BBKH 2YNPA 3GFCA 5THAA 1I2MB 1S4UX 2I0RA 3OL2B 5GMKn 3MXXA 4FA1D 1GOHA 2OIZA 3ZE2A 4ES0A 3N0DA 3DWLC 4GGAA 4O9DA 1U2VC 4PSWB 3PVWB 4AN1A 1MG2A 4CY3A 1VYHC 2XYIA 2VDPA 3B7FA 3CFSB 4U7AA 2PBIB 5FKRA 3ULEC 4XEIC 4YVDA 2GC4A 5TF2A 5AJAA 3JROA 2B5LA 2XE4A 5E6RA 4O3TB 4DNWA 4J77A 1XIPA 5FXYA 4NSXA 3SXTD 4CY5A 5CYKA 4E5ZA 3C75H 3UVOA 3NIFA 5E6UA 5FFOA 5HE3B 3I8CA 3L4MD 5EARA 5M5TA 1JMZB 2P9UC 2H6KA 4A11A 2AGXA 3UVMA 3UVNA 3VGZA 2VDMA 1B9XA 4EWRA 3BWSA 2YNOA 3ZE1A 2CNXA 5AMSA 1A0RB
chains in the Genus database with same CATH topology
3OKYB 3SFZA 4L9OA 4O3UB 4D6VA 3GREA 4HDJA 3AFCA 3JB9L 1N6EA 5EMJB 4GM9A 2QC5A 4K3ID 4CY2A 4ZOYA 2TRCB 2HKRA 4MK0B 3V7DB 2OK4A 4FAND 2PM9B 1JOFA 4JSXC 3EI3A 5GSAA 5HE0B 3DXMC 3C99A 3UKUC 4LG8A 4O1QD 4JSVC 5K19A 3F3GA 4GQ2P 4FHLA 4J84A 3SN6B 1MG3A 3UVKA 1K32A 2PM6B 3MKSB 2GC7A 2AGLA 4O45A 1N6FA 1MDAH 1N6DA 1U4CA 1XHMA 4XYIA 4FAVD 4CI1A 3F3FA 4ERYA 5HQGA 4N14A 5GXIA 3HFQA 1GOTB 3J81g 3EI2B 1TYQC 4JXMA 3V5WB 4ZN4A 3L4OD 4ZOVA 1OLZA 2H9MA 4ZOZA 3NVQA 2HESX 3ORVD 4A09A 2B4EA 2XL3A 2AH0A 3OW8A 5EALA 2QXVA 4QRJA 2H9PA 4XYHA 4A2LA 4CY1A 4BH6A 1L0QA 4A2MA 3I7KA 2G99A 3NVNA 3EG6A 5IGQA 2H13A 4PBYA 5K1CC 1TBGA 1ERJA 3SBPA 4KFMB 4PBZA 4G56B 3V9FA 2XU7A 2IWKA 3IIWA 1Q47A 3ODTA 4R7AB 1SQJA 3PXTD 3PXSD 4IMMA 3KRXB 4A08A 2J55H 3UVLA 3RN0D 4TZ4A 3F3PA 3EI4A 3RN1D 4H5JA 2IUVA 4PNKB 2AQ5A 5I5JA 3RFHA 3PE7A 4ERZA 5HE2B 5TEEA 4CI3A 3U4YA 5CYKB 3K27A 4E5ZB 4PC0A 2HJ4A 4GGDA 1PBYB 4A11B 2YMUA 3P4FA 3SHFA 4Y7RA 4FB1D 2H9LA 2I0SA 1GXRA 2I0TA 3FM0A 4J82A 4ESGA 4A7JA 4UI9R 1R5MA 3NVXA 4BL0A 1JJUB 2P9NC 4JD2C 4JT5C 4GMBA 2H9NA 3IKOA 3SCYA 3MZLA 3JZNA 4J78A 1NR0A 3OKWA 5C2VB 2J56H 4OZUA 3I8EA 4A0BA 3CFVA 4IA9A 4GZ8A 3RMZD 1YFQA 3EI3B 3C9CA 4GM3A 3BG1A 3IJ1A 4H5IA 2P9LC 4U1EI 3W15A 2H14A 4JT6C 2P9IC 2IWFA 4AOWA 2W18A 4CZXA 2AH1A 5C2WB 2AGZA 2OVRB 5H17A 5FLXg 3ZWLB 3PVUB 4A0AA 5C9ZB 3J80g 5B4WA 1XKSA 3I7OA 2EBSA 2H3XA 4J8BA 4AEZA 3RFGA 5SXMA 1B9YA 3SWSD 4GM8A 4FA4D 4Z8LA 2AGWA 1JMXB 1P22A 2CN3A 2OK6A 3RLMD 5KDOB 3AL8A 3K26A 4A09B 2B5MA 4QL1A 5EMMB 3I7HA 5FKSA 1K8KC 2H6NA 2HJBA 3IJCA 5I5MA 1PEVA 4ERQA 1SHYB 4FWWA 5EMLB 2IAAA 4J81A 2OVPB 2H68A 4JSNC 3JZHA 2O9KA 5CXBA 4J73A 4D0KA 2I3TA 1RI6A 2YNNA 4CZYA 2P9SC 3PSLA 4LGNA 3OL2A 4A08B 3C5MA 2H6QA 3DM0A 1GG2B 3OKTA 4JSPC 5HE1B 3JPXA 3PXWD 2YB8B 4J0XA 3I7PA 4CI2A 2CO0A 3EI4B 4FA5D 5EM2A 4L1QD 4X60B 2Q7QA 4J8GA 3SBRA 5EM2B 2IUQA 3RSEC 4K3JB 3JRPA 3JZGA 2P9PC 3N0EA 3MZKA 