4AEZA

Crystal structure of mitotic checkpoint complex
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
343
structure length
326
Chain Sequence
LNTRVLAFKLDAPEAKKPVDRRFNTTPERVLDAPGIIDDYYLNLLDWSNLNVVAVALERNVYVWNADSGSVSALAETDESTYVASVKWSHDGSFLSVGLGNGLVDIYDVESQTKLRTMAGHQARVGCLSWNRHVLSSGSRSGAIHHHDVRIANHQIGTLQGHSSEVCGLAWRSDGLQLASGGNDNVVQIWDARSSIPKFTKTNHNAAVKAVAWCPWQSNLLATGGGTMDKQIHFWNAATGARVNTVDAGSQVTSLIWSPHSKEIMSTHGFPDNNLSIWSYSSSGLTKQVDIPAHDTRVLYSALSPDGRILSTAASDENLKFWRVYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD REPEAT-CONTAINING PROTEIN SLP1
publication title Structure of the Mitotic Checkpoint Complex
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Cell cycle
total genus 83
structure length 326
sequence length 343
chains with identical sequence D, G
ec nomenclature
pdb deposition date 2012-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4aezA00
2AGWA 3EMHA 5EMLB 5CYKB 5C2WB 2CN2A 2YNNA 2OVRB 5EM2A 3W15A 4OWRA 5FXYA 2CO0C 1Q47A 2EBSA 3I7KA 4R7AB 2CNXA 3L4OD 1NEXB 5EARA 3BG0A 3SJLD 5AFU3 4PC0A 3OKWA 2UZXB 3DXKC 5K1CC 3EI1A 1JMXB 3CFVA 4PBYA 2HKRA 3VGZA 2UZYB 4ES0A 4X61B 4N14A 4ZOVA 1QNIA 2XU7A 5HE3B 3I7LA 3UKUC 4ERZA 2PM9A 1PI6A 4GQ2P 3UVNA 4JXMA 3B7FA 5C9ZB 3E0CA 2YBAA 3FRXA 5I5JA 4LG8A 3IIWA 4Y5RD 2H6QA 4J8BA 2P9PC 4E54B 4CZVA 5CYKA 3EG6A 3EI2A 4JD2C 3IJ1A 3V7DB 2OK4A 3I2NA 4GMBA 1OMWB 5IJ7E 3JZGA 4JSPC 1B9XA 2OK6A 3NVQA 2Z2NA 2Z2PA 3ORVD 3VH0A 5HE2B 4CI1A 2HJBA 4XYHA 2XYIA 2J56H 3C5MA 4YVDA 1K8KC 3GREA 2G9AA 3KRXB 3SCYA 1XIPA 1JMZB 3EU7A 5TEEA 4CZYA 3SVWD 3I7OA 2AQ5A 2AH0A 5I5IA 2GC7A 3PE7A 4E54A 3JAMg 3DXMC 5EMMB 4BH6A 2CN3A 2W18A 5A2Qg 1SQJA 2CE8A 3MKQA 3U4YA 2CO0A 3I89A 4QL1A 5GSAA 3UVMA 5THAA 3OTTA 4A11B 4GM3A 1XHMA 5TDHB 3SXTD 4U1EI 4LG9A 1JJUB 4CI2A 4CY2A 2YMUA 4OZUA 2I0SA 2HKMA 2H9PA 4X63B 3K27A 5CXBB 5GXHA 3C99A 1JOFA 2TRCB 3I7PA 3AH8B 4IMMA 3CIKB 4BUJC 4J87A 3OL2B 3V5WB 5CXCA 3F3PA 2IURA 2O9KA 4TZ4A 4ZOXA 4X3EA 2H9LA 2HJ4A 3L4MD 4IA9A 3EI3A 3C9CA 3IJ0A 3OKYA 5FKTA 4FB1D 3BG1A 2P9LC 1MG3A 4ERQA 2XL2A 2Q7QA 4GGCA 3K26A 2PM6B 3SHFA 4J73A 4JSVC 3SBPA 1VYHC 4GGAA 3FGBA 2H14A 2P9IC 4O9DA 4J8GA 4X60B 3SBRA 4EWRA 5FKRA 4GQBB 4A11A 4FA1D 1U2VC 2OJYA 4J79A 4A0AB 4MK0B 2P9UC 2YNOA 5KDOB 3F3FA 4PSXB 1MDAH 2H3XA 3RLMD 3RFHA 1GOTB 3BWSA 2IWFA 2Z2OA 3CFSB 3UR4A 5EMKB 4FA4D 4FWWA 4K3JB 2XL3A 1SQ9A 3SBQA 1B9YA 3JZHA 4E5ZB 2QC5A 5FA5B 1NR0A 3UVOA 3JROA 2YB8B 4PBZA 3JB9L 4PNKB 2B5NA 3AL9A 3RN1D 1S4UX 4HDJA 4GZ8A 3DWLC 2I0RA 2IUQA 4PXWA 5C2VB 3DSMA 4CI3A 4L3GD 3RMZD 4CY1A 1K32A 5EAMA 5IGQA 3OKTA 1U4CA 3RFGA 5IT9g 1TYQC 2P9SC 3SLED 3JZNA 3UKRC 3HFQA 5IGOA 4J0WA 4AEZA 4J78A 2HESX 3IKOA 5TEFA 1FWXA 5AMSA 3UVKA 4D0KA 4A0AA 2H13A 3JRPA 4JT6C 4FA5D 4J82A 3PXSD 1YFQA 3EI4B 1SHYB 2I3SA 4A2LA 4FAND 1OLZA 4CC9A 1GG2B 1PEVA 5IC7A 5EMJB 3N0EA 4J77A 5H1MA 5H17A 5EALA 3AL8B 4A08B 4H5JA 4L9OA 5GMKn 3EI1B 3N0DA 1GP2B 3I7NA 4ZOZA 3ODTA 1RI6A 2I0TA 4O3TB 4CI8A 4QRJA 2QXVA 2OVPB 3MZKA 2AGZA 3SWSD 3PSCB 2AGXA 1GXRA 4O45A 4FHLA 2I3TA 2PM9B 3VA6A 4J0XA 4G56B 5HE0B 1P22A 5AJAA 3I8CA 1N6EA 5B4WA 4A7JA 4UI9R 4L3HD 3EI4A 2BBKH 3A0FA 1PBYB 4J84A 4QQEA 3NVXA 4CY5A 1MG2A 5K19A 2OIZA 1N6DA 3EI2B 4J86A 2PM7B 4U7AA 3PXWD 4QT8A 3PXTD 3P4FA 2HYEA 3AL8A 3PSLA 5FQDA 3I7HA 4A08A 5H14A 2YNPA 2GC4A 3J81g 4LGNA 5HYNB 3MMYA 5JWZA 4CZXA 3C75H 5HE1B 4Z8LA 4O3UB 4XYIA 2OVQB 1N6FA 1R5MA 4ZN4A 4JSXC 5CXBA 4KFMB 4A09B 3OL2A 3MKSB 5HQGA 5GXIA 3EWEA 