2CE8A

An eh1 peptide bound to the groucho-tle wd40 domain.
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
337
structure length
337
Chain Sequence
DYFQGAMGSKPAYSFHVTADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Recognition of Transcriptional Repressor Motifs by the Wd Domain of the Groucho/Tle Corepressor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulation
molecule keywords TRANSDUCIN-LIKE ENHANCER PROTEIN 1
total genus 85
structure length 337
sequence length 337
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ce8A00
4N14A 4GQ1A 4XYIA 2AGWA 3EMHA 2P9KC 3UVKA 3U4YA 3JPXA 1MDAH 2UZXB 1QNIA 3SXTD 4L9OA 3J81g 3IIWA 5EM2A 3K26A 3EU7A 5IT9g 1OLZA 4H5IA 4O9DA 4QQEA 3C75H 5CXBB 3KRXB 4FA4D 1NEXB 5AFU3 3CFSB 3MZLA 2BBKH 5FA5B 2CN2A 3FRXA 4L3GD 2PM7B 4J87A 1Q47A 1FWXA 3EI1B 2IUQA 2P9LC 4FA5D 4XEIC 2UZYB 3SN6B 1ERJA 5EAPA 3VGZA 4PBYA 5GXHA 4GGCA 2HJBA 4J84A 4NSXA 3RRMC 4A7JA 3OKYA 2P9SC 1P22A 2OVPB 1U4CA 3I7NA 4R7AB 2B5NA 3A0FA 3SFZA 3EI3B 4ZOYA 4Z8LA 4QL1A 2CNXA 1PBYB 2H9MA 1JJUB 2PBIB 4D0KA 2I0RA 3IJ1A 4A2LA 5I5IA 4A08A 3OKTA 1XHMA 4J86A 4LG9A 2H13A 5HE1B 1TYQC 1RI6A 3NVNA 5AMSA 2HJ4A 4A11B 3E0CA 4GGDA 2HYEA 2IAAA 2AGXA 2Z2NA 3SBRA 5H14A 1JMZB 2OVQB 4A2MA 4L1QD 3N0DA 3ZWLB 4CY5A 3OW8A 1MG3A 1SQ9A 4K3ID 2P9NC 3C99A 5TDHB 2P9PC 3OKWA 5FXYA 5CXCB 4ZOXA 3DWLC 4FAVD 3V9FA 4L3HD 3RLMD 2CO0A 2QXVA 3BG1A 5JWZA 4G56B 4A0AB 4OWRA 4U7AA 2PM9A 2J55H 3W15A 3PVUB 5EMJB 2J57G 4J78A 2EBSA 4CI2A 3RN0D 5A2Qg 3CIKB 4ERQA 3I7PA 5GSAA 2AH1A 1PI6A 2G99A 4HDJA 4GM8A 2H68A 3V7DB 2IWFA 2H6KA 4A0AA 4KFMB 5AJAA 4ESGA 3EI4B 5K19A 4CY2A 2Q7QA 1GOTB 2OVRB 1R5MA 2H3XA 3F3FA 3RSEC 5CYKA 2OK4A 3UKUC 2P9UC 2IUPA 3JRPA 3EI4A 1A0RB 4PSWB 2PM6B 3CFVA 1B9XA 3SLED 3K27A 3RN1D 3BWSA 4ERZA 4CI8A 3KRWB 5THAA 3MKQA 3JZGA 1PGUA 4J79A 5GXIA 4A11A 4JD2C 3J80g 4PC0A 1NR0A 3AFCA 4FA1D 2AGLA 2OJYA 2XU7A 4MK0B 3PXTD 3F3GA 2MTAH 3JAMg 1OMWB 4O45A 2O9KA 4GMBA 2B5MA 2P9IC 2TRCB 3RMZD 3IJ0A 3MXXA 2H6NA 4QT8A 3EI2B 3MMYA 1N6FA 2IWKA 5EALA 3ORVD 1SQJA 2GC7A 3EWEA 5EAMA 4E5ZB 3N0EA 4BL0A 3DM0A 4CY1A 3PSCB 4FB1D 5HQGA 1L0QA 3I2NA 4ZOZA 2AH0A 4CZXA 4LG8A 4CC9A 3I7LA 3V5WB 4FAND 5EMLB 5FKRA 2Z2PA 4UI9R 3UVMA 3RFHA 3F3PA 5HYNB 3PSLA 4A0BB 4E54A 4GQ2P 3UVOA 2Z2OA 4ERYA 3GFCA 4J8GA 5IJ7E 3ODTA 4GM9A 1YFQA 2YNPA 4GQBB 3IKOA 3L4OD 2H14A 2G9AA 4A08B 3DXMC 2H47A 1N6DA 2IURA 4J0XA 4QRJA 4A0BA 2XYIA 4E54B 3EI2A 1PEVA 5FLXg 3ULEC 3JB9L 3L4MD 2QC5A 4AEZA 5FKTA 3SBQA 3DXKC 4JSVC 4O3TB 2YB8B 3EG6A 3I8CA 2YMUA 3MZKA 5IGQA 2CE8A 4U1EI 3I7HA 3C9CA 3FM0A 3OL2A 5I5MA 2GNQA 3PVWB 5TEFA 4ES0A 3PXSD 4I79A 4PBZA 2HKRA 2OK6A 2YBAA 2HKMA 3SJLD 1GP2B 1XIPA 3I8EA 5H1MA 4J73A 4D6VA 4J81A 4JT5C 3UVLA 4JT6C 5EMMB 4CY3A 4PNKB 2H9NA 3BG0A 4CZYA 3AL9A 4IA9A 2B5LA 3AL8A 3I7KA 5GMKn 3I7OA 2AQ5A 4AOWA 1MG2A 3UR4A 4FHLA 4X61B 2XL2A 5EM2B 2AGZA 2PM9B 4JSPC 4Y7RA 4BUJC 4X3EA 3JZHA 4Y5RD 4ZN4A 5TF2A 3UKRC 3GREA 3VA6A 2I3TA 4J77A 1TBGA 4A09A 3SHFA 2AGYA 1GG2B 5FKQA 5FKSA 2OIZA 3VH0A 1N6EA 3NVXA 5HE0B 5SXMA 5EMKB 4J82A 4CI1A 2B4EA 3OKYB 1GXRA 3C5MA 2HESX 3SVWD 3DSMA 3FGBA 5IJ8E 4X63B 3UVNA 3AH8B 5B4WA 4E5ZA 4JSNC 3PXWD 5KDOB 1XKSA 5EARA 4A09B 2H6QA 3EI3A 2XL3A 1SHYB 3AL8B 1K32A 4BH6A 4O1QD 5C2WB 4K3JB 5HE2B 5IGOA 4H5JA 2H9PA 4ZOVA 4J8BA 1JMXB 1S4UX 3JZNA 4JSXC 4GZ8A 4LGNA 4JXMA 3IIYA 3OTTA 5FQDA 2CO0C 2CE9A 4GGAA 3PE7A 3IJCA 4FWWA 3SMRA 2I0SA 4J0WA 4EWRA 5TEEA 5C9ZB 2W18A 2IUVA 5CYKB 3P4FA 5H17A 3RFGA 2H9LA 4OZUA 4XYHA 4O3UB 4X60B 4FA9D 3B7FA 3I89A 5CXBA 3NVQA 3SBPA 4GM3A 2YNOA 1JOFA 4TZ4A 2I3SA 4IMMA 4YVDA 3OL2B 2HXCA 2J56H 1B9YA 3EI1A 3HFQA 3JROA 2YNNA 2GC4A 4CI3A 2I0TA 4PXWA 2BCJB 5K1CC 3SWSD 1U2VC 5I5JA 5C2VB 5HE3B 5IC7A 1VYHC 3MKSB 4PSXB 4CZVA 5CXCA 1K8KC 3SCYA 2CN3A
