2AGWA

Crystal structure of tryptamine-reduced aromatic amine dehydrogenase (aadh) from alcaligenes faecalis in complex with tryptamine
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
360
structure length
360
Chain Sequence
REVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic description of an enzyme reaction dominated by proton tunneling
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Aromatic amine dehydrogenase
total genus 98
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2agwA01
4A0AA 1N6EA 2H9PA 3N0DA 3SXTD 3ULEC 4J0WA 4A08B 5CYKB 1YFQA 2B5MA 3EI4B 3BWSA 3BG1A 5HE3B 3PXSD 1JJUB 2QC5A 3I7NA 4IMMA 4CI2A 5FKQA 1MG2A 1OMWB 3PVUB 4LG8A 4KFMB 4JSPC 5I5JA 4HDJA 1FWXA 4FB1D 4FAND 1VYHC 4XYIA 3W15A 3MZLA 1JMZB 5H17A 5HYNB 3OKYB 3OKTA 2PM9A 2CE9A 3EI3A 4CY5A 5TEFA 3IIYA 4L3HD 4PSXB 3C99A 5B4WA 3B7FA 2UZXB 3UVNA 5TDHB 5I5IA 2CO0A 2AGLA 2GC7A 4UI9R 2I3TA 5EMKB 4GQBB 4X3EA 1JMXB 4ERQA 3NVNA 3CFSB 3VGZA 4CI8A 4JSXC 4GM9A 2HYEA 3CIKB 5FKTA 2GNQA 4GM8A 2O9KA 3SMRA 5C2VB 3I7HA 3RRMC 3EU7A 3GFCA 1L0QA 4CI1A 3PSCB 5FLXg 3JB9L 4MK0B 3EI2B 3VA6A 2GC4A 2IWFA 2B5LA 2OK6A 4J73A 4Y5RD 3JZHA 4PSWB 3PVWB 3I7PA 5TF2A 2H47A 2P9SC 3UKUC 4LG9A 1XKSA 3UVKA 5JWZA 2TRCB 4PBYA 1GOTB 3GREA 4L3GD 3PSLA 1A0RB 2H9NA 4A08A 4PC0A 2HXCA 2HESX 3V5WB 2AH0A 3EI4A 1N6DA 2XL3A 3AFCA 2H6KA 2PBIB 1MDAH 1SQJA 4L1QD 4G56B 2J56H 3V7DB 3DM0A 5AFU3 4D6VA 5EM2A 2XU7A 2I0RA 3L4MD 2IUQA 2CN3A 4N14A 1OLZA 2IURA 5IGQA 1U2VC 2OVRB 5THAA 3PXTD 3UVOA 2IUPA 5EMJB 4GGCA 3HFQA 3OKYA 2Z2PA 2YNPA 3EI3B 3I7OA 1JOFA 4O3UB 2AGZA 5CXBA 3J80g 2BBKH 5C2WB 2G99A 2CN2A 2HJ4A 3OW8A 4R7AB 3JAMg 3MZKA 3ORVD 4XYHA 4BL0A 4GGAA 2YMUA 4U7AA 4J8GA 5AJAA 2P9KC 3C9CA 3F3GA 3FGBA 5FXYA 4X60B 2EBSA 3OTTA 3IJ1A 3JZGA 3RN0D 3RLMD 1GG2B 3IJ0A 4H5IA 3UR4A 4J8BA 4J0XA 2HJBA 4J78A 4OZUA 1TBGA 3DSMA 2H13A 4J77A 5TEEA 3U4YA 4JSVC 2YB8B 4O3TB 4ZOYA 2W18A 4QQEA 2I3SA 5EM2B 4PBZA 4Z8LA 3EI2A 2J57G 4BUJC 4A09A 2H9MA 1R5MA 3CFVA 4X63B 2J55H 2P9UC 5H14A 5EARA 3I8EA 4O1QD 2OJYA 4FA4D 3SHFA 5H1MA 4CZXA 2AGYA 3DXMC 4GQ1A 1PGUA 3N0EA 4CZVA 3AL8A 3JPXA 4YVDA 3RSEC 3I7KA 3ODTA 3EMHA 4EWRA 4ERYA 2OK4A 2QXVA 3EG6A 5IC7A 5GSAA 2IWKA 2Q7QA 4JD2C 3MXXA 5FKRA 4CI3A 5I5MA 5IJ8E 5HE2B 4ESGA 5HE1B 4ZOZA 4A7JA 4ERZA 4D0KA 2I0SA 5K1CC 4J84A 4JXMA 3VH0A 5GXIA 3NVXA 2Z2NA 1MG3A 2PM6B 5FQDA 4X61B 1K8KC 2Z2OA 3JROA 2B4EA 5CXBB 3SLED 4FA5D 4FAVD 4AEZA 1PI6A 3SFZA 2AGWA 3UKRC 4BH6A 5A2Qg 2H68A 3MMYA 4PXWA 4JSNC 3RFHA 3F3FA 4QT8A 3JRPA 3DWLC 3EWEA 3IKOA 4GM3A 2H6NA 3AL8B 5EAPA 4CY2A 4ZN4A 5GMKn 1NEXB 1PBYB 3A0FA 2H9LA 4GMBA 5GXHA 1S4UX 4FWWA 5AMSA 4K3ID 3SN6B 3SVWD 2YNNA 1P22A 2MTAH 4JT6C 2HKRA 3L4OD 3SBPA 2P9PC 3IIWA 3ZWLB 2OVPB 3OL2B 2P9IC 4IA9A 4A09B 5FKSA 1GXRA 1SHYB 4Y7RA 3MKQA 4XEIC 3I89A 4J87A 3FM0A 3RFGA 4TZ4A 5KDOB 3EI1B 3MKSB 4LGNA 4L9OA 5CXCB 3RN1D 1XHMA 2IAAA 4PNKB 4J86A 3SCYA 5K19A 4QL1A 3I2NA 4J81A 3IJCA 4A11B 2AQ5A 4U1EI 1QNIA 3OKWA 4E5ZA 4A0BA 3SJLD 3AL9A 4J79A 3P4FA 4FHLA 2AH1A 1U4CA 3KRWB 2CNXA 4ES0A 1PEVA 3SBQA 3JZNA 2IUVA 2YBAA 3K26A 3OL2A 4GQ2P 1N6FA 3C75H 3KRXB 4OWRA 5SXMA 2I0TA 3I8CA 3K27A 1SQ9A 1Q47A 3UVMA 5IT9g 4H5JA 2UZYB 3SWSD 1ERJA 4E54B 5C9ZB 1B9YA 5CXCA 3J81g 3C5MA 4CZYA 3PE7A 1B9XA 2B5NA 3NVQA 2PM9B 4GZ8A 5EMLB 4CY1A 2P9NC 3UVLA 2OIZA 3V9FA 4A0AB 3AH8B 5HQGA 4AOWA 1XIPA 2CO0C 2H3XA 5CYKA 4QRJA 4J82A 4ZOXA 4CY3A 3DXKC 5EMMB 5IJ7E 2HKMA 5FA5B 4A0BB 4A2LA 1TYQC 4NSXA 2XL2A 3F3PA 1GP2B 2YNOA 1NR0A 4O45A 5EAMA 5EALA 3FRXA 2OVQB 3I7LA 1K32A 1RI6A 3EI1A 3PXWD 3SBRA 2AGXA 4K3JB 2CE8A 2PM7B 4A2MA 3E0CA 2G9AA 2P9LC 2H6QA 5IGOA 4ZOVA 4FA9D 2BCJB 5HE0B 4O9DA 2XYIA 4A11A 4E54A 4I79A 4CC9A 4E5ZB 4FA1D 2H14A 4GGDA 3RMZD 4JT5C 3BG0A