3F3GA 2P9NC 2AGYA 2B5MA 3IJCA 3MXXA 4BL0A 2IUPA 3PVWB 2IWKA 2HXCA 4A0BB 4GM9A 2PBIB 4I79A 1ERJA 4D6VA 2AGLA 4GQ1A 4AOWA 3SMRA 1PGUA 4XEIC 4GM8A 3PVUB 3RN0D 1XKSA 4FA9D 5EAPA 2CE9A 3SFZA 2AH1A 1L0QA 3ZWLB 4CY3A 5FKQA 5TF2A 3SN6B 2H6NA 3AFCA 3UVLA 3GFCA 2H68A 5FKSA 2IAAA 2GNQA 3ULEC 2H47A 3IIYA 2B5LA 4JSNC 3J80g 4Y7RA 4E5ZA 3NVNA 2IUVA 1A0RB 5FLXg 5EM2B 4A09A 3JPXA 5CXCB 3V9FA 3EI3B 3OKYB 4A0BA 2G99A 2H6KA 4H5IA 4ERYA 4PSWB 3RRMC 3FM0A 4JT5C 2MTAH 2BCJB 5I5MA 4A2MA 4O1QD 4L1QD 2B4EA 3I8EA 2J57G 4ZOYA 3DM0A 4K3ID 2P9KC 3MZLA 4ESGA 4GGDA 5SXMA 2H9MA 3OW8A 4NSXA 3RSEC 2J55H 4FAVD 5IJ8E 1TBGA 3KRWB 4J81A 2H9NA
chains in the Genus database with same CATH superfamily
2AGWA 3EMHA 5FFGA 5EMLB 5CYKB 3EQ9A 5C2WB 2CN2A 2YNNA 3T3MA 2OVRB 3O4IA 5EM2A 3W15A 4OWRA 5FXYA 2CO0C 1Q47A 1VE7A 2EBSA 1E5TA 3GC3B 3I7KA 4R7AB 2CNXA 3L4OD 1NEXB 5EARA 3BG0A 3SJLD 4D9SA 5AFU3 4PC0A 3OKWA 2UZXB 3DXKC 5K1CC 3EI1A 1JMXB 2VZ1A 3CFVA 4PBYA 2HKRA 3VGZA 4WK2A 2UZYB 4ES0A 4X61B 4N14A 4ZOVA 1QNIA 2XU7A 5HE3B 3I7LA 3UKUC 4ERZA 2PM9A 1PI6A 4GQ2P 2VDRA 4JHNA 3UVNA 4JXMA 3B7FA 5C9ZB 3T3PA 3E0CA 2YBAA 4BCBA 1QFSA 3FCSA 3FRXA 5I5JA 4LG8A 3IIWA 4AMZA 1E8NA 1VZ3A 4Y5RD 2H6QA 4J8BA 5M5SA 2P9PC 4E54B 4CZVA 3K6SA 5CYKA 5M5TA 1O6FA 3EG6A 3EI2A 4JD2C 3IJ1A 3V7DB 2OK4A 3I2NA 4GMBA 1OMWB 2VDNA 3IURA 5IJ7E 3JZGA 4JSPC 1B9XA 2OK6A 3NVQA 3O4HA 2Z2NA 1M1XA 2Z2PA 3KCIA 3ORVD 1JTDB 3IJEA 3VH0A 5HE2B 4CI1A 2HJBA 4L1MA 4XYHA 3FCUA 2XYIA 2J56H 3C5MA 4QAMA 4YVDA 1K8KC 4AN0A 2VDQA 3GREA 2G9AA 3KRXB 3SCYA 1L5GA 1XIPA 1JMZB 3EU7A 5TEEA 3MUNA 4CZYA 3SVWD 3I7OA 3O4JA 2AQ5A 2AH0A 5I5IA 2QZPA 2GC7A 3PE7A 2EIBA 4E54A 3JAMg 4O2WA 3DXMC 5EMMB 4BH6A 2CN3A 2W18A 4MMZA 5A2Qg 4UM8A 1SQJA 2CE8A 3MKQA 4Z7NA 3U4YA 2CO0A 3I89A 4QL1A 5GSAA 3UVMA 5THAA 1A12A 2VZ3A 3OTTA 1T2XA 4A11B 3IUNA 4GM3A 1XHMA 5TDHB 3SXTD 4U1EI 4LG9A 1JJUB 4CI2A 4CY2A 1H2YA 2YMUA 4WJKA 1QFMA 4OZUA 2I0SA 2HKMA 2H9PA 4X63B 3IVMA 3K27A 5CXBB 5GXHA 3V4PA 3C99A 3DDUA 1JOFA 2TRCB 3I7PA 3AH8B 4IMMA 3CIKB 4BUJC 4J87A 3OL2B 3V5WB 5E6UA 5CXCA 3F3PA 3QHYB 1GOHA 1VE6A 2IURA 2O9KA 4TZ4A 4ZOXA 4X3EA 2H9LA 2HJ4A 3L4MD 4IA9A 4Z7QA 3EI3A 3C9CA 3IJ0A 3OKYA 5FKTA 4FB1D 3BG1A 2P9LC 1MG3A 4ERQA 1TYEA 2XL2A 2Q7QA 4GGCA 4BCCA 1C9IA 3K26A 3ZE2A 2PM6B 3SHFA 4J73A 4JSVC 3SBPA 1VYHC 4GGAA 3FGBA 3VI4A 2H14A 2P9IC 4O9DA 3EQ7A 2VDKA 4J8GA 4X60B 2WQ8A 2VDOA 3SBRA 4EWRA 5FKRA 3ZDXA 4GQBB 4A11A 4FA1D 1U2VC 2OJYA 2VC2A 4J79A 5C92A 4A0AB 4MK0B 4MMXA 2P9UC 2YNOA 5KDOB 1BPOA 3F3FA 4PSXB 1MDAH 2H3XA 3RLMD 3QI0A 3RFHA 1GOTB 3BWSA 3EQ8A 2IWFA 2Z2OA 3NIDA 3CFSB 3UR4A 5EMKB 4FA4D 4FWWA 4K3JB 4AN1A 2EICA 2XL3A 1SQ9A 4NBMA 3SBQA 1B9YA 3JZHA 4E5ZB 2QC5A 5FA5B 1NR0A 4WK4A 3UVOA 3JROA 2YB8B 4PBZA 3JB9L 4PNKB 2XZGA 2B5NA 3AL9A 4G1MA 3V4VA 5M5VA 3RN1D 1S4UX 4HDJA 4G1EA 3DWLC 4GZ8A 2I0RA 2IUQA 4PXWA 3VI3A 3GD1I 1GOGA 5C2VB 3DSMA 3NIGA 4CI3A 1YR2A 4L3GD 3RMZD 4CY1A 2EIEA 1K32A 5EAMA 5IGQA 3OKTA 1U4CA 3RFGA 5IT9g 1TYQC 2P9SC 2XDWA 3MVDK 3SLED 3JZNA 3UKRC 3HFQA 5IGOA 3MUOA 4J0WA 4AEZA 4J78A 4DNWA 2HESX 3IKOA 5TEFA 1FWXA 5AMSA 3UVKA 4D0KA 4A0AA 2H13A 3JRPA 4IRZA 4JT6C 4FA5D 4J82A 3PXSD 1YFQA 1K3IA 3EI4B 1SHYB 2I3SA 4A2LA 4FAND 4AX4A 1OLZA 4CC9A 3IUJA 1GG2B 1PEVA 5IC7A 5EMJB 3N0EA 2VDMA 4J77A 5H1MA 5H17A 5EALA 1UTCA 3AL8B 4A08B 4H5JA 4L9OA 5GMKn 3EI1B 4AMYA 3N0DA 1GP2B 3I7NA 4ZOZA 3ODTA 1RI6A 2I0TA 4O3TB 3K71A 4CI8A 4QRJA 2QXVA 2OVPB 3MZKA 2AGZA 3SWSD 3PSCB 2AGXA 1GXRA 4O45A 