chains in the Genus database with same CATH superfamily
4N14A 4GQ1A 4XYIA 2VDKA 2AGWA 3EMHA 2P9KC 3UVKA 4WK0A 3U4YA 3O4JA 2VC2A 2VDOA 3JPXA 1O6FA 1MDAH 2UZXB 1QNIA 3SXTD 4L9OA 3J81g 3IIWA 3EQ9A 5EM2A 3T3PA 3K26A 3EU7A 5IT9g 1OLZA 4H5IA 4O9DA 4QQEA 3C75H 5CXBB 3IUJA 3KRXB 4FA4D 1NEXB 5AFU3 2EICA 3CFSB 3MZLA 2BBKH 5FA5B 2CN2A 3FRXA 4L3GD 4WK4A 2PM7B 4J87A 1Q47A 1FWXA 3EI1B 1UOOA 4RE5A 2IUQA 2P9LC 4FA5D 4MMXA 4XEIC 2UZYB 3SN6B 1H2YA 1ERJA 5EAPA 3VGZA 2XE4A 4PBYA 5GXHA 4GGCA 2HJBA 4J84A 1A12A 4NSXA 3RRMC 4A7JA 3OKYA 2P9SC 1P22A 2OVPB 1U4CA 3I7NA 4R7AB 2B5NA 3A0FA 3SFZA 4NBMA 3EI3B 4ZOYA 4Z8LA 4QL1A 3V4VA 2CNXA 1PBYB 2H9MA 1JJUB 2PBIB 4D0KA 4Z7QA 2I0RA 3IJ1A 4A2LA 5I5IA 4A08A 3OKTA 1XHMA 4J86A 4LG9A 2H13A 5HE1B 1TYQC 2VDPA 2EIBA 1GOGA 1RI6A 3NVNA 4MMYA 5AMSA 3IUNA 2HJ4A 4A11B 3E0CA 4GGDA 2HYEA 2IAAA 2AGXA 2Z2NA 3SBRA 5H14A 1JMZB 2OVQB 4A2MA 4L1QD 3N0DA 3ZWLB 4BCBA 4CY5A 3OW8A 1MG3A 1SQ9A 4K3ID 2P9NC 4AMYA 3V4PA 3C99A 5TDHB 2P9PC 3OKWA 5FXYA 3K6SA 5CXCB 3IURA 4ZOXA 3DWLC 4FAVD 3V9FA 4Z7OA 4L3HD 2BKLA 3RLMD 1E5TA 2CO0A 2QXVA 3BG1A 5JWZA 4G56B 4A0AB 4OWRA 2QR5A 4U7AA 2PM9A 2J55H 3W15A 3PVUB 5EMJB 1L5GA 2J57G 4J78A 2EBSA 4CI2A 3RN0D 5A2Qg 3CIKB 4BCDA 4QAMA 4ERQA 3I7PA 5GSAA 4MMZA 3QHYB 2AH1A 1PI6A 2G99A 4HDJA 4UM9A 5M5TA 4GM8A 2JKXA 3MUOA 3ZDYA 2H68A 3V7DB 2IWFA 2H6KA 4A0AA 1K3IA 4KFMB 3VI4A 5AJAA 4ESGA 3O4HA 3EI4B 5K19A 4CY2A 2Q7QA 1GOTB 2OVRB 1R5MA 2H3XA 3F3FA 3RSEC 5CYKA 4DNUA 5FFGA 2OK4A 3UKUC 2P9UC 2IUPA 3JRPA 3EI4A 1A0RB 4PSWB 2PM6B 3CFVA 1B9XA 3SLED 3QI0A 1BPOA 1QFSA 3KCIA 3K27A 3RN1D 3BWSA 4ERZA 3EQ7A 4CI8A 3KRWB 5THAA 2WQ8A 3MKQA 3JZGA 1H2WA 1PGUA 4J79A 4D9SA 5GXIA 4A11A 1I2MB 1QFMA 1T2XA 4JD2C 4WJKA 3J80g 4PC0A 1NR0A 3AFCA 4FA1D 2AGLA 2OJYA 2XU7A 3ZDXA 4MK0B 3PXTD 3F3GA 2MTAH 3JAMg 1OMWB 4O45A 1JTDB 2O9KA 4GMBA 2B5MA 2P9IC 3IVMA 2TRCB 3RMZD 4L1MA 3IJ0A 3MXXA 1O6GA 2H6NA 4QT8A 3EI2B 3MMYA 1N6FA 1U8CA 2IWKA 5EALA 1JV2A 3ORVD 1SQJA 4G55A 2GC7A 1VE6A 5M5VA 3EWEA 2XZGA 5EAMA 4NC4A 4E5ZB 3N0EA 4BL0A 3O4GA 4IRZA 3DM0A 4CY1A 3PSCB 4FB1D 1C9LA 5HQGA 3IUQA 1L0QA 3I2NA 4BP8A 4ZOZA 2AH0A 4CZXA 4LG8A 4CC9A 1VZ2A 2XDWA 3I7LA 2VZ1A 3V5WB 4AN0A 4FAND 5EMLB 5FKRA 3MVDK 4BCCA 2Z2PA 4UI9R 1E8MA 4DNVA 4JHPC 3RFHA 3UVMA 3F3PA 5HYNB 3PSLA 4A0BB 4E54A 1VE7A 3FCUA 4GQ2P 3UVOA 2Z2OA 4ERYA 3GFCA 4J8GA 5IJ7E 3ODTA 4GM9A 1YFQA 4BP9A 2YNPA 4GQBB 3IKOA 3L4OD 4G1EA 2H14A 2G9AA 5M61A 4A08B 3DXMC 4AN1A 2H47A 1N6DA 2IURA 1VZ3A 4J0XA 4QRJA 4A0BA 2XYIA 4E54B 3EI2A 1PEVA 4AX4A 5FLXg 2VDRA 3ULEC 5M5UA 3JB9L 5C86A 3L4MD 2QC5A 4AEZA 5FKTA 4NENA 3SBQA 3DXKC 4JSVC 4O3TB 2YB8B 3EG6A 3I8CA 2YMUA 3IULA 3MZKA 5IGQA 2CE8A 4U1EI 3I7HA 3C9CA 3FM0A 3OL2A 4G1MA 5I5MA 2GNQA 3PVWB 5TEFA 4ES0A 3PXSD 4I79A 4PBZA 2HKRA 2QZPA 5HDBA 2OK6A 2YBAA 2HKMA 3SJLD 1GP2B 1XIPA 3I8EA 5H1MA 4J73A 4D6VA 4J81A 4JT5C 3UVLA 4JT6C 5EMMB 5M5SA 4CY3A 3VI3A 4PNKB 2H9NA 3BG0A 4NAAA 2VDQA 4CZYA 3ZDZA 3AL9A 4IA9A 2B5LA 3AL8A 3I7KA 4Z7NA 5GMKn 3I7OA 2AQ5A 1GOHA 4AOWA 1MG2A 3UR4A 4RE6A 4FHLA 3NIFA 2VDMA 4X61B 1E8NA 2EIDA 2XL2A 2VZ3A 