4AEZA

Crystal structure of mitotic checkpoint complex
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
343
structure length
326
Chain Sequence
LNTRVLAFKLDAPEAKKPVDRRFNTTPERVLDAPGIIDDYYLNLLDWSNLNVVAVALERNVYVWNADSGSVSALAETDESTYVASVKWSHDGSFLSVGLGNGLVDIYDVESQTKLRTMAGHQARVGCLSWNRHVLSSGSRSGAIHHHDVRIANHQIGTLQGHSSEVCGLAWRSDGLQLASGGNDNVVQIWDARSSIPKFTKTNHNAAVKAVAWCPWQSNLLATGGGTMDKQIHFWNAATGARVNTVDAGSQVTSLIWSPHSKEIMSTHGFPDNNLSIWSYSSSGLTKQVDIPAHDTRVLYSALSPDGRILSTAASDENLKFWRVYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords WD REPEAT-CONTAINING PROTEIN SLP1
publication title Structure of the Mitotic Checkpoint Complex
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 83
structure length 326
sequence length 343
chains with identical sequence D, G
ec nomenclature
pdb deposition date 2012-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4aezA00
4J0WA 3SCYA 5I5JA 1GG2B 3RSEC 4E5ZA 2HYEA 3I7OA 4GM8A 3RN0D 4A09A 2Z2OA 1TBGA 3CFVA 2CNXA 4I79A 2H6KA 2XL2A 3I89A 4JSVC 4A2MA 1GP2B 1A0RB 2H9NA 2J55H 2MTAH 4J84A 2YB8B 3C5MA 2GNQA 3AL9A 2CO0C 2BBKH 2PBIB 4X60B 1PGUA 4OWRA 4U7AA 4LG8A 2OK4A 2IUQA 1N6EA 4U1EI 5K19A 4FA9D 4D6VA 3RLMD 1K8KC 3JZGA 2H9MA 5AJAA 1MG3A 5B4WA 2AQ5A 3I2NA 2PM7B 2I0TA 5I5MA 5THAA 4K3JB 2YMUA 3DM0A 4AEZA 5AFU3 1MG2A 4PSWB 1JMZB 5K1CC 4PNKB 3SVWD 5AMSA 1XKSA 2I0RA 3JPXA 1NR0A 2IUVA 1N6FA 2AH0A 3SBRA 2Z2PA 2IAAA 5H14A 4PBYA 4GGAA 2P9UC 3EG6A 3SWSD 2UZYB 4J73A 1R5MA 2H9PA 3DXMC 1OMWB 4JSNC 5EMMB 4CZXA 1SQJA 3MMYA 3CIKB 5GSAA 4L9OA 4KFMB 3MXXA 5HE1B 3MKQA 4A08A 4G56B 1MDAH 3NVQA 4A7JA 3ULEC 5CXBA 4CC9A 4FB1D 1L0QA 3UVMA 5IGQA 5HYNB 5CXBB 3HFQA 5HE0B 2GC4A 1PI6A 2OVPB 5FA5B 3BWSA 4GGDA 3SXTD 3E0CA 4O45A 1PEVA 1QNIA 3GFCA 3IIWA 3EI4A 1B9YA 2B5MA 4O1QD 4PBZA 4R7AB 4FAND 3CFSB 2AGWA 3AL8A 3EI4B 3PXSD 2H13A 3VA6A 3OW8A 3J80g 3JRPA 4CY3A 4CZYA 4GMBA 5EAMA 1PBYB 2YNPA 2O9KA 3AH8B 3JZHA 1SHYB 2B4EA 2OJYA 3PE7A 2B5NA 2I3SA 4NSXA 4O3UB 3NVXA 3UKRC 5CYKA 4ERYA 5GXIA 5CYKB 3F3PA 4L1QD 4X3EA 3SBQA 3EI2A 4FA1D 3RFGA 3FGBA 3EI2B 2EBSA 3SFZA 4N14A 4X63B 4MK0B 1FWXA 1U4CA 4JSXC 4HDJA 3MZLA 4OZUA 5EAPA 4AOWA 3I8EA 5EALA 2OK6A 2AGYA 1GXRA 4L3HD 2I3TA 3AFCA 5HE3B 3I7KA 3NVNA 1VYHC 5EMKB 4CY1A 2B5LA 3JZNA 2CN3A 2J57G 4A0AA 2YBAA 4J87A 3F3GA 3C75H 4ESGA 3PXTD 4A0AB 3PSCB 4QT8A 2OVRB 4FA4D 3ORVD 3IIYA 1JOFA 2H14A 4XYHA 2HJ4A 4A11A 3EI1B 4JT6C 4A11B 3L4OD 4IMMA 5GMKn 4A2LA 3KRXB 4JD2C 2QXVA 4JSPC 2AGZA 3SLED 2H47A 4GQ1A 3UR4A 3IJ0A 3OKYA 4ZOVA 4Z8LA 3W15A 2I0SA 2Q7QA 3OKYB 3SBPA 4J86A 2AGLA 3V5WB 2XL3A 4J77A 3EWEA 4E54A 4FA5D 3DWLC 4E54B 4QL1A 3F3FA 2IUPA 3FM0A 3EU7A 4JT5C 5JWZA 4J82A 4BH6A 1XHMA 5FQDA 3K26A 3PSLA 4ZOZA 2P9KC 4JXMA 3SJLD 3OKTA 2HESX 4PXWA 3VGZA 4PSXB 5HE2B 3RMZD 3I7PA 3MKSB 3N0EA 2BCJB 4GM3A 5TEEA 5IJ7E 4TZ4A 4D0KA 2YNNA 2P9IC 4FWWA 4XYIA 3EI3A 3JAMg 4LG9A 3EI3B 4FHLA 3DXKC 3SN6B 1OLZA 1GOTB 3SHFA 2H9LA 5FXYA 2CE9A 3VH0A 4ZN4A 5C2VB 3V9FA 3FRXA 1K32A 4J0XA 1YFQA 1B9XA 4ERZA 5FKQA 4H5JA 4E5ZB 4BL0A 2XYIA 3L4MD 5H1MA 2PM6B 3PVUB 4A09B 4QRJA 3UKUC 1Q47A 2P9SC 4CI2A 4Y7RA 2OVQB 2IURA 3IKOA 5H17A 3OL2A 1N6DA 4CI3A 3I8CA 3OL2B 4IA9A 3I7LA 2CN2A 4CY2A 4ERQA 5EARA 5FKRA 1TYQC 3RRMC 1RI6A 3PXWD 2PM9A 2J56H 4GGCA 4EWRA 4GQ2P 2PM9B 4CY5A 4ZOXA 2P9NC 3JB9L 1ERJA 2AH1A 4A0BA 3I7NA 3K27A 3V7DB 1P22A 4A0BB 3J81g 1NEXB 2GC7A 5I5IA 3KRWB 5EM2A 3BG0A 1XIPA 5TEFA 5EM2B 3OKWA 2XU7A 4J78A 4XEIC 3EI1A 2HJBA 3UVNA 2H6NA 5TDHB 