3E0CA 4QT8A 3CIKB 5H1MA 3SJLD 4J79A 3KRWB 3DSMA 2MTAH 2J57G 1SQ9A 3I89A 4CI8A 5EAMA 1FWXA 4PXWA 5IC7A 1NEXB 2UZYB 5I5IA 3SBQA 3SVWD 4Y5RD 3I7NA 2IURA 3I7LA 4PSXB 3EWEA 3SLED 1PI6A 2P9KC 2Z2NA 2CE8A 2HXCA 5AFU3 3VA6A 3UKRC 3OKYA 3BG0A 2HYEA 4A0BB 3EU7A 4I79A 4QQEA 3PSCB 2OVQB 5JWZA 3AL9A 2H47A 4FA9D 5A2Qg 4E54A 2BCJB 2G9AA 4OWRA 5EAPA 2Z2PA 5FKQA 4E54B 4X3EA 3IJ0A 2PM7B 3A0FA 4X61B 5CXCA 5IJ8E 4CC9A 1OMWB 2PM9A 5FKTA 5CXCB 2YBAA 4L3HD 4GQBB 4A0AB 5IGOA 4CZVA 3RRMC 4LG9A 3AH8B 4ZOXA 5EMKB 3OTTA 5H14A 5TEFA 3DXKC 4J86A 4J87A 4GQ1A 3JAMg 2HKMA 1PGUA 4BUJC 1GP2B 2IUPA 2UZXB 3AL8B 5FA5B 3I2NA 2AGYA 2CO0C 3EI2A 4GGCA 5GXHA 5IT9g 4X63B 5FQDA 3FRXA 2XL2A 2CN2A 2OJYA 3UR4A 3MKQA 5TDHB 2I3SA 2CE9A 3SMRA 1QNIA 4J0WA 5IJ7E 3IIYA 3VH0A 3EMHA 4L3GD 2B5NA 2GNQA 5CXBB 2Z2OA 3EI1A 3FGBA 5HYNB 3EI1B 3MMYA 2BBKH 2YNPA 3GFCA 5THAA 5GMKn 1S4UX 2I0RA 3OL2B 3MXXA 4FA1D 2OIZA 4ES0A 3N0DA 3DWLC 4GGAA 4O9DA 1U2VC 4PSWB 3PVWB 1MG2A 4CY3A 1VYHC 2XYIA 3B7FA 3CFSB 4U7AA 2PBIB 5FKRA 3ULEC 4XEIC 4YVDA 2GC4A 5TF2A 5AJAA 3JROA 2B5LA 4O3TB 4J77A 1XIPA 5FXYA 4NSXA 3SXTD 4CY5A 5CYKA 4E5ZA 3C75H 3UVOA 5HE3B 3I8CA 3L4MD 5EARA 1JMZB 2P9UC 2H6KA 4A11A 2AGXA 3UVMA 3UVNA 3VGZA 1B9XA 4EWRA 3BWSA 2YNOA 2CNXA 5AMSA 1A0RB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OKY B;  3SFZ A;  4L9O A;  4O3U B;  4D6V A;  3GRE A;  4HDJ A;  3AFC A;  3JB9 L;  1N6E A;  5EMJ B;  4GM9 A;  2QC5 A;  4K3I D;  4CY2 A;  4ZOY A;  2TRC B;  2HKR A;  4MK0 B;  3V7D B;  2OK4 A;  4FAN D;  2PM9 B;  1JOF A;  4JSX C;  3EI3 A;  5GSA A;  5HE0 B;  3DXM C;  3C99 A;  3UKU C;  4LG8 A;  4O1Q D;  4JSV C;  5K19 A;  3F3G A;  4GQ2 P;  4FHL A;  4J84 A;  3SN6 B;  1MG3 A;  3UVK A;  1K32 A;  2PM6 B;  3MKS B;  2GC7 A;  2AGL A;  4O45 A;  1N6F A;  1MDA H;  1N6D A;  1U4C A;  1XHM A;  4XYI A;  4FAV D;  4CI1 A;  3F3F A;  4ERY A;  5HQG A;  4N14 A;  5GXI A;  3HFQ A;  1GOT B;  3J81 g;  3EI2 B;  1TYQ C;  4JXM A;  3V5W B;  4ZN4 A;  3L4O D;  4ZOV A;  1OLZ A;  2H9M A;  4ZOZ A;  3NVQ A;  2HES X;  3ORV D;  4A09 A;  2B4E A;  2XL3 A;  2AH0 A;  3OW8 A;  5EAL A;  2QXV A;  4QRJ A;  2H9P A;  4XYH A;  4A2L A;  4CY1 A;  4BH6 A;  1L0Q A;  4A2M A;  3I7K A;  2G99 A;  3NVN A;  3EG6 A;  5IGQ A;  2H13 A;  4PBY A;  5K1C C;  1TBG A;  1ERJ A;  3SBP A;  4KFM B;  4PBZ A;  4G56 B;  3V9F A;  2XU7 A;  2IWK A;  3IIW A;  1Q47 A;  3ODT A;  4R7A B;  1SQJ A;  3PXT D;  3PXS D;  4IMM A;  3KRX B;  4A08 A;  2J55 H;  3UVL A;  3RN0 D;  