5EM2B 2AGZA 1H2XA 2PM9B 4JSPC 2HU7A 2VDNA 4Y7RA 4BUJC 3IUMA 4X3EA 1M1XA 3JZHA 3IJEA 4Y5RD 4ZN4A 5C92A 5TF2A 3UKRC 3GREA 2VDLA 3VA6A 2I3TA 4J77A 1TBGA 4A09A 3SHFA 2AGYA 1GG2B 4O02A 5FKQA 1UOQA 3MUNA 5FKSA 2OIZA 3VH0A 1N6EA 5E6RA 3NVXA 5HE0B 5SXMA 5EMKB 4J82A 4CI1A 2B4EA 3OKYB 1GXRA 3C5MA 2HESX 3SVWD 3GC3B 3DSMA 3FGBA 5IJ8E 4X63B 3UVNA 3AH8B 5B4WA 4E5ZA 4JSNC 3PXWD 5E6UA 5KDOB 1XKSA 5EARA 4A09B 2EIEA 2H6QA 3EI3A 2XL3A 1H2ZA 1SHYB 2HU5A 3O4IA 3AL8B 1K32A 4BH6A 4O1QD 4WK2A 5C2WB 4K3JB 5HE2B 5IGOA 4H5JA 3NIGA 2H9PA 4ZOVA 4J8BA 1JMXB 1S4UX 5FFOA 1TYEA 1YR2A 3JZNA 4JSXC 4GZ8A 4LGNA 4JXMA 3ZE0A 5M5RA 1UOPA 3IIYA 3NIDA 4O2WA 3K72A 3OTTA 5FQDA 2CO0C 2CE9A 4GGAA 3PE7A 3IJCA 4FWWA 3SMRA 2I0SA 4J0WA 4EWRA 5TEEA 4UM8A 5C9ZB 3FCSA 2W18A 2HU8A 2IUVA 5CYKB 3P4FA 3OF7A 3EQ8A 5H17A 3T3MA 4JHNA 5E6SA 3RFGA 2H9LA 4OZUA 4XYHA 4O3UB 4X60B 4FA9D 3B7FA 3I89A 5CXBA 3NVQA 1GOFA 3SBPA 4GM3A 2YNOA 1JOFA 4TZ4A 2I3SA 4IMMA 4YVDA 3OL2B 2HXCA 2J56H 1B9YA 3DDUA 3EI1A 3HFQA 3JROA 4DNWA 2YNNA 2GC4A 4CI3A 2I0TA 1C9IA 4PXWA 2BCJB 4AMZA 3ZE2A 3GD1I 5K1CC 1UTCA 3SWSD 3K71A 1U2VC 5I5JA 5C2VB 3ZE1A 5HE3B 5IC7A 1VYHC 3MKSB 4PSXB 4CZVA 5CXCA 1K8KC 3SCYA 2CN3A
chains in the Genus database with same CATH topology
4N14A 4GQ1A 4XYIA 2AGWA 3EMHA 2P9KC 3UVKA 3U4YA 3JPXA 1MDAH 2UZXB 1QNIA 3SXTD 4L9OA 3J81g 3IIWA 5EM2A 3K26A 3EU7A 5IT9g 1OLZA 4H5IA 4O9DA 4QQEA 3C75H 5CXBB 3KRXB 4FA4D 1NEXB 5AFU3 3CFSB 3MZLA 2BBKH 5FA5B 2CN2A 3FRXA 4L3GD 2PM7B 4J87A 1Q47A 1FWXA 3EI1B 2IUQA 2P9LC 4FA5D 4XEIC 2UZYB 3SN6B 1ERJA 5EAPA 3VGZA 4PBYA 5GXHA 4GGCA 2HJBA 4J84A 4NSXA 3RRMC 4A7JA 3OKYA 2P9SC 1P22A 2OVPB 1U4CA 3I7NA 4R7AB 2B5NA 3A0FA 3SFZA 3EI3B 4ZOYA 4Z8LA 4QL1A 2CNXA 1PBYB 2H9MA 1JJUB 2PBIB 4D0KA 2I0RA 3IJ1A 4A2LA 5I5IA 4A08A 3OKTA 1XHMA 4J86A 4LG9A 2H13A 5HE1B 1TYQC 1RI6A 3NVNA 5AMSA 2HJ4A 4A11B 3E0CA 4GGDA 2HYEA 2IAAA 2AGXA 2Z2NA 3SBRA 5H14A 1JMZB 2OVQB 4A2MA 4L1QD 3N0DA 3ZWLB 4CY5A 3OW8A 1MG3A 1SQ9A 4K3ID 2P9NC 3C99A 5TDHB 2P9PC 3OKWA 5FXYA 5CXCB 4ZOXA 3DWLC 4FAVD 3V9FA 4L3HD 3RLMD 2CO0A 2QXVA 3BG1A 5JWZA 4G56B 4A0AB 4OWRA 4U7AA 2PM9A 2J55H 3W15A 3PVUB 5EMJB 2J57G 4J78A 2EBSA 4CI2A 3RN0D 5A2Qg 3CIKB 4ERQA 3I7PA 5GSAA 2AH1A 1PI6A 2G99A 4HDJA 4GM8A 2H68A 3V7DB 2IWFA 2H6KA 4A0AA 4KFMB 5AJAA 4ESGA 3EI4B 5K19A 4CY2A 2Q7QA 1GOTB 2OVRB 1R5MA 2H3XA 3F3FA 3RSEC 5CYKA 2OK4A 3UKUC 2P9UC 2IUPA 3JRPA 3EI4A 1A0RB 4PSWB 2PM6B 3CFVA 1B9XA 3SLED 3K27A 3RN1D 3BWSA 4ERZA 4CI8A 3KRWB 5THAA 3MKQA 3JZGA 1PGUA 4J79A 5GXIA 4A11A 4JD2C 3J80g 4PC0A 1NR0A 3AFCA 4FA1D 2AGLA 2OJYA 2XU7A 4MK0B 3PXTD 3F3GA 2MTAH 3JAMg 1OMWB 4O45A 2O9KA 4GMBA 2B5MA 2P9IC 2TRCB 3RMZD 3IJ0A 3MXXA 2H6NA 4QT8A 3EI2B 3MMYA 1N6FA 2IWKA 5EALA 3ORVD 1SQJA 2GC7A 3EWEA 5EAMA 4E5ZB 3N0EA 4BL0A 3DM0A 4CY1A 3PSCB 4FB1D 5HQGA 1L0QA 3I2NA 4ZOZA 2AH0A 4CZXA 4LG8A 4CC9A 3I7LA 3V5WB 4FAND 5EMLB 5FKRA 2Z2PA 4UI9R 3UVMA 3RFHA 3F3PA 5HYNB 3PSLA 4A0BB 4E54A 4GQ2P 3UVOA 2Z2OA 4ERYA 3GFCA 4J8GA 5IJ7E 3ODTA 4GM9A 1YFQA 2YNPA 4GQBB 3IKOA 3L4OD 2H14A 2G9AA 4A08B 3DXMC 2H47A 1N6DA 2IURA 4J0XA 4QRJA 4A0BA 2XYIA 4E54B 3EI2A 1PEVA 5FLXg 3ULEC 3JB9L 3L4MD 2QC5A 4AEZA 5FKTA 3SBQA 3DXKC 4JSVC 4O3TB 2YB8B 3EG6A 3I8CA 2YMUA 3MZKA 5IGQA 2CE8A 4U1EI 3I7HA 3C9CA 3FM0A 3OL2A 5I5MA 2GNQA 3PVWB 5TEFA 4ES0A 3PXSD 4I79A 4PBZA 2HKRA 2OK6A 2YBAA 2HKMA 3SJLD 1GP2B 1XIPA 3I8EA 5H1MA 4J73A 4D6VA 4J81A 4JT5C 3UVLA 4JT6C 5EMMB 4CY3A 