3ODTA 2W18A 1S4UX 2G9AA 5C9ZB 4K3ID 3ZWLB 4PC0A 4UI9R 2P9LC 5CXCA 5EMJB 3DSMA 2G99A 5CXCB 3UVLA 2P9PC 4L3GD 3IJCA 5GXHA 4FAVD 2CO0A 1JMXB 3EMHA 4BUJC 3MZKA 3IJ1A 5IGOA 5FKTA 4ES0A 5EMLB 2YNOA 2HXCA 4H5IA 3RN1D 4GZ8A 4O3TB 4ZOYA 2AGXA 2QC5A 3OTTA 3UVOA 2UZXB 3U4YA 1SQ9A 3JROA 3GREA 2H68A 3I7HA 3A0FA 2CE8A 3N0DA 4O9DA 4A08B 4QQEA 4J79A 4J81A 3BG1A 4J8BA 2HKRA 2IWFA 2H6QA 5FLXg 2H3XA 4GQBB 4CI8A 5IC7A 3RFHA 3C9CA 4Y5RD 5IT9g 2OIZA 5SXMA 5HQGA 5TF2A 5KDOB 3SMRA 2IWKA 2TRCB 4X61B 5A2Qg 4GM9A 3C99A 3PVWB 3UVKA 1JJUB 5C2WB 4J8GA 3AL8B 1U2VC 2HKMA 4YVDA 4LGNA 2Z2NA 4CZVA 4CI1A 3P4FA 5IJ8E 3B7FA 5FKSA
chains in the Genus database with same CATH superfamily
4J0WA 3SCYA 5I5JA 4AN0A 1GG2B 3RSEC 4E5ZA 2HYEA 3I7OA 4GM8A 3RN0D 4MMXA 4A09A 3T3MA 2Z2OA 1TBGA 3CFVA 2CNXA 3GD1I 4UM8A 3ZE1A 4I79A 3O4HA 2H6KA 2EIDA 2XL2A 3I89A 4JSVC 4A2MA 1GP2B 1A0RB 2H9NA 2J55H 2MTAH 4J84A 2YB8B 3C5MA 2GNQA 3AL9A 2BBKH 2CO0C 2PBIB 4X60B 1TYEA 2BKLA 1PGUA 4OWRA 2EIEA 4U7AA 4LG8A 2OK4A 3ZDZA 2IUQA 1N6EA 4U1EI 5K19A 4FA9D 4D6VA 3RLMD 1UOPA 1K8KC 3JZGA 2H9MA 4WK4A 5AJAA 1MG3A 5B4WA 2AQ5A 3I2NA 2PM7B 2I0TA 5I5MA 5THAA 4K3JB 2YMUA 2VDMA 3ZE2A 4NC4A 3DM0A 4AEZA 5AFU3 1MG2A 4PSWB 1JMZB 1VZ2A 2JKXA 5K1CC 4PNKB 3SVWD 5AMSA 1XKSA 2I0RA 3JPXA 1NR0A 2IUVA 1N6FA 2AH0A 3SBRA 2Z2PA 4BCDA 4NAAA 2IAAA 5H14A 4PBYA 5C92A 4GGAA 2VDPA 4RE5A 2VDKA 2P9UC 3ZDYA 3EG6A 3SWSD 2UZYB 4J73A 4NBMA 1R5MA 2H9PA 3DXMC 1OMWB 4JSNC 4BP8A 5EMMB 4CZXA 1SQJA 3MMYA 3CIKB 4G55A 5GSAA 1QFSA 4L9OA 2EIBA 4KFMB 3MXXA 5HE1B 3MKQA 4A08A 3O4IA 4G56B 1MDAH 3NVQA 4A7JA 3IUQA 5CXBA 3ULEC 4CC9A 1L0QA 3UVMA 4FB1D 5IGQA 2QR5A 5HYNB 5CXBB 3HFQA 4BCBA 5HE0B 2GC4A 3GC3B 1E5TA 1PI6A 2VDNA 2OVPB 2VDOA 5FA5B 3BWSA 4GGDA 3SXTD 3E0CA 4O45A 1PEVA 1QNIA 3GFCA 1C9LA 3IIWA 3IVMA 3EI4A 1B9YA 2B5MA 4O1QD 4PBZA 4R7AB 4FAND 3CFSB 2AGWA 3AL8A 3EI4B 3PXSD 2XDWA 2H13A 3VA6A 3OW8A 3J80g 3JRPA 4CY3A 4CZYA 2VZ1A 3MUNA 2HU7A 4NENA 1M1XA 4GMBA 5EAMA 1PBYB 3EQ7A 2YNPA 2O9KA 3AH8B 3JZHA 1SHYB 2B4EA 2OJYA 4JHPC 3PE7A 1GOFA 2B5NA 3NIDA 3FCSA 2I3SA 4NSXA 4O3UB 2HU5A 3NVXA 4AX4A 3UKRC 5CYKA 4ERYA 5GXIA 5CYKB 3F3PA 4L1QD 4X3EA 3SBQA 3EI2A 4FA1D 3RFGA 3FGBA 3EI2B 2EICA 2EBSA 3SFZA 4RE6A 4N14A 3MVDK 4X63B 2VZ3A 4MK0B 1FWXA 1U4CA 1H2ZA 4JSXC 4HDJA 3MZLA 4OZUA 5EAPA 4AOWA 3I8EA 1I2MB 3ZDXA 4IRZA 4AMZA 5EALA 2OK6A 2AGYA 3O4JA 1VZ3A 1GXRA 3VI4A 4L3HD 2I3TA 3AFCA 5HE3B 3I7KA 3NVNA 1VYHC 5EMKB 1E8MA 1K3IA 4CY1A 2B5LA 3JZNA 2CN3A 3NIGA 5C86A 2J57G 4A0AA 2YBAA 4J87A 3F3GA 3C75H 4ESGA 3PXTD 4A0AB 3PSCB 4QT8A 2OVRB 4FA4D 3DDUA 3QHYB 3ORVD 3IIYA 1JOFA 2H14A 3IUMA 4XYHA 2XZGA 1O6GA 2HJ4A 5M5UA 4A11A 3EI1B 4JT6C 4DNWA 4A11B 3FCUA 3L4OD 4IMMA 5GMKn 4A2LA 2VDQA 3KRXB 4JD2C 4DNUA 2QXVA 4JSPC 3QI0A 2AGZA 1YR2A 3SLED 2H47A 4GQ1A 3UR4A 3IJ0A 3OKYA 4ZOVA 4Z8LA 3W15A 2I0SA 2Q7QA 3OKYB 3SBPA 4J86A 2AGLA 3V5WB 1JV2A 2XL3A 4J77A 3EWEA 1UOOA 4QAMA 4E54A 4FA5D 3IJEA 3DWLC 4E54B 4QL1A 3ZE0A 1VE6A 5FFOA 3F3FA 2IUPA 3FM0A 3EU7A 5M5TA 4JT5C 5JWZA 4J82A 4BH6A 1XHMA 1T2XA 5FQDA 3K26A 3PSLA 4ZOZA 5E6UA 1C9IA 2P9KC 4JXMA 3SJLD 3OKTA 2HESX 4PXWA 3VGZA 4PSXB 5HE2B 3RMZD 3I7PA 4G1EA 3MKSB 3N0EA 2BCJB 4GM3A 5TEEA 5IJ7E 4TZ4A 4D0KA 3NIFA 2YNNA 2P9IC 4FWWA 5E6SA 4DNVA 4XYIA 3EI3A 3JAMg 1H2WA 4LG9A 3EI3B 4FHLA 3DXKC 3SN6B 5M5RA 4O2WA 3IURA 1OLZA 1GOTB 3SHFA 2H9LA 5FXYA 2CE9A 3VH0A 4ZN4A 5C2VB 3V9FA 3FRXA 1GOHA 1H2YA 3K71A 1K32A 4J0XA 1YFQA 1B9XA 1QFMA 3V4PA 5FKQA 4ERZA 4H5JA 