4TZ4 A;  3F3P A;  3EI4 A;  3RN1 D;  4H5J A;  2IUV A;  4PNK B;  2AQ5 A;  5I5J A;  3RFH A;  3PE7 A;  4ERZ A;  5HE2 B;  5TEE A;  4CI3 A;  3U4Y A;  5CYK B;  3K27 A;  4E5Z B;  4PC0 A;  2HJ4 A;  4GGD A;  1PBY B;  4A11 B;  2YMU A;  3P4F A;  3SHF A;  4Y7R A;  4FB1 D;  2H9L A;  2I0S A;  1GXR A;  2I0T A;  3FM0 A;  4J82 A;  4ESG A;  4A7J A;  4UI9 R;  1R5M A;  3NVX A;  4BL0 A;  1JJU B;  2P9N C;  4JD2 C;  4JT5 C;  4GMB A;  2H9N A;  3IKO A;  3SCY A;  3MZL A;  3JZN A;  4J78 A;  1NR0 A;  3OKW A;  5C2V B;  2J56 H;  4OZU A;  3I8E A;  4A0B A;  3CFV A;  4IA9 A;  4GZ8 A;  3RMZ D;  1YFQ A;  3EI3 B;  3C9C A;  4GM3 A;  3BG1 A;  3IJ1 A;  4H5I A;  2P9L C;  4U1E I;  3W15 A;  2H14 A;  4JT6 C;  2P9I C;  2IWF A;  4AOW A;  2W18 A;  4CZX A;  2AH1 A;  5C2W B;  2AGZ A;  2OVR B;  5H17 A;  5FLX g;  3ZWL B;  3PVU B;  4A0A A;  5C9Z B;  3J80 g;  5B4W A;  1XKS A;  3I7O A;  2EBS A;  2H3X A;  4J8B A;  4AEZ A;  3RFG A;  5SXM A;  1B9Y A;  3SWS D;  4GM8 A;  4FA4 D;  4Z8L A;  2AGW A;  1JMX B;  1P22 A;  2CN3 A;  2OK6 A;  3RLM D;  5KDO B;  3AL8 A;  3K26 A;  4A09 B;  2B5M A;  4QL1 A;  5EMM B;  3I7H A;  5FKS A;  1K8K C;  2H6N A;  2HJB A;  3IJC A;  5I5M A;  1PEV A;  4ERQ A;  1SHY B;  4FWW A;  5EML B;  2IAA A;  4J81 A;  2OVP B;  2H68 A;  4JSN C;  3JZH A;  2O9K A;  5CXB A;  4J73 A;  4D0K A;  2I3T A;  1RI6 A;  2YNN A;  4CZY A;  2P9S C;  3PSL A;  4LGN A;  3OL2 A;  4A08 B;  3C5M A;  2H6Q A;  3DM0 A;  1GG2 B;  3OKT A;  4JSP C;  5HE1 B;  3JPX A;  3PXW D;  2YB8 B;  4J0X A;  3I7P A;  4CI2 A;  2CO0 A;  3EI4 B;  4FA5 D;  5EM2 A;  4L1Q D;  4X60 B;  2Q7Q A;  4J8G A;  3SBR A;  5EM2 B;  2IUQ A;  3RSE C;  4K3J B;  3JRP A;  3JZG A;  2P9P C;  3N0E A;  3MZK A;  3E0C A;  4QT8 A;  3CIK B;  5H1M A;  3SJL D;  4J79 A;  3KRW B;  3DSM A;  2MTA H;  2J57 G;  1SQ9 A;  3I89 A;  4CI8 A;  5EAM A;  1FWX A;  4PXW A;  5IC7 A;  1NEX B;  2UZY B;  5I5I A;  3SBQ A;  3SVW D;  4Y5R D;  3I7N A;  2IUR A;  3I7L A;  4PSX B;  3EWE A;  3SLE D;  1PI6 A;  2P9K C;  2Z2N A;  2CE8 A;  2HXC A;  5AFU 3;  3VA6 A;  3UKR C;  3OKY A;  3BG0 A;  2HYE A;  4A0B B;  3EU7 A;  4I79 A;  4QQE A;  3PSC B;  2OVQ B;  5JWZ A;  3AL9 A;  2H47 A;  4FA9 D;  5A2Q g;  4E54 A;  2BCJ B;  2G9A A;  4OWR A;  5EAP A;  2Z2P A;  5FKQ A;  4E54 B;  4X3E A;  3IJ0 A;  2PM7 B;  3A0F A;  4X61 B;  5CXC A;  5IJ8 E;  4CC9 A;  1OMW B;  2PM9 A;  5FKT A;  5CXC B;  2YBA A;  4L3H D;  4GQB B;  4A0A B;  5IGO A;  4CZV A;  3RRM C;  4LG9 A;  3AH8 B;  4ZOX