4FHLA 2I3TA 2PM9B 3VA6A 4RE5A 4J0XA 4UM9A 4Z7OA 4G56B 5HE0B 1P22A 4MMYA 3ZDYA 5C86A 5AJAA 3I8CA 1N6EA 5B4WA 4A7JA 4UI9R 4L3HD 1H2XA 5M61A 3EI4A 2BBKH 2XE4A 3A0FA 1PBYB 4J84A 4QQEA 3NVXA 4CY5A 3ZE1A 3NIFA 1MG2A 5K19A 2OIZA 1N6DA 3EI2B 4J86A 2PM7B 4U7AA 3PXWD 4QT8A 4BP9A 4BP8A 3PXTD 3P4FA 2HYEA 3AL8A 3PSLA 5FQDA 1GOFA 3I7HA 4A08A 4NENA 5H14A 2YNPA 2GC4A 5M5UA 3J81g 4LGNA 1H2ZA 5HYNB 3MMYA 5JWZA 4CZXA 3C75H 2QR5A 5HE1B 4Z8LA 4O3UB 4XYIA 2OVQB 1N6FA 1R5MA 2BKLA 4ZN4A 4JSXC 5CXBA 4KFMB 4A09B 3OL2A 3MKSB 5HQGA 2EIDA 5GXIA 3EWEA 3F3GA 1O6GA 2P9NC 2AGYA 2B5MA 4JHPC 3IJCA 3MXXA 4BL0A 2IUPA 3PVWB 2IWKA 4DNUA 2HXCA 4A0BB 2VDPA 4GM9A 2PBIB 1C9LA 4I79A 1JV2A 1ERJA 4D6VA 2AGLA 4GQ1A 4AOWA 3IUMA 3SMRA 3ZE0A 1PGUA 3IUQA 4XEIC 4GM8A 3PVUB 3RN0D 1XKSA 4FA9D 5EAPA 2CE9A 3SFZA 2AH1A 2JKXA 2HU5A 1L0QA 4G55A 3ZWLB 4CY3A 5FKQA 5TF2A 3SN6B 4WK0A 2H6NA 3AFCA 3UVLA 3GFCA 1UOOA 1H2WA 2H68A 5FKSA 3IULA 3K72A 2IAAA 2GNQA 3ULEC 5FFOA 2H47A 5M5RA 3IIYA 2B5LA 4JSNC 3J80g 4Y7RA 4E5ZA 3NVNA 2IUVA 1A0RB 5FLXg 1E8MA 5EM2B 4A09A 2HU8A 5E6RA 3JPXA 5CXCB 3V9FA 4NC4A 4BCDA 4DNVA 3EI3B 3OKYB 1UOPA 4A0BA 1I2MB 1VZ2A 2G99A 2H6KA 4H5IA 4ERYA 4PSWB 3RRMC 3FM0A 4NAAA 3ZDZA 4JT5C 2MTAH 2BCJB 5I5MA 4A2MA 4O1QD 4L1QD 2VDLA 3O4GA 2B4EA 3I8EA 2J57G 4ZOYA 3DM0A 4O02A 4K3ID 2P9KC 2HU7A 3MZLA 5HDBA 1U8CA 4ESGA 4GGDA 5SXMA 2H9MA 4RE6A 3OW8A 1UOQA 4NSXA 3RSEC 2J55H 4FAVD 5IJ8E 1TBGA 3KRWB 4J81A 5E6SA 2H9NA 3OF7A
chains in the Genus database with same CATH topology
2AGWA 3EMHA 5EMLB 5CYKB 5C2WB 2CN2A 2YNNA 2OVRB 5EM2A 3W15A 4OWRA 5FXYA 2CO0C 1Q47A 2EBSA 3I7KA 4R7AB 2CNXA 3L4OD 1NEXB 5EARA 3BG0A 3SJLD 5AFU3 4PC0A 3OKWA 2UZXB 3DXKC 5K1CC 3EI1A 1JMXB 3CFVA 4PBYA 2HKRA 3VGZA 2UZYB 4ES0A 4X61B 4N14A 4ZOVA 1QNIA 2XU7A 5HE3B 3I7LA 3UKUC 4ERZA 2PM9A 1PI6A 4GQ2P 3UVNA 4JXMA 3B7FA 5C9ZB 3E0CA 2YBAA 3FRXA 5I5JA 4LG8A 3IIWA 4Y5RD 2H6QA 4J8BA 2P9PC 4E54B 4CZVA 5CYKA 3EG6A 3EI2A 4JD2C 3IJ1A 3V7DB 2OK4A 3I2NA 4GMBA 1OMWB 5IJ7E 3JZGA 4JSPC 1B9XA 2OK6A 3NVQA 2Z2NA 2Z2PA 3ORVD 3VH0A 5HE2B 4CI1A 2HJBA 4XYHA 2XYIA 2J56H 3C5MA 4YVDA 1K8KC 3GREA 2G9AA 3KRXB 3SCYA 1XIPA 1JMZB 3EU7A 5TEEA 4CZYA 3SVWD 3I7OA 2AQ5A 2AH0A 5I5IA 2GC7A 3PE7A 4E54A 3JAMg 3DXMC 5EMMB 4BH6A 2CN3A 2W18A 5A2Qg 1SQJA 2CE8A 3MKQA 3U4YA 2CO0A 3I89A 4QL1A 5GSAA 3UVMA 5THAA 3OTTA 4A11B 4GM3A 1XHMA 5TDHB 3SXTD 4U1EI 4LG9A 1JJUB 4CI2A 4CY2A 2YMUA 4OZUA 2I0SA 2HKMA 2H9PA 4X63B 3K27A 5CXBB 5GXHA 3C99A 1JOFA 2TRCB 3I7PA 3AH8B 4IMMA 3CIKB 4BUJC 4J87A 3OL2B 3V5WB 5CXCA 3F3PA 2IURA 2O9KA 4TZ4A 4ZOXA 4X3EA 2H9LA 2HJ4A 3L4MD 4IA9A 3EI3A 3C9CA 3IJ0A 3OKYA 5FKTA 4FB1D 3BG1A 2P9LC 1MG3A 4ERQA 2XL2A 2Q7QA 4GGCA 3K26A 2PM6B 3SHFA 4J73A 4JSVC 3SBPA 1VYHC 4GGAA 3FGBA 2H14A 2P9IC 4O9DA 4J8GA 4X60B 3SBRA 4EWRA 5FKRA 4GQBB 4A11A 4FA1D 1U2VC 2OJYA 4J79A 4A0AB 4MK0B 2P9UC 2YNOA 5KDOB 3F3FA 4PSXB 1MDAH 2H3XA 3RLMD 3RFHA 1GOTB 3BWSA 2IWFA 2Z2OA 3CFSB 3UR4A 5EMKB 4FA4D 4FWWA 4K3JB 2XL3A 1SQ9A 3SBQA 1B9YA 3JZHA 4E5ZB 2QC5A 5FA5B 1NR0A 3UVOA 3JROA 2YB8B 4PBZA 3JB9L 4PNKB 2B5NA 3AL9A 3RN1D 1S4UX 4HDJA 4GZ8A 3DWLC 2I0RA 2IUQA 4PXWA 5C2VB 3DSMA 4CI3A 4L3GD 3RMZD 4CY1A 1K32A 5EAMA 5IGQA 3OKTA 1U4CA 3RFGA 5IT9g 1TYQC 2P9SC 3SLED 3JZNA 3UKRC 3HFQA 5IGOA 4J0WA 4AEZA 4J78A 2HESX 3IKOA 5TEFA 1FWXA 5AMSA 3UVKA 4D0KA 4A0AA 2H13A 3JRPA 4JT6C 4FA5D 4J82A 3PXSD 1YFQA 3EI4B 1SHYB 2I3SA 4A2LA 4FAND 1OLZA 4CC9A 1GG2B 1PEVA 5IC7A 5EMJB 3N0EA 4J77A 5H1MA 5H17A 5EALA 3AL8B 