4E5ZB 4BL0A 2XYIA 3L4MD 5H1MA 2PM6B 3PVUB 4BCCA 4A09B 4QRJA 3UKUC 1BPOA 1Q47A 2P9SC 4CI2A 4Y7RA 5E6RA 2OVQB 2IURA 3IKOA 5H17A 3OL2A 1N6DA 4CI3A 3I8CA 3OL2B 4IA9A 3I7LA 2CN2A 4CY2A 4ERQA 5EARA 5FKRA 1TYQC 3EQ9A 3RRMC 1RI6A 3PXWD 2PM9A 2J56H 1O6FA 4GGCA 2VC2A 4EWRA 2PM9B 4GQ2P 4CY5A 4ZOXA 2P9NC 3JB9L 1ERJA 2XE4A 2AH1A 4A0BA 3I7NA 3K27A 3V7DB 3KCIA 1P22A 4A0BB 3MUOA 3OF7A 4O02A 4MMYA 3J81g 1NEXB 2GC7A 5I5IA 3KRWB 5EM2A 3BG0A 1XIPA 5TEFA 5EM2B 3OKWA 4MMZA 2QZPA 2XU7A 4J78A 4XEIC 3EI1A 3EQ8A 2HJBA 3UVNA 2H6NA 5TDHB 3ODTA 2W18A 1VE7A 1L5GA 4WK0A 1S4UX 1A12A 3IULA 2G9AA 5C9ZB 4K3ID 3ZWLB 4WJKA 4PC0A 4UI9R 3K6SA 4AMYA 2P9LC 3T3PA 5CXCA 5EMJB 3DSMA 2G99A 5CXCB 3UVLA 1E8NA 2P9PC 4L3GD 3IJCA 2VDRA 4FAVD 2CO0A 1JMXB 5GXHA 3EMHA 4BUJC 3MZKA 3IJ1A 5IGOA 4Z7QA 5FKTA 4WK2A 4ES0A 5EMLB 5M61A 2YNOA 3V4VA 2HXCA 1U8CA 4H5IA 3RN1D 4GZ8A 4O3TB 1GOGA 4ZOYA 2AGXA 2QC5A 3OTTA 4JHNA 3UVOA 2UZXB 5M5VA 3U4YA 1SQ9A 3IUNA 3JROA 3O4GA 3GREA 2H68A 4Z7NA 3I7HA 3A0FA 2CE8A 3N0DA 4Z7OA 4O9DA 5HDBA 4A08B 4QQEA 4J79A 4J81A 3BG1A 3IUJA 4J8BA 4BP9A 4D9SA 2HKRA 2IWFA 2H6QA 5FLXg 2H3XA 4GQBB 4CI8A 5IC7A 3RFHA 3C9CA 4Y5RD 5IT9g 2OIZA 3K72A 5SXMA 4UM9A 5HQGA 5TF2A 1JTDB 5KDOB 3SMRA 2VDLA 2IWKA 2TRCB 4X61B 2WQ8A 5A2Qg 4GM9A 1H2XA 3C99A 5FFGA 5M5SA 3PVWB 3UVKA 1JJUB 5C2WB 4J8GA 1UTCA 3AL8B 1U2VC 2HKMA 4YVDA 4LGNA 2Z2NA 4L1MA 4CZVA 3VI3A 4CI1A 1UOQA 3P4FA 4AN1A 5IJ8E 3B7FA 5FKSA 2HU8A 4G1MA
chains in the Genus database with same CATH topology
4J0WA 3SCYA 5I5JA 1GG2B 3RSEC 4E5ZA 2HYEA 3I7OA 4GM8A 3RN0D 4A09A 2Z2OA 1TBGA 3CFVA 2CNXA 4I79A 2H6KA 2XL2A 3I89A 4JSVC 4A2MA 1GP2B 1A0RB 2H9NA 2J55H 2MTAH 4J84A 2YB8B 3C5MA 2GNQA 3AL9A 2CO0C 2BBKH 2PBIB 4X60B 1PGUA 4OWRA 4U7AA 4LG8A 2OK4A 2IUQA 1N6EA 4U1EI 5K19A 4FA9D 4D6VA 3RLMD 1K8KC 3JZGA 2H9MA 5AJAA 1MG3A 5B4WA 2AQ5A 3I2NA 2PM7B 2I0TA 5I5MA 5THAA 4K3JB 2YMUA 3DM0A 4AEZA 5AFU3 1MG2A 4PSWB 1JMZB 5K1CC 4PNKB 3SVWD 5AMSA 1XKSA 2I0RA 3JPXA 1NR0A 2IUVA 1N6FA 2AH0A 3SBRA 2Z2PA 2IAAA 5H14A 4PBYA 4GGAA 2P9UC 3EG6A 3SWSD 2UZYB 4J73A 1R5MA 2H9PA 3DXMC 1OMWB 4JSNC 5EMMB 4CZXA 1SQJA 3MMYA 3CIKB 5GSAA 4L9OA 4KFMB 3MXXA 5HE1B 3MKQA 4A08A 4G56B 1MDAH 3NVQA 4A7JA 3ULEC 5CXBA 4CC9A 4FB1D 1L0QA 3UVMA 5IGQA 5HYNB 5CXBB 3HFQA 5HE0B 2GC4A 1PI6A 2OVPB 5FA5B 3BWSA 4GGDA 3SXTD 3E0CA 4O45A 1PEVA 1QNIA 3GFCA 3IIWA 3EI4A 1B9YA 2B5MA 4O1QD 4PBZA 4R7AB 4FAND 3CFSB 2AGWA 3AL8A 3EI4B 3PXSD 2H13A 3VA6A 3OW8A 3J80g 3JRPA 4CY3A 4CZYA 4GMBA 5EAMA 1PBYB 2YNPA 2O9KA 3AH8B 3JZHA 1SHYB 2B4EA 2OJYA 3PE7A 2B5NA 2I3SA 4NSXA 4O3UB 3NVXA 3UKRC 5CYKA 4ERYA 5GXIA 5CYKB 3F3PA 4L1QD 4X3EA 3SBQA 3EI2A 4FA1D 3RFGA 3FGBA 3EI2B 2EBSA 3SFZA 4N14A 4X63B 4MK0B 1FWXA 1U4CA 4JSXC 4HDJA 3MZLA 4OZUA 5EAPA 4AOWA 3I8EA 5EALA 2OK6A 2AGYA 1GXRA 4L3HD 2I3TA 3AFCA 5HE3B 3I7KA 3NVNA 1VYHC 5EMKB 4CY1A 2B5LA 3JZNA 2CN3A 2J57G 4A0AA 2YBAA 4J87A 3F3GA 3C75H 4ESGA 3PXTD 4A0AB 3PSCB 4QT8A 2OVRB 4FA4D 3ORVD 3IIYA 1JOFA 2H14A 4XYHA 2HJ4A 4A11A 3EI1B 4JT6C 4A11B 3L4OD 4IMMA 5GMKn 4A2LA 3KRXB 4JD2C 2QXVA 4JSPC 2AGZA 3SLED 2H47A 4GQ1A 3UR4A 3IJ0A 3OKYA 4ZOVA 4Z8LA 3W15A 2I0SA 2Q7QA 3OKYB 3SBPA 4J86A 2AGLA 3V5WB 2XL3A 4J77A 3EWEA 4E54A 4FA5D 3DWLC 4E54B 4QL1A 3F3FA 2IUPA 3FM0A 3EU7A 4JT5C 5JWZA 4J82A 4BH6A 1XHMA 5FQDA 3K26A 3PSLA 4ZOZA 2P9KC 4JXMA 3SJLD 3OKTA 2HESX 4PXWA 3VGZA 4PSXB 5HE2B 3RMZD 3I7PA 3MKSB 3N0EA 2BCJB 4GM3A 5TEEA 5IJ7E 4TZ4A 4D0KA 2YNNA 2P9IC 4FWWA 4XYIA 3EI3A 3JAMg 4LG9A 3EI3B 