chains in the Genus database with same CATH superfamily
4A0AA 1N6EA 2H9PA 3N0DA 2XDWA 3SXTD 3ULEC 4J0WA 4A08B 5CYKB 1YFQA 2B5MA 4G1EA 3EI4B 3BWSA 3BG1A 1C9IA 5HE3B 3PXSD 1JJUB 2QC5A 3I7NA 4IMMA 4CI2A 5FKQA 1MG2A 1OMWB 3PVUB 4LG8A 4KFMB 4JSPC 5I5JA 4HDJA 1FWXA 4FB1D 4FAND 5E6RA 3EQ7A 1VYHC 4XYIA 1VZ2A 3W15A 4Z7QA 3MZLA 1JMZB 5H17A 5HYNB 3OKYB 3OKTA 2PM9A 2CE9A 3EI3A 4CY5A 5TEFA 3IIYA 4L3HD 4PSXB 3C99A 5B4WA 3B7FA 2UZXB 3UVNA 5M61A 5TDHB 5I5IA 1YR2A 2CO0A 2AGLA 3MVDK 2EIDA 1H2XA 2GC7A 4UI9R 3IJEA 2I3TA 5HDBA 5EMKB 2VDKA 4GQBB 1GOFA 4X3EA 1JMXB 4ERQA 3NVNA 3CFSB 3VGZA 2VDRA 3IUQA 4UM8A 4AN1A 4CI8A 4JSXC 2VZ1A 4O02A 4GM9A 2HYEA 3CIKB 5FKTA 2GNQA 4GM8A 1U8CA 2O9KA 3SMRA 5C2VB 3K71A 3I7HA 3RRMC 3EU7A 3GFCA 1L0QA 4BCCA 4CI1A 3PSCB 5FLXg 2HU7A 3JB9L 4MK0B 3EI2B 3VA6A 2GC4A 3ZE0A 2IWFA 2B5LA 1QFMA 2OK6A 4J73A 3K72A 3JZHA 4Y5RD 4PSWB 3PVWB 3I7PA 5TF2A 3ZDZA 2H47A 2P9SC 3UKUC 4LG9A 1XKSA 2XE4A 3UVKA 2TRCB 5JWZA 4PBYA 1GOTB 3GD1I 3GREA 4L3GD 3PSLA 1A0RB 1O6GA 4MMYA 3OF7A 4AMYA 2H9NA 4A08A 3EQ9A 2WQ8A 4PC0A 2HXCA 2HESX 1VZ3A 2AH0A 3EI4A 1N6DA 2EIBA 2XL3A 3AFCA 3V5WB 2H6KA 2PBIB 5C86A 1MDAH 1SQJA 4L1QD 4G56B 2J56H 3V7DB 5FFGA 3DM0A 4WK2A 5AFU3 3K6SA 4D6VA 5EM2A 2XU7A 2I0RA 3L4MD 2IUQA 2CN3A 4RE5A 4N14A 1OLZA 2IURA 4JHNA 1K3IA 4BP8A 5IGQA 3FCUA 1U2VC 2OVRB 5THAA 3PXTD 1H2WA 4AN0A 2VDPA 3UVOA 2IUPA 5EMJB 4GGCA 3HFQA 3OKYA 2Z2PA 4MMXA 2EICA 2YNPA 3EI3B 3I7OA 1JOFA 4O3UB 2AGZA 5CXBA 3J80g 2BBKH 5C2WB 1BPOA 2G99A 2CN2A 2HJ4A 3OW8A 4R7AB 3JAMg 4L1MA 3MZKA 3ORVD 4XYHA 4BL0A 4GGAA 2YMUA 4U7AA 4J8GA 5AJAA 4BCDA 2P9KC 3C9CA 3F3GA 3FGBA 3IUMA 5FXYA 5M5VA 3EQ8A 4NBMA 1UOPA 4G1MA 4X60B 2EBSA 3OTTA 3IJ1A 3JZGA 4NAAA 3RLMD 3RN0D 4Z7NA 5M5SA 1GG2B 3IJ0A 4H5IA 1TYEA 3UR4A 4DNWA 4J8BA 4J0XA 2HJBA 4J78A 4OZUA 2XZGA 1TBGA 3DSMA 5M5RA 1JV2A 2H13A 4J77A 5TEEA 3U4YA 4JSVC 4AMZA 5M5TA 3T3PA 2YB8B 4O3TB 4ZOYA 2W18A 4QQEA 1O6FA 2I3SA 5EM2B 4PBZA 4JHPC 3FCSA 4Z8LA 4DNUA 2J57G 4BUJC 3EI2A 4A09A 2H9MA 1R5MA 3CFVA 4X63B 2J55H 2P9UC 5H14A 5EARA 3I8EA 4O1QD 2OJYA 4FA4D 3SHFA 2VDLA 5H1MA 4CZXA 2AGYA 3DXMC 4GQ1A 1PGUA 1UTCA 3N0EA 4CZVA 1H2YA 3AL8A 3JPXA 4YVDA 3RSEC 1A12A 3I7KA 3ODTA 3EMHA 3IVMA 4EWRA 4ERYA 2HU5A 2OK4A 3VI3A 2QXVA 3EG6A 5IC7A 5GSAA 2IWKA 2Q7QA 4JD2C 4Z7OA 3MXXA 5FKRA 4CI3A 5I5MA 5IJ8E 5HE2B 4ESGA 5HE1B 4D9SA 2JKXA 4ZOZA 4A7JA 4ERZA 4D0KA 2I0SA 5K1CC 4J84A 4JXMA 3VH0A 5FFOA 5E6UA 3QI0A 3NVXA 5GXIA 2Z2NA 3ZE2A 1MG3A 3ZE1A 2PM6B 5FQDA 4X61B 1K8KC 2Z2OA 3JROA 4WK0A 2B4EA 2HU8A 5CXBB 3SLED 3KCIA 4FA5D 4FAVD 4AEZA 4NENA 3IURA 1PI6A 3SFZA 2AGWA 3UKRC 4BH6A 5A2Qg 4AX4A 2H68A 1T2XA 3MMYA 4PXWA 4JSNC 3NIFA 3RFHA 3F3FA 4QT8A 3V4VA 3JRPA 3DWLC 3EWEA 3IKOA 4GM3A 5C92A 2H6NA 3AL8B 5EAPA 4CY2A 4ZN4A 5GMKn 1NEXB 1PBYB 3A0FA 3IULA 2H9LA 4GMBA 5GXHA 1S4UX 2QZPA 4FWWA 5AMSA 4K3ID 3SN6B 3SVWD 2YNNA 3MUNA 1P22A 2MTAH 4JT6C 3L4OD 2HKRA 3SBPA 4QAMA 2P9PC 3IIWA 2EIEA 3ZWLB 1E5TA 2OVPB 3OL2B 2P9IC 4IA9A 4A09B 1M1XA 5FKSA 1GXRA 1SHYB 4Y7RA 4BP9A 3MKQA 4XEIC 3I89A 4J87A 2VDOA 3FM0A 2QR5A 5E6SA 1GOHA 3RFGA 3DDUA 4TZ4A 5KDOB 3EI1B 3MKSB 4LGNA 