2AGWA

Crystal structure of tryptamine-reduced aromatic amine dehydrogenase (aadh) from alcaligenes faecalis in complex with tryptamine
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
360
structure length
360
Chain Sequence
REVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aromatic amine dehydrogenase
publication title Atomic description of an enzyme reaction dominated by proton tunneling
pubmed doi rcsb
total genus 98
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2agwA01
2YNNA 3UVNA 2AGXA 2Z2NA 2H68A 2P9SC 4QL1A 3OL2A 2AGZA 2CE8A 4CI1A 2YNOA 3ULEC 3BG1A 3RSEC 2OIZA 1TBGA 1B9XA 2XL3A 3OKTA 4YVDA 3EI1B 3RFHA 4ERQA 4J87A 3CIKB 4FWWA 2H9NA 2YBAA 3JPXA 2HESX 2H6NA 4CZYA 1A0RB 3P4FA 3IIYA 4PSXB 4U1EI 1GXRA 3SCYA 5CXBB 3EI2B 2P9LC 3BWSA 3UVLA 3RN0D 4O45A 3A0FA 2CN2A 4ZOYA 5FKTA 3SWSD 4GMBA 5JWZA 5HE2B 4CY3A 3J81g 3VH0A 5AJAA 4QRJA 5EMJB 3NVXA 1XIPA 2HJ4A 4FAVD 5IJ7E 4A0BB 3VA6A 5IT9g 5I5JA 5CXCA 2P9IC 3EMHA 3I7OA 5HQGA 2QXVA 4OWRA 4CY1A 2CE9A 4X3EA 3I2NA 4JSPC 4ZOVA 4LG8A 4LG9A 1MG2A 3IJ1A 3SBQA 3AFCA 4IMMA 4A11B 4A2MA 4CI8A 3K27A 3DXKC 4JXMA 3UKRC 2UZYB 4XYIA 2H9LA 3V5WB 5CYKB 2OK4A 3AL8B 3OKWA 2HJBA 2HXCA 3DWLC 4ESGA 3SJLD 2AGWA 1QNIA 4J86A 3GFCA 4UI9R 5GSAA 4BL0A 4A09A 4EWRA 3JZHA 1JJUB 4KFMB 3OL2B 4GGCA 3CFSB 3I7NA 4J78A 5HE0B 2H3XA 2PM7B 2AGLA 5FXYA 3DXMC 2IUPA 2J55H 4N14A 5TEEA 3L4OD 3SBPA 3FRXA 4XYHA 1U2VC 5TDHB 3RFGA 4L3HD 5EMLB 4A0AA 3F3GA 2OK6A 3PSCB 3EI3A 1GP2B 3L4MD 2AH1A 4PSWB 3VGZA 4A7JA 3IIWA 3JZNA 3NVQA 4GQBB 5H1MA 2I3SA 3CFVA 2GC7A 4E54A 4X61B 5C2WB 3NVNA 4BH6A 5GMKn 3PE7A 2TRCB 4Y7RA 2B5MA 2CO0A 5FKSA 3SBRA 1NR0A 2B5LA 1OLZA 5EMKB 3I89A 1JMZB 3F3FA 3V7DB 2B5NA 3MKQA 1VYHC 4PBZA 3UKUC 3MZKA 1Q47A 2P9UC 1PI6A 4CI2A 1SQJA 4AEZA 2IAAA 5H14A 4J79A 2PM9B 3PVUB 4NSXA 4JD2C 3UR4A 3SLED 3UVKA 2IUQA 2B4EA 1U4CA 3FM0A 1XHMA 4GZ8A 2MTAH 5EM2B 1ERJA 4J8GA 5GXHA 4TZ4A 3I8EA 3J80g 1N6FA 5FKRA 2XYIA 2YB8B 3BG0A 3I7PA 3OW8A 4U7AA 4O3UB 1R5MA 3C99A 3EI1A 3JZGA 4PC0A 5FQDA 3OKYA 1RI6A 3OTTA 4FA5D 4MK0B 2OVQB 4O1QD 5I5MA 5EAMA 4O9DA 2J57G 5H17A 4ZN4A 5FLXg 3EG6A 3C75H 4E5ZA 2P9PC 4H5IA 4GQ2P 3ZWLB 2IWKA 4A0AB 1PEVA 2H9MA 3B7FA 5HE3B 5CXBA 2XU7A 4CI3A 3IJCA 4IA9A 3UVOA 2QC5A 3K26A 4Y5RD 4J77A 3MMYA 3SN6B 4E54B 2CO0C 3F3PA 3MZLA 1N6EA 5C9ZB 3PVWB 3GREA 4AOWA 3RLMD 4BUJC 4K3JB 2YMUA 2GC4A 5B4WA 4GQ1A 2UZXB 2H47A 5I5IA 4HDJA 3U4YA 4GM3A 5TEFA 4GM9A 4I79A 4A08A 1JOFA 5FA5B 4GGDA 3PXTD 4ERZA 3HFQA 4CZVA 5HE1B 3JB9L 4X60B 5SXMA 4CY5A 3UVMA 5CYKA 2HYEA 2AH0A 3AL8A 3PXSD 1GG2B 3AH8B 1TYQC 3C5MA 2Z2OA 2I0SA 4FHLA 1GOTB 2P9KC 4FA9D 3DM0A 1N6DA 3FGBA 3KRWB 3N0EA 4R7AB 2H6KA 4CZXA 5K19A 1YFQA 4L1QD 3KRXB 4CC9A 1MG3A 3C9CA 2AGYA 3V9FA 5FKQA 4J82A 4ZOXA 2H13A 3EI4A 4OZUA 3ODTA 3W15A 4FA1D 4FAND 3SMRA 3JAMg 5EARA 5CXCB 2H14A 5IJ8E 2OJYA 4QQEA 2CN3A 5IGOA 3E0CA 4PNKB 3JRPA 3OKYB 2I0RA 3SFZA 4J0WA 4XEIC 4GGAA 2YNPA 5EALA 4JSXC 4JSVC 5GXIA 4E5ZB 3PSLA 4FB1D 5KDOB 3IJ0A 4X63B 4H5JA 2H6QA 3SHFA 2OVRB 5EAPA 4J81A 2H9PA 1OMWB 2IWFA 3I7HA 1B9YA 2Q7QA 2BCJB 4A09B 5K1CC 4D0KA 5A2Qg 3MXXA 3SXTD 2PBIB 3MKSB 1FWXA 3ORVD 3I8CA 5IGQA 4FA4D 4ZOZA 4K3ID 1P22A 5C2VB 4J84A 4G56B 2HKRA 2PM9A 2OVPB 2IURA 2J56H 4A08B 2HKMA 5IC7A 4CY2A 3N0DA 2GNQA 4J73A 3EI2A 1L0QA 3EI3B 2BBKH 5AFU3 4Z8LA 4JSNC 5THAA 4LGNA 3EU7A 2EBSA 5EM2A 4A2LA 4ERYA 4A0BA 2XL2A 3IKOA 4ES0A 2IUVA 2AQ5A 4D6VA 3I7KA 4L3GD 2G9AA 1S4UX 2I0TA 2I3TA 4PXWA 1JMXB 3JROA 4L9OA 3AL9A 4O3TB 4GM8A 1SQ9A 4JT5C 4A11A 3PXWD 3EI4B 5TF2A 1XKSA 3EWEA 1NEXB 5EMMB 2P9NC 3RN1D 3RMZD 5AMSA 2PM6B 4JT6C 1K32A 1MDAH 4J8BA 2Z2PA 3RRMC 1SHYB 2CNXA 2G99A 1PBYB 3I7LA 4QT8A 1PGUA 2O9KA 4J0XA 4PBYA 3DSMA 3SVWD 5HYNB 1K8KC 2W18A
