2CE8A

An eh1 peptide bound to the groucho-tle wd40 domain.
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
337
structure length
337
Chain Sequence
DYFQGAMGSKPAYSFHVTADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSDUCIN-LIKE ENHANCER PROTEIN 1
publication title Molecular Recognition of Transcriptional Repressor Motifs by the Wd Domain of the Groucho/Tle Corepressor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulation
total genus 85
structure length 337
sequence length 337
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ce8A00
1YFQA 3I8CA 3ODTA 2J56H 4OWRA 2PM6B 2OK4A 4FHLA 4PSWB 2UZYB 4A11A 1U2VC 4FA4D 3FGBA 3I7LA 4CY1A 5AFU3 4H5IA 2H13A 4PBYA 5EMMB 3NVXA 3E0CA 1XKSA 5EMJB 3KRXB 1NR0A 4J79A 3K26A 3AFCA 3SLED 3EI1A 1TBGA 1GG2B 4L9OA 3U4YA 1L0QA 3RRMC 3ZWLB 5TEEA 3CFVA 3SBRA 2PM9A 3OKYB 2B4EA 2CN2A 4G56B 3V5WB 3PE7A 3NVQA 4U1EI 5KDOB 3IJ1A 4GM8A 3DWLC 5EARA 4QL1A 3BWSA 3MKQA 5CYKB 4BH6A 3VGZA 2BCJB 2P9LC 3OW8A 3N0DA 3I89A 4CZYA 1JJUB 4NSXA 3AL8B 3EI4A 3OKTA 4QRJA 2G9AA 4A09A 1ERJA 3JPXA 2O9KA 5HE2B 3RFHA 3PXTD 3JZGA 1K32A 2CO0C 4E54B 4GM3A 3I7OA 3SWSD 4CI3A 3MMYA 1P22A 2OVRB 3ORVD 2P9UC 4A2LA 2I0SA 3ULEC 2Z2OA 1NEXB 4K3JB 4A08B 4FAVD 4CZVA 4E5ZA 1N6FA 4LGNA 4ZOVA 3C99A 5GXHA 5GXIA 3B7FA 4ESGA 4R7AB 3SCYA 1B9XA 4LG9A 4FWWA 5CXCB 2OIZA 5FLXg 4ZN4A 3OTTA 4CC9A 2MTAH 4L3HD 4J0WA 5C2WB 3SXTD 4FAND 5GMKn 4J73A 4AEZA 3EI3B 3EWEA 4MK0B 1A0RB 5B4WA 3RSEC 4GQBB 1GXRA 4KFMB 3RMZD 2B5NA 3P4FA 4JT5C 1N6EA 2P9SC 5I5MA 3UKUC 4EWRA 4JXMA 4Z8LA 4CY2A 2H6KA 4J77A 5AJAA 4ZOXA 4FA5D 3UVMA 3JROA 3DSMA 4J0XA 5EAPA 2PBIB 2P9KC 2YB8B 4H5JA 3FRXA 1R5MA 4ZOZA 4X3EA 5JWZA 3PSCB 2OJYA 5FKRA 4GGCA 4L3GD 4N14A 5CYKA 3CIKB 1N6DA 2J55H 4X61B 2Z2NA 2W18A 2Z2PA 3NVNA 4J8BA 4O3UB 1PEVA 3IJ0A 2IAAA 1MDAH 3EI2B 3OL2B 5AMSA 2P9PC 5CXBB 4E54A 4JSPC 3UKRC 4FA9D 2HYEA 1TYQC 4QT8A 3GREA 3I7NA 3I7KA 3EG6A 1MG3A 5HE1B 5K19A 2AQ5A 2H47A 2I0TA 4J8GA 2YNPA 5HE0B 5IGQA 4ERYA 4A0BB 4A0AB 3IIYA 4A08A 3AL9A 4ERQA 3DXMC 3BG1A 4YVDA 2GNQA 2IUQA 3F3GA 2XU7A 1U4CA 3HFQA 5FKSA 3JZNA 4L1QD 4AOWA 2H3XA 3GFCA 5CXCA 3V7DB 3MXXA 5C9ZB 4CY3A 1SQ9A 2H9MA 2H6NA 2GC4A 5I5JA 4X63B 3VA6A 5EM2B 4J84A 3N0EA 4PC0A 2P9IC 1K8KC 2OVQB 3EI3A 1JMZB 2HKRA 1OLZA 4BL0A 4PSXB 5C2VB 1Q47A 3F3PA 2YBAA 2XYIA 2H68A 3JAMg 3OKWA 2HXCA 2CE9A 4U7AA 4IMMA 2Q7QA 1B9YA 3EI1B 4D6VA 3SHFA 4IA9A 4LG8A 3C5MA 2B5MA 5EAMA 4PXWA 3RLMD 3C9CA 2IURA 2J57G 3I7PA 4GGAA 1XHMA 2IUVA 3OL2A 3DM0A 5IT9g 2IWKA 5EMLB 4CI2A 4JSNC 3BG0A 4BUJC 3A0FA 2OVPB 2XL2A 5IJ7E 1QNIA 3JRPA 4QQEA 4UI9R 4O3TB 2GC7A 5GSAA 1JOFA 3IJCA 3UVKA 4J82A 3JB9L 4O9DA 3EMHA 4FA1D 4CI1A 4A0BA 3OKYA 3RFGA 4A0AA 5A2Qg 3F3FA 2P9NC 3I2NA 2CO0A 2TRCB 4X60B 4GQ1A 3SBQA 3UVNA 5SXMA 2YNOA 2H9NA 5HYNB 5IGOA 1RI6A 3AL8A 2AH0A 2AH1A 5HE3B 5FKQA 4O1QD 4GMBA 5EM2A 3EU7A 4XYIA 4J81A 5FXYA 3L4MD 3MZLA 1VYHC 2H9LA 2CNXA 2AGXA 3PVUB 4A7JA 5FQDA 4Y7RA 1XIPA 2EBSA 2HESX 2AGWA 4CY5A 4CZXA 1S4UX 3DXKC 2PM7B 5IC7A 1PGUA 4PBZA 5TF2A 4Y5RD 5EMKB 3SBPA 5H17A 2CN3A 3IIWA 4J87A 3VH0A 3RN0D 2IUPA 4JSVC 5I5IA 2HJBA 4GQ2P 4GGDA 1MG2A 3W15A 4XYHA 3UVOA 3AH8B 4HDJA 3SN6B 1GOTB 4A11B 2G99A 5H14A 4ES0A 2B5LA 5TDHB 3SFZA 3SVWD 3V9FA 5H1MA 3PXWD 3C75H 3I8EA 2I3SA 4ERZA 5K1CC 3FM0A 4O45A 3PXSD 3K27A 4K3ID 4J86A 5THAA 2PM9B 4J78A 5EALA 2AGZA 4OZUA 5IJ8E 3PVWB 2UZXB 3RN1D 3JZHA 2AGLA 1PI6A 3EI2A 4GZ8A 4FB1D 5CXBA 2IWFA 2XL3A 2BBKH 5FKTA 3MZKA 4D0KA 3UVLA 3PSLA 2HKMA 2QC5A 5FA5B 3MKSB 4PNKB 1FWXA 2YMUA 2CE8A 4JT6C 3EI4B 4A09B 4ZOYA 1OMWB 4TZ4A 2OK6A 4A2MA 3SMRA 1SHYB 1PBYB 4JD2C 4I79A 2I0RA 2HJ4A 2I3TA 3IKOA 3I7HA 3L4OD 2QXVA 3CFSB 5TEFA 1JMXB 4GM9A 3J81g 3J80g 2H14A 4XEIC 4E5ZB 3SJLD 3KRWB 3UR4A 2H9PA 2H6QA 5HQGA 1GP2B 2YNNA 4JSXC 4CI8A 2AGYA 1SQJA