4L9OA 5CXCB 2VDMA 3RN1D 1XHMA 2IAAA 4PNKB 4O2WA 4J86A 3SCYA 5K19A 1I2MB 4QL1A 4G55A 3I2NA 3ZDYA 4WJKA 4J81A 3IJCA 4A11B 1VE7A 2AQ5A 4U1EI 1QNIA 3OKWA 4E5ZA 4RE6A 4A0BA 3SJLD 4BCBA 3AL9A 4J79A 3V4PA 4DNVA 4NC4A 1L5GA 3P4FA 4FHLA 2AH1A 1U4CA 4UM9A 3KRWB 2CNXA 3O4HA 1E8NA 4ES0A 1PEVA 3NIDA 3SBQA 3JZNA 2IUVA 2YBAA 3K26A 3OL2A 4GQ2P 1N6FA 3C75H 3NIGA 3KRXB 2VZ3A 4OWRA 5SXMA 2I0TA 1UOQA 3I8CA 3K27A 1SQ9A 1Q47A 3UVMA 5IT9g 5M5UA 4H5JA 2UZYB 3SWSD 1ERJA 4E54B 5C9ZB 1H2ZA 1B9YA 5CXCA 3J81g 3C5MA 3O4IA 4CZYA 3PE7A 1B9XA 1QFSA 2B5NA 3NVQA 2PM9B 4GZ8A 5EMLB 4CY1A 2P9NC 2VDQA 1VE6A 3UVLA 2OIZA 3V9FA 4A0AB 3AH8B 5HQGA 4AOWA 1XIPA 2CO0C 2H3XA 5CYKA 2VDNA 4J82A 4QRJA 4ZOXA 4CY3A 3DXKC 5EMMB 3O4GA 5IJ7E 2HKMA 5FA5B 4A0BB 3GC3B 4A2LA 1TYQC 4NSXA 2BKLA 1UOOA 2XL2A 3F3PA 3O4JA 1C9LA 1GP2B 2YNOA 1NR0A 4O45A 5EAMA 4MMZA 1JTDB 5EALA 3FRXA 3ZDXA 2OVQB 3I7LA 1K32A 1RI6A 3VI4A 3EI1A 3IUJA 3PXWD 3SBRA 2AGXA 1GOGA 4K3JB 2CE8A 2PM7B 4A2MA 3E0CA 2G9AA 2P9LC 2H6QA 5IGOA 4ZOVA 4FA9D 2BCJB 5HE0B 4O9DA 2VC2A 1E8MA 4IRZA 2XYIA 4A11A 4E54A 4I79A 4CC9A 4E5ZB 4FA1D 3QHYB 4WK4A 2H14A 3MUOA 4GGDA 3RMZD 4JT5C 3T3MA 3BG0A 3IUNA
chains in the Genus database with same CATH topology
4A0AA 1N6EA 2H9PA 3N0DA 3SXTD 3ULEC 4J0WA 4A08B 5CYKB 1YFQA 2B5MA 3EI4B 3BWSA 3BG1A 5HE3B 3PXSD 1JJUB 2QC5A 3I7NA 4IMMA 4CI2A 5FKQA 1MG2A 1OMWB 3PVUB 4LG8A 4KFMB 4JSPC 5I5JA 4HDJA 1FWXA 4FB1D 4FAND 1VYHC 4XYIA 3W15A 3MZLA 1JMZB 5H17A 5HYNB 3OKYB 3OKTA 2PM9A 2CE9A 3EI3A 4CY5A 5TEFA 3IIYA 4L3HD 4PSXB 3C99A 5B4WA 3B7FA 2UZXB 3UVNA 5TDHB 5I5IA 2CO0A 2AGLA 2GC7A 4UI9R 2I3TA 5EMKB 4GQBB 4X3EA 1JMXB 4ERQA 3NVNA 3CFSB 3VGZA 4CI8A 4JSXC 4GM9A 2HYEA 3CIKB 5FKTA 2GNQA 4GM8A 2O9KA 3SMRA 5C2VB 3I7HA 3RRMC 3EU7A 3GFCA 1L0QA 4CI1A 3PSCB 5FLXg 3JB9L 4MK0B 3EI2B 3VA6A 2GC4A 2IWFA 2B5LA 2OK6A 4J73A 4Y5RD 3JZHA 4PSWB 3PVWB 3I7PA 5TF2A 2H47A 2P9SC 3UKUC 4LG9A 1XKSA 3UVKA 5JWZA 2TRCB 4PBYA 1GOTB 3GREA 4L3GD 3PSLA 1A0RB 2H9NA 4A08A 4PC0A 2HXCA 2HESX 3V5WB 2AH0A 3EI4A 1N6DA 2XL3A 3AFCA 2H6KA 2PBIB 1MDAH 1SQJA 4L1QD 4G56B 2J56H 3V7DB 3DM0A 5AFU3 4D6VA 5EM2A 2XU7A 2I0RA 3L4MD 2IUQA 2CN3A 4N14A 1OLZA 2IURA 5IGQA 1U2VC 2OVRB 5THAA 3PXTD 3UVOA 2IUPA 5EMJB 4GGCA 3HFQA 3OKYA 2Z2PA 2YNPA 3EI3B 3I7OA 1JOFA 4O3UB 2AGZA 5CXBA 3J80g 2BBKH 5C2WB 2G99A 2CN2A 2HJ4A 3OW8A 4R7AB 3JAMg 3MZKA 3ORVD 4XYHA 4BL0A 4GGAA 2YMUA 4U7AA 4J8GA 5AJAA 2P9KC 3C9CA 3F3GA 3FGBA 5FXYA 4X60B 2EBSA 3OTTA 3IJ1A 3JZGA 3RN0D 3RLMD 1GG2B 3IJ0A 4H5IA 3UR4A 4J8BA 4J0XA 2HJBA 4J78A 4OZUA 1TBGA 3DSMA 2H13A 4J77A 5TEEA 3U4YA 4JSVC 2YB8B 4O3TB 4ZOYA 2W18A 4QQEA 2I3SA 5EM2B 4PBZA 4Z8LA 3EI2A 2J57G 4BUJC 4A09A 2H9MA 1R5MA 3CFVA 4X63B 2J55H 2P9UC 5H14A 5EARA 3I8EA 4O1QD 2OJYA 4FA4D 3SHFA 5H1MA 4CZXA 2AGYA 3DXMC 4GQ1A 1PGUA 3N0EA 4CZVA 3AL8A 3JPXA 4YVDA 3RSEC 3I7KA 3ODTA 3EMHA 4EWRA 4ERYA 2OK4A 2QXVA 3EG6A 5IC7A 5GSAA 2IWKA 2Q7QA 4JD2C 3MXXA 5FKRA 4CI3A 5I5MA 5IJ8E 5HE2B 4ESGA 5HE1B 4ZOZA 4A7JA 4ERZA 4D0KA 2I0SA 5K1CC 4J84A 4JXMA 3VH0A 5GXIA 3NVXA 2Z2NA 1MG3A 2PM6B 5FQDA 4X61B 1K8KC 2Z2OA 3JROA 2B4EA 5CXBB 3SLED 4FA5D 4FAVD 4AEZA 1PI6A 3SFZA 2AGWA 3UKRC 4BH6A 5A2Qg 2H68A 3MMYA 4PXWA 4JSNC 3RFHA 3F3FA 4QT8A 3JRPA 3DWLC 3EWEA 3IKOA 4GM3A 2H6NA 3AL8B 5EAPA 4CY2A 4ZN4A 5GMKn 1NEXB 1PBYB 3A0FA 2H9LA 4GMBA 5GXHA 1S4UX 4FWWA 5AMSA 4K3ID 3SN6B 3SVWD 2YNNA 1P22A 2MTAH 4JT6C 2HKRA 3L4OD 3SBPA 2P9PC 3IIWA 3ZWLB 2OVPB 