chains in the Genus database with same CATH superfamily
2YNNA 3UVNA 2AGXA 2Z2NA 2H68A 2P9SC 4QL1A 3OL2A 2AGZA 2CE8A 1C9LA 4CI1A 2YNOA 5M61A 3ULEC 3BG1A 3RSEC 2OIZA 2EIEA 1TBGA 1B9XA 5C86A 2XL3A 4D9SA 3OKTA 4YVDA 3EI1B 3RFHA 3NIFA 4ERQA 4J87A 3CIKB 4FWWA 2VC2A 2H9NA 2YBAA 4BP8A 3JPXA 2HESX 2HU8A 4Z7QA 2H6NA 4CZYA 4QAMA 1A0RB 4IRZA 3P4FA 4BP9A 3IIYA 4PSXB 3MVDK 3IUNA 4NAAA 4U1EI 1GXRA 3SCYA 5CXBB 4L1MA 3EI2B 2P9LC 3BWSA 2VDOA 3RN0D 3UVLA 1C9IA 4O45A 3A0FA 2CN2A 4ZOYA 4JHPC 5FKTA 3SWSD 4GMBA 5JWZA 5HE2B 4CY3A 2QZPA 4BCDA 3J81g 3VH0A 5AJAA 4QRJA 5EMJB 3NVXA 1XIPA 2HJ4A 3IJEA 4AMYA 4FAVD 5IJ7E 3VA6A 4A0BB 5IT9g 5I5JA 2QR5A 5CXCA 2P9IC 3EMHA 3I7OA 5HQGA 2QXVA 1GOFA 4OWRA 4CY1A 1H2XA 2CE9A 4X3EA 3I2NA 4JSPC 4ZOVA 4LG8A 4LG9A 1MG2A 3GD1I 3IJ1A 3SBQA 3OF7A 5M5SA 3AFCA 4IMMA 4A11B 4A2MA 4BCCA 2XZGA 4CI8A 2WQ8A 3EQ7A 3K27A 3DXKC 5M5UA 4JXMA 3UKRC 2UZYB 4XYIA 2H9LA 3V5WB 5CYKB 2OK4A 3AL8B 3IUJA 3OKWA 2BKLA 2HJBA 3IUMA 3ZDZA 2HXCA 3DWLC 4ESGA 1GOGA 3SJLD 2AGWA 1H2ZA 1QNIA 4J86A 4WK0A 2VDMA 3GFCA 4UI9R 5GSAA 4BL0A 3QHYB 4NC4A 4A09A 2VDLA 4EWRA 3JZHA 1JJUB 4KFMB 3OL2B 4GGCA 3CFSB 5M5RA 3I7NA 5FFOA 4J78A 5HE0B 2H3XA 2VDKA 2PM7B 2AGLA 5FXYA 3DXMC 2IUPA 2J55H 4N14A 1GOHA 5TEEA 3L4OD 3SBPA 3FRXA 4UM9A 4XYHA 1U2VC 5TDHB 3RFGA 3VI4A 4L3HD 5EMLB 4A0AA 3F3GA 2OK6A 3PSCB 3EI3A 1GP2B 3IULA 3L4MD 2AH1A 4PSWB 3VGZA 4A7JA 3IIWA 3JZNA 3NVQA 4GQBB 5H1MA 2I3SA 1M1XA 3CFVA 2GC7A 4E54A 4X61B 5C2WB 3NVNA 4BH6A 5GMKn 3PE7A 3ZE2A 2TRCB 4Y7RA 2B5MA 2CO0A 4JHNA 5FKSA 1NR0A 2B5LA 3SBRA 1OLZA 5EMKB 3I89A 5FFGA 1JMZB 3F3FA 1JV2A 3V7DB 2B5NA 3MKQA 1VZ3A 2VZ1A 1VYHC 4PBZA 3UKUC 1U8CA 3MZKA 3O4HA 1Q47A 1UOOA 2P9UC 1PI6A 4CI2A 4RE5A 1SQJA 1BPOA 3O4IA 4G55A 4AEZA 2IAAA 5H14A 4Z7NA 1O6GA 4J79A 2PM9B 3PVUB 4NSXA 4JD2C 3UR4A 3IVMA 4NBMA 4BCBA 3QI0A 3SLED 3UVKA 2IUQA 2B4EA 5M5TA 1U4CA 3FM0A 1XHMA 4GZ8A 3O4JA 4WK4A 2MTAH 5EM2B 2XE4A 1ERJA 4J8GA 5GXHA 4TZ4A 3K72A 3I8EA 3J80g 1N6FA 5FKRA 2XYIA 2YB8B 3BG0A 4UM8A 3I7PA 3OW8A 4U7AA 4O3UB 1R5MA 3C99A 4O2WA 3EI1A 5HDBA 3ZDYA 3JZGA 4PC0A 3EQ8A 3OKYA 5FQDA 3ZE1A 1RI6A 2VDPA 3V4VA 3OTTA 4FA5D 4MK0B 3K71A 2OVQB 4MMXA 5E6UA 3ZE0A 4O1QD 5I5MA 5EAMA 3T3PA 2JKXA 4O9DA 2J57G 2XDWA 5H17A 4ZN4A 3EG6A 5FLXg 3C75H 4E5ZA 2P9PC 4H5IA 3MUOA 4GQ2P 3ZWLB 2IWKA 4A0AB 3ZDXA 1PEVA 2H9MA 3B7FA 5HE3B 5CXBA 2XU7A 4MMYA 1E8MA 4CI3A 1VE6A 3IJCA 4IA9A 3UVOA 2QC5A 3K26A 4Y5RD 4J77A 3MMYA 3SN6B 4DNUA 4RE6A 4DNVA 4E54B 2CO0C 3F3PA 3MZLA 1N6EA 4WK2A 5C9ZB 3PVWB 1QFMA 2VZ3A 3GREA 4AOWA 3RLMD 4BUJC 4K3JB 2YMUA 2GC4A 5B4WA 4GQ1A 2UZXB 2H47A 3KCIA 5I5IA 4HDJA 1L5GA 3U4YA 3EQ9A 4GM3A 5TEFA 4GM9A 4I79A 5M5VA 4A08A 1JOFA 5FA5B 4GGDA 3PXTD 4ERZA 3HFQA 1E5TA 4CZVA 5HE1B 3JB9L 4X60B 5SXMA 4CY5A 4O02A 3UVMA 5CYKA 2HYEA 1H2WA 1A12A 2AH0A 3AL8A 3PXSD 1GG2B 2VDNA 3NIGA 3AH8B 4G1MA 1O6FA 1TYQC 3C5MA 2Z2OA 1VE7A 2I0SA 4FHLA 5C92A 1GOTB 2P9KC 4FA9D 3DM0A 1N6DA 3FGBA 3FCUA 2EIDA 3KRWB 3N0EA 4R7AB 2H6KA 4CZXA 5K19A 1YFQA 4L1QD 3KRXB 4CC9A 1MG3A 3C9CA 2AGYA 3V9FA 3GC3B 5FKQA 4J82A 4ZOXA 2H13A 3EI4A 4OZUA 3ODTA 3W15A 4FA1D 4FAND 4AN0A 3SMRA 3JAMg 5EARA 