4PNKB 2H9NA 3BG0A 4CZYA 3AL9A 4IA9A 2B5LA 3AL8A 3I7KA 5GMKn 3I7OA 2AQ5A 4AOWA 1MG2A 3UR4A 4FHLA 4X61B 2XL2A 5EM2B 2AGZA 2PM9B 4JSPC 4Y7RA 4BUJC 4X3EA 3JZHA 4Y5RD 4ZN4A 5TF2A 3UKRC 3GREA 3VA6A 2I3TA 4J77A 1TBGA 4A09A 3SHFA 2AGYA 1GG2B 5FKQA 5FKSA 2OIZA 3VH0A 1N6EA 3NVXA 5HE0B 5SXMA 5EMKB 4J82A 4CI1A 2B4EA 3OKYB 1GXRA 3C5MA 2HESX 3SVWD 3DSMA 3FGBA 5IJ8E 4X63B 3UVNA 3AH8B 5B4WA 4E5ZA 4JSNC 3PXWD 5KDOB 1XKSA 5EARA 4A09B 2H6QA 3EI3A 2XL3A 1SHYB 3AL8B 1K32A 4BH6A 4O1QD 5C2WB 4K3JB 5HE2B 5IGOA 4H5JA 2H9PA 4ZOVA 4J8BA 1JMXB 1S4UX 3JZNA 4JSXC 4GZ8A 4LGNA 4JXMA 3IIYA 3OTTA 5FQDA 2CO0C 2CE9A 4GGAA 3PE7A 3IJCA 4FWWA 3SMRA 2I0SA 4J0WA 4EWRA 5TEEA 5C9ZB 2W18A 2IUVA 5CYKB 3P4FA 5H17A 3RFGA 2H9LA 4OZUA 4XYHA 4O3UB 4X60B 4FA9D 3B7FA 3I89A 5CXBA 3NVQA 3SBPA 4GM3A 2YNOA 1JOFA 4TZ4A 2I3SA 4IMMA 4YVDA 3OL2B 2HXCA 2J56H 1B9YA 3EI1A 3HFQA 3JROA 2YNNA 2GC4A 4CI3A 2I0TA 4PXWA 2BCJB 5K1CC 3SWSD 1U2VC 5I5JA 5C2VB 5HE3B 5IC7A 1VYHC 3MKSB 4PSXB 4CZVA 5CXCA 1K8KC 3SCYA 2CN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N14 A;  4GQ1 A;  4XYI A;  2AGW A;  3EMH A;  2P9K C;  3UVK A;  3U4Y A;  3JPX A;  1MDA H;  2UZX B;  1QNI A;  3SXT D;  4L9O A;  3J81 g;  3IIW A;  5EM2 A;  3K26 A;  3EU7 A;  5IT9 g;  1OLZ A;  4H5I A;  4O9D A;  4QQE A;  3C75 H;  5CXB B;  3KRX B;  4FA4 D;  1NEX B;  5AFU 3;  3CFS B;  3MZL A;  2BBK H;  5FA5 B;  2CN2 A;  3FRX A;  4L3G D;  2PM7 B;  4J87 A;  1Q47 A;  1FWX A;  3EI1 B;  2IUQ A;  2P9L C;  4FA5 D;  4XEI C;  2UZY B;  3SN6 B;  1ERJ A;  5EAP A;  3VGZ A;  4PBY A;  5GXH A;  4GGC A;  2HJB A;  4J84 A;  4NSX A;  3RRM C;  4A7J A;  3OKY A;  2P9S C;  1P22 A;  2OVP B;  1U4C A;  3I7N A;  4R7A B;  2B5N A;  3A0F A;  3SFZ A;  3EI3 B;  4ZOY A;  4Z8L A;  4QL1 A;  2CNX A;  1PBY B;  2H9M A;  1JJU B;  2PBI B;  4D0K A;  2I0R A;  3IJ1 A;  4A2L A;  5I5I A;  4A08 A;  3OKT A;  1XHM A;  4J86 A;  4LG9 A;  2H13 A;  5HE1 B;  1TYQ C;  1RI6 A;  3NVN A;  5AMS A;  2HJ4 A;  4A11 B;  3E0C A;  4GGD A;  2HYE A;  2IAA A;  2AGX A;  2Z2N A;  3SBR A;  5H14 A;  1JMZ B;  2OVQ B;  4A2M A;  4L1Q D;  3N0D A;  3ZWL B;  4CY5 A;  3OW8 A;  1MG3 A;  1SQ9 A;  4K3I D;  2P9N C;  3C99 A;  5TDH B;  2P9P C;  3OKW A;  5FXY A;  5CXC B;  4ZOX A;  3DWL C;  4FAV D;  3V9F A;  4L3H D;  3RLM D;  2CO0 A;  2QXV A;  3BG1 A;  5JWZ A;  4G56 B;  4A0A B;  4OWR A;  4U7A A;  2PM9 A;  2J55 H;  3W15 A;  3PVU B;  5EMJ B;  2J57 G;  4J78 A;  2EBS A;  4CI2 A;  3RN0 D;  5A2Q g;  3CIK B;  4ERQ A;  3I7P A;  5GSA A;  2AH1 A;  1PI6 A;  2G99 A;  4HDJ A;  4GM8 A;  2H68 A;  3V7D B;  2IWF A;  2H6K A;  4A0A A;  4KFM B;  5AJA A;  4ESG A;  3EI4 B;  5K19 A;  4CY2 A;  2Q7Q A;  1GOT B;  2OVR B;  1R5M A;  2H3X A;  3F3F A;  3RSE C;  5CYK A;  2OK4 A;  3UKU C;  2P9U C;  2IUP A;  3JRP A;  3EI4 A;  1A0R B;  4PSW B;  2PM6 B;  3CFV A;  1B9X A;  3SLE D;  3K27 A;  3RN1 D;  3BWS A;  4ERZ A;  4CI8 A;  3KRW B;  5THA A;  3MKQ A;  3JZG A;  1PGU A;  4J79 A;  5GXI A;  4A11 A;  4JD2 C;  3J80 g;  4PC0 A;  1NR0 A;  3AFC A;  4FA1 D;  2AGL A;  2OJY A;  2XU7 A;  4MK0 B;  3PXT D;  3F3G A;  2MTA H;  3JAM g;  1OMW B;  4O45 A;  2O9K A;  4GMB A;  2B5M A;  2P9I C;  2TRC B;  3RMZ D;  3IJ0 A;  3MXX A;  2H6N A;  4QT8 A;  3EI2 B;  3MMY A;  1N6F A;  2IWK A;  5EAL A;  3ORV D;  1SQJ A;  2GC7 A;  3EWE A;  5EAM A;  4E5Z B;  3N0E A;  4BL0 A;  3DM0 A;  4CY1 A;  3PSC B;  4FB1 D;  5HQG A;  1L0Q A;  3I2N A;  4ZOZ A;  