chains in the Genus database with same CATH superfamily
1YFQA 3I8CA 4WK4A 1VZ3A 3NIFA 4UM9A 3ODTA 2J56H 4OWRA 2PM6B 2OK4A 2JKXA 4FHLA 4PSWB 2UZYB 4A11A 1U2VC 4FA4D 3FGBA 3I7LA 4CY1A 5AFU3 4H5IA 2H13A 4PBYA 1L5GA 5EMMB 3NVXA 3E0CA 1XKSA 5EMJB 3KRXB 1GOHA 1NR0A 4J79A 3K26A 3AFCA 3SLED 3EI1A 1O6GA 1TBGA 3EQ8A 3MVDK 1GG2B 5C86A 4L9OA 3U4YA 1L0QA 3RRMC 3ZWLB 4JHNA 5TEEA 3IURA 3CFVA 3SBRA 2PM9A 3OKYB 4BCDA 2B4EA 2CN2A 2EICA 4G56B 3V5WB 3PE7A 3NVQA 4U1EI 5KDOB 4BP8A 3IJ1A 5E6RA 4GM8A 3DWLC 4Z7OA 5EARA 4QL1A 3BWSA 3MKQA 5CYKB 4BH6A 1VE6A 3VGZA 2BCJB 2P9LC 3OW8A 3N0DA 4DNVA 3I89A 4CZYA 1JJUB 4NSXA 3AL8B 3EI4A 3OKTA 4QRJA 2EIEA 2G9AA 4A09A 1ERJA 3JPXA 2O9KA 5HE2B 3RFHA 3PXTD 3JZGA 4WK2A 1K32A 2CO0C 4E54B 1GOGA 3OF7A 4GM3A 3I7OA 3ZE1A 3SWSD 4CI3A 3MMYA 1P22A 2OVRB 3ORVD 2P9UC 4AX4A 4A2LA 2I0SA 3ULEC 4UM8A 2Z2OA 1NEXB 4K3JB 4A08B 4FAVD 4CZVA 4E5ZA 1N6FA 4JHPC 1O6FA 4LGNA 4ZOVA 3C99A 5GXHA 5GXIA 3B7FA 1VE7A 4AN1A 5FFGA 4ESGA 5FFOA 4R7AB 3SCYA 3DDUA 5E6SA 2HU7A 1B9XA 1A12A 4LG9A 3ZE2A 4FWWA 5CXCB 2OIZA 5FLXg 4ZN4A 3OTTA 3NIGA 4CC9A 4AMYA 2VDLA 2XE4A 2MTAH 4L3HD 4J0WA 1GOFA 3FCSA 5C2WB 3SXTD 4FAND 2VDRA 5GMKn 4J73A 4AEZA 3EI3B 3EWEA 4MK0B 1A0RB 2HU5A 2QZPA 5B4WA 3RSEC 5M5SA 4GQBB 1GXRA 4KFMB 3RMZD 2B5NA 3P4FA 2EIBA 3MUNA 1N6EA 2P9SC 4JT5C 5I5MA 3UKUC 4EWRA 4Z7QA 4AN0A 4O2WA 4JXMA 4Z8LA 4CY2A 2H6KA 4J77A 5AJAA 4ZOXA 4FA5D 3UVMA 4DNWA 3JROA 3DSMA 4J0XA 3T3PA 5EAPA 4BP9A 2PBIB 2P9KC 2YB8B 4H5JA 3FRXA 1R5MA 4ZOZA 4X3EA 5JWZA 3PSCB 1E8NA 2OJYA 5FKRA 4GGCA 4L3GD 4N14A 5CYKA 3CIKB 1N6DA 3V4VA 2J55H 4X61B 2Z2NA 2W18A 2Z2PA 3NVNA 2WQ8A 3VI3A 5M5TA 4J8BA 1UOQA 4O3UB 1PEVA 3IJ0A 2IAAA 1MDAH 3EI2B 1C9LA 3OL2B 5AMSA 2P9PC 5CXBB 1UTCA 4E54A 4JSPC 3UKRC 4FA9D 2HYEA 1TYQC 4QT8A 3GREA 1BPOA 3I7NA 3I7KA 3EG6A 4IRZA 1MG3A 5HE1B 3FCUA 5K19A 2AQ5A 2H47A 2I0TA 4J8GA 2YNPA 2HU8A 5HE0B 1YR2A 4ERYA 5IGQA 4A0BB 4A0AB 3IIYA 4A08A 3AL9A 4ERQA 3DXMC 3BG1A 3IVMA 4YVDA 2GNQA 1H2WA 2IUQA 3F3GA 2XU7A 1U4CA 3HFQA 5FKSA 3JZNA 4L1QD 4AOWA 2H3XA 3GFCA 5CXCA 4WK0A 1T2XA 3V7DB 3MXXA 5C9ZB 2BKLA 4CY3A 1H2XA 1SQ9A 2H9MA 2H6NA 2GC4A 5I5JA 4X63B 3VA6A 5EM2B 4J84A 2VC2A 3N0EA 3EQ9A 4PC0A 2P9IC 1K8KC 2OVQB 1TYEA 3EI3A 2VDKA 3T3MA 1H2YA 1JMZB 2HKRA 1OLZA 4BL0A 5C92A 3ZDYA 4PSXB 5C2VB 1Q47A 3F3PA 2YBAA 3V4PA 3IUQA 2XYIA 3K71A 2H68A 3JAMg 3OKWA 2HXCA 2CE9A 4U7AA 4WJKA 4MMYA 4IMMA 3QI0A 3GD1I 3EQ7A 2Q7QA 1B9YA 3EI1B 4D6VA 3SHFA 2VDOA 4IA9A 4LG8A 1E5TA 3MUOA 3C5MA 2B5MA 5EAMA 3IUMA 4PXWA 5M5UA 3RLMD 3C9CA 2IURA 2J57G 3I7PA 4GGAA 1XHMA 2IUVA 3OL2A 3DM0A 5IT9g 2IWKA 3O4GA 5EMLB 4CI2A 4JSNC 3BG0A 2XZGA 4BUJC 3A0FA 2OVPB 2XL2A 5IJ7E 4NC4A 1QNIA 3JRPA 4QQEA 4UI9R 4O3TB 2GC7A 3ZDZA 5GSAA 1JOFA 3IJCA 3UVKA 4J82A 3JB9L 4O9DA 1H2ZA 3EMHA 4FA1D 4CI1A 4A0BA 3OKYA 3RFGA 4A0AA 4QAMA 5A2Qg 3F3FA 2P9NC 3I2NA 3NIDA 2CO0A 2TRCB 1K3IA 3IULA 4X60B 4GQ1A 3O4JA 2EIDA 3SBQA 3UVNA 5M5RA 5SXMA 2YNOA 2H9NA 5HYNB 5IGOA 1RI6A 3AL8A 2AH0A 2AH1A 5HE3B 2VZ1A 5FKQA 4O1QD 4GMBA 5EM2A 3EU7A 4XYIA 4J81A 4MMXA 1I2MB 5FXYA 4MMZA 5M5VA 3L4MD 4G55A 