A;  5EMK B;  3OTT A;  5H14 A;  5TEF A;  3DXK C;  4J86 A;  4J87 A;  4GQ1 A;  3JAM g;  2HKM A;  1PGU A;  4BUJ C;  1GP2 B;  2IUP A;  2UZX B;  3AL8 B;  5FA5 B;  3I2N A;  2AGY A;  2CO0 C;  3EI2 A;  4GGC A;  5GXH A;  5IT9 g;  4X63 B;  5FQD A;  3FRX A;  2XL2 A;  2CN2 A;  2OJY A;  3UR4 A;  3MKQ A;  5TDH B;  2I3S A;  2CE9 A;  3SMR A;  1QNI A;  4J0W A;  5IJ7 E;  3IIY A;  3VH0 A;  3EMH A;  4L3G D;  2B5N A;  2GNQ A;  5CXB B;  2Z2O A;  3EI1 A;  3FGB A;  5HYN B;  3EI1 B;  3MMY A;  2BBK H;  2YNP A;  3GFC A;  5THA A;  5GMK n;  1S4U X;  2I0R A;  3OL2 B;  3MXX A;  4FA1 D;  2OIZ A;  4ES0 A;  3N0D A;  3DWL C;  4GGA A;  4O9D A;  1U2V C;  4PSW B;  3PVW B;  1MG2 A;  4CY3 A;  1VYH C;  2XYI A;  3B7F A;  3CFS B;  4U7A A;  2PBI B;  5FKR A;  3ULE C;  4XEI C;  4YVD A;  2GC4 A;  5TF2 A;  5AJA A;  3JRO A;  2B5L A;  4O3T B;  4J77 A;  1XIP A;  5FXY A;  4NSX A;  3SXT D;  4CY5 A;  5CYK A;  4E5Z A;  3C75 H;  3UVO A;  5HE3 B;  3I8C A;  3L4M D;  5EAR A;  1JMZ B;  2P9U C;  2H6K A;  4A11 A;  2AGX A;  3UVM A;  3UVN A;  3VGZ A;  1B9X A;  4EWR A;  3BWS A;  2YNO A;  2CNX A;  5AMS A;  1A0R B; 
#chains in the Genus database with same CATH topology
 3OKY B;  3SFZ A;  4L9O A;  4O3U B;  4D6V A;  2HU5 A;  3GRE A;  4WK2 A;  1VE6 A;  3GD1 I;  4HDJ A;  3AFC A;  3JB9 L;  1N6E A;  4NEN A;  5EMJ B;  4GM9 A;  2QC5 A;  4K3I D;  3KCI A;  4CY2 A;  3EQ9 A;  4ZOY A;  2TRC B;  5M61 A;  2HKR A;  4MK0 B;  3V7D B;  2OK4 A;  4FAN D;  2PM9 B;  1JOF A;  4JSX C;  3EI3 A;  5C92 A;  5GSA A;  3FCU A;  3T3P A;  5HE0 B;  3DXM C;  3C99 A;  3UKU C;  4LG8 A;  4O02 A;  4O1Q D;  4JSV C;  3GC3 B;  5K19 A;  3F3G A;  1H2W A;  3IUQ A;  4GQ2 P;  4FHL A;  4J84 A;  3SN6 B;  1MG3 A;  2QZP A;  3UVK A;  1QFM A;  1K32 A;  2PM6 B;  3IUR A;  3MKS B;  2GC7 A;  2AGL A;  4O45 A;  1N6F A;  1MDA H;  1N6D A;  1U4C A;  4WK0 A;  1XHM A;  4XYI A;  3NID A;  2VDL A;  4FAV D;  2VZ3 A;  4CI1 A;  3F3F A;  4ERY A;  5HQG A;  4N14 A;  5GXI A;  2HU8 A;  3HFQ A;  1GOT B;  1JTD B;  3J81 g;  3EI2 B;  1TYQ C;  4JXM A;  3V5W B;  4ZN4 A;  3L4O D;  4ZOV A;  3IJE A;  1OLZ A;  4IRZ A;  2H9M A;  4ZOZ A;  1O6G A;  3NVQ A;  2HES X;  3ORV D;  4A09 A;  2B4E A;  2XL3 A;  2AH0 A;  3OW8 A;  4JHP C;  5EAL A;  2QXV A;  4QRJ A;  2H9P A;  4XYH A;  4A2L A;  4CY1 A;  4BH6 A;  1L0Q A;  4BP9 A;  4A2M A;  3I7K A;  2G99 A;  4BCD A;  3NVN A;  2EIE A;  3EG6 A;  3T3M A;  5IGQ A;  2H13 A;  4PBY A;  3MVD K;  5K1C C;  1TBG A;  1ERJ A;  3SBP