5CXCB 2H14A 5IJ8E 2OJYA 4QQEA 2CN3A 5IGOA 3E0CA 4PNKB 2EIBA 1QFSA 3JRPA 3OKYB 2I0RA 3SFZA 4J0WA 4XEIC 4GGAA 2YNPA 5EALA 4JSXC 4JSVC 4WJKA 5E6SA 5GXIA 3FCSA 4E5ZB 3PSLA 4FB1D 1UOQA 5KDOB 3IJ0A 1YR2A 4X63B 5E6RA 4H5JA 2H6QA 3SHFA 2OVRB 5EAPA 4J81A 2H9PA 1OMWB 2IWFA 3I7HA 1B9YA 4AMZA 2Q7QA 3DDUA 4DNWA 2BCJB 2HU7A 4A09B 5K1CC 4D0KA 5A2Qg 3MXXA 3SXTD 2PBIB 3MKSB 1FWXA 3ORVD 3I8CA 5IGQA 2EICA 4ZOZA 4K3ID 1P22A 4FA4D 3VI3A 5C2VB 4NENA 4J84A 4G56B 2HKRA 3NIDA 1E8NA 2PM9A 2OVPB 2IURA 2J56H 4A08B 2HKMA 5IC7A 4CY2A 3N0DA 3T3MA 2GNQA 4J73A 3EI2A 1L0QA 1VZ2A 3EI3B 2BBKH 5AFU3 4Z8LA 4JSNC 5THAA 4LGNA 3EU7A 2EBSA 4Z7OA 2VDQA 5EM2A 4AX4A 1UTCA 1TYEA 4A2LA 4ERYA 4A0BA 2XL2A 3IKOA 4ES0A 2IUVA 2AQ5A 2HU5A 4D6VA 3I7KA 1JTDB 4L3GD 2G9AA 1S4UX 2I0TA 2I3TA 4PXWA 1JMXB 3K6SA 3JROA 4L9OA 3AL9A 3MUNA 4O3TB 1H2YA 4MMZA 4GM8A 1SQ9A 1I2MB 3IUQA 4JT5C 2VDRA 4A11A 3PXWD 3EI4B 5TF2A 1XKSA 3EWEA 1NEXB 5EMMB 2P9NC 3O4GA 3RN1D 3RMZD 4G1EA 5AMSA 2PM6B 4JT6C 4AN1A 1K32A 1UOPA 1MDAH 2Z2PA 4J8BA 3RRMC 1SHYB 2CNXA 1K3IA 2G99A 1PBYB 3I7LA 4QT8A 1PGUA 2O9KA 4J0XA 4PBYA 3DSMA 3IURA 3SVWD 1T2XA 5HYNB 1K8KC 3V4PA 2W18A
chains in the Genus database with same CATH topology
2YNNA 3UVNA 2AGXA 2Z2NA 2H68A 2P9SC 4QL1A 3OL2A 2AGZA 2CE8A 4CI1A 2YNOA 3ULEC 3BG1A 3RSEC 2OIZA 1TBGA 1B9XA 2XL3A 3OKTA 4YVDA 3EI1B 3RFHA 4ERQA 4J87A 3CIKB 4FWWA 2H9NA 2YBAA 3JPXA 2HESX 2H6NA 4CZYA 1A0RB 3P4FA 3IIYA 4PSXB 4U1EI 1GXRA 3SCYA 5CXBB 3EI2B 2P9LC 3BWSA 3UVLA 3RN0D 4O45A 3A0FA 2CN2A 4ZOYA 5FKTA 3SWSD 4GMBA 5JWZA 5HE2B 4CY3A 3J81g 3VH0A 5AJAA 4QRJA 5EMJB 3NVXA 1XIPA 2HJ4A 4FAVD 5IJ7E 4A0BB 3VA6A 5IT9g 5I5JA 5CXCA 2P9IC 3EMHA 3I7OA 5HQGA 2QXVA 4OWRA 4CY1A 2CE9A 4X3EA 3I2NA 4JSPC 4ZOVA 4LG8A 4LG9A 1MG2A 3IJ1A 3SBQA 3AFCA 4IMMA 4A11B 4A2MA 4CI8A 3K27A 3DXKC 4JXMA 3UKRC 2UZYB 4XYIA 2H9LA 3V5WB 5CYKB 2OK4A 3AL8B 3OKWA 2HJBA 2HXCA 3DWLC 4ESGA 3SJLD 2AGWA 1QNIA 4J86A 3GFCA 4UI9R 5GSAA 4BL0A 4A09A 4EWRA 3JZHA 1JJUB 4KFMB 3OL2B 4GGCA 3CFSB 3I7NA 4J78A 5HE0B 2H3XA 2PM7B 2AGLA 5FXYA 3DXMC 2IUPA 2J55H 4N14A 5TEEA 3L4OD 3SBPA 3FRXA 4XYHA 1U2VC 5TDHB 3RFGA 4L3HD 5EMLB 4A0AA 3F3GA 2OK6A 3PSCB 3EI3A 1GP2B 3L4MD 2AH1A 4PSWB 3VGZA 4A7JA 3IIWA 3JZNA 3NVQA 4GQBB 5H1MA 2I3SA 3CFVA 2GC7A 4E54A 4X61B 5C2WB 3NVNA 4BH6A 5GMKn 3PE7A 2TRCB 4Y7RA 2B5MA 2CO0A 5FKSA 3SBRA 1NR0A 2B5LA 1OLZA 5EMKB 3I89A 1JMZB 3F3FA 3V7DB 2B5NA 3MKQA 1VYHC 4PBZA 3UKUC 3MZKA 1Q47A 2P9UC 1PI6A 4CI2A 1SQJA 4AEZA 2IAAA 5H14A 4J79A 2PM9B 3PVUB 4NSXA 4JD2C 3UR4A 3SLED 3UVKA 2IUQA 2B4EA 1U4CA 3FM0A 1XHMA 4GZ8A 2MTAH 5EM2B 1ERJA 4J8GA 5GXHA 4TZ4A 3I8EA 3J80g 1N6FA 5FKRA 2XYIA 2YB8B 3BG0A 3I7PA 3OW8A 4U7AA 4O3UB 1R5MA 3C99A 3EI1A 3JZGA 4PC0A 5FQDA 3OKYA 1RI6A 3OTTA 4FA5D 4MK0B 2OVQB 4O1QD 5I5MA 5EAMA 4O9DA 2J57G 5H17A 4ZN4A 5FLXg 3EG6A 3C75H 4E5ZA 2P9PC 4H5IA 4GQ2P 3ZWLB 2IWKA 4A0AB 1PEVA 2H9MA 3B7FA 5HE3B 5CXBA 2XU7A 4CI3A 3IJCA 4IA9A 3UVOA 2QC5A 3K26A 4Y5RD 4J77A 3MMYA 3SN6B 4E54B 2CO0C 3F3PA 3MZLA 1N6EA 5C9ZB 3PVWB 3GREA 4AOWA 3RLMD 4BUJC 4K3JB 2YMUA 2GC4A 5B4WA 4GQ1A 2UZXB 2H47A 5I5IA 4HDJA 3U4YA 4GM3A 5TEFA 4GM9A 4I79A 4A08A 1JOFA 5FA5B 4GGDA 3PXTD 4ERZA 3HFQA 4CZVA 5HE1B 3JB9L 4X60B 5SXMA 4CY5A 3UVMA 5CYKA 2HYEA 2AH0A 3AL8A 3PXSD 1GG2B 3AH8B 1TYQC 3C5MA 2Z2OA 2I0SA 4FHLA 1GOTB 2P9KC 4FA9D 3DM0A 1N6DA 3FGBA 3KRWB 3N0EA 4R7AB 2H6KA 4CZXA 5K19A 1YFQA 4L1QD 3KRXB 4CC9A 1MG3A 3C9CA 2AGYA 3V9FA 