3MZLA 4L1MA 1VZ2A 1VYHC 4DNUA 2VZ3A 3ZE0A 1UOOA 3ZDXA 2H9LA 2CNXA 2AGXA 3PVUB 4A7JA 5FQDA 4Y7RA 1XIPA 2EBSA 2HESX 5M61A 2AGWA 4CY5A 4CZXA 1S4UX 3DXKC 4Z7NA 2PM7B 5IC7A 1PGUA 4PBZA 5TF2A 4Y5RD 1JV2A 5EMKB 3SBPA 3K6SA 3VI4A 5H17A 2CN3A 3IIWA 4J87A 3VH0A 3RN0D 5E6UA 2IUPA 4JSVC 5I5IA 2HJBA 4GQ2P 4GGDA 1MG2A 3W15A 4XYHA 3UVOA 3AH8B 4HDJA 3SN6B 1GOTB 4A11B 2G99A 3O4HA 4RE6A 5H14A 4ES0A 2B5LA 5TDHB 4O02A 1UOPA 4BCCA 3KCIA 4NBMA 1U8CA 3SFZA 4NAAA 3SVWD 3V9FA 5H1MA 4BCBA 3PXWD 1M1XA 3C75H 3I8EA 2I3SA 4ERZA 1JTDB 3QHYB 5K1CC 3FM0A 4O45A 3PXSD 3K27A 5HDBA 4K3ID 4NENA 4J86A 5THAA 2PM9B 4J78A 5EALA 2AGZA 4OZUA 5IJ8E 3PVWB 2UZXB 3RN1D 2VDMA 1C9IA 3JZHA 2AGLA 1PI6A 3EI2A 4GZ8A 4FB1D 5CXBA 2IWFA 2XL3A 2BBKH 4AMZA 5FKTA 1E8MA 3MZKA 4D0KA 3UVLA 3PSLA 2HKMA 2QC5A 5FA5B 3MKSB 3IJEA 4PNKB 1FWXA 2YMUA 2CE8A 3IUJA 4JT6C 3EI4B 3K72A 4A09B 4ZOYA 1OMWB 4TZ4A 1QFMA 2OK6A 4A2MA 3SMRA 1SHYB 4G1MA 1QFSA 1PBYB 2XDWA 4JD2C 2VDQA 4I79A 2I0RA 2HJ4A 2I3TA 2QR5A 2VDPA 3IKOA 3I7HA 2QXVA 3CFSB 3L4OD 4D9SA 5TEFA 3IUNA 4RE5A 1JMXB 2VDNA 4G1EA 4GM9A 3O4IA 3J81g 3J80g 2H14A 4XEIC 4E5ZB 3SJLD 3KRWB 3UR4A 2H9PA 2H6QA 5HQGA 1GP2B 2YNNA 3GC3B 4JSXC 4CI8A 2AGYA 1SQJA
chains in the Genus database with same CATH topology
1YFQA 3I8CA 3ODTA 2J56H 4OWRA 2PM6B 2OK4A 4FHLA 4PSWB 2UZYB 4A11A 1U2VC 4FA4D 3FGBA 3I7LA 4CY1A 5AFU3 4H5IA 2H13A 4PBYA 5EMMB 3NVXA 3E0CA 1XKSA 5EMJB 3KRXB 1NR0A 4J79A 3K26A 3AFCA 3SLED 3EI1A 1TBGA 1GG2B 4L9OA 3U4YA 1L0QA 3RRMC 3ZWLB 5TEEA 3CFVA 3SBRA 2PM9A 3OKYB 2B4EA 2CN2A 4G56B 3V5WB 3PE7A 3NVQA 4U1EI 5KDOB 3IJ1A 4GM8A 3DWLC 5EARA 4QL1A 3BWSA 3MKQA 5CYKB 4BH6A 3VGZA 2BCJB 2P9LC 3OW8A 3N0DA 3I89A 4CZYA 1JJUB 4NSXA 3AL8B 3EI4A 3OKTA 4QRJA 2G9AA 4A09A 1ERJA 3JPXA 2O9KA 5HE2B 3RFHA 3PXTD 3JZGA 1K32A 2CO0C 4E54B 4GM3A 3I7OA 3SWSD 4CI3A 3MMYA 1P22A 2OVRB 3ORVD 2P9UC 4A2LA 2I0SA 3ULEC 2Z2OA 1NEXB 4K3JB 4A08B 4FAVD 4CZVA 4E5ZA 1N6FA 4LGNA 4ZOVA 3C99A 5GXHA 5GXIA 3B7FA 4ESGA 4R7AB 3SCYA 1B9XA 4LG9A 4FWWA 5CXCB 2OIZA 5FLXg 4ZN4A 3OTTA 4CC9A 2MTAH 4L3HD 4J0WA 5C2WB 3SXTD 4FAND 5GMKn 4J73A 4AEZA 3EI3B 3EWEA 4MK0B 1A0RB 5B4WA 3RSEC 4GQBB 1GXRA 4KFMB 3RMZD 2B5NA 3P4FA 4JT5C 1N6EA 2P9SC 5I5MA 3UKUC 4EWRA 4JXMA 4Z8LA 4CY2A 2H6KA 4J77A 5AJAA 4ZOXA 4FA5D 3UVMA 3JROA 3DSMA 4J0XA 5EAPA 2PBIB 2P9KC 2YB8B 4H5JA 3FRXA 1R5MA 4ZOZA 4X3EA 5JWZA 3PSCB 2OJYA 5FKRA 4GGCA 4L3GD 4N14A 5CYKA 3CIKB 1N6DA 2J55H 4X61B 2Z2NA 2W18A 2Z2PA 3NVNA 4J8BA 4O3UB 1PEVA 3IJ0A 2IAAA 1MDAH 3EI2B 3OL2B 5AMSA 2P9PC 5CXBB 4E54A 4JSPC 3UKRC 4FA9D 2HYEA 1TYQC 4QT8A 3GREA 3I7NA 3I7KA 3EG6A 1MG3A 5HE1B 5K19A 2AQ5A 2H47A 2I0TA 4J8GA 2YNPA 5HE0B 5IGQA 4ERYA 4A0BB 4A0AB 3IIYA 4A08A 3AL9A 4ERQA 3DXMC 3BG1A 4YVDA 2GNQA 2IUQA 3F3GA 2XU7A 1U4CA 3HFQA 5FKSA 3JZNA 4L1QD 4AOWA 2H3XA 3GFCA 5CXCA 3V7DB 3MXXA 5C9ZB 4CY3A 1SQ9A 2H9MA 2H6NA 2GC4A 5I5JA 4X63B 3VA6A 5EM2B 4J84A 3N0EA 4PC0A 2P9IC 1K8KC 2OVQB 3EI3A 1JMZB 2HKRA 1OLZA 4BL0A 4PSXB 5C2VB 1Q47A 3F3PA 2YBAA 2XYIA 2H68A 3JAMg 3OKWA 2HXCA 2CE9A 4U7AA 4IMMA 2Q7QA 1B9YA 3EI1B 4D6VA 3SHFA 4IA9A 4LG8A 3C5MA 2B5MA 5EAMA 4PXWA 3RLMD 3C9CA 2IURA 2J57G 3I7PA 4GGAA 1XHMA 2IUVA 3OL2A 3DM0A 5IT9g 2IWKA 5EMLB 4CI2A 4JSNC 3BG0A 4BUJC 3A0FA 2OVPB 2XL2A 5IJ7E 1QNIA 3JRPA 4QQEA 4UI9R 4O3TB 2GC7A 5GSAA 1JOFA 3IJCA 3UVKA 4J82A 3JB9L 4O9DA 3EMHA 4FA1D 4CI1A 4A0BA 3OKYA 3RFGA 4A0AA 5A2Qg 3F3FA 2P9NC 3I2NA 2CO0A 2TRCB 4X60B 4GQ1A 3SBQA 3UVNA 