4A08B 4H5JA 4L9OA 5GMKn 3EI1B 3N0DA 1GP2B 3I7NA 4ZOZA 3ODTA 1RI6A 2I0TA 4O3TB 4CI8A 4QRJA 2QXVA 2OVPB 3MZKA 2AGZA 3SWSD 3PSCB 2AGXA 1GXRA 4O45A 4FHLA 2I3TA 2PM9B 3VA6A 4J0XA 4G56B 5HE0B 1P22A 5AJAA 3I8CA 1N6EA 5B4WA 4A7JA 4UI9R 4L3HD 3EI4A 2BBKH 3A0FA 1PBYB 4J84A 4QQEA 3NVXA 4CY5A 1MG2A 5K19A 2OIZA 1N6DA 3EI2B 4J86A 2PM7B 4U7AA 3PXWD 4QT8A 3PXTD 3P4FA 2HYEA 3AL8A 3PSLA 5FQDA 3I7HA 4A08A 5H14A 2YNPA 2GC4A 3J81g 4LGNA 5HYNB 3MMYA 5JWZA 4CZXA 3C75H 5HE1B 4Z8LA 4O3UB 4XYIA 2OVQB 1N6FA 1R5MA 4ZN4A 4JSXC 5CXBA 4KFMB 4A09B 3OL2A 3MKSB 5HQGA 5GXIA 3EWEA 3F3GA 2P9NC 2AGYA 2B5MA 3IJCA 3MXXA 4BL0A 2IUPA 3PVWB 2IWKA 2HXCA 4A0BB 4GM9A 2PBIB 4I79A 1ERJA 4D6VA 2AGLA 4GQ1A 4AOWA 3SMRA 1PGUA 4XEIC 4GM8A 3PVUB 3RN0D 1XKSA 4FA9D 5EAPA 2CE9A 3SFZA 2AH1A 1L0QA 3ZWLB 4CY3A 5FKQA 5TF2A 3SN6B 2H6NA 3AFCA 3UVLA 3GFCA 2H68A 5FKSA 2IAAA 2GNQA 3ULEC 2H47A 3IIYA 2B5LA 4JSNC 3J80g 4Y7RA 4E5ZA 3NVNA 2IUVA 1A0RB 5FLXg 5EM2B 4A09A 3JPXA 5CXCB 3V9FA 3EI3B 3OKYB 4A0BA 2G99A 2H6KA 4H5IA 4ERYA 4PSWB 3RRMC 3FM0A 4JT5C 2MTAH 2BCJB 5I5MA 4A2MA 4O1QD 4L1QD 2B4EA 3I8EA 2J57G 4ZOYA 3DM0A 4K3ID 2P9KC 3MZLA 4ESGA 4GGDA 5SXMA 2H9MA 3OW8A 4NSXA 3RSEC 2J55H 4FAVD 5IJ8E 1TBGA 3KRWB 4J81A 2H9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AGW A;  3EMH A;  5EML B;  5CYK B;  5C2W B;  2CN2 A;  2YNN A;  2OVR B;  5EM2 A;  3W15 A;  4OWR A;  5FXY A;  2CO0 C;  1Q47 A;  2EBS A;  3I7K A;  4R7A B;  2CNX A;  3L4O D;  1NEX B;  5EAR A;  3BG0 A;  3SJL D;  5AFU 3;  4PC0 A;  3OKW A;  2UZX B;  3DXK C;  5K1C C;  3EI1 A;  1JMX B;  3CFV A;  4PBY A;  2HKR A;  3VGZ A;  2UZY B;  4ES0 A;  4X61 B;  4N14 A;  4ZOV A;  1QNI A;  2XU7 A;  5HE3 B;  3I7L A;  3UKU C;  4ERZ A;  2PM9 A;  1PI6 A;  4GQ2 P;  3UVN A;  4JXM A;  3B7F A;  5C9Z B;  3E0C A;  2YBA A;  3FRX A;  5I5J A;  4LG8 A;  3IIW A;  4Y5R D;  2H6Q A;  4J8B A;  2P9P C;  4E54 B;  4CZV A;  5CYK A;  3EG6 A;  3EI2 A;  4JD2 C;  3IJ1 A;  3V7D B;  2OK4 A;  3I2N A;  4GMB A;  1OMW B;  5IJ7 E;  3JZG A;  4JSP C;  1B9X A;  2OK6 A;  3NVQ A;  2Z2N A;  2Z2P A;  3ORV D;  3VH0 A;  5HE2 B;  4CI1 A;  2HJB A;  4XYH A;  2XYI A;  2J56 H;  3C5M A;  4YVD A;  1K8K C;  3GRE A;  2G9A A;  3KRX B;  3SCY A;  1XIP A;  1JMZ B;  3EU7 A;  5TEE A;  4CZY A;  3SVW D;  3I7O A;  2AQ5 A;  2AH0 A;  5I5I A;  2GC7 A;  3PE7 A;  4E54 A;  3JAM g;  3DXM C;  5EMM B;  4BH6 A;  2CN3 A;  2W18 A;  5A2Q g;  1SQJ A;  2CE8 A;  3MKQ A;  3U4Y A;  2CO0 A;  3I89 A;  4QL1 A;  5GSA A;  3UVM A;  5THA A;  3OTT A;  4A11 B;  4GM3 A;  1XHM A;  5TDH B;  3SXT D;  4U1E I;  4LG9 A;  1JJU B;  4CI2 A;  4CY2 A;  2YMU A;  4OZU A;  2I0S A;  2HKM A;  2H9P A;  4X63 B;  3K27 A;  5CXB B;  5GXH A;  3C99 A;  1JOF A;  2TRC B;  3I7P A;  3AH8 B;  4IMM A;  3CIK B;  4BUJ C;  4J87 A;  3OL2 B;  3V5W B;  5CXC A;  3F3P A;  2IUR A;  2O9K A;  4TZ4 A;  4ZOX A;  4X3E A;  2H9L A;  2HJ4 A;  3L4M D;  4IA9 A;  3EI3 A;  3C9C A;  3IJ0 A;  3OKY A;  5FKT A;  4FB1 D;  3BG1 A;  2P9L C;  1MG3 A;  4ERQ A;  2XL2 A;  2Q7Q A;  4GGC A;  3K26 A;  2PM6 B;  3SHF A;  4J73 A;  4JSV C;  3SBP A;  1VYH C;  4GGA A;  3FGB A;  2H14 A;  2P9I C;  4O9D A;  4J8G A;  4X60 B;  3SBR A;  4EWR A;  5FKR A;  4GQB B;  4A11 A;  4FA1 D;  1U2V C;  2OJY A;  4J79 A;  4A0A B;  4MK0 B;  2P9U C;  2YNO A;  5KDO B;  3F3F A;  4PSX B;  1MDA H;  2H3X A;  3RLM D;  3RFH A;  1GOT B;  3BWS A;  2IWF A;  2Z2O A;  3CFS B;  3UR4 A;  5EMK B;  4FA4 D;  4FWW A;  4K3J B;  2XL3 A;  1SQ9 A;  