5FKQA 4J82A 4ZOXA 2H13A 3EI4A 4OZUA 3ODTA 3W15A 4FA1D 4FAND 3SMRA 3JAMg 5EARA 5CXCB 2H14A 5IJ8E 2OJYA 4QQEA 2CN3A 5IGOA 3E0CA 4PNKB 3JRPA 3OKYB 2I0RA 3SFZA 4J0WA 4XEIC 4GGAA 2YNPA 5EALA 4JSXC 4JSVC 5GXIA 4E5ZB 3PSLA 4FB1D 5KDOB 3IJ0A 4X63B 4H5JA 2H6QA 3SHFA 2OVRB 5EAPA 4J81A 2H9PA 1OMWB 2IWFA 3I7HA 1B9YA 2Q7QA 2BCJB 4A09B 5K1CC 4D0KA 5A2Qg 3MXXA 3SXTD 2PBIB 3MKSB 1FWXA 3ORVD 3I8CA 5IGQA 4FA4D 4ZOZA 4K3ID 1P22A 5C2VB 4J84A 4G56B 2HKRA 2PM9A 2OVPB 2IURA 2J56H 4A08B 2HKMA 5IC7A 4CY2A 3N0DA 2GNQA 4J73A 3EI2A 1L0QA 3EI3B 2BBKH 5AFU3 4Z8LA 4JSNC 5THAA 4LGNA 3EU7A 2EBSA 5EM2A 4A2LA 4ERYA 4A0BA 2XL2A 3IKOA 4ES0A 2IUVA 2AQ5A 4D6VA 3I7KA 4L3GD 2G9AA 1S4UX 2I0TA 2I3TA 4PXWA 1JMXB 3JROA 4L9OA 3AL9A 4O3TB 4GM8A 1SQ9A 4JT5C 4A11A 3PXWD 3EI4B 5TF2A 1XKSA 3EWEA 1NEXB 5EMMB 2P9NC 3RN1D 3RMZD 5AMSA 2PM6B 4JT6C 1K32A 1MDAH 4J8BA 2Z2PA 3RRMC 1SHYB 2CNXA 2G99A 1PBYB 3I7LA 4QT8A 1PGUA 2O9KA 4J0XA 4PBYA 3DSMA 3SVWD 5HYNB 1K8KC 2W18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YNN A;  3UVN A;  2AGX A;  2Z2N A;  2H68 A;  2P9S C;  4QL1 A;  3OL2 A;  2AGZ A;  2CE8 A;  4CI1 A;  2YNO A;  3ULE C;  3BG1 A;  3RSE C;  2OIZ A;  1TBG A;  1B9X A;  2XL3 A;  3OKT A;  4YVD A;  3EI1 B;  3RFH A;  4ERQ A;  4J87 A;  3CIK B;  4FWW A;  2H9N A;  2YBA A;  3JPX A;  2HES X;  2H6N A;  4CZY A;  1A0R B;  3P4F A;  3IIY A;  4PSX B;  4U1E I;  1GXR A;  3SCY A;  5CXB B;  3EI2 B;  2P9L C;  3BWS A;  3UVL A;  3RN0 D;  4O45 A;  3A0F A;  2CN2 A;  4ZOY A;  5FKT A;  3SWS D;  4GMB A;  5JWZ A;  5HE2 B;  4CY3 A;  3J81 g;  3VH0 A;  5AJA A;  4QRJ A;  5EMJ B;  3NVX A;  1XIP A;  2HJ4 A;  4FAV D;  5IJ7 E;  4A0B B;  3VA6 A;  5IT9 g;  5I5J A;  5CXC A;  2P9I C;  3EMH A;  3I7O A;  5HQG A;  2QXV A;  4OWR A;  4CY1 A;  2CE9 A;  4X3E A;  3I2N A;  4JSP C;  4ZOV A;  4LG8 A;  4LG9 A;  1MG2 A;  3IJ1 A;  3SBQ A;  3AFC A;  4IMM A;  4A11 B;  4A2M A;  4CI8 A;  3K27 A;  3DXK C;  4JXM A;  3UKR C;  2UZY B;  4XYI A;  2H9L A;  3V5W B;  5CYK B;  2OK4 A;  3AL8 B;  3OKW A;  2HJB A;  2HXC A;  3DWL C;  4ESG A;  3SJL D;  2AGW A;  1QNI A;  4J86 A;  3GFC A;  4UI9 R;  5GSA A;  4BL0 A;  4A09 A;  4EWR A;  3JZH A;  1JJU B;  4KFM B;  3OL2 B;  4GGC A;  3CFS B;  3I7N A;  4J78 A;  5HE0 B;  2H3X A;  2PM7 B;  2AGL A;  5FXY A;  3DXM C;  2IUP A;  2J55 H;  4N14 A;  5TEE A;  3L4O D;  3SBP A;  3FRX A;  4XYH A;  1U2V C;  5TDH B;  3RFG A;  4L3H D;  5EML B;  4A0A A;  3F3G A;  2OK6 A;  3PSC B;  3EI3 A;  1GP2 B;  3L4M D;  2AH1 A;  4PSW B;  3VGZ A;  4A7J A;  3IIW A;  3JZN A;  3NVQ A;  4GQB B;  5H1M A;  2I3S A;  3CFV A;  2GC7 A;  4E54 A;  4X61 B;  5C2W B;  3NVN A;  4BH6 A;  5GMK n;  3PE7 A;  2TRC B;  4Y7R A;  2B5M A;  2CO0 A;  5FKS A;  3SBR A;  1NR0 A;  2B5L A;  1OLZ A;  5EMK B;  3I89 A;  1JMZ B;  3F3F A;  3V7D B;  2B5N A;  3MKQ A;  1VYH C;  4PBZ A;  3UKU C;  3MZK A;  1Q47 A;  2P9U C;  1PI6 A;  4CI2 A;  1SQJ A;  4AEZ A;  2IAA A;  5H14 A;  4J79 A;  2PM9 B;  3PVU B;  4NSX A;  4JD2 C;  3UR4 A;  3SLE D;  3UVK A;  2IUQ A;  2B4E A;  1U4C A;  3FM0 A;  1XHM A;  4GZ8 A;  2MTA H;  5EM2 B;  1ERJ A;  4J8G A;  5GXH A;  4TZ4 A;  3I8E A;  3J80 g;  1N6F A;  5FKR A;  2XYI A;  2YB8 B;  3BG0 A;  3I7P A;  3OW8 A;  4U7A A;  4O3U B;  1R5M A;  3C99 A;  3EI1 A;  3JZG A;  4PC0 A;  5FQD A;  3OKY A;  1RI6 A;  3OTT A;  4FA5 D;  4MK0 B;  2OVQ B;  4O1Q D;  5I5M A;  5EAM A;  4O9D A;  2J57 G;  5H17 A;  4ZN4 A;  