3OL2B 2P9IC 4IA9A 4A09B 5FKSA 1GXRA 1SHYB 4Y7RA 3MKQA 4XEIC 3I89A 4J87A 3FM0A 3RFGA 4TZ4A 5KDOB 3EI1B 3MKSB 4LGNA 4L9OA 5CXCB 3RN1D 1XHMA 2IAAA 4PNKB 4J86A 3SCYA 5K19A 4QL1A 3I2NA 4J81A 3IJCA 4A11B 2AQ5A 4U1EI 1QNIA 3OKWA 4E5ZA 4A0BA 3SJLD 3AL9A 4J79A 3P4FA 4FHLA 2AH1A 1U4CA 3KRWB 2CNXA 4ES0A 1PEVA 3SBQA 3JZNA 2IUVA 2YBAA 3K26A 3OL2A 4GQ2P 1N6FA 3C75H 3KRXB 4OWRA 5SXMA 2I0TA 3I8CA 3K27A 1SQ9A 1Q47A 3UVMA 5IT9g 4H5JA 2UZYB 3SWSD 1ERJA 4E54B 5C9ZB 1B9YA 5CXCA 3J81g 3C5MA 4CZYA 3PE7A 1B9XA 2B5NA 3NVQA 2PM9B 4GZ8A 5EMLB 4CY1A 2P9NC 3UVLA 2OIZA 3V9FA 4A0AB 3AH8B 5HQGA 4AOWA 1XIPA 2CO0C 2H3XA 5CYKA 4QRJA 4J82A 4ZOXA 4CY3A 3DXKC 5EMMB 5IJ7E 2HKMA 5FA5B 4A0BB 4A2LA 1TYQC 4NSXA 2XL2A 3F3PA 1GP2B 2YNOA 1NR0A 4O45A 5EAMA 5EALA 3FRXA 2OVQB 3I7LA 1K32A 1RI6A 3EI1A 3PXWD 3SBRA 2AGXA 4K3JB 2CE8A 2PM7B 4A2MA 3E0CA 2G9AA 2P9LC 2H6QA 5IGOA 4ZOVA 4FA9D 2BCJB 5HE0B 4O9DA 2XYIA 4A11A 4E54A 4I79A 4CC9A 4E5ZB 4FA1D 2H14A 4GGDA 3RMZD 4JT5C 3BG0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A0A A;  1N6E A;  2H9P A;  3N0D A;  3SXT D;  3ULE C;  4J0W A;  4A08 B;  5CYK B;  1YFQ A;  2B5M A;  3EI4 B;  3BWS A;  3BG1 A;  5HE3 B;  3PXS D;  1JJU B;  2QC5 A;  3I7N A;  4IMM A;  4CI2 A;  5FKQ A;  1MG2 A;  1OMW B;  3PVU B;  4LG8 A;  4KFM B;  4JSP C;  5I5J A;  4HDJ A;  1FWX A;  4FB1 D;  4FAN D;  1VYH C;  4XYI A;  3W15 A;  3MZL A;  1JMZ B;  5H17 A;  5HYN B;  3OKY B;  3OKT A;  2PM9 A;  2CE9 A;  3EI3 A;  4CY5 A;  5TEF A;  3IIY A;  4L3H D;  4PSX B;  3C99 A;  5B4W A;  3B7F A;  2UZX B;  3UVN A;  5TDH B;  5I5I A;  2CO0 A;  2AGL A;  2GC7 A;  4UI9 R;  2I3T A;  5EMK B;  4GQB B;  4X3E A;  1JMX B;  4ERQ A;  3NVN A;  3CFS B;  3VGZ A;  4CI8 A;  4JSX C;  4GM9 A;  2HYE A;  3CIK B;  5FKT A;  2GNQ A;  4GM8 A;  2O9K A;  3SMR A;  5C2V B;  3I7H A;  3RRM C;  3EU7 A;  3GFC A;  1L0Q A;  4CI1 A;  3PSC B;  5FLX g;  3JB9 L;  4MK0 B;  3EI2 B;  3VA6 A;  2GC4 A;  2IWF A;  2B5L A;  2OK6 A;  4J73 A;  4Y5R D;  3JZH A;  4PSW B;  3PVW B;  3I7P A;  5TF2 A;  2H47 A;  2P9S C;  3UKU C;  4LG9 A;  1XKS A;  3UVK A;  5JWZ A;  2TRC B;  4PBY A;  1GOT B;  3GRE A;  4L3G D;  3PSL A;  1A0R B;  2H9N A;  4A08 A;  4PC0 A;  2HXC A;  2HES X;  3V5W B;  2AH0 A;  3EI4 A;  1N6D A;  2XL3 A;  3AFC A;  2H6K A;  2PBI B;  1MDA H;  1SQJ A;  4L1Q D;  4G56 B;  2J56 H;  3V7D B;  3DM0 A;  5AFU 3;  4D6V A;  5EM2 A;  2XU7 A;  2I0R A;  3L4M D;  2IUQ A;  2CN3 A;  4N14 A;  1OLZ A;  2IUR A;  5IGQ A;  1U2V C;  2OVR B;  5THA A;  3PXT D;  3UVO A;  2IUP A;  5EMJ B;  4GGC A;  3HFQ A;  3OKY A;  2Z2P A;  2YNP A;  3EI3 B;  3I7O A;  1JOF A;  4O3U B;  2AGZ A;  5CXB A;  3J80 g;  2BBK H;  5C2W B;  2G99 A;  2CN2 A;  2HJ4 A;  3OW8 A;  4R7A B;  3JAM g;  3MZK A;  3ORV D;  4XYH A;  4BL0 A;  4GGA A;  2YMU A;  4U7A A;  4J8G A;  5AJA A;  2P9K C;  3C9C A;  3F3G A;  3FGB A;  5FXY A;  4X60 B;  2EBS A;  3OTT A;  3IJ1 A;  3JZG A;  3RN0 D;  3RLM D;  1GG2 B;  3IJ0 A;  4H5I A;  3UR4 A;  4J8B A;  4J0X A;  2HJB A;  4J78 A;  4OZU A;  1TBG A;  3DSM A;  2H13 A;  4J77 A;  5TEE A;  3U4Y A;  4JSV C;  2YB8 B;  4O3T B;  4ZOY A;  2W18 A;  4QQE A;  2I3S A;  5EM2 B;  4PBZ A;  4Z8L A;  3EI2 A;  2J57 G;  4BUJ C;  4A09 A;  2H9M A;  1R5M A;  3CFV A;  4X63 B;  2J55 H;  2P9U C;  5H14 A;  5EAR A;  3I8E A;  4O1Q D;  2OJY A;  4FA4 D;  3SHF A;  5H1M A;  4CZX A;  2AGY A;  3DXM C;  4GQ1 A;  1PGU A;  3N0E A;  4CZV A;  3AL8 A;  3JPX