5SXMA 2YNOA 2H9NA 5HYNB 5IGOA 1RI6A 3AL8A 2AH0A 2AH1A 5HE3B 5FKQA 4O1QD 4GMBA 5EM2A 3EU7A 4XYIA 4J81A 5FXYA 3L4MD 3MZLA 1VYHC 2H9LA 2CNXA 2AGXA 3PVUB 4A7JA 5FQDA 4Y7RA 1XIPA 2EBSA 2HESX 2AGWA 4CY5A 4CZXA 1S4UX 3DXKC 2PM7B 5IC7A 1PGUA 4PBZA 5TF2A 4Y5RD 5EMKB 3SBPA 5H17A 2CN3A 3IIWA 4J87A 3VH0A 3RN0D 2IUPA 4JSVC 5I5IA 2HJBA 4GQ2P 4GGDA 1MG2A 3W15A 4XYHA 3UVOA 3AH8B 4HDJA 3SN6B 1GOTB 4A11B 2G99A 5H14A 4ES0A 2B5LA 5TDHB 3SFZA 3SVWD 3V9FA 5H1MA 3PXWD 3C75H 3I8EA 2I3SA 4ERZA 5K1CC 3FM0A 4O45A 3PXSD 3K27A 4K3ID 4J86A 5THAA 2PM9B 4J78A 5EALA 2AGZA 4OZUA 5IJ8E 3PVWB 2UZXB 3RN1D 3JZHA 2AGLA 1PI6A 3EI2A 4GZ8A 4FB1D 5CXBA 2IWFA 2XL3A 2BBKH 5FKTA 3MZKA 4D0KA 3UVLA 3PSLA 2HKMA 2QC5A 5FA5B 3MKSB 4PNKB 1FWXA 2YMUA 2CE8A 4JT6C 3EI4B 4A09B 4ZOYA 1OMWB 4TZ4A 2OK6A 4A2MA 3SMRA 1SHYB 1PBYB 4JD2C 4I79A 2I0RA 2HJ4A 2I3TA 3IKOA 3I7HA 3L4OD 2QXVA 3CFSB 5TEFA 1JMXB 4GM9A 3J81g 3J80g 2H14A 4XEIC 4E5ZB 3SJLD 3KRWB 3UR4A 2H9PA 2H6QA 5HQGA 1GP2B 2YNNA 4JSXC 4CI8A 2AGYA 1SQJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YFQ A;  3I8C A;  3ODT A;  2J56 H;  4OWR A;  2PM6 B;  2OK4 A;  4FHL A;  4PSW B;  2UZY B;  4A11 A;  1U2V C;  4FA4 D;  3FGB A;  3I7L A;  4CY1 A;  5AFU 3;  4H5I A;  2H13 A;  4PBY A;  5EMM B;  3NVX A;  3E0C A;  1XKS A;  5EMJ B;  3KRX B;  1NR0 A;  4J79 A;  3K26 A;  3AFC A;  3SLE D;  3EI1 A;  1TBG A;  1GG2 B;  4L9O A;  3U4Y A;  1L0Q A;  3RRM C;  3ZWL B;  5TEE A;  3CFV A;  3SBR A;  2PM9 A;  3OKY B;  2B4E A;  2CN2 A;  4G56 B;  3V5W B;  3PE7 A;  3NVQ A;  4U1E I;  5KDO B;  3IJ1 A;  4GM8 A;  3DWL C;  5EAR A;  4QL1 A;  3BWS A;  3MKQ A;  5CYK B;  4BH6 A;  3VGZ A;  2BCJ B;  2P9L C;  3OW8 A;  3N0D A;  3I89 A;  4CZY A;  1JJU B;  4NSX A;  3AL8 B;  3EI4 A;  3OKT A;  4QRJ A;  2G9A A;  4A09 A;  1ERJ A;  3JPX A;  2O9K A;  5HE2 B;  3RFH A;  3PXT D;  3JZG A;  1K32 A;  2CO0 C;  4E54 B;  4GM3 A;  3I7O A;  3SWS D;  4CI3 A;  3MMY A;  1P22 A;  2OVR B;  3ORV D;  2P9U C;  4A2L A;  2I0S A;  3ULE C;  2Z2O A;  1NEX B;  4K3J B;  4A08 B;  4FAV D;  4CZV A;  4E5Z A;  1N6F A;  4LGN A;  4ZOV A;  3C99 A;  5GXH A;  5GXI A;  3B7F A;  4ESG A;  4R7A B;  3SCY A;  1B9X A;  4LG9 A;  4FWW A;  5CXC B;  2OIZ A;  5FLX g;  4ZN4 A;  3OTT A;  4CC9 A;  2MTA H;  4L3H D;  4J0W A;  5C2W B;  3SXT D;  4FAN D;  5GMK n;  4J73 A;  4AEZ A;  3EI3 B;  3EWE A;  4MK0 B;  1A0R B;  5B4W A;  3RSE C;  4GQB B;  1GXR A;  4KFM B;  3RMZ D;  2B5N A;  3P4F A;  4JT5 C;  1N6E A;  2P9S C;  5I5M A;  3UKU C;  4EWR A;  4JXM A;  4Z8L A;  4CY2 A;  2H6K A;  4J77 A;  5AJA A;  4ZOX A;  4FA5 D;  3UVM A;  3JRO A;  3DSM A;  4J0X A;  5EAP A;  2PBI B;  2P9K C;  2YB8 B;  4H5J A;  3FRX A;  1R5M A;  4ZOZ A;  4X3E A;  5JWZ A;  3PSC B;  2OJY A;  5FKR A;  4GGC A;  4L3G D;  4N14 A;  5CYK A;  3CIK B;  1N6D A;  2J55 H;  4X61 B;  2Z2N A;  2W18 A;  2Z2P A;  3NVN A;  4J8B A;  4O3U B;  1PEV A;  3IJ0 A;  2IAA A;  1MDA H;  3EI2 B;  3OL2 B;  5AMS A;  2P9P C;  5CXB B;  4E54 A;  4JSP C;  3UKR C;  4FA9 D;  2HYE A;  1TYQ C;  4QT8 A;  3GRE A;  3I7N A;  3I7K A;  3EG6 A;  1MG3 A;  5HE1 B;  5K19 A;  2AQ5 A;  2H47 A;  2I0T A;  4J8G A;  2YNP A;  5HE0 B;  5IGQ A;  4ERY A;  4A0B B;  4A0A B;  3IIY A;  4A08 A;  3AL9 A;  4ERQ A;  3DXM C;  3BG1 A;  4YVD A;  2GNQ A;  2IUQ A;  3F3G A;  2XU7 A;  1U4C A;  3HFQ A;  5FKS A;  3JZN A;  4L1Q D;  4AOW A;  2H3X A;  3GFC A;  5CXC A;  3V7D B;  3MXX A;  5C9Z B;  4CY3 