5FLX g;  3EG6 A;  3C75 H;  4E5Z A;  2P9P C;  4H5I A;  4GQ2 P;  3ZWL B;  2IWK A;  4A0A B;  1PEV A;  2H9M A;  3B7F A;  5HE3 B;  5CXB A;  2XU7 A;  4CI3 A;  3IJC A;  4IA9 A;  3UVO A;  2QC5 A;  3K26 A;  4Y5R D;  4J77 A;  3MMY A;  3SN6 B;  4E54 B;  2CO0 C;  3F3P A;  3MZL A;  1N6E A;  5C9Z B;  3PVW B;  3GRE A;  4AOW A;  3RLM D;  4BUJ C;  4K3J B;  2YMU A;  2GC4 A;  5B4W A;  4GQ1 A;  2UZX B;  2H47 A;  5I5I A;  4HDJ A;  3U4Y A;  4GM3 A;  5TEF A;  4GM9 A;  4I79 A;  4A08 A;  1JOF A;  5FA5 B;  4GGD A;  3PXT D;  4ERZ A;  3HFQ A;  4CZV A;  5HE1 B;  3JB9 L;  4X60 B;  5SXM A;  4CY5 A;  3UVM A;  5CYK A;  2HYE A;  2AH0 A;  3AL8 A;  3PXS D;  1GG2 B;  3AH8 B;  1TYQ C;  3C5M A;  2Z2O A;  2I0S A;  4FHL A;  1GOT B;  2P9K C;  4FA9 D;  3DM0 A;  1N6D A;  3FGB A;  3KRW B;  3N0E A;  4R7A B;  2H6K A;  4CZX A;  5K19 A;  1YFQ A;  4L1Q D;  3KRX B;  4CC9 A;  1MG3 A;  3C9C A;  2AGY A;  3V9F A;  5FKQ A;  4J82 A;  4ZOX A;  2H13 A;  3EI4 A;  4OZU A;  3ODT A;  3W15 A;  4FA1 D;  4FAN D;  3SMR A;  3JAM g;  5EAR A;  5CXC B;  2H14 A;  5IJ8 E;  2OJY A;  4QQE A;  2CN3 A;  5IGO A;  3E0C A;  4PNK B;  3JRP A;  3OKY B;  2I0R A;  3SFZ A;  4J0W A;  4XEI C;  4GGA A;  2YNP A;  5EAL A;  4JSX C;  4JSV C;  5GXI A;  4E5Z B;  3PSL A;  4FB1 D;  5KDO B;  3IJ0 A;  4X63 B;  4H5J A;  2H6Q A;  3SHF A;  2OVR B;  5EAP A;  4J81 A;  2H9P A;  1OMW B;  2IWF A;  3I7H A;  1B9Y A;  2Q7Q A;  2BCJ B;  4A09 B;  5K1C C;  4D0K A;  5A2Q g;  3MXX A;  3SXT D;  2PBI B;  3MKS B;  1FWX A;  3ORV D;  3I8C A;  5IGQ A;  4FA4 D;  4ZOZ A;  4K3I D;  1P22 A;  5C2V B;  4J84 A;  4G56 B;  2HKR A;  2PM9 A;  2OVP B;  2IUR A;  2J56 H;  4A08 B;  2HKM A;  5IC7 A;  4CY2 A;  3N0D A;  2GNQ A;  4J73 A;  3EI2 A;  1L0Q A;  3EI3 B;  2BBK H;  5AFU 3;  4Z8L A;  4JSN C;  5THA A;  4LGN A;  3EU7 A;  2EBS A;  5EM2 A;  4A2L A;  4ERY A;  4A0B A;  2XL2 A;  3IKO A;  4ES0 A;  2IUV A;  2AQ5 A;  4D6V A;  3I7K A;  4L3G D;  2G9A A;  1S4U X;  2I0T A;  2I3T A;  4PXW A;  1JMX B;  3JRO A;  4L9O A;  3AL9 A;  4O3T B;  4GM8 A;  1SQ9 A;  4JT5 C;  4A11 A;  3PXW D;  3EI4 B;  5TF2 A;  1XKS A;  3EWE A;  1NEX B;  5EMM B;  2P9N C;  3RN1 D;  3RMZ D;  5AMS A;  2PM6 B;  4JT6 C;  1K32 A;  1MDA H;  4J8B A;  2Z2P A;  3RRM C;  1SHY B;  2CNX A;  2G99 A;  1PBY B;  3I7L A;  4QT8 A;  1PGU A;  2O9K A;  4J0X A;  4PBY A;  3DSM A;  3SVW D;  5HYN B;  1K8K C;  2W18 A; 
#chains in the Genus database with same CATH topology
 2YNN A;  3UVN A;  2AGX A;  2Z2N A;  2H68 A;  2P9S C;  4QL1 A;  3OL2 A;  2AGZ A;  2CE8 A;  1C9L A;  4CI1 A;  2YNO A;  5M61 A;  3ULE C;  3BG1 A;  3RSE C;  2OIZ A;  2EIE A;  1TBG A;  1B9X A;  5C86 A;  2XL3 A;  4D9S A;  3OKT A;  4YVD A;  3EI1 B;  3RFH A;  3NIF A;  4ERQ A;  4J87 A;  3CIK B;  4FWW A;  2VC2 A;  2H9N A;  2YBA A;  4BP8 A;  3JPX A;  2HES X;  2HU8 A;  4Z7Q A;  2H6N A;  4CZY A;  4QAM A;  1A0R B;  4IRZ A;  3P4F A;  4BP9 A;  3IIY A;  4PSX B;  3MVD K;  3IUN A;  4NAA A;  4U1E I;  1GXR A;  3SCY A;  5CXB B;  4L1M A;  3EI2 B;  2P9L C;  3BWS A;  2VDO A;  3RN0 D;  3UVL A;  1C9I A;  4O45 A;  3A0F A;  2CN2 A;  4ZOY A;  4JHP C;  5FKT A;  3SWS D;  4GMB A;  5JWZ A;  5HE2 B;  4CY3 A;  2QZP A;  4BCD A;  3J81 g;  3VH0 A;  5AJA A;  4QRJ A;  5EMJ B;  3NVX A;  1XIP A;  2HJ4 A;  3IJE A;  4AMY A;  4FAV D;  5IJ7 E;  3VA6 A;  4A0B B;  5IT9 g;  5I5J A;  2QR5 A;  5CXC A;  2P9I C;  3EMH A;  3I7O A;  5HQG A;  2QXV A;  1GOF