A;  4YVD A;  3RSE C;  3I7K A;  3ODT A;  3EMH A;  4EWR A;  4ERY A;  2OK4 A;  2QXV A;  3EG6 A;  5IC7 A;  5GSA A;  2IWK A;  2Q7Q A;  4JD2 C;  3MXX A;  5FKR A;  4CI3 A;  5I5M A;  5IJ8 E;  5HE2 B;  4ESG A;  5HE1 B;  4ZOZ A;  4A7J A;  4ERZ A;  4D0K A;  2I0S A;  5K1C C;  4J84 A;  4JXM A;  3VH0 A;  5GXI A;  3NVX A;  2Z2N A;  1MG3 A;  2PM6 B;  5FQD A;  4X61 B;  1K8K C;  2Z2O A;  3JRO A;  2B4E A;  5CXB B;  3SLE D;  4FA5 D;  4FAV D;  4AEZ A;  1PI6 A;  3SFZ A;  2AGW A;  3UKR C;  4BH6 A;  5A2Q g;  2H68 A;  3MMY A;  4PXW A;  4JSN C;  3RFH A;  3F3F A;  4QT8 A;  3JRP A;  3DWL C;  3EWE A;  3IKO A;  4GM3 A;  2H6N A;  3AL8 B;  5EAP A;  4CY2 A;  4ZN4 A;  5GMK n;  1NEX B;  1PBY B;  3A0F A;  2H9L A;  4GMB A;  5GXH A;  1S4U X;  4FWW A;  5AMS A;  4K3I D;  3SN6 B;  3SVW D;  2YNN A;  1P22 A;  2MTA H;  4JT6 C;  2HKR A;  3L4O D;  3SBP A;  2P9P C;  3IIW A;  3ZWL B;  2OVP B;  3OL2 B;  2P9I C;  4IA9 A;  4A09 B;  5FKS A;  1GXR A;  1SHY B;  4Y7R A;  3MKQ A;  4XEI C;  3I89 A;  4J87 A;  3FM0 A;  3RFG A;  4TZ4 A;  5KDO B;  3EI1 B;  3MKS B;  4LGN A;  4L9O A;  5CXC B;  3RN1 D;  1XHM A;  2IAA A;  4PNK B;  4J86 A;  3SCY A;  5K19 A;  4QL1 A;  3I2N A;  4J81 A;  3IJC A;  4A11 B;  2AQ5 A;  4U1E I;  1QNI A;  3OKW A;  4E5Z A;  4A0B A;  3SJL D;  3AL9 A;  4J79 A;  3P4F A;  4FHL A;  2AH1 A;  1U4C A;  3KRW B;  2CNX A;  4ES0 A;  1PEV A;  3SBQ A;  3JZN A;  2IUV A;  2YBA A;  3K26 A;  3OL2 A;  4GQ2 P;  1N6F A;  3C75 H;  3KRX B;  4OWR A;  5SXM A;  2I0T A;  3I8C A;  3K27 A;  1SQ9 A;  1Q47 A;  3UVM A;  5IT9 g;  4H5J A;  2UZY B;  3SWS D;  1ERJ A;  4E54 B;  5C9Z B;  1B9Y A;  5CXC A;  3J81 g;  3C5M A;  4CZY A;  3PE7 A;  1B9X A;  2B5N A;  3NVQ A;  2PM9 B;  4GZ8 A;  5EML B;  4CY1 A;  2P9N C;  3UVL A;  2OIZ A;  3V9F A;  4A0A B;  3AH8 B;  5HQG A;  4AOW A;  1XIP A;  2CO0 C;  2H3X A;  5CYK A;  4QRJ A;  4J82 A;  4ZOX A;  4CY3 A;  3DXK C;  5EMM B;  5IJ7 E;  2HKM A;  5FA5 B;  4A0B B;  4A2L A;  1TYQ C;  4NSX A;  2XL2 A;  3F3P A;  1GP2 B;  2YNO A;  1NR0 A;  4O45 A;  5EAM A;  5EAL A;  3FRX A;  2OVQ B;  3I7L A;  1K32 A;  1RI6 A;  3EI1 A;  3PXW D;  3SBR A;  2AGX A;  4K3J B;  2CE8 A;  2PM7 B;  4A2M A;  3E0C A;  2G9A A;  2P9L C;  2H6Q A;  5IGO A;  4ZOV A;  4FA9 D;  2BCJ B;  5HE0 B;  4O9D A;  2XYI A;  4A11 A;  4E54 A;  4I79 A;  4CC9 A;  4E5Z B;  4FA1 D;  2H14 A;  4GGD A;  3RMZ D;  4JT5 C;  3BG0 A; 
#chains in the Genus database with same CATH topology
 4A0A A;  1N6E A;  2H9P A;  3N0D A;  2XDW A;  3SXT D;  3ULE C;  4J0W A;  4A08 B;  5CYK B;  1YFQ A;  2B5M A;  4G1E A;  3EI4 B;  3BWS A;  3BG1 A;  1C9I A;  5HE3 B;  3PXS D;  1JJU B;  2QC5 A;  3I7N A;  4IMM A;  4CI2 A;  5FKQ A;  1MG2 A;  1OMW B;  3PVU B;  4LG8 A;  4KFM B;  4JSP C;  5I5J A;  4HDJ A;  1FWX A;  4FB1 D;  4FAN D;  5E6R A;  3EQ7 A;  1VYH C;  4XYI A;  1VZ2 A;  3W15 A;  4Z7Q A;  3MZL A;  1JMZ B;  5H17 A;  5HYN B;  3OKY B;  3OKT A;  2PM9 A;  2CE9 A;  3EI3 A;  4CY5 A;  5TEF A;  3IIY A;  4L3H D;  4PSX B;  3C99 A;  5B4W A;  3B7F A;  2UZX B;  3UVN A;  5M61 A;  5TDH B;  5I5I A;  1YR2 A;  2CO0 A;  2AGL A;  3MVD K;  2EID A;  1H2X A;  2GC7 A;  4UI9 R;  3IJE A;  2I3T A;  5HDB A;  5EMK B;  2VDK A;  4GQB B;  1GOF A;  4X3E A;  1JMX B;  4ERQ A;  3NVN A;  3CFS B;  3VGZ A;  2VDR A;  3IUQ A;  4UM8 A;  4AN1 A;  4CI8 A;  4JSX C;  2VZ1 A;  4O02 A;  4GM9 A;  2HYE A;  3CIK B;  5FKT A;  2GNQ A;  4GM8 A;  1U8C A;  