2AH0 A;  4CZX A;  4LG8 A;  4CC9 A;  3I7L A;  3V5W B;  4FAN D;  5EML B;  5FKR A;  2Z2P A;  4UI9 R;  3UVM A;  3RFH A;  3F3P A;  5HYN B;  3PSL A;  4A0B B;  4E54 A;  4GQ2 P;  3UVO A;  2Z2O A;  4ERY A;  3GFC A;  4J8G A;  5IJ7 E;  3ODT A;  4GM9 A;  1YFQ A;  2YNP A;  4GQB B;  3IKO A;  3L4O D;  2H14 A;  2G9A A;  4A08 B;  3DXM C;  2H47 A;  1N6D A;  2IUR A;  4J0X A;  4QRJ A;  4A0B A;  2XYI A;  4E54 B;  3EI2 A;  1PEV A;  5FLX g;  3ULE C;  3JB9 L;  3L4M D;  2QC5 A;  4AEZ A;  5FKT A;  3SBQ A;  3DXK C;  4JSV C;  4O3T B;  2YB8 B;  3EG6 A;  3I8C A;  2YMU A;  3MZK A;  5IGQ A;  2CE8 A;  4U1E I;  3I7H A;  3C9C A;  3FM0 A;  3OL2 A;  5I5M A;  2GNQ A;  3PVW B;  5TEF A;  4ES0 A;  3PXS D;  4I79 A;  4PBZ A;  2HKR A;  2OK6 A;  2YBA A;  2HKM A;  3SJL D;  1GP2 B;  1XIP A;  3I8E A;  5H1M A;  4J73 A;  4D6V A;  4J81 A;  4JT5 C;  3UVL A;  4JT6 C;  5EMM B;  4CY3 A;  4PNK B;  2H9N A;  3BG0 A;  4CZY A;  3AL9 A;  4IA9 A;  2B5L A;  3AL8 A;  3I7K A;  5GMK n;  3I7O A;  2AQ5 A;  4AOW A;  1MG2 A;  3UR4 A;  4FHL A;  4X61 B;  2XL2 A;  5EM2 B;  2AGZ A;  2PM9 B;  4JSP C;  4Y7R A;  4BUJ C;  4X3E A;  3JZH A;  4Y5R D;  4ZN4 A;  5TF2 A;  3UKR C;  3GRE A;  3VA6 A;  2I3T A;  4J77 A;  1TBG A;  4A09 A;  3SHF A;  2AGY A;  1GG2 B;  5FKQ A;  5FKS A;  2OIZ A;  3VH0 A;  1N6E A;  3NVX A;  5HE0 B;  5SXM A;  5EMK B;  4J82 A;  4CI1 A;  2B4E A;  3OKY B;  1GXR A;  3C5M A;  2HES X;  3SVW D;  3DSM A;  3FGB A;  5IJ8 E;  4X63 B;  3UVN A;  3AH8 B;  5B4W A;  4E5Z A;  4JSN C;  3PXW D;  5KDO B;  1XKS A;  5EAR A;  4A09 B;  2H6Q A;  3EI3 A;  2XL3 A;  1SHY B;  3AL8 B;  1K32 A;  4BH6 A;  4O1Q D;  5C2W B;  4K3J B;  5HE2 B;  5IGO A;  4H5J A;  2H9P A;  4ZOV A;  4J8B A;  1JMX B;  1S4U X;  3JZN A;  4JSX C;  4GZ8 A;  4LGN A;  4JXM A;  3IIY A;  3OTT A;  5FQD A;  2CO0 C;  2CE9 A;  4GGA A;  3PE7 A;  3IJC A;  4FWW A;  3SMR A;  2I0S A;  4J0W A;  4EWR A;  5TEE A;  5C9Z B;  2W18 A;  2IUV A;  5CYK B;  3P4F A;  5H17 A;  3RFG A;  2H9L A;  4OZU A;  4XYH A;  4O3U B;  4X60 B;  4FA9 D;  3B7F A;  3I89 A;  5CXB A;  3NVQ A;  3SBP A;  4GM3 A;  2YNO A;  1JOF A;  4TZ4 A;  2I3S A;  4IMM A;  4YVD A;  3OL2 B;  2HXC A;  2J56 H;  1B9Y A;  3EI1 A;  3HFQ A;  3JRO A;  2YNN A;  2GC4 A;  4CI3 A;  2I0T A;  4PXW A;  2BCJ B;  5K1C C;  3SWS D;  1U2V C;  5I5J A;  5C2V B;  5HE3 B;  5IC7 A;  1VYH C;  3MKS B;  4PSX B;  4CZV A;  5CXC A;  1K8K C;  3SCY A;  2CN3 A; 
#chains in the Genus database with same CATH topology
 4N14 A;  4GQ1 A;  4XYI A;  2VDK A;  2AGW A;  3EMH A;  2P9K C;  3UVK A;  4WK0 A;  3U4Y A;  3O4J A;  2VC2 A;  2VDO A;  3JPX A;  1O6F A;  1MDA H;  2UZX B;  1QNI A;  3SXT D;  4L9O A;  3J81 g;  3IIW A;  3EQ9 A;  5EM2 A;  3T3P A;  3K26 A;  3EU7 A;  5IT9 g;  1OLZ A;  4H5I A;  4O9D A;  4QQE A;  3C75 H;  5CXB B;  3IUJ A;  3KRX B;  4FA4 D;  1NEX B;  5AFU 3;  2EIC A;  3CFS B;  3MZL A;  2BBK H;  5FA5 B;  2CN2 A;  3FRX A;  4L3G D;  4WK4 A;  2PM7 B;  4J87 A;  1Q47 A;  1FWX A;  3EI1 B;  1UOO A;  4RE5 A;  2IUQ A;  2P9L C;  4FA5 D;  4MMX A;  4XEI C;  2UZY B;  3SN6 B;  1H2Y A;  1ERJ A;  5EAP A;  3VGZ A;  2XE4 A;  4PBY A;  5GXH A;  4GGC A;  2HJB A;  4J84 A;  1A12 A;  4NSX A;  3RRM C;  4A7J A;  3OKY A;  2P9S C;  1P22 A;  2OVP B;  1U4C A;  3I7N A;  4R7A B;  2B5N A;  3A0F A;  3SFZ A;  4NBM A;  3EI3 B;  4ZOY A;  4Z8L A;  4QL1 A;  3V4V A;  2CNX A;  1PBY B;  2H9M A;  1JJU B;  2PBI B;  4D0K A;  4Z7Q A;  