A;  4OWR A;  4CY1 A;  1H2X A;  2CE9 A;  4X3E A;  3I2N A;  4JSP C;  4ZOV A;  4LG8 A;  4LG9 A;  1MG2 A;  3GD1 I;  3IJ1 A;  3SBQ A;  3OF7 A;  5M5S A;  3AFC A;  4IMM A;  4A11 B;  4A2M A;  4BCC A;  2XZG A;  4CI8 A;  2WQ8 A;  3EQ7 A;  3K27 A;  3DXK C;  5M5U A;  4JXM A;  3UKR C;  2UZY B;  4XYI A;  2H9L A;  3V5W B;  5CYK B;  2OK4 A;  3AL8 B;  3IUJ A;  3OKW A;  2BKL A;  2HJB A;  3IUM A;  3ZDZ A;  2HXC A;  3DWL C;  4ESG A;  1GOG A;  3SJL D;  2AGW A;  1H2Z A;  1QNI A;  4J86 A;  4WK0 A;  2VDM A;  3GFC A;  4UI9 R;  5GSA A;  4BL0 A;  3QHY B;  4NC4 A;  4A09 A;  2VDL A;  4EWR A;  3JZH A;  1JJU B;  4KFM B;  3OL2 B;  4GGC A;  3CFS B;  5M5R A;  3I7N A;  5FFO A;  4J78 A;  5HE0 B;  2H3X A;  2VDK A;  2PM7 B;  2AGL A;  5FXY A;  3DXM C;  2IUP A;  2J55 H;  4N14 A;  1GOH A;  5TEE A;  3L4O D;  3SBP A;  3FRX A;  4UM9 A;  4XYH A;  1U2V C;  5TDH B;  3RFG A;  3VI4 A;  4L3H D;  5EML B;  4A0A A;  3F3G A;  2OK6 A;  3PSC B;  3EI3 A;  1GP2 B;  3IUL A;  3L4M D;  2AH1 A;  4PSW B;  3VGZ A;  4A7J A;  3IIW A;  3JZN A;  3NVQ A;  4GQB B;  5H1M A;  2I3S A;  1M1X A;  3CFV A;  2GC7 A;  4E54 A;  4X61 B;  5C2W B;  3NVN A;  4BH6 A;  5GMK n;  3PE7 A;  3ZE2 A;  2TRC B;  4Y7R A;  2B5M A;  2CO0 A;  4JHN A;  5FKS A;  1NR0 A;  2B5L A;  3SBR A;  1OLZ A;  5EMK B;  3I89 A;  5FFG A;  1JMZ B;  3F3F A;  1JV2 A;  3V7D B;  2B5N A;  3MKQ A;  1VZ3 A;  2VZ1 A;  1VYH C;  4PBZ A;  3UKU C;  1U8C A;  3MZK A;  3O4H A;  1Q47 A;  1UOO A;  2P9U C;  1PI6 A;  4CI2 A;  4RE5 A;  1SQJ A;  1BPO A;  3O4I A;  4G55 A;  4AEZ A;  2IAA A;  5H14 A;  4Z7N A;  1O6G A;  4J79 A;  2PM9 B;  3PVU B;  4NSX A;  4JD2 C;  3UR4 A;  3IVM A;  4NBM A;  4BCB A;  3QI0 A;  3SLE D;  3UVK A;  2IUQ A;  2B4E A;  5M5T A;  1U4C A;  3FM0 A;  1XHM A;  4GZ8 A;  3O4J A;  4WK4 A;  2MTA H;  5EM2 B;  2XE4 A;  1ERJ A;  4J8G A;  5GXH A;  4TZ4 A;  3K72 A;  3I8E A;  3J80 g;  1N6F A;  5FKR A;  2XYI A;  2YB8 B;  3BG0 A;  4UM8 A;  3I7P A;  3OW8 A;  4U7A A;  4O3U B;  1R5M A;  3C99 A;  4O2W A;  3EI1 A;  5HDB A;  3ZDY A;  3JZG A;  4PC0 A;  3EQ8 A;  3OKY A;  5FQD A;  3ZE1 A;  1RI6 A;  2VDP A;  3V4V A;  3OTT A;  4FA5 D;  4MK0 B;  3K71 A;  2OVQ B;  4MMX A;  5E6U A;  3ZE0 A;  4O1Q D;  5I5M A;  5EAM A;  3T3P A;  2JKX A;  4O9D A;  2J57 G;  2XDW A;  5H17 A;  4ZN4 A;  3EG6 A;  5FLX g;  3C75 H;  4E5Z A;  2P9P C;  4H5I A;  3MUO A;  4GQ2 P;  3ZWL B;  2IWK A;  4A0A B;  3ZDX A;  1PEV A;  2H9M A;  3B7F A;  5HE3 B;  5CXB A;  2XU7 A;  4MMY A;  1E8M A;  4CI3 A;  1VE6 A;  3IJC A;  4IA9 A;  3UVO A;  2QC5 A;  3K26 A;  4Y5R D;  4J77 A;  3MMY A;  3SN6 B;  4DNU A;  4RE6 A;  4DNV A;  4E54 B;  2CO0 C;  3F3P A;  3MZL A;  1N6E A;  4WK2 A;  5C9Z B;  3PVW B;  1QFM A;  2VZ3 A;  3GRE A;  4AOW A;  3RLM D;  4BUJ C;  4K3J B;  2YMU A;  2GC4 A;  5B4W A;  4GQ1 A;  2UZX B;  2H47 A;  3KCI A;  5I5I A;  4HDJ A;  1L5G A;  3U4Y A;  3EQ9 A;  4GM3 A;  5TEF A;  4GM9 A;  4I79 A;  5M5V A;  4A08 A;  1JOF A;  5FA5 B;  4GGD A;  3PXT D;  4ERZ A;  3HFQ A;  1E5T A;  4CZV A;  5HE1 B;  3JB9 L;  4X60 B;  5SXM A;  4CY5 A;  4O02 A;  3UVM A;  5CYK A;  2HYE A;  1H2W A;  1A12 A;  2AH0 A;  3AL8 A;  3PXS D;  1GG2 B;  2VDN A;  3NIG A;  3AH8 B;  4G1M A;  1O6F A;  1TYQ C;  3C5M A;  2Z2O A;  1VE7 A;  2I0S A;  4FHL A;  5C92 A;  1GOT B;  2P9K C;  4FA9 D;  3DM0 A;  1N6D A;  3FGB A;  3FCU A;  2EID A;  3KRW B;  3N0E A;  4R7A B;  2H6K A;  4CZX A;  5K19 A;  1YFQ A;  