4FHLA 3DXKC 3SN6B 1OLZA 1GOTB 3SHFA 2H9LA 5FXYA 2CE9A 3VH0A 4ZN4A 5C2VB 3V9FA 3FRXA 1K32A 4J0XA 1YFQA 1B9XA 4ERZA 5FKQA 4H5JA 4E5ZB 4BL0A 2XYIA 3L4MD 5H1MA 2PM6B 3PVUB 4A09B 4QRJA 3UKUC 1Q47A 2P9SC 4CI2A 4Y7RA 2OVQB 2IURA 3IKOA 5H17A 3OL2A 1N6DA 4CI3A 3I8CA 3OL2B 4IA9A 3I7LA 2CN2A 4CY2A 4ERQA 5EARA 5FKRA 1TYQC 3RRMC 1RI6A 3PXWD 2PM9A 2J56H 4GGCA 4EWRA 4GQ2P 2PM9B 4CY5A 4ZOXA 2P9NC 3JB9L 1ERJA 2AH1A 4A0BA 3I7NA 3K27A 3V7DB 1P22A 4A0BB 3J81g 1NEXB 2GC7A 5I5IA 3KRWB 5EM2A 3BG0A 1XIPA 5TEFA 5EM2B 3OKWA 2XU7A 4J78A 4XEIC 3EI1A 2HJBA 3UVNA 2H6NA 5TDHB 3ODTA 2W18A 1S4UX 2G9AA 5C9ZB 4K3ID 3ZWLB 4PC0A 4UI9R 2P9LC 5CXCA 5EMJB 3DSMA 2G99A 5CXCB 3UVLA 2P9PC 4L3GD 3IJCA 5GXHA 4FAVD 2CO0A 1JMXB 3EMHA 4BUJC 3MZKA 3IJ1A 5IGOA 5FKTA 4ES0A 5EMLB 2YNOA 2HXCA 4H5IA 3RN1D 4GZ8A 4O3TB 4ZOYA 2AGXA 2QC5A 3OTTA 3UVOA 2UZXB 3U4YA 1SQ9A 3JROA 3GREA 2H68A 3I7HA 3A0FA 2CE8A 3N0DA 4O9DA 4A08B 4QQEA 4J79A 4J81A 3BG1A 4J8BA 2HKRA 2IWFA 2H6QA 5FLXg 2H3XA 4GQBB 4CI8A 5IC7A 3RFHA 3C9CA 4Y5RD 5IT9g 2OIZA 5SXMA 5HQGA 5TF2A 5KDOB 3SMRA 2IWKA 2TRCB 4X61B 5A2Qg 4GM9A 3C99A 3PVWB 3UVKA 1JJUB 5C2WB 4J8GA 3AL8B 1U2VC 2HKMA 4YVDA 4LGNA 2Z2NA 4CZVA 4CI1A 3P4FA 5IJ8E 3B7FA 5FKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J0W A;  3SCY A;  5I5J A;  1GG2 B;  3RSE C;  4E5Z A;  2HYE A;  3I7O A;  4GM8 A;  3RN0 D;  4A09 A;  2Z2O A;  1TBG A;  3CFV A;  2CNX A;  4I79 A;  2H6K A;  2XL2 A;  3I89 A;  4JSV C;  4A2M A;  1GP2 B;  1A0R B;  2H9N A;  2J55 H;  2MTA H;  4J84 A;  2YB8 B;  3C5M A;  2GNQ A;  3AL9 A;  2CO0 C;  2BBK H;  2PBI B;  4X60 B;  1PGU A;  4OWR A;  4U7A A;  4LG8 A;  2OK4 A;  2IUQ A;  1N6E A;  4U1E I;  5K19 A;  4FA9 D;  4D6V A;  3RLM D;  1K8K C;  3JZG A;  2H9M A;  5AJA A;  1MG3 A;  5B4W A;  2AQ5 A;  3I2N A;  2PM7 B;  2I0T A;  5I5M A;  5THA A;  4K3J B;  2YMU A;  3DM0 A;  4AEZ A;  5AFU 3;  1MG2 A;  4PSW B;  1JMZ B;  5K1C C;  4PNK B;  3SVW D;  5AMS A;  1XKS A;  2I0R A;  3JPX A;  1NR0 A;  2IUV A;  1N6F A;  2AH0 A;  3SBR A;  2Z2P A;  2IAA A;  5H14 A;  4PBY A;  4GGA A;  2P9U C;  3EG6 A;  3SWS D;  2UZY B;  4J73 A;  1R5M A;  2H9P A;  3DXM C;  1OMW B;  4JSN C;  5EMM B;  4CZX A;  1SQJ A;  3MMY A;  3CIK B;  5GSA A;  4L9O A;  4KFM B;  3MXX A;  5HE1 B;  3MKQ A;  4A08 A;  4G56 B;  1MDA H;  3NVQ A;  4A7J A;  3ULE C;  5CXB A;  4CC9 A;  4FB1 D;  1L0Q A;  3UVM A;  5IGQ A;  5HYN B;  5CXB B;  3HFQ A;  5HE0 B;  2GC4 A;  1PI6 A;  2OVP B;  5FA5 B;  3BWS A;  4GGD A;  3SXT D;  3E0C A;  4O45 A;  1PEV A;  1QNI A;  3GFC A;  3IIW A;  3EI4 A;  1B9Y A;  2B5M A;  4O1Q D;  4PBZ A;  4R7A B;  4FAN D;  3CFS B;  2AGW A;  3AL8 A;  3EI4 B;  3PXS D;  2H13 A;  3VA6 A;  3OW8 A;  3J80 g;  3JRP A;  4CY3 A;  4CZY A;  4GMB A;  5EAM A;  1PBY B;  2YNP A;  2O9K A;  3AH8 B;  3JZH A;  1SHY B;  2B4E A;  2OJY A;  3PE7 A;  2B5N A;  2I3S A;  4NSX A;  4O3U B;  3NVX A;  3UKR C;  5CYK A;  4ERY A;  5GXI A;  5CYK B;  3F3P A;  4L1Q D;  4X3E A;  3SBQ A;  3EI2 A;  4FA1 D;  3RFG A;  3FGB A;  3EI2 B;  2EBS A;  3SFZ A;  4N14 A;  4X63 B;  4MK0 B;  1FWX A;  1U4C A;  4JSX C;  4HDJ A;  3MZL A;  4OZU A;  5EAP A;  4AOW A;  3I8E A;  5EAL A;  2OK6 A;  2AGY A;  1GXR A;  4L3H D;  2I3T A;  3AFC A;  5HE3 B;  3I7K A;  3NVN A;  1VYH C;  5EMK B;  4CY1 A;  2B5L A;  3JZN A;  2CN3 A;  2J57 G;  4A0A A;  2YBA A;  4J87 A;  3F3G A;  3C75 H;  4ESG A;  3PXT D;  4A0A B;  3PSC B;  4QT8 A;  2OVR B;  4FA4 D;  3ORV D;  3IIY A;  1JOF A;  2H14 