2I0R A;  3IJ1 A;  4A2L A;  5I5I A;  4A08 A;  3OKT A;  1XHM A;  4J86 A;  4LG9 A;  2H13 A;  5HE1 B;  1TYQ C;  2VDP A;  2EIB A;  1GOG A;  1RI6 A;  3NVN A;  4MMY A;  5AMS A;  3IUN A;  2HJ4 A;  4A11 B;  3E0C A;  4GGD A;  2HYE A;  2IAA A;  2AGX A;  2Z2N A;  3SBR A;  5H14 A;  1JMZ B;  2OVQ B;  4A2M A;  4L1Q D;  3N0D A;  3ZWL B;  4BCB A;  4CY5 A;  3OW8 A;  1MG3 A;  1SQ9 A;  4K3I D;  2P9N C;  4AMY A;  3V4P A;  3C99 A;  5TDH B;  2P9P C;  3OKW A;  5FXY A;  3K6S A;  5CXC B;  3IUR A;  4ZOX A;  3DWL C;  4FAV D;  3V9F A;  4Z7O A;  4L3H D;  2BKL A;  3RLM D;  1E5T A;  2CO0 A;  2QXV A;  3BG1 A;  5JWZ A;  4G56 B;  4A0A B;  4OWR A;  2QR5 A;  4U7A A;  2PM9 A;  2J55 H;  3W15 A;  3PVU B;  5EMJ B;  1L5G A;  2J57 G;  4J78 A;  2EBS A;  4CI2 A;  3RN0 D;  5A2Q g;  3CIK B;  4BCD A;  4QAM A;  4ERQ A;  3I7P A;  5GSA A;  4MMZ A;  3QHY B;  2AH1 A;  1PI6 A;  2G99 A;  4HDJ A;  4UM9 A;  5M5T A;  4GM8 A;  2JKX A;  3MUO A;  3ZDY A;  2H68 A;  3V7D B;  2IWF A;  2H6K A;  4A0A A;  1K3I A;  4KFM B;  3VI4 A;  5AJA A;  4ESG A;  3O4H A;  3EI4 B;  5K19 A;  4CY2 A;  2Q7Q A;  1GOT B;  2OVR B;  1R5M A;  2H3X A;  3F3F A;  3RSE C;  5CYK A;  4DNU A;  5FFG A;  2OK4 A;  3UKU C;  2P9U C;  2IUP A;  3JRP A;  3EI4 A;  1A0R B;  4PSW B;  2PM6 B;  3CFV A;  1B9X A;  3SLE D;  3QI0 A;  1BPO A;  1QFS A;  3KCI A;  3K27 A;  3RN1 D;  3BWS A;  4ERZ A;  3EQ7 A;  4CI8 A;  3KRW B;  5THA A;  2WQ8 A;  3MKQ A;  3JZG A;  1H2W A;  1PGU A;  4J79 A;  4D9S A;  5GXI A;  4A11 A;  1I2M B;  1QFM A;  1T2X A;  4JD2 C;  4WJK A;  3J80 g;  4PC0 A;  1NR0 A;  3AFC A;  4FA1 D;  2AGL A;  2OJY A;  2XU7 A;  3ZDX A;  4MK0 B;  3PXT D;  3F3G A;  2MTA H;  3JAM g;  1OMW B;  4O45 A;  1JTD B;  2O9K A;  4GMB A;  2B5M A;  2P9I C;  3IVM A;  2TRC B;  3RMZ D;  4L1M A;  3IJ0 A;  3MXX A;  1O6G A;  2H6N A;  4QT8 A;  3EI2 B;  3MMY A;  1N6F A;  1U8C A;  2IWK A;  5EAL A;  1JV2 A;  3ORV D;  1SQJ A;  4G55 A;  2GC7 A;  1VE6 A;  5M5V A;  3EWE A;  2XZG A;  5EAM A;  4NC4 A;  4E5Z B;  3N0E A;  4BL0 A;  3O4G A;  4IRZ A;  3DM0 A;  4CY1 A;  3PSC B;  4FB1 D;  1C9L A;  5HQG A;  3IUQ A;  1L0Q A;  3I2N A;  4BP8 A;  4ZOZ A;  2AH0 A;  4CZX A;  4LG8 A;  4CC9 A;  1VZ2 A;  2XDW A;  3I7L A;  2VZ1 A;  3V5W B;  4AN0 A;  4FAN D;  5EML B;  5FKR A;  3MVD K;  4BCC A;  2Z2P A;  4UI9 R;  1E8M A;  4DNV A;  4JHP C;  3RFH A;  3UVM A;  3F3P A;  5HYN B;  3PSL A;  4A0B B;  4E54 A;  1VE7 A;  3FCU A;  4GQ2 P;  3UVO A;  2Z2O A;  4ERY A;  3GFC A;  4J8G A;  5IJ7 E;  3ODT A;  4GM9 A;  1YFQ A;  4BP9 A;  2YNP A;  4GQB B;  3IKO A;  3L4O D;  4G1E A;  2H14 A;  2G9A A;  5M61 A;  4A08 B;  3DXM C;  4AN1 A;  2H47 A;  1N6D A;  2IUR A;  1VZ3 A;  4J0X A;  4QRJ A;  4A0B A;  2XYI A;  4E54 B;  3EI2 A;  1PEV A;  4AX4 A;  5FLX g;  2VDR A;  3ULE C;  5M5U A;  3JB9 L;  5C86 A;  3L4M D;  2QC5 A;  4AEZ A;  5FKT A;  4NEN A;  3SBQ A;  3DXK C;  4JSV C;  4O3T B;  2YB8 B;  3EG6 A;  3I8C A;  2YMU A;  3IUL A;  3MZK A;  5IGQ A;  2CE8 A;  4U1E I;  3I7H A;  3C9C A;  3FM0 A;  3OL2 A;  4G1M A;  5I5M A;  2GNQ A;  3PVW B;  5TEF A;  4ES0 A;  3PXS D;  4I79 A;  4PBZ A;  2HKR A;  2QZP A;  5HDB A;  2OK6 A;  2YBA A;  2HKM A;  3SJL D;  1GP2 B;  1XIP A;  3I8E A;  5H1M A;  4J73 A;  4D6V A;  4J81 A;  4JT5 C;  3UVL A;  4JT6 C;  5EMM B;  5M5S A;  4CY3 A;  3VI3 A;  4PNK B;  2H9N A;  3BG0 A;  4NAA A;  2VDQ A;  4CZY A;  3ZDZ A;  3AL9 A;  4IA9 A;  2B5L A;  3AL8 A;  3I7K A;  4Z7N