2O9K A;  3SMR A;  5C2V B;  3K71 A;  3I7H A;  3RRM C;  3EU7 A;  3GFC A;  1L0Q A;  4BCC A;  4CI1 A;  3PSC B;  5FLX g;  2HU7 A;  3JB9 L;  4MK0 B;  3EI2 B;  3VA6 A;  2GC4 A;  3ZE0 A;  2IWF A;  2B5L A;  1QFM A;  2OK6 A;  4J73 A;  3K72 A;  3JZH A;  4Y5R D;  4PSW B;  3PVW B;  3I7P A;  5TF2 A;  3ZDZ A;  2H47 A;  2P9S C;  3UKU C;  4LG9 A;  1XKS A;  2XE4 A;  3UVK A;  2TRC B;  5JWZ A;  4PBY A;  1GOT B;  3GD1 I;  3GRE A;  4L3G D;  3PSL A;  1A0R B;  1O6G A;  4MMY A;  3OF7 A;  4AMY A;  2H9N A;  4A08 A;  3EQ9 A;  2WQ8 A;  4PC0 A;  2HXC A;  2HES X;  1VZ3 A;  2AH0 A;  3EI4 A;  1N6D A;  2EIB A;  2XL3 A;  3AFC A;  3V5W B;  2H6K A;  2PBI B;  5C86 A;  1MDA H;  1SQJ A;  4L1Q D;  4G56 B;  2J56 H;  3V7D B;  5FFG A;  3DM0 A;  4WK2 A;  5AFU 3;  3K6S A;  4D6V A;  5EM2 A;  2XU7 A;  2I0R A;  3L4M D;  2IUQ A;  2CN3 A;  4RE5 A;  4N14 A;  1OLZ A;  2IUR A;  4JHN A;  1K3I A;  4BP8 A;  5IGQ A;  3FCU A;  1U2V C;  2OVR B;  5THA A;  3PXT D;  1H2W A;  4AN0 A;  2VDP A;  3UVO A;  2IUP A;  5EMJ B;  4GGC A;  3HFQ A;  3OKY A;  2Z2P A;  4MMX A;  2EIC A;  2YNP A;  3EI3 B;  3I7O A;  1JOF A;  4O3U B;  2AGZ A;  5CXB A;  3J80 g;  2BBK H;  5C2W B;  1BPO A;  2G99 A;  2CN2 A;  2HJ4 A;  3OW8 A;  4R7A B;  3JAM g;  4L1M A;  3MZK A;  3ORV D;  4XYH A;  4BL0 A;  4GGA A;  2YMU A;  4U7A A;  4J8G A;  5AJA A;  4BCD A;  2P9K C;  3C9C A;  3F3G A;  3FGB A;  3IUM A;  5FXY A;  5M5V A;  3EQ8 A;  4NBM A;  1UOP A;  4G1M A;  4X60 B;  2EBS A;  3OTT A;  3IJ1 A;  3JZG A;  4NAA A;  3RLM D;  3RN0 D;  4Z7N A;  5M5S A;  1GG2 B;  3IJ0 A;  4H5I A;  1TYE A;  3UR4 A;  4DNW A;  4J8B A;  4J0X A;  2HJB A;  4J78 A;  4OZU A;  2XZG A;  1TBG A;  3DSM A;  5M5R A;  1JV2 A;  2H13 A;  4J77 A;  5TEE A;  3U4Y A;  4JSV C;  4AMZ A;  5M5T A;  3T3P A;  2YB8 B;  4O3T B;  4ZOY A;  2W18 A;  4QQE A;  1O6F A;  2I3S A;  5EM2 B;  4PBZ A;  4JHP C;  3FCS A;  4Z8L A;  4DNU A;  2J57 G;  4BUJ C;  3EI2 A;  4A09 A;  2H9M A;  1R5M A;  3CFV A;  4X63 B;  2J55 H;  2P9U C;  5H14 A;  5EAR A;  3I8E A;  4O1Q D;  2OJY A;  4FA4 D;  3SHF A;  2VDL A;  5H1M A;  4CZX A;  2AGY A;  3DXM C;  4GQ1 A;  1PGU A;  1UTC A;  3N0E A;  4CZV A;  1H2Y A;  3AL8 A;  3JPX A;  4YVD A;  3RSE C;  1A12 A;  3I7K A;  3ODT A;  3EMH A;  3IVM A;  4EWR A;  4ERY A;  2HU5 A;  2OK4 A;  3VI3 A;  2QXV A;  3EG6 A;  5IC7 A;  5GSA A;  2IWK A;  2Q7Q A;  4JD2 C;  4Z7O A;  3MXX A;  5FKR A;  4CI3 A;  5I5M A;  5IJ8 E;  5HE2 B;  4ESG A;  5HE1 B;  4D9S A;  2JKX A;  4ZOZ A;  4A7J A;  4ERZ A;  4D0K A;  2I0S A;  5K1C C;  4J84 A;  4JXM A;  3VH0 A;  5FFO A;  5E6U A;  3QI0 A;  3NVX A;  5GXI A;  2Z2N A;  3ZE2 A;  1MG3 A;  3ZE1 A;  2PM6 B;  5FQD A;  4X61 B;  1K8K C;  2Z2O A;  3JRO A;  4WK0 A;  2B4E A;  2HU8 A;  5CXB B;  3SLE D;  3KCI A;  4FA5 D;  4FAV D;  4AEZ A;  4NEN A;  3IUR A;  1PI6 A;  3SFZ A;  2AGW A;  3UKR C;  4BH6 A;  5A2Q g;  4AX4 A;  2H68 A;  1T2X A;  3MMY A;  4PXW A;  4JSN C;  3NIF A;  3RFH A;  3F3F A;  4QT8 A;  3V4V A;  3JRP A;  3DWL C;  3EWE A;  3IKO A;  4GM3 A;  5C92 A;  2H6N A;  3AL8 B;  5EAP A;  4CY2 A;  4ZN4 A;  5GMK n;  1NEX B;  1PBY B;  3A0F A;  3IUL A;  2H9L A;  4GMB A;  5GXH A;  1S4U X;  2QZP A;  4FWW A;  5AMS A;  4K3I D;  3SN6 B;  3SVW D;  2YNN A;  3MUN A;  1P22 A;  2MTA H;  4JT6 C;  3L4O D;  2HKR A;  3SBP A;  4QAM A;  2P9P C;  3IIW A;  2EIE A;  3ZWL B;  1E5T A;  2OVP B;  3OL2 B;  2P9I C;  4IA9 A;  4A09 B;  1M1X A;  5FKS