A;  4XYH A;  2HJ4 A;  4A11 A;  3EI1 B;  4JT6 C;  4A11 B;  3L4O D;  4IMM A;  5GMK n;  4A2L A;  3KRX B;  4JD2 C;  2QXV A;  4JSP C;  2AGZ A;  3SLE D;  2H47 A;  4GQ1 A;  3UR4 A;  3IJ0 A;  3OKY A;  4ZOV A;  4Z8L A;  3W15 A;  2I0S A;  2Q7Q A;  3OKY B;  3SBP A;  4J86 A;  2AGL A;  3V5W B;  2XL3 A;  4J77 A;  3EWE A;  4E54 A;  4FA5 D;  3DWL C;  4E54 B;  4QL1 A;  3F3F A;  2IUP A;  3FM0 A;  3EU7 A;  4JT5 C;  5JWZ A;  4J82 A;  4BH6 A;  1XHM A;  5FQD A;  3K26 A;  3PSL A;  4ZOZ A;  2P9K C;  4JXM A;  3SJL D;  3OKT A;  2HES X;  4PXW A;  3VGZ A;  4PSX B;  5HE2 B;  3RMZ D;  3I7P A;  3MKS B;  3N0E A;  2BCJ B;  4GM3 A;  5TEE A;  5IJ7 E;  4TZ4 A;  4D0K A;  2YNN A;  2P9I C;  4FWW A;  4XYI A;  3EI3 A;  3JAM g;  4LG9 A;  3EI3 B;  4FHL A;  3DXK C;  3SN6 B;  1OLZ A;  1GOT B;  3SHF A;  2H9L A;  5FXY A;  2CE9 A;  3VH0 A;  4ZN4 A;  5C2V B;  3V9F A;  3FRX A;  1K32 A;  4J0X A;  1YFQ A;  1B9X A;  4ERZ A;  5FKQ A;  4H5J A;  4E5Z B;  4BL0 A;  2XYI A;  3L4M D;  5H1M A;  2PM6 B;  3PVU B;  4A09 B;  4QRJ A;  3UKU C;  1Q47 A;  2P9S C;  4CI2 A;  4Y7R A;  2OVQ B;  2IUR A;  3IKO A;  5H17 A;  3OL2 A;  1N6D A;  4CI3 A;  3I8C A;  3OL2 B;  4IA9 A;  3I7L A;  2CN2 A;  4CY2 A;  4ERQ A;  5EAR A;  5FKR A;  1TYQ C;  3RRM C;  1RI6 A;  3PXW D;  2PM9 A;  2J56 H;  4GGC A;  4EWR A;  4GQ2 P;  2PM9 B;  4CY5 A;  4ZOX A;  2P9N C;  3JB9 L;  1ERJ A;  2AH1 A;  4A0B A;  3I7N A;  3K27 A;  3V7D B;  1P22 A;  4A0B B;  3J81 g;  1NEX B;  2GC7 A;  5I5I A;  3KRW B;  5EM2 A;  3BG0 A;  1XIP A;  5TEF A;  5EM2 B;  3OKW A;  2XU7 A;  4J78 A;  4XEI C;  3EI1 A;  2HJB A;  3UVN A;  2H6N A;  5TDH B;  3ODT A;  2W18 A;  1S4U X;  2G9A A;  5C9Z B;  4K3I D;  3ZWL B;  4PC0 A;  4UI9 R;  2P9L C;  5CXC A;  5EMJ B;  3DSM A;  2G99 A;  5CXC B;  3UVL A;  2P9P C;  4L3G D;  3IJC A;  5GXH A;  4FAV D;  2CO0 A;  1JMX B;  3EMH A;  4BUJ C;  3MZK A;  3IJ1 A;  5IGO A;  5FKT A;  4ES0 A;  5EML B;  2YNO A;  2HXC A;  4H5I A;  3RN1 D;  4GZ8 A;  4O3T B;  4ZOY A;  2AGX A;  2QC5 A;  3OTT A;  3UVO A;  2UZX B;  3U4Y A;  1SQ9 A;  3JRO A;  3GRE A;  2H68 A;  3I7H A;  3A0F A;  2CE8 A;  3N0D A;  4O9D A;  4A08 B;  4QQE A;  4J79 A;  4J81 A;  3BG1 A;  4J8B A;  2HKR A;  2IWF A;  2H6Q A;  5FLX g;  2H3X A;  4GQB B;  4CI8 A;  5IC7 A;  3RFH A;  3C9C A;  4Y5R D;  5IT9 g;  2OIZ A;  5SXM A;  5HQG A;  5TF2 A;  5KDO B;  3SMR A;  2IWK A;  2TRC B;  4X61 B;  5A2Q g;  4GM9 A;  3C99 A;  3PVW B;  3UVK A;  1JJU B;  5C2W B;  4J8G A;  3AL8 B;  1U2V C;  2HKM A;  4YVD A;  4LGN A;  2Z2N A;  4CZV A;  4CI1 A;  3P4F A;  5IJ8 E;  3B7F A;  5FKS A; 
#chains in the Genus database with same CATH topology
 4J0W A;  3SCY A;  5I5J A;  4AN0 A;  1GG2 B;  3RSE C;  4E5Z A;  2HYE A;  3I7O A;  4GM8 A;  3RN0 D;  4MMX A;  4A09 A;  3T3M A;  2Z2O A;  1TBG A;  3CFV A;  2CNX A;  3GD1 I;  4UM8 A;  3ZE1 A;  4I79 A;  3O4H A;  2H6K A;  2EID A;  2XL2 A;  3I89 A;  4JSV C;  4A2M A;  1GP2 B;  1A0R B;  2H9N A;  2J55 H;  2MTA H;  4J84 A;  2YB8 B;  3C5M A;  2GNQ A;  3AL9 A;  2BBK H;  2CO0 C;  2PBI B;  4X60 B;  1TYE A;  2BKL A;  1PGU A;  4OWR A;  2EIE A;  4U7A A;  4LG8 A;  2OK4 A;  3ZDZ A;  2IUQ A;  1N6E A;  4U1E I;  5K19 A;  4FA9 D;  4D6V A;  3RLM D;  1UOP A;  1K8K C;  3JZG A;  2H9M A;  4WK4 A;  5AJA A;  1MG3 A;  5B4W A;  2AQ5 A;  3I2N A;  2PM7 B;  2I0T A;  5I5M A;  5THA A;  4K3J B;  2YMU A;  2VDM A;  3ZE2 A;  4NC4 A;  3DM0 A;  4AEZ A;  5AFU 3;  1MG2 A;  4PSW B;  1JMZ B;  1VZ2 A;  2JKX A;  