A;  1SQ9 A;  2H9M A;  2H6N A;  2GC4 A;  5I5J A;  4X63 B;  3VA6 A;  5EM2 B;  4J84 A;  3N0E A;  4PC0 A;  2P9I C;  1K8K C;  2OVQ B;  3EI3 A;  1JMZ B;  2HKR A;  1OLZ A;  4BL0 A;  4PSX B;  5C2V B;  1Q47 A;  3F3P A;  2YBA A;  2XYI A;  2H68 A;  3JAM g;  3OKW A;  2HXC A;  2CE9 A;  4U7A A;  4IMM A;  2Q7Q A;  1B9Y A;  3EI1 B;  4D6V A;  3SHF A;  4IA9 A;  4LG8 A;  3C5M A;  2B5M A;  5EAM A;  4PXW A;  3RLM D;  3C9C A;  2IUR A;  2J57 G;  3I7P A;  4GGA A;  1XHM A;  2IUV A;  3OL2 A;  3DM0 A;  5IT9 g;  2IWK A;  5EML B;  4CI2 A;  4JSN C;  3BG0 A;  4BUJ C;  3A0F A;  2OVP B;  2XL2 A;  5IJ7 E;  1QNI A;  3JRP A;  4QQE A;  4UI9 R;  4O3T B;  2GC7 A;  5GSA A;  1JOF A;  3IJC A;  3UVK A;  4J82 A;  3JB9 L;  4O9D A;  3EMH A;  4FA1 D;  4CI1 A;  4A0B A;  3OKY A;  3RFG A;  4A0A A;  5A2Q g;  3F3F A;  2P9N C;  3I2N A;  2CO0 A;  2TRC B;  4X60 B;  4GQ1 A;  3SBQ A;  3UVN A;  5SXM A;  2YNO A;  2H9N A;  5HYN B;  5IGO A;  1RI6 A;  3AL8 A;  2AH0 A;  2AH1 A;  5HE3 B;  5FKQ A;  4O1Q D;  4GMB A;  5EM2 A;  3EU7 A;  4XYI A;  4J81 A;  5FXY A;  3L4M D;  3MZL A;  1VYH C;  2H9L A;  2CNX A;  2AGX A;  3PVU B;  4A7J A;  5FQD A;  4Y7R A;  1XIP A;  2EBS A;  2HES X;  2AGW A;  4CY5 A;  4CZX A;  1S4U X;  3DXK C;  2PM7 B;  5IC7 A;  1PGU A;  4PBZ A;  5TF2 A;  4Y5R D;  5EMK B;  3SBP A;  5H17 A;  2CN3 A;  3IIW A;  4J87 A;  3VH0 A;  3RN0 D;  2IUP A;  4JSV C;  5I5I A;  2HJB A;  4GQ2 P;  4GGD A;  1MG2 A;  3W15 A;  4XYH A;  3UVO A;  3AH8 B;  4HDJ A;  3SN6 B;  1GOT B;  4A11 B;  2G99 A;  5H14 A;  4ES0 A;  2B5L A;  5TDH B;  3SFZ A;  3SVW D;  3V9F A;  5H1M A;  3PXW D;  3C75 H;  3I8E A;  2I3S A;  4ERZ A;  5K1C C;  3FM0 A;  4O45 A;  3PXS D;  3K27 A;  4K3I D;  4J86 A;  5THA A;  2PM9 B;  4J78 A;  5EAL A;  2AGZ A;  4OZU A;  5IJ8 E;  3PVW B;  2UZX B;  3RN1 D;  3JZH A;  2AGL A;  1PI6 A;  3EI2 A;  4GZ8 A;  4FB1 D;  5CXB A;  2IWF A;  2XL3 A;  2BBK H;  5FKT A;  3MZK A;  4D0K A;  3UVL A;  3PSL A;  2HKM A;  2QC5 A;  5FA5 B;  3MKS B;  4PNK B;  1FWX A;  2YMU A;  2CE8 A;  4JT6 C;  3EI4 B;  4A09 B;  4ZOY A;  1OMW B;  4TZ4 A;  2OK6 A;  4A2M A;  3SMR A;  1SHY B;  1PBY B;  4JD2 C;  4I79 A;  2I0R A;  2HJ4 A;  2I3T A;  3IKO A;  3I7H A;  3L4O D;  2QXV A;  3CFS B;  5TEF A;  1JMX B;  4GM9 A;  3J81 g;  3J80 g;  2H14 A;  4XEI C;  4E5Z B;  3SJL D;  3KRW B;  3UR4 A;  2H9P A;  2H6Q A;  5HQG A;  1GP2 B;  2YNN A;  4JSX C;  4CI8 A;  2AGY A;  1SQJ A; 
#chains in the Genus database with same CATH topology
 1YFQ A;  3I8C A;  4WK4 A;  1VZ3 A;  3NIF A;  4UM9 A;  3ODT A;  2J56 H;  4OWR A;  2PM6 B;  2OK4 A;  2JKX A;  4FHL A;  4PSW B;  2UZY B;  4A11 A;  1U2V C;  4FA4 D;  3FGB A;  3I7L A;  4CY1 A;  5AFU 3;  4H5I A;  2H13 A;  4PBY A;  1L5G A;  5EMM B;  3NVX A;  3E0C A;  1XKS A;  5EMJ B;  3KRX B;  1GOH A;  1NR0 A;  4J79 A;  3K26 A;  3AFC A;  3SLE D;  3EI1 A;  1O6G A;  1TBG A;  3EQ8 A;  3MVD K;  1GG2 B;  5C86 A;  4L9O A;  3U4Y A;  1L0Q A;  3RRM C;  3ZWL B;  4JHN A;  5TEE A;  3IUR A;  3CFV A;  3SBR A;  2PM9 A;  3OKY B;  4BCD A;  2B4E A;  2CN2 A;  2EIC A;  4G56 B;  3V5W B;  3PE7 A;  3NVQ A;  4U1E I;  5KDO B;  4BP8 A;  3IJ1 A;  5E6R A;  4GM8 A;  3DWL C;  4Z7O A;  5EAR A;  4QL1 A;  3BWS A;  3MKQ A;  5CYK B;  4BH6 A;  1VE6 A;  3VGZ A;  2BCJ B;  2P9L C;  3OW8 A;  3N0D A;  4DNV A;  3I89 A;  4CZY A;  1JJU B;  4NSX A;  3AL8 B;  3EI4 A;  3OKT A;  4QRJ A;  2EIE A;  2G9A A;  4A09 A;  1ERJ A;  3JPX A;  