A;  5GMK n;  3I7O A;  2AQ5 A;  1GOH A;  4AOW A;  1MG2 A;  3UR4 A;  4RE6 A;  4FHL A;  3NIF A;  2VDM A;  4X61 B;  1E8N A;  2EID A;  2XL2 A;  2VZ3 A;  5EM2 B;  2AGZ A;  1H2X A;  2PM9 B;  4JSP C;  2HU7 A;  2VDN A;  4Y7R A;  4BUJ C;  3IUM A;  4X3E A;  1M1X A;  3JZH A;  3IJE A;  4Y5R D;  4ZN4 A;  5C92 A;  5TF2 A;  3UKR C;  3GRE A;  2VDL A;  3VA6 A;  2I3T A;  4J77 A;  1TBG A;  4A09 A;  3SHF A;  2AGY A;  1GG2 B;  4O02 A;  5FKQ A;  1UOQ A;  3MUN A;  5FKS A;  2OIZ A;  3VH0 A;  1N6E A;  5E6R A;  3NVX A;  5HE0 B;  5SXM A;  5EMK B;  4J82 A;  4CI1 A;  2B4E A;  3OKY B;  1GXR A;  3C5M A;  2HES X;  3SVW D;  3GC3 B;  3DSM A;  3FGB A;  5IJ8 E;  4X63 B;  3UVN A;  3AH8 B;  5B4W A;  4E5Z A;  4JSN C;  3PXW D;  5E6U A;  5KDO B;  1XKS A;  5EAR A;  4A09 B;  2EIE A;  2H6Q A;  3EI3 A;  2XL3 A;  1H2Z A;  1SHY B;  2HU5 A;  3O4I A;  3AL8 B;  1K32 A;  4BH6 A;  4O1Q D;  4WK2 A;  5C2W B;  4K3J B;  5HE2 B;  5IGO A;  4H5J A;  3NIG A;  2H9P A;  4ZOV A;  4J8B A;  1JMX B;  1S4U X;  5FFO A;  1TYE A;  1YR2 A;  3JZN A;  4JSX C;  4GZ8 A;  4LGN A;  4JXM A;  3ZE0 A;  5M5R A;  1UOP A;  3IIY A;  3NID A;  4O2W A;  3K72 A;  3OTT A;  5FQD A;  2CO0 C;  2CE9 A;  4GGA A;  3PE7 A;  3IJC A;  4FWW A;  3SMR A;  2I0S A;  4J0W A;  4EWR A;  5TEE A;  4UM8 A;  5C9Z B;  3FCS A;  2W18 A;  2HU8 A;  2IUV A;  5CYK B;  3P4F A;  3OF7 A;  3EQ8 A;  5H17 A;  3T3M A;  4JHN A;  5E6S A;  3RFG A;  2H9L A;  4OZU A;  4XYH A;  4O3U B;  4X60 B;  4FA9 D;  3B7F A;  3I89 A;  5CXB A;  3NVQ A;  1GOF A;  3SBP A;  4GM3 A;  2YNO A;  1JOF A;  4TZ4 A;  2I3S A;  4IMM A;  4YVD A;  3OL2 B;  2HXC A;  2J56 H;  1B9Y A;  3DDU A;  3EI1 A;  3HFQ A;  3JRO A;  4DNW A;  2YNN A;  2GC4 A;  4CI3 A;  2I0T A;  1C9I A;  4PXW A;  2BCJ B;  4AMZ A;  3ZE2 A;  3GD1 I;  5K1C C;  1UTC A;  3SWS D;  3K71 A;  1U2V C;  5I5J A;  5C2V B;  3ZE1 A;  5HE3 B;  5IC7 A;  1VYH C;  3MKS B;  4PSX B;  4CZV A;  5CXC A;  1K8K C;  3SCY A;  2CN3 A; 
#chains in the Genus database with same CATH homology
 4N14 A;  4GQ1 A;  4XYI A;  2AGW A;  3EMH A;  2P9K C;  3UVK A;  3U4Y A;  3JPX A;  1MDA H;  2UZX B;  1QNI A;  3SXT D;  4L9O A;  3J81 g;  3IIW A;  5EM2 A;  3K26 A;  3EU7 A;  5IT9 g;  1OLZ A;  4H5I A;  4O9D A;  4QQE A;  3C75 H;  5CXB B;  3KRX B;  4FA4 D;  1NEX B;  5AFU 3;  3CFS B;  3MZL A;  2BBK H;  5FA5 B;  2CN2 A;  3FRX A;  4L3G D;  2PM7 B;  4J87 A;  1Q47 A;  1FWX A;  3EI1 B;  2IUQ A;  2P9L C;  4FA5 D;  4XEI C;  2UZY B;  3SN6 B;  1ERJ A;  5EAP A;  3VGZ A;  4PBY A;  5GXH A;  4GGC A;  2HJB A;  4J84 A;  4NSX A;  3RRM C;  4A7J A;  3OKY A;  2P9S C;  1P22 A;  2OVP B;  1U4C A;  3I7N A;  4R7A B;  2B5N A;  3A0F A;  3SFZ A;  3EI3 B;  4ZOY A;  4Z8L A;  4QL1 A;  2CNX A;  1PBY B;  2H9M A;  1JJU B;  2PBI B;  4D0K A;  2I0R A;  3IJ1 A;  4A2L A;  5I5I A;  4A08 A;  3OKT A;  1XHM A;  4J86 A;  4LG9 A;  2H13 A;  5HE1 B;  1TYQ C;  1RI6 A;  3NVN A;  5AMS A;  2HJ4 A;  4A11 B;  3E0C A;  4GGD A;  2HYE A;  2IAA A;  2AGX A;  2Z2N A;  3SBR A;  5H14 A;  1JMZ B;  2OVQ B;  4A2M A;  4L1Q D;  3N0D A;  3ZWL B;  4CY5 A;  3OW8 A;  1MG3 A;  1SQ9 A;  4K3I D;  2P9N C;  3C99 A;  5TDH B;  2P9P C;  3OKW A;  5FXY A;  5CXC B;  4ZOX A;  3DWL C;  4FAV D;  3V9F A;  4L3H D;  3RLM D;  2CO0 A;  2QXV A;  3BG1 A;  5JWZ A;  4G56 B;  4A0A B;  4OWR A;  4U7A A;  2PM9 A;  2J55 H;  3W15 A;  3PVU B;  5EMJ B;  2J57 G;  4J78 A;  2EBS A;  4CI2 A;  3RN0 D;  5A2Q g;  3CIK