5K1C C;  4PNK B;  3SVW D;  5AMS A;  1XKS A;  2I0R A;  3JPX A;  1NR0 A;  2IUV A;  1N6F A;  2AH0 A;  3SBR A;  2Z2P A;  4BCD A;  4NAA A;  2IAA A;  5H14 A;  4PBY A;  5C92 A;  4GGA A;  2VDP A;  4RE5 A;  2VDK A;  2P9U C;  3ZDY A;  3EG6 A;  3SWS D;  2UZY B;  4J73 A;  4NBM A;  1R5M A;  2H9P A;  3DXM C;  1OMW B;  4JSN C;  4BP8 A;  5EMM B;  4CZX A;  1SQJ A;  3MMY A;  3CIK B;  4G55 A;  5GSA A;  1QFS A;  4L9O A;  2EIB A;  4KFM B;  3MXX A;  5HE1 B;  3MKQ A;  4A08 A;  3O4I A;  4G56 B;  1MDA H;  3NVQ A;  4A7J A;  3IUQ A;  5CXB A;  3ULE C;  4CC9 A;  1L0Q A;  3UVM A;  4FB1 D;  5IGQ A;  2QR5 A;  5HYN B;  5CXB B;  3HFQ A;  4BCB A;  5HE0 B;  2GC4 A;  3GC3 B;  1E5T A;  1PI6 A;  2VDN A;  2OVP B;  2VDO A;  5FA5 B;  3BWS A;  4GGD A;  3SXT D;  3E0C A;  4O45 A;  1PEV A;  1QNI A;  3GFC A;  1C9L A;  3IIW A;  3IVM A;  3EI4 A;  1B9Y A;  2B5M A;  4O1Q D;  4PBZ A;  4R7A B;  4FAN D;  3CFS B;  2AGW A;  3AL8 A;  3EI4 B;  3PXS D;  2XDW A;  2H13 A;  3VA6 A;  3OW8 A;  3J80 g;  3JRP A;  4CY3 A;  4CZY A;  2VZ1 A;  3MUN A;  2HU7 A;  4NEN A;  1M1X A;  4GMB A;  5EAM A;  1PBY B;  3EQ7 A;  2YNP A;  2O9K A;  3AH8 B;  3JZH A;  1SHY B;  2B4E A;  2OJY A;  4JHP C;  3PE7 A;  1GOF A;  2B5N A;  3NID A;  3FCS A;  2I3S A;  4NSX A;  4O3U B;  2HU5 A;  3NVX A;  4AX4 A;  3UKR C;  5CYK A;  4ERY A;  5GXI A;  5CYK B;  3F3P A;  4L1Q D;  4X3E A;  3SBQ A;  3EI2 A;  4FA1 D;  3RFG A;  3FGB A;  3EI2 B;  2EIC A;  2EBS A;  3SFZ A;  4RE6 A;  4N14 A;  3MVD K;  4X63 B;  2VZ3 A;  4MK0 B;  1FWX A;  1U4C A;  1H2Z A;  4JSX C;  4HDJ A;  3MZL A;  4OZU A;  5EAP A;  4AOW A;  3I8E A;  1I2M B;  3ZDX A;  4IRZ A;  4AMZ A;  5EAL A;  2OK6 A;  2AGY A;  3O4J A;  1VZ3 A;  1GXR A;  3VI4 A;  4L3H D;  2I3T A;  3AFC A;  5HE3 B;  3I7K A;  3NVN A;  1VYH C;  5EMK B;  1E8M A;  1K3I A;  4CY1 A;  2B5L A;  3JZN A;  2CN3 A;  3NIG A;  5C86 A;  2J57 G;  4A0A A;  2YBA A;  4J87 A;  3F3G A;  3C75 H;  4ESG A;  3PXT D;  4A0A B;  3PSC B;  4QT8 A;  2OVR B;  4FA4 D;  3DDU A;  3QHY B;  3ORV D;  3IIY A;  1JOF A;  2H14 A;  3IUM A;  4XYH A;  2XZG A;  1O6G A;  2HJ4 A;  5M5U A;  4A11 A;  3EI1 B;  4JT6 C;  4DNW A;  4A11 B;  3FCU A;  3L4O D;  4IMM A;  5GMK n;  4A2L A;  2VDQ A;  3KRX B;  4JD2 C;  4DNU A;  2QXV A;  4JSP C;  3QI0 A;  2AGZ A;  1YR2 A;  3SLE D;  2H47 A;  4GQ1 A;  3UR4 A;  3IJ0 A;  3OKY A;  4ZOV A;  4Z8L A;  3W15 A;  2I0S A;  2Q7Q A;  3OKY B;  3SBP A;  4J86 A;  2AGL A;  3V5W B;  1JV2 A;  2XL3 A;  4J77 A;  3EWE A;  1UOO A;  4QAM A;  4E54 A;  4FA5 D;  3IJE A;  3DWL C;  4E54 B;  4QL1 A;  3ZE0 A;  1VE6 A;  5FFO A;  3F3F A;  2IUP A;  3FM0 A;  3EU7 A;  5M5T A;  4JT5 C;  5JWZ A;  4J82 A;  4BH6 A;  1XHM A;  1T2X A;  5FQD A;  3K26 A;  3PSL A;  4ZOZ A;  5E6U A;  1C9I A;  2P9K C;  4JXM A;  3SJL D;  3OKT A;  2HES X;  4PXW A;  3VGZ A;  4PSX B;  5HE2 B;  3RMZ D;  3I7P A;  4G1E A;  3MKS B;  3N0E A;  2BCJ B;  4GM3 A;  5TEE A;  5IJ7 E;  4TZ4 A;  4D0K A;  3NIF A;  2YNN A;  2P9I C;  4FWW A;  5E6S A;  4DNV A;  4XYI A;  3EI3 A;  3JAM g;  1H2W A;  4LG9 A;  3EI3 B;  4FHL A;  3DXK C;  3SN6 B;  5M5R A;  4O2W A;  3IUR A;  1OLZ A;  1GOT B;  3SHF A;  2H9L A;  5FXY A;  2CE9 A;  3VH0 A;  4ZN4 A;  5C2V B;  3V9F A;  3FRX A;  1GOH A;  1H2Y A;  3K71 A;  1K32 A;  4J0X A;  1YFQ A;  1B9X A;  1QFM A;  3V4P A;  5FKQ A;  4ERZ A;  4H5J A;  4E5Z B;  4BL0 A;  2XYI A;  3L4M D;  5H1M A;  2PM6 B;  3PVU B;  4BCC A;  4A09 B;  4QRJ A;  3UKU C;  1BPO A;  1Q47 A;  2P9S