3SBQ A;  1B9Y A;  3JZH A;  4E5Z B;  2QC5 A;  5FA5 B;  1NR0 A;  3UVO A;  3JRO A;  2YB8 B;  4PBZ A;  3JB9 L;  4PNK B;  2B5N A;  3AL9 A;  3RN1 D;  1S4U X;  4HDJ A;  4GZ8 A;  3DWL C;  2I0R A;  2IUQ A;  4PXW A;  5C2V B;  3DSM A;  4CI3 A;  4L3G D;  3RMZ D;  4CY1 A;  1K32 A;  5EAM A;  5IGQ A;  3OKT A;  1U4C A;  3RFG A;  5IT9 g;  1TYQ C;  2P9S C;  3SLE D;  3JZN A;  3UKR C;  3HFQ A;  5IGO A;  4J0W A;  4AEZ A;  4J78 A;  2HES X;  3IKO A;  5TEF A;  1FWX A;  5AMS A;  3UVK A;  4D0K A;  4A0A A;  2H13 A;  3JRP A;  4JT6 C;  4FA5 D;  4J82 A;  3PXS D;  1YFQ A;  3EI4 B;  1SHY B;  2I3S A;  4A2L A;  4FAN D;  1OLZ A;  4CC9 A;  1GG2 B;  1PEV A;  5IC7 A;  5EMJ B;  3N0E A;  4J77 A;  5H1M A;  5H17 A;  5EAL A;  3AL8 B;  4A08 B;  4H5J A;  4L9O A;  5GMK n;  3EI1 B;  3N0D A;  1GP2 B;  3I7N A;  4ZOZ A;  3ODT A;  1RI6 A;  2I0T A;  4O3T B;  4CI8 A;  4QRJ A;  2QXV A;  2OVP B;  3MZK A;  2AGZ A;  3SWS D;  3PSC B;  2AGX A;  1GXR A;  4O45 A;  4FHL A;  2I3T A;  2PM9 B;  3VA6 A;  4J0X A;  4G56 B;  5HE0 B;  1P22 A;  5AJA A;  3I8C A;  1N6E A;  5B4W A;  4A7J A;  4UI9 R;  4L3H D;  3EI4 A;  2BBK H;  3A0F A;  1PBY B;  4J84 A;  4QQE A;  3NVX A;  4CY5 A;  1MG2 A;  5K19 A;  2OIZ A;  1N6D A;  3EI2 B;  4J86 A;  2PM7 B;  4U7A A;  3PXW D;  4QT8 A;  3PXT D;  3P4F A;  2HYE A;  3AL8 A;  3PSL A;  5FQD A;  3I7H A;  4A08 A;  5H14 A;  2YNP A;  2GC4 A;  3J81 g;  4LGN A;  5HYN B;  3MMY A;  5JWZ A;  4CZX A;  3C75 H;  5HE1 B;  4Z8L A;  4O3U B;  4XYI A;  2OVQ B;  1N6F A;  1R5M A;  4ZN4 A;  4JSX C;  5CXB A;  4KFM B;  4A09 B;  3OL2 A;  3MKS B;  5HQG A;  5GXI A;  3EWE A;  3F3G A;  2P9N C;  2AGY A;  2B5M A;  3IJC A;  3MXX A;  4BL0 A;  2IUP A;  3PVW B;  2IWK A;  2HXC A;  4A0B B;  4GM9 A;  2PBI B;  4I79 A;  1ERJ A;  4D6V A;  2AGL A;  4GQ1 A;  4AOW A;  3SMR A;  1PGU A;  4XEI C;  4GM8 A;  3PVU B;  3RN0 D;  1XKS A;  4FA9 D;  5EAP A;  2CE9 A;  3SFZ A;  2AH1 A;  1L0Q A;  3ZWL B;  4CY3 A;  5FKQ A;  5TF2 A;  3SN6 B;  2H6N A;  3AFC A;  3UVL A;  3GFC A;  2H68 A;  5FKS A;  2IAA A;  2GNQ A;  3ULE C;  2H47 A;  3IIY A;  2B5L A;  4JSN C;  3J80 g;  4Y7R A;  4E5Z A;  3NVN A;  2IUV A;  1A0R B;  5FLX g;  5EM2 B;  4A09 A;  3JPX A;  5CXC B;  3V9F A;  3EI3 B;  3OKY B;  4A0B A;  2G99 A;  2H6K A;  4H5I A;  4ERY A;  4PSW B;  3RRM C;  3FM0 A;  4JT5 C;  2MTA H;  2BCJ B;  5I5M A;  4A2M A;  4O1Q D;  4L1Q D;  2B4E A;  3I8E A;  2J57 G;  4ZOY A;  3DM0 A;  4K3I D;  2P9K C;  3MZL A;  4ESG A;  4GGD A;  5SXM A;  2H9M A;  3OW8 A;  4NSX A;  3RSE C;  2J55 H;  4FAV D;  5IJ8 E;  1TBG A;  3KRW B;  4J81 A;  2H9N A; 
#chains in the Genus database with same CATH topology
 2AGW A;  3EMH A;  5FFG A;  5EML B;  5CYK B;  3EQ9 A;  5C2W B;  2CN2 A;  2YNN A;  3T3M A;  2OVR B;  3O4I A;  5EM2 A;  3W15 A;  4OWR A;  5FXY A;  2CO0 C;  1Q47 A;  1VE7 A;  2EBS A;  1E5T A;  3GC3 B;  3I7K A;  4R7A B;  2CNX A;  3L4O D;  1NEX B;  5EAR A;  3BG0 A;  3SJL D;  4D9S A;  5AFU 3;  4PC0 A;  3OKW A;  2UZX B;  3DXK C;  5K1C C;  3EI1 A;  1JMX B;  2VZ1 A;  3CFV A;  4PBY A;  2HKR A;  3VGZ A;  4WK2 A;  2UZY B;  4ES0 A;  4X61 B;  4N14 A;  4ZOV A;  1QNI A;  2XU7 A;  5HE3 B;  3I7L A;  3UKU C;  4ERZ A;  2PM9 A;  1PI6 A;  4GQ2 P;  2VDR A;  4JHN A;  3UVN A;  4JXM A;  3B7F A;  5C9Z B;  3T3P A;  3E0C A;  2YBA A;  4BCB A;  1QFS A;  3FCS A;  3FRX A;  5I5J A;  4LG8 A;  3IIW A;  4AMZ A;  1E8N A;  1VZ3 A;  4Y5R D;  2H6Q A;  4J8B A;  5M5S A;  2P9P C;  4E54 B;  4CZV A;  3K6S