4L1Q D;  3KRX B;  4CC9 A;  1MG3 A;  3C9C A;  2AGY A;  3V9F A;  3GC3 B;  5FKQ A;  4J82 A;  4ZOX A;  2H13 A;  3EI4 A;  4OZU A;  3ODT A;  3W15 A;  4FA1 D;  4FAN D;  4AN0 A;  3SMR A;  3JAM g;  5EAR A;  5CXC B;  2H14 A;  5IJ8 E;  2OJY A;  4QQE A;  2CN3 A;  5IGO A;  3E0C A;  4PNK B;  2EIB A;  1QFS A;  3JRP A;  3OKY B;  2I0R A;  3SFZ A;  4J0W A;  4XEI C;  4GGA A;  2YNP A;  5EAL A;  4JSX C;  4JSV C;  4WJK A;  5E6S A;  5GXI A;  3FCS A;  4E5Z B;  3PSL A;  4FB1 D;  1UOQ A;  5KDO B;  3IJ0 A;  1YR2 A;  4X63 B;  5E6R A;  4H5J A;  2H6Q A;  3SHF A;  2OVR B;  5EAP A;  4J81 A;  2H9P A;  1OMW B;  2IWF A;  3I7H A;  1B9Y A;  4AMZ A;  2Q7Q A;  3DDU A;  4DNW A;  2BCJ B;  2HU7 A;  4A09 B;  5K1C C;  4D0K A;  5A2Q g;  3MXX A;  3SXT D;  2PBI B;  3MKS B;  1FWX A;  3ORV D;  3I8C A;  5IGQ A;  2EIC A;  4ZOZ A;  4K3I D;  1P22 A;  4FA4 D;  3VI3 A;  5C2V B;  4NEN A;  4J84 A;  4G56 B;  2HKR A;  3NID A;  1E8N A;  2PM9 A;  2OVP B;  2IUR A;  2J56 H;  4A08 B;  2HKM A;  5IC7 A;  4CY2 A;  3N0D A;  3T3M A;  2GNQ A;  4J73 A;  3EI2 A;  1L0Q A;  1VZ2 A;  3EI3 B;  2BBK H;  5AFU 3;  4Z8L A;  4JSN C;  5THA A;  4LGN A;  3EU7 A;  2EBS A;  4Z7O A;  2VDQ A;  5EM2 A;  4AX4 A;  1UTC A;  1TYE A;  4A2L A;  4ERY A;  4A0B A;  2XL2 A;  3IKO A;  4ES0 A;  2IUV A;  2AQ5 A;  2HU5 A;  4D6V A;  3I7K A;  1JTD B;  4L3G D;  2G9A A;  1S4U X;  2I0T A;  2I3T A;  4PXW A;  1JMX B;  3K6S A;  3JRO A;  4L9O A;  3AL9 A;  3MUN A;  4O3T B;  1H2Y A;  4MMZ A;  4GM8 A;  1SQ9 A;  1I2M B;  3IUQ A;  4JT5 C;  2VDR A;  4A11 A;  3PXW D;  3EI4 B;  5TF2 A;  1XKS A;  3EWE A;  1NEX B;  5EMM B;  2P9N C;  3O4G A;  3RN1 D;  3RMZ D;  4G1E A;  5AMS A;  2PM6 B;  4JT6 C;  4AN1 A;  1K32 A;  1UOP A;  1MDA H;  2Z2P A;  4J8B A;  3RRM C;  1SHY B;  2CNX A;  1K3I A;  2G99 A;  1PBY B;  3I7L A;  4QT8 A;  1PGU A;  2O9K A;  4J0X A;  4PBY A;  3DSM A;  3IUR A;  3SVW D;  1T2X A;  5HYN B;  1K8K C;  3V4P A;  2W18 A; 
#chains in the Genus database with same CATH homology
 2YNN A;  3UVN A;  2AGX A;  2Z2N A;  2H68 A;  2P9S C;  4QL1 A;  3OL2 A;  2AGZ A;  2CE8 A;  4CI1 A;  2YNO A;  3ULE C;  3BG1 A;  3RSE C;  2OIZ A;  1TBG A;  1B9X A;  2XL3 A;  3OKT A;  4YVD A;  3EI1 B;  3RFH A;  4ERQ A;  4J87 A;  3CIK B;  4FWW A;  2H9N A;  2YBA A;  3JPX A;  2HES X;  2H6N A;  4CZY A;  1A0R B;  3P4F A;  3IIY A;  4PSX B;  4U1E I;  1GXR A;  3SCY A;  5CXB B;  3EI2 B;  2P9L C;  3BWS A;  3UVL A;  3RN0 D;  4O45 A;  3A0F A;  2CN2 A;  4ZOY A;  5FKT A;  3SWS D;  4GMB A;  5JWZ A;  5HE2 B;  4CY3 A;  3J81 g;  3VH0 A;  5AJA A;  4QRJ A;  5EMJ B;  3NVX A;  1XIP A;  2HJ4 A;  4FAV D;  5IJ7 E;  4A0B B;  3VA6 A;  5IT9 g;  5I5J A;  5CXC A;  2P9I C;  3EMH A;  3I7O A;  5HQG A;  2QXV A;  4OWR A;  4CY1 A;  2CE9 A;  4X3E A;  3I2N A;  4JSP C;  4ZOV A;  4LG8 A;  4LG9 A;  1MG2 A;  3IJ1 A;  3SBQ A;  3AFC A;  4IMM A;  4A11 B;  4A2M A;  4CI8 A;  3K27 A;  3DXK C;  4JXM A;  3UKR C;  2UZY B;  4XYI A;  2H9L A;  3V5W B;  5CYK B;  2OK4 A;  3AL8 B;  3OKW A;  2HJB A;  2HXC A;  3DWL C;  4ESG A;  3SJL D;  2AGW A;  1QNI A;  4J86 A;  3GFC A;  4UI9 R;  5GSA A;  4BL0 A;  4A09 A;  4EWR A;  3JZH A;  1JJU B;  4KFM B;  3OL2 B;  4GGC A;  3CFS B;  3I7N A;  4J78 A;  5HE0 B;  2H3X A;  2PM7 B;  2AGL A;  5FXY A;  3DXM C;  2IUP A;  2J55 H;  4N14 A;  5TEE A;  3L4O D;  3SBP A;  3FRX A;  4XYH A;  1U2V C;  5TDH B;  3RFG A;  4L3H D;  5EML B;  4A0A A;  3F3G A;  