C;  4CI2 A;  4Y7R A;  5E6R A;  2OVQ B;  2IUR A;  3IKO A;  5H17 A;  3OL2 A;  1N6D A;  4CI3 A;  3I8C A;  3OL2 B;  4IA9 A;  3I7L A;  2CN2 A;  4CY2 A;  4ERQ A;  5EAR A;  5FKR A;  1TYQ C;  3EQ9 A;  3RRM C;  1RI6 A;  3PXW D;  2PM9 A;  2J56 H;  1O6F A;  4GGC A;  2VC2 A;  4EWR A;  2PM9 B;  4GQ2 P;  4CY5 A;  4ZOX A;  2P9N C;  3JB9 L;  1ERJ A;  2XE4 A;  2AH1 A;  4A0B A;  3I7N A;  3K27 A;  3V7D B;  3KCI A;  1P22 A;  4A0B B;  3MUO A;  3OF7 A;  4O02 A;  4MMY A;  3J81 g;  1NEX B;  2GC7 A;  5I5I A;  3KRW B;  5EM2 A;  3BG0 A;  1XIP A;  5TEF A;  5EM2 B;  3OKW A;  4MMZ A;  2QZP A;  2XU7 A;  4J78 A;  4XEI C;  3EI1 A;  3EQ8 A;  2HJB A;  3UVN A;  2H6N A;  5TDH B;  3ODT A;  2W18 A;  1VE7 A;  1L5G A;  4WK0 A;  1S4U X;  1A12 A;  3IUL A;  2G9A A;  5C9Z B;  4K3I D;  3ZWL B;  4WJK A;  4PC0 A;  4UI9 R;  3K6S A;  4AMY A;  2P9L C;  3T3P A;  5CXC A;  5EMJ B;  3DSM A;  2G99 A;  5CXC B;  3UVL A;  1E8N A;  2P9P C;  4L3G D;  3IJC A;  2VDR A;  4FAV D;  2CO0 A;  1JMX B;  5GXH A;  3EMH A;  4BUJ C;  3MZK A;  3IJ1 A;  5IGO A;  4Z7Q A;  5FKT A;  4WK2 A;  4ES0 A;  5EML B;  5M61 A;  2YNO A;  3V4V A;  2HXC A;  1U8C A;  4H5I A;  3RN1 D;  4GZ8 A;  4O3T B;  1GOG A;  4ZOY A;  2AGX A;  2QC5 A;  3OTT A;  4JHN A;  3UVO A;  2UZX B;  5M5V A;  3U4Y A;  1SQ9 A;  3IUN A;  3JRO A;  3O4G A;  3GRE A;  2H68 A;  4Z7N A;  3I7H A;  3A0F A;  2CE8 A;  3N0D A;  4Z7O A;  4O9D A;  5HDB A;  4A08 B;  4QQE A;  4J79 A;  4J81 A;  3BG1 A;  3IUJ A;  4J8B A;  4BP9 A;  4D9S A;  2HKR A;  2IWF A;  2H6Q A;  5FLX g;  2H3X A;  4GQB B;  4CI8 A;  5IC7 A;  3RFH A;  3C9C A;  4Y5R D;  5IT9 g;  2OIZ A;  3K72 A;  5SXM A;  4UM9 A;  5HQG A;  5TF2 A;  1JTD B;  5KDO B;  3SMR A;  2VDL A;  2IWK A;  2TRC B;  4X61 B;  2WQ8 A;  5A2Q g;  4GM9 A;  1H2X A;  3C99 A;  5FFG A;  5M5S A;  3PVW B;  3UVK A;  1JJU B;  5C2W B;  4J8G A;  1UTC A;  3AL8 B;  1U2V C;  2HKM A;  4YVD A;  4LGN A;  2Z2N A;  4L1M A;  4CZV A;  3VI3 A;  4CI1 A;  1UOQ A;  3P4F A;  4AN1 A;  5IJ8 E;  3B7F A;  5FKS A;  2HU8 A;  4G1M A; 
#chains in the Genus database with same CATH homology
 4J0W A;  3SCY A;  5I5J A;  1GG2 B;  3RSE C;  4E5Z A;  2HYE A;  3I7O A;  4GM8 A;  3RN0 D;  4A09 A;  2Z2O A;  1TBG A;  3CFV A;  2CNX A;  4I79 A;  2H6K A;  2XL2 A;  3I89 A;  4JSV C;  4A2M A;  1GP2 B;  1A0R B;  2H9N A;  2J55 H;  2MTA H;  4J84 A;  2YB8 B;  3C5M A;  2GNQ A;  3AL9 A;  2CO0 C;  2BBK H;  2PBI B;  4X60 B;  1PGU A;  4OWR A;  4U7A A;  4LG8 A;  2OK4 A;  2IUQ A;  1N6E A;  4U1E I;  5K19 A;  4FA9 D;  4D6V A;  3RLM D;  1K8K C;  3JZG A;  2H9M A;  5AJA A;  1MG3 A;  5B4W A;  2AQ5 A;  3I2N A;  2PM7 B;  2I0T A;  5I5M A;  5THA A;  4K3J B;  2YMU A;  3DM0 A;  4AEZ A;  5AFU 3;  1MG2 A;  4PSW B;  1JMZ B;  5K1C C;  4PNK B;  3SVW D;  5AMS A;  1XKS A;  2I0R A;  3JPX A;  1NR0 A;  2IUV A;  1N6F A;  2AH0 A;  3SBR A;  2Z2P A;  2IAA A;  5H14 A;  4PBY A;  4GGA A;  2P9U C;  3EG6 A;  3SWS D;  2UZY B;  4J73 A;  1R5M A;  2H9P A;  3DXM C;  1OMW B;  4JSN C;  5EMM B;  4CZX A;  1SQJ A;  3MMY A;  3CIK B;  5GSA A;  4L9O A;  4KFM B;  3MXX A;  5HE1 B;  3MKQ A;  4A08 A;  4G56 B;  1MDA H;  3NVQ A;  4A7J A;  3ULE C;  5CXB A;  4CC9 A;  4FB1 D;  1L0Q A;  3UVM A;  5IGQ A;  5HYN B;  5CXB B;  3HFQ A;  5HE0 B;  2GC4 A;  1PI6 A;  2OVP B;  5FA5 B;  3BWS A;  4GGD A;  3SXT D;  3E0C A;  4O45 A;  1PEV A;  1QNI A;  3GFC A;  3IIW A;  3EI4 A;  1B9Y A;  2B5M A;  4O1Q D;  4PBZ A;  4R7A B;  4FAN D;  3CFS B;  2AGW A;  