A;  5CYK A;  5M5T A;  1O6F A;  3EG6 A;  3EI2 A;  4JD2 C;  3IJ1 A;  3V7D B;  2OK4 A;  3I2N A;  4GMB A;  1OMW B;  2VDN A;  3IUR A;  5IJ7 E;  3JZG A;  4JSP C;  1B9X A;  2OK6 A;  3NVQ A;  3O4H A;  2Z2N A;  1M1X A;  2Z2P A;  3KCI A;  3ORV D;  1JTD B;  3IJE A;  3VH0 A;  5HE2 B;  4CI1 A;  2HJB A;  4L1M A;  4XYH A;  3FCU A;  2XYI A;  2J56 H;  3C5M A;  4QAM A;  4YVD A;  1K8K C;  4AN0 A;  2VDQ A;  3GRE A;  2G9A A;  3KRX B;  3SCY A;  1L5G A;  1XIP A;  1JMZ B;  3EU7 A;  5TEE A;  3MUN A;  4CZY A;  3SVW D;  3I7O A;  3O4J A;  2AQ5 A;  2AH0 A;  5I5I A;  2QZP A;  2GC7 A;  3PE7 A;  2EIB A;  4E54 A;  3JAM g;  4O2W A;  3DXM C;  5EMM B;  4BH6 A;  2CN3 A;  2W18 A;  4MMZ A;  5A2Q g;  4UM8 A;  1SQJ A;  2CE8 A;  3MKQ A;  4Z7N A;  3U4Y A;  2CO0 A;  3I89 A;  4QL1 A;  5GSA A;  3UVM A;  5THA A;  1A12 A;  2VZ3 A;  3OTT A;  1T2X A;  4A11 B;  3IUN A;  4GM3 A;  1XHM A;  5TDH B;  3SXT D;  4U1E I;  4LG9 A;  1JJU B;  4CI2 A;  4CY2 A;  1H2Y A;  2YMU A;  4WJK A;  1QFM A;  4OZU A;  2I0S A;  2HKM A;  2H9P A;  4X63 B;  3IVM A;  3K27 A;  5CXB B;  5GXH A;  3V4P A;  3C99 A;  3DDU A;  1JOF A;  2TRC B;  3I7P A;  3AH8 B;  4IMM A;  3CIK B;  4BUJ C;  4J87 A;  3OL2 B;  3V5W B;  5E6U A;  5CXC A;  3F3P A;  3QHY B;  1GOH A;  1VE6 A;  2IUR A;  2O9K A;  4TZ4 A;  4ZOX A;  4X3E A;  2H9L A;  2HJ4 A;  3L4M D;  4IA9 A;  4Z7Q A;  3EI3 A;  3C9C A;  3IJ0 A;  3OKY A;  5FKT A;  4FB1 D;  3BG1 A;  2P9L C;  1MG3 A;  4ERQ A;  1TYE A;  2XL2 A;  2Q7Q A;  4GGC A;  4BCC A;  1C9I A;  3K26 A;  3ZE2 A;  2PM6 B;  3SHF A;  4J73 A;  4JSV C;  3SBP A;  1VYH C;  4GGA A;  3FGB A;  3VI4 A;  2H14 A;  2P9I C;  4O9D A;  3EQ7 A;  2VDK A;  4J8G A;  4X60 B;  2WQ8 A;  2VDO A;  3SBR A;  4EWR A;  5FKR A;  3ZDX A;  4GQB B;  4A11 A;  4FA1 D;  1U2V C;  2OJY A;  2VC2 A;  4J79 A;  5C92 A;  4A0A B;  4MK0 B;  4MMX A;  2P9U C;  2YNO A;  5KDO B;  1BPO A;  3F3F A;  4PSX B;  1MDA H;  2H3X A;  3RLM D;  3QI0 A;  3RFH A;  1GOT B;  3BWS A;  3EQ8 A;  2IWF A;  2Z2O A;  3NID A;  3CFS B;  3UR4 A;  5EMK B;  4FA4 D;  4FWW A;  4K3J B;  4AN1 A;  2EIC A;  2XL3 A;  1SQ9 A;  4NBM A;  3SBQ A;  1B9Y A;  3JZH A;  4E5Z B;  2QC5 A;  5FA5 B;  1NR0 A;  4WK4 A;  3UVO A;  3JRO A;  2YB8 B;  4PBZ A;  3JB9 L;  4PNK B;  2XZG A;  2B5N A;  3AL9 A;  4G1M A;  3V4V A;  5M5V A;  3RN1 D;  1S4U X;  4HDJ A;  4G1E A;  3DWL C;  4GZ8 A;  2I0R A;  2IUQ A;  4PXW A;  3VI3 A;  3GD1 I;  1GOG A;  5C2V B;  3DSM A;  3NIG A;  4CI3 A;  1YR2 A;  4L3G D;  3RMZ D;  4CY1 A;  2EIE A;  1K32 A;  5EAM A;  5IGQ A;  3OKT A;  1U4C A;  3RFG A;  5IT9 g;  1TYQ C;  2P9S C;  2XDW A;  3MVD K;  3SLE D;  3JZN A;  3UKR C;  3HFQ A;  5IGO A;  3MUO A;  4J0W A;  4AEZ A;  4J78 A;  4DNW A;  2HES X;  3IKO A;  5TEF A;  1FWX A;  5AMS A;  3UVK A;  4D0K A;  4A0A A;  2H13 A;  3JRP A;  4IRZ A;  4JT6 C;  4FA5 D;  4J82 A;  3PXS D;  1YFQ A;  1K3I A;  3EI4 B;  1SHY B;  2I3S A;  4A2L A;  4FAN D;  4AX4 A;  1OLZ A;  4CC9 A;  3IUJ A;  1GG2 B;  1PEV A;  5IC7 A;  5EMJ B;  3N0E A;  2VDM A;  4J77 A;  5H1M A;  5H17 A;  5EAL A;  1UTC A;  3AL8 B;  4A08 B;  4H5J A;  4L9O A;  5GMK n;  3EI1 B;  4AMY A;  3N0D A;  1GP2 B;  3I7N A;  4ZOZ A;  3ODT A;  1RI6 A;  2I0T A;  4O3T B;  3K71 A;  4CI8 A;  4QRJ A;  2QXV A;  2OVP B;  3MZK A;  2AGZ A;  3SWS D;  3PSC B;  2AGX A;  1GXR A;  4O45 A;  4FHL A;  2I3T A;  2PM9 B;  3VA6 A;  4RE5 A;  4J0X A;  4UM9 A;  4Z7O A;  4G56 B;  5HE0 B;  1P22 A;  4MMY A;  3ZDY A;  5C86 A;  5AJA A;  