2XZGA

Clathrin terminal domain complexed with pitstop 1
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
358
structure length
358
Chain Sequence
FMAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis
molecule keywords CLATHRIN HEAVY CHAIN 1
publication title Role of the Clathrin Terminal Domain in Regulating Coated Pit Dynamics Revealed by Small Molecule Inhibition.
pubmed doi rcsb
source organism Homo sapiens
total genus 80
structure length 358
sequence length 358
ec nomenclature
pdb deposition date 2010-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01394 Clathrin_propel Clathrin propeller repeat
A PF09268 Clathrin-link Clathrin, heavy-chain linker
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.110 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Clathrin heavy-chain terminal domain 2xzgA00
1BPOA 5M61A 1C9IA 4G55A 3GD1I 2XZGA 1UTCA 5M5VA 3GC3B 5M5SA 5M5UA 5M5RA 5M5TA 1C9LA
chains in the Genus database with same CATH superfamily
2IUPA 3JB9L 3O4GA 1L5GA 3VI4A 4J81A 4FAND 3MZLA 4J73A 2VC2A 3PXTD 4MMYA 4R7AB 5HYNB 3SCYA 4ZOXA 3KRWB 2EBSA 3I8CA 4G1MA 3W15A 4NSXA 3F3GA 4K3JB 2BBKH 3SHFA 5M61A 4UI9R 4GM8A 5IJ8E 1UTCA 1UOQA 1H2YA 2B4EA 4K3ID 3C9CA 1VE6A 4A0BA 4YVDA 3EG6A 5FFGA 3SJLD 3UVKA 3ZDYA 2P9UC 2YMUA 4JHNA 5KDOB 1E8NA 5TEFA 4MMXA 1M1XA 5GXIA 2OJYA 2HESX 4N14A 1JV2A 3EI1A 3JZGA 5TDHB 2UZYB 2J56H 2OVRB 3BG1A 4X60B 3RFHA 2G99A 3IUNA 5HDBA 1H2WA 2XDWA 2MTAH 4X3EA 4ZOYA 2HU5A 2XE4A 5FKTA 3IIWA 4XYIA 4BUJC 1SHYB 3IUQA 1N6EA 3ZDXA 2HKRA 1XKSA 2PBIB 3IJEA 4BH6A 1P22A 2G9AA 3JZHA 4X63B 5IGOA 3E0CA 4O9DA 3PXSD 4Z7QA 2H47A 5TF2A 2H9NA 5EM2B 2CN3A 1VYHC 2PM6B 2YNPA 2IWFA 3L4OD 4IA9A 3ZE2A 3OKWA 4QL1A 3SLED 1FWXA 4JHPC 4QRJA 3BG0A 4PNKB 2EIDA 4DNWA 4NENA 2H6NA 5IT9g 5GXHA 5H17A 3EI3B 2CE8A 3V4PA 4CC9A 4WK4A 3EI4B 2EICA 5EMKB 2YNNA 2TRCB 3ZDZA 4WJKA 1TBGA 4JT5C 5THAA 4FA5D 3K6SA 4Z8LA 1XIPA 2VDOA 2OK6A 3EI2B 3I8EA 4GGCA 3K27A 4G56B 2YB8B 1N6DA 3O4IA 2P9NC 4J8GA 2VDQA 4Y5RD 3SFZA 3K72A 2VDMA 1QNIA 3SVWD 2AH0A 3PSLA 2PM7B 4AOWA 5JWZA 2GC7A 2HU7A 3FGBA 3N0DA 2P9IC 3F3FA 5FQDA 2IUVA 2GC4A 1K32A 1JMXB 3UR4A 4J82A 3AL8B 5H14A 3IUMA 5CXCA 5FKSA 4AX4A 2H68A 4CY1A 4LG9A 4GGDA 2I3SA 2QZPA 4UM8A 3ZWLB 