2O9K A;  5HE2 B;  3RFH A;  3PXT D;  3JZG A;  4WK2 A;  1K32 A;  2CO0 C;  4E54 B;  1GOG A;  3OF7 A;  4GM3 A;  3I7O A;  3ZE1 A;  3SWS D;  4CI3 A;  3MMY A;  1P22 A;  2OVR B;  3ORV D;  2P9U C;  4AX4 A;  4A2L A;  2I0S A;  3ULE C;  4UM8 A;  2Z2O A;  1NEX B;  4K3J B;  4A08 B;  4FAV D;  4CZV A;  4E5Z A;  1N6F A;  4JHP C;  1O6F A;  4LGN A;  4ZOV A;  3C99 A;  5GXH A;  5GXI A;  3B7F A;  1VE7 A;  4AN1 A;  5FFG A;  4ESG A;  5FFO A;  4R7A B;  3SCY A;  3DDU A;  5E6S A;  2HU7 A;  1B9X A;  1A12 A;  4LG9 A;  3ZE2 A;  4FWW A;  5CXC B;  2OIZ A;  5FLX g;  4ZN4 A;  3OTT A;  3NIG A;  4CC9 A;  4AMY A;  2VDL A;  2XE4 A;  2MTA H;  4L3H D;  4J0W A;  1GOF A;  3FCS A;  5C2W B;  3SXT D;  4FAN D;  2VDR A;  5GMK n;  4J73 A;  4AEZ A;  3EI3 B;  3EWE A;  4MK0 B;  1A0R B;  2HU5 A;  2QZP A;  5B4W A;  3RSE C;  5M5S A;  4GQB B;  1GXR A;  4KFM B;  3RMZ D;  2B5N A;  3P4F A;  2EIB A;  3MUN A;  1N6E A;  2P9S C;  4JT5 C;  5I5M A;  3UKU C;  4EWR A;  4Z7Q A;  4AN0 A;  4O2W A;  4JXM A;  4Z8L A;  4CY2 A;  2H6K A;  4J77 A;  5AJA A;  4ZOX A;  4FA5 D;  3UVM A;  4DNW A;  3JRO A;  3DSM A;  4J0X A;  3T3P A;  5EAP A;  4BP9 A;  2PBI B;  2P9K C;  2YB8 B;  4H5J A;  3FRX A;  1R5M A;  4ZOZ A;  4X3E A;  5JWZ A;  3PSC B;  1E8N A;  2OJY A;  5FKR A;  4GGC A;  4L3G D;  4N14 A;  5CYK A;  3CIK B;  1N6D A;  3V4V A;  2J55 H;  4X61 B;  2Z2N A;  2W18 A;  2Z2P A;  3NVN A;  2WQ8 A;  3VI3 A;  5M5T A;  4J8B A;  1UOQ A;  4O3U B;  1PEV A;  3IJ0 A;  2IAA A;  1MDA H;  3EI2 B;  1C9L A;  3OL2 B;  5AMS A;  2P9P C;  5CXB B;  1UTC A;  4E54 A;  4JSP C;  3UKR C;  4FA9 D;  2HYE A;  1TYQ C;  4QT8 A;  3GRE A;  1BPO A;  3I7N A;  3I7K A;  3EG6 A;  4IRZ A;  1MG3 A;  5HE1 B;  3FCU A;  5K19 A;  2AQ5 A;  2H47 A;  2I0T A;  4J8G A;  2YNP A;  2HU8 A;  5HE0 B;  1YR2 A;  4ERY A;  5IGQ A;  4A0B B;  4A0A B;  3IIY A;  4A08 A;  3AL9 A;  4ERQ A;  3DXM C;  3BG1 A;  3IVM A;  4YVD A;  2GNQ A;  1H2W A;  2IUQ A;  3F3G A;  2XU7 A;  1U4C A;  3HFQ A;  5FKS A;  3JZN A;  4L1Q D;  4AOW A;  2H3X A;  3GFC A;  5CXC A;  4WK0 A;  1T2X A;  3V7D B;  3MXX A;  5C9Z B;  2BKL A;  4CY3 A;  1H2X A;  1SQ9 A;  2H9M A;  2H6N A;  2GC4 A;  5I5J A;  4X63 B;  3VA6 A;  5EM2 B;  4J84 A;  2VC2 A;  3N0E A;  3EQ9 A;  4PC0 A;  2P9I C;  1K8K C;  2OVQ B;  1TYE A;  3EI3 A;  2VDK A;  3T3M A;  1H2Y A;  1JMZ B;  2HKR A;  1OLZ A;  4BL0 A;  5C92 A;  3ZDY A;  4PSX B;  5C2V B;  1Q47 A;  3F3P A;  2YBA A;  3V4P A;  3IUQ A;  2XYI A;  3K71 A;  2H68 A;  3JAM g;  3OKW A;  2HXC A;  2CE9 A;  4U7A A;  4WJK A;  4MMY A;  4IMM A;  3QI0 A;  3GD1 I;  3EQ7 A;  2Q7Q A;  1B9Y A;  3EI1 B;  4D6V A;  3SHF A;  2VDO A;  4IA9 A;  4LG8 A;  1E5T A;  3MUO A;  3C5M A;  2B5M A;  5EAM A;  3IUM A;  4PXW A;  5M5U A;  3RLM D;  3C9C A;  2IUR A;  2J57 G;  3I7P A;  4GGA A;  1XHM A;  2IUV A;  3OL2 A;  3DM0 A;  5IT9 g;  2IWK A;  3O4G A;  5EML B;  4CI2 A;  4JSN C;  3BG0 A;  2XZG A;  4BUJ C;  3A0F A;  2OVP B;  2XL2 A;  5IJ7 E;  4NC4 A;  1QNI A;  3JRP A;  4QQE A;  4UI9 R;  4O3T B;  2GC7 A;  3ZDZ A;  5GSA A;  1JOF A;  3IJC A;  3UVK A;  4J82 A;  3JB9 L;  4O9D A;  1H2Z A;  3EMH A;  4FA1 D;  4CI1 A;  4A0B A;  3OKY A;  3RFG A;  4A0A A;  4QAM A;  5A2Q g;  3F3F A;  2P9N C;  3I2N A;  3NID A;  2CO0 A;  2TRC B;  1K3I A;  3IUL A;  4X60 B;  4GQ1 A;  3O4J A;  2EID A;  3SBQ A;  3UVN A;  5M5R A;  5SXM A;  2YNO A;  2H9N A;  5HYN B;  5IGO A;  1RI6 A;  3AL8 A;  2AH0 A;  2AH1 A;  