3I8C A;  1N6E A;  5B4W A;  4A7J A;  4UI9 R;  4L3H D;  1H2X A;  5M61 A;  3EI4 A;  2BBK H;  2XE4 A;  3A0F A;  1PBY B;  4J84 A;  4QQE A;  3NVX A;  4CY5 A;  3ZE1 A;  3NIF A;  1MG2 A;  5K19 A;  2OIZ A;  1N6D A;  3EI2 B;  4J86 A;  2PM7 B;  4U7A A;  3PXW D;  4QT8 A;  4BP9 A;  4BP8 A;  3PXT D;  3P4F A;  2HYE A;  3AL8 A;  3PSL A;  5FQD A;  1GOF A;  3I7H A;  4A08 A;  4NEN A;  5H14 A;  2YNP A;  2GC4 A;  5M5U A;  3J81 g;  4LGN A;  1H2Z A;  5HYN B;  3MMY A;  5JWZ A;  4CZX A;  3C75 H;  2QR5 A;  5HE1 B;  4Z8L A;  4O3U B;  4XYI A;  2OVQ B;  1N6F A;  1R5M A;  2BKL A;  4ZN4 A;  4JSX C;  5CXB A;  4KFM B;  4A09 B;  3OL2 A;  3MKS B;  5HQG A;  2EID A;  5GXI A;  3EWE A;  3F3G A;  1O6G A;  2P9N C;  2AGY A;  2B5M A;  4JHP C;  3IJC A;  3MXX A;  4BL0 A;  2IUP A;  3PVW B;  2IWK A;  4DNU A;  2HXC A;  4A0B B;  2VDP A;  4GM9 A;  2PBI B;  1C9L A;  4I79 A;  1JV2 A;  1ERJ A;  4D6V A;  2AGL A;  4GQ1 A;  4AOW A;  3IUM A;  3SMR A;  3ZE0 A;  1PGU A;  3IUQ A;  4XEI C;  4GM8 A;  3PVU B;  3RN0 D;  1XKS A;  4FA9 D;  5EAP A;  2CE9 A;  3SFZ A;  2AH1 A;  2JKX A;  2HU5 A;  1L0Q A;  4G55 A;  3ZWL B;  4CY3 A;  5FKQ A;  5TF2 A;  3SN6 B;  4WK0 A;  2H6N A;  3AFC A;  3UVL A;  3GFC A;  1UOO A;  1H2W A;  2H68 A;  5FKS A;  3IUL A;  3K72 A;  2IAA A;  2GNQ A;  3ULE C;  5FFO A;  2H47 A;  5M5R A;  3IIY A;  2B5L A;  4JSN C;  3J80 g;  4Y7R A;  4E5Z A;  3NVN A;  2IUV A;  1A0R B;  5FLX g;  1E8M A;  5EM2 B;  4A09 A;  2HU8 A;  5E6R A;  3JPX A;  5CXC B;  3V9F A;  4NC4 A;  4BCD A;  4DNV A;  3EI3 B;  3OKY B;  1UOP A;  4A0B A;  1I2M B;  1VZ2 A;  2G99 A;  2H6K A;  4H5I A;  4ERY A;  4PSW B;  3RRM C;  3FM0 A;  4NAA A;  3ZDZ A;  4JT5 C;  2MTA H;  2BCJ B;  5I5M A;  4A2M A;  4O1Q D;  4L1Q D;  2VDL A;  3O4G A;  2B4E A;  3I8E A;  2J57 G;  4ZOY A;  3DM0 A;  4O02 A;  4K3I D;  2P9K C;  2HU7 A;  3MZL A;  5HDB A;  1U8C A;  4ESG A;  4GGD A;  5SXM A;  2H9M A;  4RE6 A;  3OW8 A;  1UOQ A;  4NSX A;  3RSE C;  2J55 H;  4FAV D;  5IJ8 E;  1TBG A;  3KRW B;  4J81 A;  5E6S A;  2H9N A;  3OF7 A; 
#chains in the Genus database with same CATH homology
 2AGW A;  3EMH A;  5EML B;  5CYK B;  5C2W B;  2CN2 A;  2YNN A;  2OVR B;  5EM2 A;  3W15 A;  4OWR A;  5FXY A;  2CO0 C;  1Q47 A;  2EBS A;  3I7K A;  4R7A B;  2CNX A;  3L4O D;  1NEX B;  5EAR A;  3BG0 A;  3SJL D;  5AFU 3;  4PC0 A;  3OKW A;  2UZX B;  3DXK C;  5K1C C;  3EI1 A;  1JMX B;  3CFV A;  4PBY A;  2HKR A;  3VGZ A;  2UZY B;  4ES0 A;  4X61 B;  4N14 A;  4ZOV A;  1QNI A;  2XU7 A;  5HE3 B;  3I7L A;  3UKU C;  4ERZ A;  2PM9 A;  1PI6 A;  4GQ2 P;  3UVN A;  4JXM A;  3B7F A;  5C9Z B;  3E0C A;  2YBA A;  3FRX A;  5I5J A;  4LG8 A;  3IIW A;  4Y5R D;  2H6Q A;  4J8B A;  2P9P C;  4E54 B;  4CZV A;  5CYK A;  3EG6 A;  3EI2 A;  4JD2 C;  3IJ1 A;  3V7D B;  2OK4 A;  3I2N A;  4GMB A;  1OMW B;  5IJ7 E;  3JZG A;  4JSP C;  1B9X A;  2OK6 A;  3NVQ A;  2Z2N A;  2Z2P A;  3ORV D;  3VH0 A;  5HE2 B;  4CI1 A;  2HJB A;  4XYH A;  2XYI A;  2J56 H;  3C5M A;  4YVD A;  1K8K C;  3GRE A;  2G9A A;  3KRX B;  3SCY A;  1XIP A;  1JMZ B;  3EU7 A;  5TEE A;  4CZY A;  3SVW D;  3I7O A;  2AQ5 A;  2AH0 A;  5I5I A;  2GC7 A;  3PE7 A;  4E54 A;  3JAM g;  3DXM C;  5EMM B;  4BH6 A;  2CN3 A;  2W18 A;  5A2Q g;  1SQJ A;  2CE8 A;  3MKQ A;  3U4Y A;  2CO0 A;  3I89 A;  4QL1 A;  5GSA A;  3UVM A;  5THA A;  3OTT A;  4A11 B;  4GM3 A;  1XHM A;  5TDH B;  3SXT D;  4U1E I;  4LG9 A;  1JJU B;  4CI2 A;  4CY2 A;  2YMU A;  4OZU A;  2I0S A;  2HKM A;  