3AL8 A;  3EI4 B;  3PXS D;  2H13 A;  3VA6 A;  3OW8 A;  3J80 g;  3JRP A;  4CY3 A;  4CZY A;  4GMB A;  5EAM A;  1PBY B;  2YNP A;  2O9K A;  3AH8 B;  3JZH A;  1SHY B;  2B4E A;  2OJY A;  3PE7 A;  2B5N A;  2I3S A;  4NSX A;  4O3U B;  3NVX A;  3UKR C;  5CYK A;  4ERY A;  5GXI A;  5CYK B;  3F3P A;  4L1Q D;  4X3E A;  3SBQ A;  3EI2 A;  4FA1 D;  3RFG A;  3FGB A;  3EI2 B;  2EBS A;  3SFZ A;  4N14 A;  4X63 B;  4MK0 B;  1FWX A;  1U4C A;  4JSX C;  4HDJ A;  3MZL A;  4OZU A;  5EAP A;  4AOW A;  3I8E A;  5EAL A;  2OK6 A;  2AGY A;  1GXR A;  4L3H D;  2I3T A;  3AFC A;  5HE3 B;  3I7K A;  3NVN A;  1VYH C;  5EMK B;  4CY1 A;  2B5L A;  3JZN A;  2CN3 A;  2J57 G;  4A0A A;  2YBA A;  4J87 A;  3F3G A;  3C75 H;  4ESG A;  3PXT D;  4A0A B;  3PSC B;  4QT8 A;  2OVR B;  4FA4 D;  3ORV D;  3IIY A;  1JOF A;  2H14 A;  4XYH A;  2HJ4 A;  4A11 A;  3EI1 B;  4JT6 C;  4A11 B;  3L4O D;  4IMM A;  5GMK n;  4A2L A;  3KRX B;  4JD2 C;  2QXV A;  4JSP C;  2AGZ A;  3SLE D;  2H47 A;  4GQ1 A;  3UR4 A;  3IJ0 A;  3OKY A;  4ZOV A;  4Z8L A;  3W15 A;  2I0S A;  2Q7Q A;  3OKY B;  3SBP A;  4J86 A;  2AGL A;  3V5W B;  2XL3 A;  4J77 A;  3EWE A;  4E54 A;  4FA5 D;  3DWL C;  4E54 B;  4QL1 A;  3F3F A;  2IUP A;  3FM0 A;  3EU7 A;  4JT5 C;  5JWZ A;  4J82 A;  4BH6 A;  1XHM A;  5FQD A;  3K26 A;  3PSL A;  4ZOZ A;  2P9K C;  4JXM A;  3SJL D;  3OKT A;  2HES X;  4PXW A;  3VGZ A;  4PSX B;  5HE2 B;  3RMZ D;  3I7P A;  3MKS B;  3N0E A;  2BCJ B;  4GM3 A;  5TEE A;  5IJ7 E;  4TZ4 A;  4D0K A;  2YNN A;  2P9I C;  4FWW A;  4XYI A;  3EI3 A;  3JAM g;  4LG9 A;  3EI3 B;  4FHL A;  3DXK C;  3SN6 B;  1OLZ A;  1GOT B;  3SHF A;  2H9L A;  5FXY A;  2CE9 A;  3VH0 A;  4ZN4 A;  5C2V B;  3V9F A;  3FRX A;  1K32 A;  4J0X A;  1YFQ A;  1B9X A;  4ERZ A;  5FKQ A;  4H5J A;  4E5Z B;  4BL0 A;  2XYI A;  3L4M D;  5H1M A;  2PM6 B;  3PVU B;  4A09 B;  4QRJ A;  3UKU C;  1Q47 A;  2P9S C;  4CI2 A;  4Y7R A;  2OVQ B;  2IUR A;  3IKO A;  5H17 A;  3OL2 A;  1N6D A;  4CI3 A;  3I8C A;  3OL2 B;  4IA9 A;  3I7L A;  2CN2 A;  4CY2 A;  4ERQ A;  5EAR A;  5FKR A;  1TYQ C;  3RRM C;  1RI6 A;  3PXW D;  2PM9 A;  2J56 H;  4GGC A;  4EWR A;  4GQ2 P;  2PM9 B;  4CY5 A;  4ZOX A;  2P9N C;  3JB9 L;  1ERJ A;  2AH1 A;  4A0B A;  3I7N A;  3K27 A;  3V7D B;  1P22 A;  4A0B B;  3J81 g;  1NEX B;  2GC7 A;  5I5I A;  3KRW B;  5EM2 A;  3BG0 A;  1XIP A;  5TEF A;  5EM2 B;  3OKW A;  2XU7 A;  4J78 A;  4XEI C;  3EI1 A;  2HJB A;  3UVN A;  2H6N A;  5TDH B;  3ODT A;  2W18 A;  1S4U X;  2G9A A;  5C9Z B;  4K3I D;  3ZWL B;  4PC0 A;  4UI9 R;  2P9L C;  5CXC A;  5EMJ B;  3DSM A;  2G99 A;  5CXC B;  3UVL A;  2P9P C;  4L3G D;  3IJC A;  5GXH A;  4FAV D;  2CO0 A;  1JMX B;  3EMH A;  4BUJ C;  3MZK A;  3IJ1 A;  5IGO A;  5FKT A;  4ES0 A;  5EML B;  2YNO A;  2HXC A;  4H5I A;  3RN1 D;  4GZ8 A;  4O3T B;  4ZOY A;  2AGX A;  2QC5 A;  3OTT A;  3UVO A;  2UZX B;  3U4Y A;  1SQ9 A;  3JRO A;  3GRE A;  2H68 A;  3I7H A;  3A0F A;  2CE8 A;  3N0D A;  4O9D A;  4A08 B;  4QQE A;  4J79 A;  4J81 A;  3BG1 A;  4J8B A;  2HKR A;  2IWF A;  2H6Q A;  5FLX g;  2H3X A;  4GQB B;  4CI8 A;  5IC7 A;  3RFH A;  3C9C A;  4Y5R D;  5IT9 g;  2OIZ A;  5SXM A;  5HQG A;  5TF2 A;  5KDO B;  3SMR A;  2IWK A;  2TRC B;  4X61 B;  5A2Q g;  4GM9 A;  3C99 A;  3PVW B;  3UVK A;  1JJU B;  5C2W B;  4J8G A;  3AL8 B;  1U2V C;  2HKM A;  4YVD A;  4LGN A;  2Z2N A;  4CZV A;  4CI1 A;  3P4F A;  5IJ8 E;  3B7F A;  5FKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...