A;  4KFM B;  4PBZ A;  4G56 B;  3V9F A;  5M5U A;  2XU7 A;  1GOG A;  2IWK A;  1E8N A;  3IIW A;  1Q47 A;  3ODT A;  3QHY B;  4R7A B;  1SQJ A;  3PXT D;  1BPO A;  3PXS D;  2VZ1 A;  4IMM A;  4WK4 A;  3KRX B;  4A08 A;  2J55 H;  1M1X A;  3UVL A;  3RN0 D;  4AMZ A;  3K71 A;  4TZ4 A;  3F3P A;  4UM9 A;  3EI4 A;  4DNU A;  3RN1 D;  4H5J A;  2IUV A;  4PNK B;  4NBM A;  2AQ5 A;  5I5J A;  3RFH A;  3DDU A;  4WJK A;  3O4G A;  2EID A;  3PE7 A;  3K72 A;  4ERZ A;  5HE2 B;  5TEE A;  3O4H A;  4CI3 A;  3U4Y A;  5CYK B;  3K27 A;  4E5Z B;  4PC0 A;  2HJ4 A;  1UOO A;  2XDW A;  4GGD A;  3ZDZ A;  1PBY B;  4A11 B;  2YMU A;  3P4F A;  3IUL A;  4NAA A;  3SHF A;  4NC4 A;  2VDR A;  4Y7R A;  4RE5 A;  4FB1 D;  2H9L A;  1E5T A;  2I0S A;  1GXR A;  2I0T A;  3FM0 A;  4J82 A;  4ESG A;  4A7J A;  4UI9 R;  4MMY A;  1R5M A;  3NVX A;  4BL0 A;  1JJU B;  2P9N C;  4JD2 C;  4JT5 C;  4GMB A;  2H9N A;  3IKO A;  3SCY A;  3MZL A;  3JZN A;  4J78 A;  1NR0 A;  2VDK A;  3OKW A;  4G1M A;  5C2V B;  2JKX A;  2J56 H;  4OZU A;  3I8E A;  4A0B A;  2EIC A;  3CFV A;  4IA9 A;  4GZ8 A;  4MMZ A;  3RMZ D;  1YFQ A;  3EI3 B;  3C9C A;  4GM3 A;  3BG1 A;  1U8C A;  3IJ1 A;  4H5I A;  2P9L C;  5C86 A;  4U1E I;  3W15 A;  2H14 A;  1GOF A;  2P9I C;  2VDO A;  4JT6 C;  2IWF A;  3O4I A;  4RE6 A;  4AOW A;  2W18 A;  4G1E A;  4CZX A;  2AH1 A;  1YR2 A;  4D9S A;  4O2W A;  5C2W B;  2AGZ A;  2OVR B;  5H17 A;  5FLX g;  3ZWL B;  3PVU B;  4Z7N A;  4A0A A;  5M5R A;  5M5V A;  5C9Z B;  3J80 g;  5B4W A;  1XKS A;  3I7O A;  2EBS A;  2H3X A;  4J8B A;  4AEZ A;  4DNV A;  3NIG A;  3RFG A;  5SXM A;  1B9Y A;  3IUJ A;  3SWS D;  4GM8 A;  4FA4 D;  4Z8L A;  2AGW A;  4G55 A;  4AX4 A;  1JMX B;  1P22 A;  2CN3 A;  1H2X A;  2OK6 A;  5E6S A;  3RLM D;  4BCC A;  5KDO B;  3AL8 A;  3K6S A;  3ZDX A;  3K26 A;  4A09 B;  2B5M A;  4QL1 A;  5EMM B;  1VZ3 A;  3I7H A;  2QR5 A;  5FKS A;  1K8K C;  2H6N A;  2HJB A;  3IJC A;  5I5M A;  1PEV A;  3OF7 A;  5M5S A;  4ERQ A;  1SHY B;  4FWW A;  5EML B;  2IAA A;  4J81 A;  2OVP B;  1L5G A;  1JV2 A;  1A12 A;  2H68 A;  1C9L A;  4JSN C;  1C9I A;  3JZH A;  2O9K A;  5CXB A;  3ZDY A;  4J73 A;  4D0K A;  2I3T A;  1T2X A;  1RI6 A;  2YNN A;  1VE7 A;  3FCS A;  4CZY A;  2P9S C;  3PSL A;  4LGN A;  3OL2 A;  4A08 B;  3C5M A;  2H6Q A;  2HU7 A;  1GG2 B;  3DM0 A;  3OKT A;  4JSP C;  5HE1 B;  3JPX A;  3MUO A;  3PXW D;  2VC2 A;  2YB8 B;  4J0X A;  3I7P A;  4CI2 A;  2CO0 A;  3EI4 B;  5FFG A;  4FA5 D;  5EM2 A;  4L1Q D;  