5HE3 B;  2VZ1 A;  5FKQ A;  4O1Q D;  4GMB A;  5EM2 A;  3EU7 A;  4XYI A;  4J81 A;  4MMX A;  1I2M B;  5FXY A;  4MMZ A;  5M5V A;  3L4M D;  4G55 A;  3MZL A;  4L1M A;  1VZ2 A;  1VYH C;  4DNU A;  2VZ3 A;  3ZE0 A;  1UOO A;  3ZDX A;  2H9L A;  2CNX A;  2AGX A;  3PVU B;  4A7J A;  5FQD A;  4Y7R A;  1XIP A;  2EBS A;  2HES X;  5M61 A;  2AGW A;  4CY5 A;  4CZX A;  1S4U X;  3DXK C;  4Z7N A;  2PM7 B;  5IC7 A;  1PGU A;  4PBZ A;  5TF2 A;  4Y5R D;  1JV2 A;  5EMK B;  3SBP A;  3K6S A;  3VI4 A;  5H17 A;  2CN3 A;  3IIW A;  4J87 A;  3VH0 A;  3RN0 D;  5E6U A;  2IUP A;  4JSV C;  5I5I A;  2HJB A;  4GQ2 P;  4GGD A;  1MG2 A;  3W15 A;  4XYH A;  3UVO A;  3AH8 B;  4HDJ A;  3SN6 B;  1GOT B;  4A11 B;  2G99 A;  3O4H A;  4RE6 A;  5H14 A;  4ES0 A;  2B5L A;  5TDH B;  4O02 A;  1UOP A;  4BCC A;  3KCI A;  4NBM A;  1U8C A;  3SFZ A;  4NAA A;  3SVW D;  3V9F A;  5H1M A;  4BCB A;  3PXW D;  1M1X A;  3C75 H;  3I8E A;  2I3S A;  4ERZ A;  1JTD B;  3QHY B;  5K1C C;  3FM0 A;  4O45 A;  3PXS D;  3K27 A;  5HDB A;  4K3I D;  4NEN A;  4J86 A;  5THA A;  2PM9 B;  4J78 A;  5EAL A;  2AGZ A;  4OZU A;  5IJ8 E;  3PVW B;  2UZX B;  3RN1 D;  2VDM A;  1C9I A;  3JZH A;  2AGL A;  1PI6 A;  3EI2 A;  4GZ8 A;  4FB1 D;  5CXB A;  2IWF A;  2XL3 A;  2BBK H;  4AMZ A;  5FKT A;  1E8M A;  3MZK A;  4D0K A;  3UVL A;  3PSL A;  2HKM A;  2QC5 A;  5FA5 B;  3MKS B;  3IJE A;  4PNK B;  1FWX A;  2YMU A;  2CE8 A;  3IUJ A;  4JT6 C;  3EI4 B;  3K72 A;  4A09 B;  4ZOY A;  1OMW B;  4TZ4 A;  1QFM A;  2OK6 A;  4A2M A;  3SMR A;  1SHY B;  4G1M A;  1QFS A;  1PBY B;  2XDW A;  4JD2 C;  2VDQ A;  4I79 A;  2I0R A;  2HJ4 A;  2I3T A;  2QR5 A;  2VDP A;  3IKO A;  3I7H A;  2QXV A;  3CFS B;  3L4O D;  4D9S A;  5TEF A;  3IUN A;  4RE5 A;  1JMX B;  2VDN A;  4G1E A;  4GM9 A;  3O4I A;  3J81 g;  3J80 g;  2H14 A;  4XEI C;  4E5Z B;  3SJL D;  3KRW B;  3UR4 A;  2H9P A;  2H6Q A;  5HQG A;  1GP2 B;  2YNN A;  3GC3 B;  4JSX C;  4CI8 A;  2AGY A;  1SQJ A; 
#chains in the Genus database with same CATH homology
 1YFQ A;  3I8C A;  3ODT A;  2J56 H;  4OWR A;  2PM6 B;  2OK4 A;  4FHL A;  4PSW B;  2UZY B;  4A11 A;  1U2V C;  4FA4 D;  3FGB A;  3I7L A;  4CY1 A;  5AFU 3;  4H5I A;  2H13 A;  4PBY A;  5EMM B;  3NVX A;  3E0C A;  1XKS A;  5EMJ B;  3KRX B;  1NR0 A;  4J79 A;  3K26 A;  3AFC A;  3SLE D;  3EI1 A;  1TBG A;  1GG2 B;  4L9O A;  3U4Y A;  1L0Q A;  3RRM C;  3ZWL B;  5TEE A;  3CFV A;  3SBR A;  2PM9 A;  3OKY B;  2B4E A;  2CN2 A;  4G56 B;  3V5W B;  3PE7 A;  3NVQ A;  4U1E I;  5KDO B;  3IJ1 A;  4GM8 A;  3DWL C;  5EAR A;  4QL1 A;  3BWS A;  3MKQ A;  5CYK B;  4BH6 A;  3VGZ A;  2BCJ B;  2P9L C;  3OW8 A;  3N0D A;  3I89 A;  4CZY A;  1JJU B;  4NSX A;  3AL8 B;  3EI4 A;  3OKT A;  4QRJ A;  2G9A A;  4A09 A;  1ERJ A;  3JPX A;  2O9K A;  5HE2 B;  3RFH A;  3PXT D;  3JZG A;  1K32 A;  2CO0 C;  4E54 B;  4GM3 A;  3I7O A;  3SWS D;  4CI3 A;  3MMY A;  1P22 A;  2OVR B;  3ORV D;  2P9U C;  4A2L A;  2I0S A;  3ULE C;  2Z2O A;  1NEX B;  4K3J B;  4A08 B;  4FAV D;  4CZV A;  4E5Z A;  1N6F A;  4LGN A;  4ZOV A;  3C99 A;  5GXH A;  5GXI A;  3B7F A;  4ESG A;  4R7A B;  3SCY A;  1B9X A;  4LG9 A;  4FWW A;  5CXC B;  2OIZ A;  5FLX g;  4ZN4 A;  3OTT A;  4CC9 A;  2MTA H;  4L3H D;  4J0W A;  5C2W B;  3SXT D;  4FAN D;  5GMK n;  4J73 A;  4AEZ A;  3EI3 B;  3EWE A;  4MK0 B;  1A0R B;  5B4W A;  3RSE C;  4GQB B;  1GXR A;  4KFM B;  3RMZ D;  2B5N A;  3P4F A;  4JT5 C;  1N6E A;  2P9S