4CI8A 5FFOA 1U4CA 1B9XA 2AGLA 3K26A 5EMLB 4CZYA 3T3PA 4FB1D 3RFGA 4E54A 4XEIC 4A08A 2HYEA 5EAMA 5HE0B 4FA9D 1QFMA 3PSCB 3F3PA 3PXWD 4H5IA 4ZOZA 5AFU3 3ZE0A 3GREA 4FA1D 3VGZA 3JAMg 3NVNA 3FCSA 3EI3A 1U2VC 4QAMA 2H14A 2XL3A 3EI4A 1SQJA 3I7OA 4XYHA 5E6SA 4ZN4A 4JSVC 4L3GD 4ERZA 3DSMA 4L1MA 1B9YA 3ODTA 4O2WA 2HJ4A 3OF7A 4J8BA 3EI2A 2OVPB 4PSWB 4PBYA 1JTDB 4WK2A 4E5ZA 4O1QD 4FHLA 2XZGA 3VI3A 5C92A 5IJ7E 2HKMA 3AL9A 4J79A 4GQBB 1OMWB 3SBPA 3MKQA 3ZE1A 5C86A 3MUNA 5HE1B 2IWKA 4U1EI 4A0AB 3JRPA 5IGQA 3O4JA 4A2MA 3I89A 3OL2B 2AGWA 3P4FA 2B5NA 4HDJA 2CE9A 4D6VA 4AMYA 5EMJB 3OW8A 3SMRA 2HXCA 3CFVA 4JD2C 5EARA 2Z2OA 5FA5B 5EMMB 1K8KC 1UOOA 1S4UX 5E6UA 3VH0A 1N6FA 1JJUB 3AH8B 3I7NA 4BCBA 4ERYA 3HFQA 3ORVD 1L0QA 3JPXA 3NVQA 4AN1A 2QR5A 4EWRA 2CO0C 4PXWA 1TYQC 2HU8A 2P9SC 4RE6A 4CZXA 2Z2PA 4I79A 2PM9B 5C2WB 4J86A 3GFCA 4O45A 3OTTA 4U7AA 3RLMD 3KRXB 4JT6C 3IJ1A 3IIYA 4CI2A 3A0FA 4AMZA 2YBAA 1PGUA 3GD1I 4NAAA 4OWRA 2J57G 4LGNA 2HJBA 3I7HA 4GQ1A 4NC4A 1PEVA 3C99A 3UVLA 2W18A 1VZ3A 4IRZA 2UZXB 2B5LA 3EQ7A 3RMZD 5M5RA 4G55A 4KFMB 5CXBB 3IVMA 3SXTD 2EIBA 3UKUC 1O6FA 2EIEA 3C75H 3VA6A 2J55H 3QI0A 4CY5A 4PSXB 2XL2A 3PVUB 3SN6B 2CO0A 2Q7QA 4L3HD 3K71A 5HQGA 4QQEA 3EU7A 5FLXg 2OIZA 4FAVD 4FWWA 4DNUA 2AH1A 1QFSA 2XU7A 5AMSA 3OKTA 2BKLA 2VDPA 4MMZA 4A2LA 1YR2A 4GZ8A 1A12A 4BCCA 5I5MA 4JXMA 3MUOA 3RRMC 4ERQA 3I7LA 5EM2A 3I2NA 4J78A 2CNXA 5K1CC 1C9IA 5IC7A 3NIFA 5M5UA 2H6KA 4GQ2P 1R5MA 2P9PC 2PM9A 3BWSA 3RN0D 1E8MA 2GNQA 3PE7A 3DWLC 2H6QA 4UM9A 2VDNA 2H13A 1RI6A 3ULEC 2H9PA 4J0XA 3DXKC 3CIKB 3EWEA 1PI6A 5I5IA 3RN1D 4A09B 3IUJA 4D0KA 2VDLA 2YNOA 3UVNA 1TYEA 3I7PA 1XHMA 3C5MA 3GC3B 2CN2A 5C2VB 3RSEC 4H5JA 3MXXA 2QC5A 4LG8A 3O4HA 5CXBA 5M5TA 3NIDA 4J84A 5EAPA 5FXYA 2AGYA 3V7DB 3UVOA 3J81g 2H9MA 4X61B 2I0TA 2P9KC 1K3IA 3DM0A 5A2Qg 3V4VA 4BL0A 2B5MA 3B7FA 3FCUA 4PC0A 3AL8A 3NIGA 3U4YA 2VDRA 4Y7RA 1SQ9A 5B4WA 2I0RA 2VZ3A 5SXMA 4L1QD 2AGXA 1PBYB 3EQ8A 3MVDK 5GSAA 4GM3A 5HE2B 3OKYB 4CY3A 4JSNC 4MK0B 2I0SA 1JOFA 2O9KA 2QXVA 5K19A 1GP2B 4CI3A 3AFCA 5FKRA 5CXCB 5HE3B 2WQ8A 5H1MA 3SWSD 4A11B 3KCIA 2AGZA 4BP9A 4GM9A 3MKSB 2H3XA 4DNVA 5C9ZB 4A09A 4ES0A 3DDUA 1MG3A 4RE5A 2BCJB 1BPOA 4E54B 3FRXA 4A08B 1T2XA 2IURA 5CYKB 5AJAA 4ZOVA 4ESGA 3N0EA 4PBZA 