4X60 B;  2Q7Q A;  4J8G A;  3SBR A;  5EM2 B;  2IUQ A;  3RSE C;  3QI0 A;  4K3J B;  3JRP A;  3JZG A;  2P9P C;  3VI4 A;  3N0E A;  3MZK A;  4L1M A;  4Z7Q A;  3E0C A;  4QT8 A;  3CIK B;  5H1M A;  4AMY A;  3SJL D;  4J79 A;  3KRW B;  3DSM A;  2MTA H;  2J57 G;  1H2Y A;  1SQ9 A;  3MUN A;  3I89 A;  4CI8 A;  5EAM A;  1FWX A;  4PXW A;  5IC7 A;  1NEX B;  2UZY B;  3EQ8 A;  5I5I A;  3SBQ A;  3SVW D;  4Y5R D;  3I7N A;  1E8M A;  2IUR A;  3I7L A;  4AN0 A;  4PSX B;  2VDN A;  3EWE A;  3SLE D;  3VI3 A;  1PI6 A;  2P9K C;  2VDQ A;  2Z2N A;  2CE8 A;  1K3I A;  2HXC A;  5AFU 3;  1UOP A;  3VA6 A;  2XZG A;  3UKR C;  3OKY A;  2EIB A;  3BG0 A;  2HYE A;  4A0B B;  3EU7 A;  4I79 A;  4QQE A;  3PSC B;  3V4V A;  2OVQ B;  5JWZ A;  3AL9 A;  2H47 A;  4FA9 D;  5A2Q g;  4E54 A;  2BCJ B;  2G9A A;  4JHN A;  4OWR A;  5EAP A;  2Z2P A;  5FKQ A;  3V4P A;  4E54 B;  1UOQ A;  1UTC A;  3IUN A;  4X3E A;  4Z7O A;  3O4J A;  3IJ0 A;  2PM7 B;  3A0F A;  4X61 B;  5CXC A;  5IJ8 E;  4CC9 A;  1OMW B;  2PM9 A;  5FKT A;  5CXC B;  2YBA A;  4L3H D;  4GQB B;  4A0A B;  5IGO A;  4UM8 A;  3ZE0 A;  4BCB A;  3RRM C;  4CZV A;  4LG9 A;  3AH8 B;  4ZOX A;  1O6F A;  3IVM A;  5EMK B;  3OTT A;  4QAM A;  5H14 A;  5TEF A;  3DXK C;  4J86 A;  4J87 A;  4GQ1 A;  3JAM g;  2HKM A;  1PGU A;  4BUJ C;  1GP2 B;  2IUP A;  2UZX B;  3AL8 B;  5FA5 B;  4MMX A;  3I2N A;  2BKL A;  2AGY A;  2CO0 C;  3EI2 A;  4GGC A;  5GXH A;  5IT9 g;  4X63 B;  1H2Z A;  5FQD A;  2WQ8 A;  3FRX A;  1VZ2 A;  2CN2 A;  2XL2 A;  2OJY A;  1TYE A;  3UR4 A;  3MKQ A;  5HDB A;  5TDH B;  2I3S A;  2CE9 A;  3EQ7 A;  3SMR A;  4BP8 A;  1QNI A;  4J0W A;  5IJ7 E;  1QFS A;  3IIY A;  3VH0 A;  3EMH A;  4L3G D;  2B5N A;  2GNQ A;  5CXB B;  2Z2O A;  3EI1 A;  3FGB A;  5HYN B;  3EI1 B;  3IUM A;  3MMY A;  2BBK H;  2YNP A;  3GFC A;  5THA A;  1I2M B;  1S4U X;  2I0R A;  3OL2 B;  5GMK n;  3MXX A;  4FA1 D;  1GOH A;  2OIZ A;  3ZE2 A;  4ES0 A;  3N0D A;  3DWL C;  4GGA A;  4O9D A;  1U2V C;  4PSW B;  3PVW B;  4AN1 A;  1MG2 A;  4CY3 A;  1VYH C;  2XYI A;  2VDP A;  3B7F A;  3CFS B;  4U7A A;  2PBI B;  5FKR A;  3ULE C;  4XEI C;  4YVD A;  2GC4 A;  5TF2 A;  5AJA A;  3JRO A;  2B5L A;  2XE4 A;  5E6R A;  4O3T B;  4DNW A;  4J77 A;  1XIP A;  5FXY A;  4NSX A;  3SXT D;  4CY5 A;  5CYK A;  4E5Z A;  3C75 H;  3UVO A;  3NIF A;  5E6U A;  5FFO A;  5HE3 B;  3I8C A;  3L4M D;  5EAR A;  5M5T A;  1JMZ B;  2P9U C;  2H6K A;  4A11 A;  2AGX A;  3UVM A;  3UVN A;  3VGZ A;  2VDM A;  1B9X A;  4EWR A;  3BWS A;  2YNO A;  3ZE1 A;  2CNX A;  5AMS A;  1A0R B; 