B;  4ERQ A;  3I7P A;  5GSA A;  2AH1 A;  1PI6 A;  2G99 A;  4HDJ A;  4GM8 A;  2H68 A;  3V7D B;  2IWF A;  2H6K A;  4A0A A;  4KFM B;  5AJA A;  4ESG A;  3EI4 B;  5K19 A;  4CY2 A;  2Q7Q A;  1GOT B;  2OVR B;  1R5M A;  2H3X A;  3F3F A;  3RSE C;  5CYK A;  2OK4 A;  3UKU C;  2P9U C;  2IUP A;  3JRP A;  3EI4 A;  1A0R B;  4PSW B;  2PM6 B;  3CFV A;  1B9X A;  3SLE D;  3K27 A;  3RN1 D;  3BWS A;  4ERZ A;  4CI8 A;  3KRW B;  5THA A;  3MKQ A;  3JZG A;  1PGU A;  4J79 A;  5GXI A;  4A11 A;  4JD2 C;  3J80 g;  4PC0 A;  1NR0 A;  3AFC A;  4FA1 D;  2AGL A;  2OJY A;  2XU7 A;  4MK0 B;  3PXT D;  3F3G A;  2MTA H;  3JAM g;  1OMW B;  4O45 A;  2O9K A;  4GMB A;  2B5M A;  2P9I C;  2TRC B;  3RMZ D;  3IJ0 A;  3MXX A;  2H6N A;  4QT8 A;  3EI2 B;  3MMY A;  1N6F A;  2IWK A;  5EAL A;  3ORV D;  1SQJ A;  2GC7 A;  3EWE A;  5EAM A;  4E5Z B;  3N0E A;  4BL0 A;  3DM0 A;  4CY1 A;  3PSC B;  4FB1 D;  5HQG A;  1L0Q A;  3I2N A;  4ZOZ A;  2AH0 A;  4CZX A;  4LG8 A;  4CC9 A;  3I7L A;  3V5W B;  4FAN D;  5EML B;  5FKR A;  2Z2P A;  4UI9 R;  3UVM A;  3RFH A;  3F3P A;  5HYN B;  3PSL A;  4A0B B;  4E54 A;  4GQ2 P;  3UVO A;  2Z2O A;  4ERY A;  3GFC A;  4J8G A;  5IJ7 E;  3ODT A;  4GM9 A;  1YFQ A;  2YNP A;  4GQB B;  3IKO A;  3L4O D;  2H14 A;  2G9A A;  4A08 B;  3DXM C;  2H47 A;  1N6D A;  2IUR A;  4J0X A;  4QRJ A;  4A0B A;  2XYI A;  4E54 B;  3EI2 A;  1PEV A;  5FLX g;  3ULE C;  3JB9 L;  3L4M D;  2QC5 A;  4AEZ A;  5FKT A;  3SBQ A;  3DXK C;  4JSV C;  4O3T B;  2YB8 B;  3EG6 A;  3I8C A;  2YMU A;  3MZK A;  5IGQ A;  2CE8 A;  4U1E I;  3I7H A;  3C9C A;  3FM0 A;  3OL2 A;  5I5M A;  2GNQ A;  3PVW B;  5TEF A;  4ES0 A;  3PXS D;  4I79 A;  4PBZ A;  2HKR A;  2OK6 A;  2YBA A;  2HKM A;  3SJL D;  1GP2 B;  1XIP A;  3I8E A;  5H1M A;  4J73 A;  4D6V A;  4J81 A;  4JT5 C;  3UVL A;  4JT6 C;  5EMM B;  4CY3 A;  4PNK B;  2H9N A;  3BG0 A;  4CZY A;  3AL9 A;  4IA9 A;  2B5L A;  3AL8 A;  3I7K A;  5GMK n;  3I7O A;  2AQ5 A;  4AOW A;  1MG2 A;  3UR4 A;  4FHL A;  4X61 B;  2XL2 A;  5EM2 B;  2AGZ A;  2PM9 B;  4JSP C;  4Y7R A;  4BUJ C;  4X3E A;  3JZH A;  4Y5R D;  4ZN4 A;  5TF2 A;  3UKR C;  3GRE A;  3VA6 A;  2I3T A;  4J77 A;  1TBG A;  4A09 A;  3SHF A;  2AGY A;  1GG2 B;  5FKQ A;  5FKS A;  2OIZ A;  3VH0 A;  1N6E A;  3NVX A;  5HE0 B;  5SXM A;  5EMK B;  4J82 A;  4CI1 A;  2B4E A;  3OKY B;  1GXR A;  3C5M A;  2HES X;  3SVW D;  3DSM A;  3FGB A;  5IJ8 E;  4X63 B;  3UVN A;  3AH8 B;  5B4W A;  4E5Z A;  4JSN C;  3PXW D;  5KDO B;  1XKS A;  5EAR A;  4A09 B;  2H6Q A;  3EI3 A;  2XL3 A;  1SHY B;  3AL8 B;  1K32 A;  4BH6 A;  4O1Q D;  5C2W B;  4K3J B;  5HE2 B;  5IGO A;  4H5J A;  2H9P A;  4ZOV A;  4J8B A;  1JMX B;  1S4U X;  3JZN A;  4JSX C;  4GZ8 A;  4LGN A;  4JXM A;  3IIY A;  3OTT A;  5FQD A;  2CO0 C;  2CE9 A;  4GGA A;  3PE7 A;  3IJC A;  4FWW A;  3SMR A;  2I0S A;  4J0W A;  4EWR A;  5TEE A;  5C9Z B;  2W18 A;  2IUV A;  5CYK B;  3P4F A;  5H17 A;  3RFG A;  2H9L A;  4OZU A;  4XYH A;  4O3U B;  4X60 B;  4FA9 D;  3B7F A;  3I89 A;  5CXB A;  3NVQ A;  3SBP A;  4GM3 A;  2YNO A;  1JOF A;  4TZ4 A;  2I3S A;  4IMM A;  4YVD A;  3OL2 B;  2HXC A;  2J56 H;  1B9Y A;  3EI1 A;  3HFQ A;  3JRO A;  2YNN A;  2GC4 A;  4CI3 A;  2I0T A;  4PXW A;  2BCJ B;  5K1C C;  3SWS D;  1U2V C;  5I5J A;  5C2V B;  5HE3 B;  5IC7 A;  1VYH C;  3MKS B;  4PSX B;  4CZV A;  5CXC A;  1K8K C;  3SCY A;  2CN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...