A;  1GXR A;  1SHY B;  4Y7R A;  4BP9 A;  3MKQ A;  4XEI C;  3I89 A;  4J87 A;  2VDO A;  3FM0 A;  2QR5 A;  5E6S A;  1GOH A;  3RFG A;  3DDU A;  4TZ4 A;  5KDO B;  3EI1 B;  3MKS B;  4LGN A;  4L9O A;  5CXC B;  2VDM A;  3RN1 D;  1XHM A;  2IAA A;  4PNK B;  4O2W A;  4J86 A;  3SCY A;  5K19 A;  1I2M B;  4QL1 A;  4G55 A;  3I2N A;  3ZDY A;  4WJK A;  4J81 A;  3IJC A;  4A11 B;  1VE7 A;  2AQ5 A;  4U1E I;  1QNI A;  3OKW A;  4E5Z A;  4RE6 A;  4A0B A;  3SJL D;  4BCB A;  3AL9 A;  4J79 A;  3V4P A;  4DNV A;  4NC4 A;  1L5G A;  3P4F A;  4FHL A;  2AH1 A;  1U4C A;  4UM9 A;  3KRW B;  2CNX A;  3O4H A;  1E8N A;  4ES0 A;  1PEV A;  3NID A;  3SBQ A;  3JZN A;  2IUV A;  2YBA A;  3K26 A;  3OL2 A;  4GQ2 P;  1N6F A;  3C75 H;  3NIG A;  3KRX B;  2VZ3 A;  4OWR A;  5SXM A;  2I0T A;  1UOQ A;  3I8C A;  3K27 A;  1SQ9 A;  1Q47 A;  3UVM A;  5IT9 g;  5M5U A;  4H5J A;  2UZY B;  3SWS D;  1ERJ A;  4E54 B;  5C9Z B;  1H2Z A;  1B9Y A;  5CXC A;  3J81 g;  3C5M A;  3O4I A;  4CZY A;  3PE7 A;  1B9X A;  1QFS A;  2B5N A;  3NVQ A;  2PM9 B;  4GZ8 A;  5EML B;  4CY1 A;  2P9N C;  2VDQ A;  1VE6 A;  3UVL A;  2OIZ A;  3V9F A;  4A0A B;  3AH8 B;  5HQG A;  4AOW A;  1XIP A;  2CO0 C;  2H3X A;  5CYK A;  2VDN A;  4J82 A;  4QRJ A;  4ZOX A;  4CY3 A;  3DXK C;  5EMM B;  3O4G A;  5IJ7 E;  2HKM A;  5FA5 B;  4A0B B;  3GC3 B;  4A2L A;  1TYQ C;  4NSX A;  2BKL A;  1UOO A;  2XL2 A;  3F3P A;  3O4J A;  1C9L A;  1GP2 B;  2YNO A;  1NR0 A;  4O45 A;  5EAM A;  4MMZ A;  1JTD B;  5EAL A;  3FRX A;  3ZDX A;  2OVQ B;  3I7L A;  1K32 A;  1RI6 A;  3VI4 A;  3EI1 A;  3IUJ A;  3PXW D;  3SBR A;  2AGX A;  1GOG A;  4K3J B;  2CE8 A;  2PM7 B;  4A2M A;  3E0C A;  2G9A A;  2P9L C;  2H6Q A;  5IGO A;  4ZOV A;  4FA9 D;  2BCJ B;  5HE0 B;  4O9D A;  2VC2 A;  1E8M A;  4IRZ A;  2XYI A;  4A11 A;  4E54 A;  4I79 A;  4CC9 A;  4E5Z B;  4FA1 D;  3QHY B;  4WK4 A;  2H14 A;  3MUO A;  4GGD A;  3RMZ D;  4JT5 C;  3T3M A;  3BG0 A;  3IUN A; 
#chains in the Genus database with same CATH homology
 4A0A A;  1N6E A;  2H9P A;  3N0D A;  3SXT D;  3ULE C;  4J0W A;  4A08 B;  5CYK B;  1YFQ A;  2B5M A;  3EI4 B;  3BWS A;  3BG1 A;  5HE3 B;  3PXS D;  1JJU B;  2QC5 A;  3I7N A;  4IMM A;  4CI2 A;  5FKQ A;  1MG2 A;  1OMW B;  3PVU B;  4LG8 A;  4KFM B;  4JSP C;  5I5J A;  4HDJ A;  1FWX A;  4FB1 D;  4FAN D;  1VYH C;  4XYI A;  3W15 A;  3MZL A;  1JMZ B;  5H17 A;  5HYN B;  3OKY B;  3OKT A;  2PM9 A;  2CE9 A;  3EI3 A;  4CY5 A;  5TEF A;  3IIY A;  4L3H D;  4PSX B;  3C99 A;  5B4W A;  3B7F A;  2UZX B;  3UVN A;  5TDH B;  5I5I A;  2CO0 A;  2AGL A;  2GC7 A;  4UI9 R;  2I3T A;  5EMK B;  4GQB B;  4X3E A;  1JMX B;  4ERQ A;  3NVN A;  3CFS B;  3VGZ A;  4CI8 A;  4JSX C;  4GM9 A;  2HYE A;  3CIK B;  5FKT A;  2GNQ A;  4GM8 A;  2O9K A;  3SMR A;  5C2V B;  3I7H A;  3RRM C;  3EU7 A;  3GFC A;  1L0Q A;  4CI1 A;  3PSC B;  5FLX g;  3JB9 L;  4MK0 B;  3EI2 B;  3VA6 A;  2GC4 A;  2IWF A;  2B5L A;  2OK6 A;  4J73 A;  4Y5R D;  3JZH A;  4PSW B;  3PVW B;  3I7P A;  5TF2 A;  2H47 A;  2P9S C;  3UKU C;  4LG9 A;  1XKS A;  3UVK A;  5JWZ A;  2TRC B;  4PBY A;  1GOT B;  3GRE A;  4L3G D;  3PSL A;  1A0R B;  2H9N A;  4A08 A;  4PC0 A;  2HXC A;  2HES X;  3V5W B;  2AH0 A;  3EI4 A;  1N6D A;  2XL3 A;  3AFC A;  2H6K A;  2PBI B;  1MDA H;  1SQJ A;  4L1Q D;  4G56 B;  2J56 H;  3V7D B;  3DM0 A;  5AFU 3;  4D6V A;  5EM2 A;  2XU7 A;  2I0R A;  3L4M D;  2IUQ A;  2CN3 A;  4N14 A;  1OLZ A;  