#chains in the Genus database with same CATH homology
 3OKY B;  3SFZ A;  4L9O A;  4O3U B;  4D6V A;  3GRE A;  4HDJ A;  3AFC A;  3JB9 L;  1N6E A;  5EMJ B;  4GM9 A;  2QC5 A;  4K3I D;  4CY2 A;  4ZOY A;  2TRC B;  2HKR A;  4MK0 B;  3V7D B;  2OK4 A;  4FAN D;  2PM9 B;  1JOF A;  4JSX C;  3EI3 A;  5GSA A;  5HE0 B;  3DXM C;  3C99 A;  3UKU C;  4LG8 A;  4O1Q D;  4JSV C;  5K19 A;  3F3G A;  4GQ2 P;  4FHL A;  4J84 A;  3SN6 B;  1MG3 A;  3UVK A;  1K32 A;  2PM6 B;  3MKS B;  2GC7 A;  2AGL A;  4O45 A;  1N6F A;  1MDA H;  1N6D A;  1U4C A;  1XHM A;  4XYI A;  4FAV D;  4CI1 A;  3F3F A;  4ERY A;  5HQG A;  4N14 A;  5GXI A;  3HFQ A;  1GOT B;  3J81 g;  3EI2 B;  1TYQ C;  4JXM A;  3V5W B;  4ZN4 A;  3L4O D;  4ZOV A;  1OLZ A;  2H9M A;  4ZOZ A;  3NVQ A;  2HES X;  3ORV D;  4A09 A;  2B4E A;  2XL3 A;  2AH0 A;  3OW8 A;  5EAL A;  2QXV A;  4QRJ A;  2H9P A;  4XYH A;  4A2L A;  4CY1 A;  4BH6 A;  1L0Q A;  4A2M A;  3I7K A;  2G99 A;  3NVN A;  3EG6 A;  5IGQ A;  2H13 A;  4PBY A;  5K1C C;  1TBG A;  1ERJ A;  3SBP A;  4KFM B;  4PBZ A;  4G56 B;  3V9F A;  2XU7 A;  2IWK A;  3IIW A;  1Q47 A;  3ODT A;  4R7A B;  1SQJ A;  3PXT D;  3PXS D;  4IMM A;  3KRX B;  4A08 A;  2J55 H;  3UVL A;  3RN0 D;  4TZ4 A;  3F3P A;  3EI4 A;  3RN1 D;  4H5J A;  2IUV A;  4PNK B;  2AQ5 A;  5I5J A;  3RFH A;  3PE7 A;  4ERZ A;  5HE2 B;  5TEE A;  4CI3 A;  3U4Y A;  5CYK B;  3K27 A;  4E5Z B;  4PC0 A;  2HJ4 A;  4GGD A;  1PBY B;  4A11 B;  2YMU A;  3P4F A;  3SHF A;  4Y7R A;  4FB1 D;  2H9L A;  2I0S A;  1GXR A;  2I0T A;  3FM0 A;  4J82 A;  4ESG A;  4A7J A;  4UI9 R;  1R5M A;  3NVX A;  4BL0 A;  1JJU B;  2P9N C;  4JD2 C;  4JT5 C;  4GMB A;  2H9N A;  3IKO A;  3SCY A;  3MZL A;  3JZN A;  4J78 A;  1NR0 A;  3OKW A;  5C2V B;  2J56 H;  4OZU A;  3I8E A;  4A0B A;  3CFV A;  4IA9 A;  4GZ8 A;  3RMZ D;  1YFQ A;  3EI3 B;  3C9C A;  4GM3 A;  3BG1 A;  3IJ1 A;  4H5I A;  2P9L C;  4U1E I;  3W15 A;  2H14 A;  4JT6 C;  2P9I C;  2IWF A;  4AOW A;  2W18 A;  4CZX A;  2AH1 A;  5C2W B;  2AGZ A;  2OVR B;  5H17 A;  5FLX g;  3ZWL B;  3PVU B;  4A0A A;  5C9Z B;  3J80 g;  5B4W A;  1XKS A;  3I7O A;  2EBS A;  2H3X A;  4J8B A;  4AEZ A;  3RFG A;  5SXM A;  1B9Y A;  3SWS D;  4GM8 A;  4FA4 D;  4Z8L A;  2AGW A;  1JMX B;  1P22 A;  2CN3 A;  2OK6 A;  3RLM D;  5KDO B;  3AL8 A;  3K26 A;  4A09 B;  2B5M A;  4QL1 A;  5EMM B;  3I7H A;  5FKS A;  1K8K C;  2H6N A;  2HJB A;  3IJC A;  5I5M