C;  5I5M A;  3UKU C;  4EWR A;  4JXM A;  4Z8L A;  4CY2 A;  2H6K A;  4J77 A;  5AJA A;  4ZOX A;  4FA5 D;  3UVM A;  3JRO A;  3DSM A;  4J0X A;  5EAP A;  2PBI B;  2P9K C;  2YB8 B;  4H5J A;  3FRX A;  1R5M A;  4ZOZ A;  4X3E A;  5JWZ A;  3PSC B;  2OJY A;  5FKR A;  4GGC A;  4L3G D;  4N14 A;  5CYK A;  3CIK B;  1N6D A;  2J55 H;  4X61 B;  2Z2N A;  2W18 A;  2Z2P A;  3NVN A;  4J8B A;  4O3U B;  1PEV A;  3IJ0 A;  2IAA A;  1MDA H;  3EI2 B;  3OL2 B;  5AMS A;  2P9P C;  5CXB B;  4E54 A;  4JSP C;  3UKR C;  4FA9 D;  2HYE A;  1TYQ C;  4QT8 A;  3GRE A;  3I7N A;  3I7K A;  3EG6 A;  1MG3 A;  5HE1 B;  5K19 A;  2AQ5 A;  2H47 A;  2I0T A;  4J8G A;  2YNP A;  5HE0 B;  5IGQ A;  4ERY A;  4A0B B;  4A0A B;  3IIY A;  4A08 A;  3AL9 A;  4ERQ A;  3DXM C;  3BG1 A;  4YVD A;  2GNQ A;  2IUQ A;  3F3G A;  2XU7 A;  1U4C A;  3HFQ A;  5FKS A;  3JZN A;  4L1Q D;  4AOW A;  2H3X A;  3GFC A;  5CXC A;  3V7D B;  3MXX A;  5C9Z B;  4CY3 A;  1SQ9 A;  2H9M A;  2H6N A;  2GC4 A;  5I5J A;  4X63 B;  3VA6 A;  5EM2 B;  4J84 A;  3N0E A;  4PC0 A;  2P9I C;  1K8K C;  2OVQ B;  3EI3 A;  1JMZ B;  2HKR A;  1OLZ A;  4BL0 A;  4PSX B;  5C2V B;  1Q47 A;  3F3P A;  2YBA A;  2XYI A;  2H68 A;  3JAM g;  3OKW A;  2HXC A;  2CE9 A;  4U7A A;  4IMM A;  2Q7Q A;  1B9Y A;  3EI1 B;  4D6V A;  3SHF A;  4IA9 A;  4LG8 A;  3C5M A;  2B5M A;  5EAM A;  4PXW A;  3RLM D;  3C9C A;  2IUR A;  2J57 G;  3I7P A;  4GGA A;  1XHM A;  2IUV A;  3OL2 A;  3DM0 A;  5IT9 g;  2IWK A;  5EML B;  4CI2 A;  4JSN C;  3BG0 A;  4BUJ C;  3A0F A;  2OVP B;  2XL2 A;  5IJ7 E;  1QNI A;  3JRP A;  4QQE A;  4UI9 R;  4O3T B;  2GC7 A;  5GSA A;  1JOF A;  3IJC A;  3UVK A;  4J82 A;  3JB9 L;  4O9D A;  3EMH A;  4FA1 D;  4CI1 A;  4A0B A;  3OKY A;  3RFG A;  4A0A A;  5A2Q g;  3F3F A;  2P9N C;  3I2N A;  2CO0 A;  2TRC B;  4X60 B;  4GQ1 A;  3SBQ A;  3UVN A;  5SXM A;  2YNO A;  2H9N A;  5HYN B;  5IGO A;  1RI6 A;  3AL8 A;  2AH0 A;  2AH1 A;  5HE3 B;  5FKQ A;  4O1Q D;  4GMB A;  5EM2 A;  3EU7 A;  4XYI A;  4J81 A;  5FXY A;  3L4M D;  3MZL A;  1VYH C;  2H9L A;  2CNX A;  2AGX A;  3PVU B;  4A7J A;  5FQD A;  4Y7R A;  1XIP A;  2EBS A;  2HES X;  2AGW A;  4CY5 A;  4CZX A;  1S4U X;  3DXK C;  2PM7 B;  5IC7 A;  1PGU A;  4PBZ A;  5TF2 A;  4Y5R D;  5EMK B;  3SBP A;  5H17 A;  2CN3 A;  3IIW A;  4J87 A;  3VH0 A;  3RN0 D;  2IUP A;  4JSV C;  5I5I A;  2HJB A;  4GQ2 P;  4GGD A;  1MG2 A;  3W15 A;  4XYH A;  3UVO A;  3AH8 B;  4HDJ A;  3SN6 B;  1GOT B;  4A11 B;  2G99 A;  5H14 A;  4ES0 A;  2B5L A;  5TDH B;  3SFZ A;  3SVW D;  3V9F A;  5H1M A;  3PXW D;  3C75 H;  3I8E A;  2I3S A;  4ERZ A;  5K1C C;  3FM0 A;  4O45 A;  3PXS D;  3K27 A;  4K3I D;  4J86 A;  5THA A;  2PM9 B;  4J78 A;  5EAL A;  2AGZ A;  4OZU A;  5IJ8 E;  3PVW B;  2UZX B;  3RN1 D;  3JZH A;  2AGL A;  1PI6 A;  3EI2 A;  4GZ8 A;  4FB1 D;  5CXB A;  2IWF A;  2XL3 A;  2BBK H;  5FKT A;  3MZK A;  4D0K A;  3UVL A;  3PSL A;  2HKM A;  2QC5 A;  5FA5 B;  3MKS B;  4PNK B;  1FWX A;  2YMU A;  2CE8 A;  4JT6 C;  3EI4 B;  4A09 B;  4ZOY A;  1OMW B;  4TZ4 A;  2OK6 A;  4A2M A;  3SMR A;  1SHY B;  1PBY B;  4JD2 C;  4I79 A;  2I0R A;  2HJ4 A;  2I3T A;  3IKO A;  3I7H A;  3L4O D;  2QXV A;  3CFS B;  5TEF A;  1JMX B;  4GM9 A;  3J81 g;  3J80 g;  2H14 A;  4XEI C;  4E5Z B;  3SJL D;  3KRW B;  3UR4 A;  2H9P A;  2H6Q A;  5HQG A;  1GP2 B;  2YNN A;  4JSX C;  4CI8 A;  2AGY A;  1SQJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...