2IUR A;  5IGQ A;  1U2V C;  2OVR B;  5THA A;  3PXT D;  3UVO A;  2IUP A;  5EMJ B;  4GGC A;  3HFQ A;  3OKY A;  2Z2P A;  2YNP A;  3EI3 B;  3I7O A;  1JOF A;  4O3U B;  2AGZ A;  5CXB A;  3J80 g;  2BBK H;  5C2W B;  2G99 A;  2CN2 A;  2HJ4 A;  3OW8 A;  4R7A B;  3JAM g;  3MZK A;  3ORV D;  4XYH A;  4BL0 A;  4GGA A;  2YMU A;  4U7A A;  4J8G A;  5AJA A;  2P9K C;  3C9C A;  3F3G A;  3FGB A;  5FXY A;  4X60 B;  2EBS A;  3OTT A;  3IJ1 A;  3JZG A;  3RN0 D;  3RLM D;  1GG2 B;  3IJ0 A;  4H5I A;  3UR4 A;  4J8B A;  4J0X A;  2HJB A;  4J78 A;  4OZU A;  1TBG A;  3DSM A;  2H13 A;  4J77 A;  5TEE A;  3U4Y A;  4JSV C;  2YB8 B;  4O3T B;  4ZOY A;  2W18 A;  4QQE A;  2I3S A;  5EM2 B;  4PBZ A;  4Z8L A;  3EI2 A;  2J57 G;  4BUJ C;  4A09 A;  2H9M A;  1R5M A;  3CFV A;  4X63 B;  2J55 H;  2P9U C;  5H14 A;  5EAR A;  3I8E A;  4O1Q D;  2OJY A;  4FA4 D;  3SHF A;  5H1M A;  4CZX A;  2AGY A;  3DXM C;  4GQ1 A;  1PGU A;  3N0E A;  4CZV A;  3AL8 A;  3JPX A;  4YVD A;  3RSE C;  3I7K A;  3ODT A;  3EMH A;  4EWR A;  4ERY A;  2OK4 A;  2QXV A;  3EG6 A;  5IC7 A;  5GSA A;  2IWK A;  2Q7Q A;  4JD2 C;  3MXX A;  5FKR A;  4CI3 A;  5I5M A;  5IJ8 E;  5HE2 B;  4ESG A;  5HE1 B;  4ZOZ A;  4A7J A;  4ERZ A;  4D0K A;  2I0S A;  5K1C C;  4J84 A;  4JXM A;  3VH0 A;  5GXI A;  3NVX A;  2Z2N A;  1MG3 A;  2PM6 B;  5FQD A;  4X61 B;  1K8K C;  2Z2O A;  3JRO A;  2B4E A;  5CXB B;  3SLE D;  4FA5 D;  4FAV D;  4AEZ A;  1PI6 A;  3SFZ A;  2AGW A;  3UKR C;  4BH6 A;  5A2Q g;  2H68 A;  3MMY A;  4PXW A;  4JSN C;  3RFH A;  3F3F A;  4QT8 A;  3JRP A;  3DWL C;  3EWE A;  3IKO A;  4GM3 A;  2H6N A;  3AL8 B;  5EAP A;  4CY2 A;  4ZN4 A;  5GMK n;  1NEX B;  1PBY B;  3A0F A;  2H9L A;  4GMB A;  5GXH A;  1S4U X;  4FWW A;  5AMS A;  4K3I D;  3SN6 B;  3SVW D;  2YNN A;  1P22 A;  2MTA H;  4JT6 C;  2HKR A;  3L4O D;  3SBP A;  2P9P C;  3IIW A;  3ZWL B;  2OVP B;  3OL2 B;  2P9I C;  4IA9 A;  4A09 B;  5FKS A;  1GXR A;  1SHY B;  4Y7R A;  3MKQ A;  4XEI C;  3I89 A;  4J87 A;  3FM0 A;  3RFG A;  4TZ4 A;  5KDO B;  3EI1 B;  3MKS B;  4LGN A;  4L9O A;  5CXC B;  3RN1 D;  1XHM A;  2IAA A;  4PNK B;  4J86 A;  3SCY A;  5K19 A;  4QL1 A;  3I2N A;  4J81 A;  3IJC A;  4A11 B;  2AQ5 A;  4U1E I;  1QNI A;  3OKW A;  4E5Z A;  4A0B A;  3SJL D;  3AL9 A;  4J79 A;  3P4F A;  4FHL A;  2AH1 A;  1U4C A;  3KRW B;  2CNX A;  4ES0 A;  1PEV A;  3SBQ A;  3JZN A;  2IUV A;  2YBA A;  3K26 A;  3OL2 A;  4GQ2 P;  1N6F A;  3C75 H;  3KRX B;  4OWR A;  5SXM A;  2I0T A;  3I8C A;  3K27 A;  1SQ9 A;  1Q47 A;  3UVM A;  5IT9 g;  4H5J A;  2UZY B;  3SWS D;  1ERJ A;  4E54 B;  5C9Z B;  1B9Y A;  5CXC A;  3J81 g;  3C5M A;  4CZY A;  3PE7 A;  1B9X A;  2B5N A;  3NVQ A;  2PM9 B;  4GZ8 A;  5EML B;  4CY1 A;  2P9N C;  3UVL A;  2OIZ A;  3V9F A;  4A0A B;  3AH8 B;  5HQG A;  4AOW A;  1XIP A;  2CO0 C;  2H3X A;  5CYK A;  4QRJ A;  4J82 A;  4ZOX A;  4CY3 A;  3DXK C;  5EMM B;  5IJ7 E;  2HKM A;  5FA5 B;  4A0B B;  4A2L A;  1TYQ C;  4NSX A;  2XL2 A;  3F3P A;  1GP2 B;  2YNO A;  1NR0 A;  4O45 A;  5EAM A;  5EAL A;  3FRX A;  2OVQ B;  3I7L A;  1K32 A;  1RI6 A;  3EI1 A;  3PXW D;  3SBR A;  2AGX A;  4K3J B;  2CE8 A;  2PM7 B;  4A2M A;  3E0C A;  2G9A A;  2P9L C;  2H6Q A;  5IGO A;  4ZOV A;  4FA9 D;  2BCJ B;  5HE0 B;  4O9D A;  2XYI A;  4A11 A;  4E54 A;  4I79 A;  4CC9 A;  4E5Z B;  4FA1 D;  2H14 A;  4GGD A;  3RMZ D;  4JT5 C;  3BG0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...