A;  1PEV A;  4ERQ A;  1SHY B;  4FWW A;  5EML B;  2IAA A;  4J81 A;  2OVP B;  2H68 A;  4JSN C;  3JZH A;  2O9K A;  5CXB A;  4J73 A;  4D0K A;  2I3T A;  1RI6 A;  2YNN A;  4CZY A;  2P9S C;  3PSL A;  4LGN A;  3OL2 A;  4A08 B;  3C5M A;  2H6Q A;  3DM0 A;  1GG2 B;  3OKT A;  4JSP C;  5HE1 B;  3JPX A;  3PXW D;  2YB8 B;  4J0X A;  3I7P A;  4CI2 A;  2CO0 A;  3EI4 B;  4FA5 D;  5EM2 A;  4L1Q D;  4X60 B;  2Q7Q A;  4J8G A;  3SBR A;  5EM2 B;  2IUQ A;  3RSE C;  4K3J B;  3JRP A;  3JZG A;  2P9P C;  3N0E A;  3MZK A;  3E0C A;  4QT8 A;  3CIK B;  5H1M A;  3SJL D;  4J79 A;  3KRW B;  3DSM A;  2MTA H;  2J57 G;  1SQ9 A;  3I89 A;  4CI8 A;  5EAM A;  1FWX A;  4PXW A;  5IC7 A;  1NEX B;  2UZY B;  5I5I A;  3SBQ A;  3SVW D;  4Y5R D;  3I7N A;  2IUR A;  3I7L A;  4PSX B;  3EWE A;  3SLE D;  1PI6 A;  2P9K C;  2Z2N A;  2CE8 A;  2HXC A;  5AFU 3;  3VA6 A;  3UKR C;  3OKY A;  3BG0 A;  2HYE A;  4A0B B;  3EU7 A;  4I79 A;  4QQE A;  3PSC B;  2OVQ B;  5JWZ A;  3AL9 A;  2H47 A;  4FA9 D;  5A2Q g;  4E54 A;  2BCJ B;  2G9A A;  4OWR A;  5EAP A;  2Z2P A;  5FKQ A;  4E54 B;  4X3E A;  3IJ0 A;  2PM7 B;  3A0F A;  4X61 B;  5CXC A;  5IJ8 E;  4CC9 A;  1OMW B;  2PM9 A;  5FKT A;  5CXC B;  2YBA A;  4L3H D;  4GQB B;  4A0A B;  5IGO A;  4CZV A;  3RRM C;  4LG9 A;  3AH8 B;  4ZOX A;  5EMK B;  3OTT A;  5H14 A;  5TEF A;  3DXK C;  4J86 A;  4J87 A;  4GQ1 A;  3JAM g;  2HKM A;  1PGU A;  4BUJ C;  1GP2 B;  2IUP A;  2UZX B;  3AL8 B;  5FA5 B;  3I2N A;  2AGY A;  2CO0 C;  3EI2 A;  4GGC A;  5GXH A;  5IT9 g;  4X63 B;  5FQD A;  3FRX A;  2XL2 A;  2CN2 A;  2OJY A;  3UR4 A;  3MKQ A;  5TDH B;  2I3S A;  2CE9 A;  3SMR A;  1QNI A;  4J0W A;  5IJ7 E;  3IIY A;  3VH0 A;  3EMH A;  4L3G D;  2B5N A;  2GNQ A;  5CXB B;  2Z2O A;  3EI1 A;  3FGB A;  5HYN B;  3EI1 B;  3MMY A;  2BBK H;  2YNP A;  3GFC A;  5THA A;  5GMK n;  1S4U X;  2I0R A;  3OL2 B;  3MXX A;  4FA1 D;  2OIZ A;  4ES0 A;  3N0D A;  3DWL C;  4GGA A;  4O9D A;  1U2V C;  4PSW B;  3PVW B;  1MG2 A;  4CY3 A;  1VYH C;  2XYI A;  3B7F A;  3CFS B;  4U7A A;  2PBI B;  5FKR A;  3ULE C;  4XEI C;  4YVD A;  2GC4 A;  5TF2 A;  5AJA A;  3JRO A;  2B5L A;  4O3T B;  4J77 A;  1XIP A;  5FXY A;  4NSX A;  3SXT D;  4CY5 A;  5CYK A;  4E5Z A;  3C75 H;  3UVO A;  5HE3 B;  3I8C A;  3L4M D;  5EAR A;  1JMZ B;  2P9U C;  2H6K A;  4A11 A;  2AGX A;  3UVM A;  3UVN A;  3VGZ A;  1B9X A;  4EWR A;  3BWS A;  2YNO A;  2CNX A;  5AMS A;  1A0R B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...