2OK6 A;  3PSC B;  3EI3 A;  1GP2 B;  3L4M D;  2AH1 A;  4PSW B;  3VGZ A;  4A7J A;  3IIW A;  3JZN A;  3NVQ A;  4GQB B;  5H1M A;  2I3S A;  3CFV A;  2GC7 A;  4E54 A;  4X61 B;  5C2W B;  3NVN A;  4BH6 A;  5GMK n;  3PE7 A;  2TRC B;  4Y7R A;  2B5M A;  2CO0 A;  5FKS A;  3SBR A;  1NR0 A;  2B5L A;  1OLZ A;  5EMK B;  3I89 A;  1JMZ B;  3F3F A;  3V7D B;  2B5N A;  3MKQ A;  1VYH C;  4PBZ A;  3UKU C;  3MZK A;  1Q47 A;  2P9U C;  1PI6 A;  4CI2 A;  1SQJ A;  4AEZ A;  2IAA A;  5H14 A;  4J79 A;  2PM9 B;  3PVU B;  4NSX A;  4JD2 C;  3UR4 A;  3SLE D;  3UVK A;  2IUQ A;  2B4E A;  1U4C A;  3FM0 A;  1XHM A;  4GZ8 A;  2MTA H;  5EM2 B;  1ERJ A;  4J8G A;  5GXH A;  4TZ4 A;  3I8E A;  3J80 g;  1N6F A;  5FKR A;  2XYI A;  2YB8 B;  3BG0 A;  3I7P A;  3OW8 A;  4U7A A;  4O3U B;  1R5M A;  3C99 A;  3EI1 A;  3JZG A;  4PC0 A;  5FQD A;  3OKY A;  1RI6 A;  3OTT A;  4FA5 D;  4MK0 B;  2OVQ B;  4O1Q D;  5I5M A;  5EAM A;  4O9D A;  2J57 G;  5H17 A;  4ZN4 A;  5FLX g;  3EG6 A;  3C75 H;  4E5Z A;  2P9P C;  4H5I A;  4GQ2 P;  3ZWL B;  2IWK A;  4A0A B;  1PEV A;  2H9M A;  3B7F A;  5HE3 B;  5CXB A;  2XU7 A;  4CI3 A;  3IJC A;  4IA9 A;  3UVO A;  2QC5 A;  3K26 A;  4Y5R D;  4J77 A;  3MMY A;  3SN6 B;  4E54 B;  2CO0 C;  3F3P A;  3MZL A;  1N6E A;  5C9Z B;  3PVW B;  3GRE A;  4AOW A;  3RLM D;  4BUJ C;  4K3J B;  2YMU A;  2GC4 A;  5B4W A;  4GQ1 A;  2UZX B;  2H47 A;  5I5I A;  4HDJ A;  3U4Y A;  4GM3 A;  5TEF A;  4GM9 A;  4I79 A;  4A08 A;  1JOF A;  5FA5 B;  4GGD A;  3PXT D;  4ERZ A;  3HFQ A;  4CZV A;  5HE1 B;  3JB9 L;  4X60 B;  5SXM A;  4CY5 A;  3UVM A;  5CYK A;  2HYE A;  2AH0 A;  3AL8 A;  3PXS D;  1GG2 B;  3AH8 B;  1TYQ C;  3C5M A;  2Z2O A;  2I0S A;  4FHL A;  1GOT B;  2P9K C;  4FA9 D;  3DM0 A;  1N6D A;  3FGB A;  3KRW B;  3N0E A;  4R7A B;  2H6K A;  4CZX A;  5K19 A;  1YFQ A;  4L1Q D;  3KRX B;  4CC9 A;  1MG3 A;  3C9C A;  2AGY A;  3V9F A;  5FKQ A;  4J82 A;  4ZOX A;  2H13 A;  3EI4 A;  4OZU A;  3ODT A;  3W15 A;  4FA1 D;  4FAN D;  3SMR A;  3JAM g;  5EAR A;  5CXC B;  2H14 A;  5IJ8 E;  2OJY A;  4QQE A;  2CN3 A;  5IGO A;  3E0C A;  4PNK B;  3JRP A;  3OKY B;  2I0R A;  3SFZ A;  4J0W A;  4XEI C;  4GGA A;  2YNP A;  5EAL A;  4JSX C;  4JSV C;  5GXI A;  4E5Z B;  3PSL A;  4FB1 D;  5KDO B;  3IJ0 A;  4X63 B;  4H5J A;  2H6Q A;  3SHF A;  2OVR B;  5EAP A;  4J81 A;  2H9P A;  1OMW B;  2IWF A;  3I7H A;  1B9Y A;  2Q7Q A;  2BCJ B;  4A09 B;  5K1C C;  4D0K A;  5A2Q g;  3MXX A;  3SXT D;  2PBI B;  3MKS B;  1FWX A;  3ORV D;  3I8C A;  5IGQ A;  4FA4 D;  4ZOZ A;  4K3I D;  1P22 A;  5C2V B;  4J84 A;  4G56 B;  2HKR A;  2PM9 A;  2OVP B;  2IUR A;  2J56 H;  4A08 B;  2HKM A;  5IC7 A;  4CY2 A;  3N0D A;  2GNQ A;  4J73 A;  3EI2 A;  1L0Q A;  3EI3 B;  2BBK H;  5AFU 3;  4Z8L A;  4JSN C;  5THA A;  4LGN A;  3EU7 A;  2EBS A;  5EM2 A;  4A2L A;  4ERY A;  4A0B A;  2XL2 A;  3IKO A;  4ES0 A;  2IUV A;  2AQ5 A;  4D6V A;  3I7K A;  4L3G D;  2G9A A;  1S4U X;  2I0T A;  2I3T A;  4PXW A;  1JMX B;  3JRO A;  4L9O A;  3AL9 A;  4O3T B;  4GM8 A;  1SQ9 A;  4JT5 C;  4A11 A;  3PXW D;  3EI4 B;  5TF2 A;  1XKS A;  3EWE A;  1NEX B;  5EMM B;  2P9N C;  3RN1 D;  3RMZ D;  5AMS A;  2PM6 B;  4JT6 C;  1K32 A;  1MDA H;  4J8B A;  2Z2P A;  3RRM C;  1SHY B;  2CNX A;  2G99 A;  1PBY B;  3I7L A;  4QT8 A;  1PGU A;  2O9K A;  4J0X A;  4PBY A;  3DSM A;  3SVW D;  5HYN B;  1K8K C;  2W18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...