2H9P A;  4X63 B;  3K27 A;  5CXB B;  5GXH A;  3C99 A;  1JOF A;  2TRC B;  3I7P A;  3AH8 B;  4IMM A;  3CIK B;  4BUJ C;  4J87 A;  3OL2 B;  3V5W B;  5CXC A;  3F3P A;  2IUR A;  2O9K A;  4TZ4 A;  4ZOX A;  4X3E A;  2H9L A;  2HJ4 A;  3L4M D;  4IA9 A;  3EI3 A;  3C9C A;  3IJ0 A;  3OKY A;  5FKT A;  4FB1 D;  3BG1 A;  2P9L C;  1MG3 A;  4ERQ A;  2XL2 A;  2Q7Q A;  4GGC A;  3K26 A;  2PM6 B;  3SHF A;  4J73 A;  4JSV C;  3SBP A;  1VYH C;  4GGA A;  3FGB A;  2H14 A;  2P9I C;  4O9D A;  4J8G A;  4X60 B;  3SBR A;  4EWR A;  5FKR A;  4GQB B;  4A11 A;  4FA1 D;  1U2V C;  2OJY A;  4J79 A;  4A0A B;  4MK0 B;  2P9U C;  2YNO A;  5KDO B;  3F3F A;  4PSX B;  1MDA H;  2H3X A;  3RLM D;  3RFH A;  1GOT B;  3BWS A;  2IWF A;  2Z2O A;  3CFS B;  3UR4 A;  5EMK B;  4FA4 D;  4FWW A;  4K3J B;  2XL3 A;  1SQ9 A;  3SBQ A;  1B9Y A;  3JZH A;  4E5Z B;  2QC5 A;  5FA5 B;  1NR0 A;  3UVO A;  3JRO A;  2YB8 B;  4PBZ A;  3JB9 L;  4PNK B;  2B5N A;  3AL9 A;  3RN1 D;  1S4U X;  4HDJ A;  4GZ8 A;  3DWL C;  2I0R A;  2IUQ A;  4PXW A;  5C2V B;  3DSM A;  4CI3 A;  4L3G D;  3RMZ D;  4CY1 A;  1K32 A;  5EAM A;  5IGQ A;  3OKT A;  1U4C A;  3RFG A;  5IT9 g;  1TYQ C;  2P9S C;  3SLE D;  3JZN A;  3UKR C;  3HFQ A;  5IGO A;  4J0W A;  4AEZ A;  4J78 A;  2HES X;  3IKO A;  5TEF A;  1FWX A;  5AMS A;  3UVK A;  4D0K A;  4A0A A;  2H13 A;  3JRP A;  4JT6 C;  4FA5 D;  4J82 A;  3PXS D;  1YFQ A;  3EI4 B;  1SHY B;  2I3S A;  4A2L A;  4FAN D;  1OLZ A;  4CC9 A;  1GG2 B;  1PEV A;  5IC7 A;  5EMJ B;  3N0E A;  4J77 A;  5H1M A;  5H17 A;  5EAL A;  3AL8 B;  4A08 B;  4H5J A;  4L9O A;  5GMK n;  3EI1 B;  3N0D A;  1GP2 B;  3I7N A;  4ZOZ A;  3ODT A;  1RI6 A;  2I0T A;  4O3T B;  4CI8 A;  4QRJ A;  2QXV A;  2OVP B;  3MZK A;  2AGZ A;  3SWS D;  3PSC B;  2AGX A;  1GXR A;  4O45 A;  4FHL A;  2I3T A;  2PM9 B;  3VA6 A;  4J0X A;  4G56 B;  5HE0 B;  1P22 A;  5AJA A;  3I8C A;  1N6E A;  5B4W A;  4A7J A;  4UI9 R;  4L3H D;  3EI4 A;  2BBK H;  3A0F A;  1PBY B;  4J84 A;  4QQE A;  3NVX A;  4CY5 A;  1MG2 A;  5K19 A;  2OIZ A;  1N6D A;  3EI2 B;  4J86 A;  2PM7 B;  4U7A A;  3PXW D;  4QT8 A;  3PXT D;  3P4F A;  2HYE A;  3AL8 A;  3PSL A;  5FQD A;  3I7H A;  4A08 A;  5H14 A;  2YNP A;  2GC4 A;  3J81 g;  4LGN A;  5HYN B;  3MMY A;  5JWZ A;  4CZX A;  3C75 H;  5HE1 B;  4Z8L A;  4O3U B;  4XYI A;  2OVQ B;  1N6F A;  1R5M A;  4ZN4 A;  4JSX C;  5CXB A;  4KFM B;  4A09 B;  3OL2 A;  3MKS B;  5HQG A;  5GXI A;  3EWE A;  3F3G A;  2P9N C;  2AGY A;  2B5M A;  3IJC A;  3MXX A;  4BL0 A;  2IUP A;  3PVW B;  2IWK A;  2HXC A;  4A0B B;  4GM9 A;  2PBI B;  4I79 A;  1ERJ A;  4D6V A;  2AGL A;  4GQ1 A;  4AOW A;  3SMR A;  1PGU A;  4XEI C;  4GM8 A;  3PVU B;  3RN0 D;  1XKS A;  4FA9 D;  5EAP A;  2CE9 A;  3SFZ A;  2AH1 A;  1L0Q A;  3ZWL B;  4CY3 A;  5FKQ A;  5TF2 A;  3SN6 B;  2H6N A;  3AFC A;  3UVL A;  3GFC A;  2H68 A;  5FKS A;  2IAA A;  2GNQ A;  3ULE C;  2H47 A;  3IIY A;  2B5L A;  4JSN C;  3J80 g;  4Y7R A;  4E5Z A;  3NVN A;  2IUV A;  1A0R B;  5FLX g;  5EM2 B;  4A09 A;  3JPX A;  5CXC B;  3V9F A;  3EI3 B;  3OKY B;  4A0B A;  2G99 A;  2H6K A;  4H5I A;  4ERY A;  4PSW B;  3RRM C;  3FM0 A;  4JT5 C;  2MTA H;  2BCJ B;  5I5M A;  4A2M A;  4O1Q D;  4L1Q D;  2B4E A;  3I8E A;  2J57 G;  4ZOY A;  3DM0 A;  4K3I D;  2P9K C;  3MZL A;  4ESG A;  4GGD A;  5SXM A;  2H9M A;  3OW8 A;  4NSX A;  3RSE C;  2J55 H;  4FAV D;  5IJ8 E;  1TBG A;  3KRW B;  4J81 A;  2H9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...