3FM0A 4AN0A 4NBMA 4CI1A 4G1EA 4Z7NA 3IJ0A 3L4MD 4OZUA 3J80g 4BP8A 1GG2B 4A0AA 3IURA 3CFSB 4O02A 5M5SA 3V9FA 4WK0A 2OK4A 3DXMC 1ERJA 3OL2A 3QHYB 1NEXB 1UOPA 2H9LA 2P9LC 1VZ2A 2VDKA 4IMMA 4AEZA 3UVMA 3NVXA 1VE7A 2I3TA 2JKXA 2AQ5A 3IULA 3UKRC 3SBRA 3EQ9A 1I2MB 3IKOA 1GOGA 5TEEA 4E5ZB 2Z2NA 3EMHA 4A0BB 1MDAH 3PVWB 4O3UB 2OVQB 2XYIA 1JMZB 1H2XA 1U8CA 1C9LA 1GOHA 5E6RA 4J87A 1GOFA 5I5JA 3OKYA 5EALA 3JZNA 4JSXC 3SBQA 2VZ1A 3EI1B 1Q47A 3V5WB 5GMKn 4D9SA 1GXRA 4GMBA 4JSPC 4TZ4A 3IJCA 4CZVA 4GGAA 4O3TB 5FKQA 4A11A 4J77A 4QT8A 5M5VA 4A7JA 4J0WA 1NR0A 1GOTB 3MZKA 1A0RB 4L9OA 4BCDA 2IAAA 5CYKA 1YFQA 4Z7OA 3I7KA 1MG2A 1H2ZA 3T3MA 2IUQA 4CY2A 4FA4D 3MMYA 1O6GA 1OLZA 1E5TA 3JROA
chains in the Genus database with same CATH topology
1BPOA 5M61A 1C9IA 4G55A 3GD1I 2XZGA 1UTCA 5M5VA 3GC3B 5M5SA 5M5UA 5M5RA 5M5TA 1C9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BPO A;  5M61 A;  1C9I A;  4G55 A;  3GD1 I;  2XZG A;  1UTC A;  5M5V A;  3GC3 B;  5M5S A;  5M5U A;  5M5R A;  5M5T A;  1C9L A; 
#chains in the Genus database with same CATH topology
 2IUP A;  3JB9 L;  3O4G A;  1L5G A;  3VI4 A;  4J81 A;  4FAN D;  3MZL A;  4J73 A;  2VC2 A;  3PXT D;  4MMY A;  4R7A B;  5HYN B;  3SCY A;  4ZOX A;  3KRW B;  2EBS A;  3I8C A;  4G1M A;  3W15 A;  4NSX A;  3F3G A;  4K3J B;  2BBK H;  3SHF A;  5M61 A;  4UI9 R;  4GM8 A;  5IJ8 E;  1UTC A;  1UOQ A;  1H2Y A;  2B4E A;  4K3I D;  3C9C A;  1VE6 A;  4A0B A;  4YVD A;  3EG6 A;  5FFG A;  3SJL D;  3UVK A;  3ZDY A;  2P9U C;  2YMU A;  4JHN A;  5KDO B;  1E8N A;  5TEF A;  4MMX A;  1M1X A;  5GXI A;  2OJY A;  2HES X;  4N14 A;  1JV2 A;  3EI1 A;  3JZG A;  5TDH B;  2UZY B;  2J56 H;  2OVR B;  3BG1 A;  4X60 B;  3RFH A;  2G99 A;  3IUN A;  5HDB A;  1H2W A;  2XDW A;  2MTA H;  4X3E A;  4ZOY A;  2HU5 A;  2XE4 A;  5FKT A;  3IIW A;  4XYI A;  4BUJ C;  1SHY B;  3IUQ A;  1N6E A;  3ZDX A;  2HKR A;  1XKS A;  2PBI B;  3IJE A;  4BH6 A;  1P22 A;  2G9A A;  3JZH A;  4X63 B;  5IGO A;  3E0C A;  4O9D A;  3PXS D;  4Z7Q A;  2H47 A;  5TF2 A;  2H9N A;  5EM2 B;  2CN3 A;  1VYH C;  2PM6 B;  2YNP A;  2IWF A;  3L4O D;  4IA9 A;  3ZE2 A;  3OKW A;  4QL1 A;  3SLE D;  1FWX A;  4JHP C;  4QRJ A;  3BG0 A;  4PNK B;  2EID A;  4DNW A;  4NEN A;  2H6N A;  5IT9 g;  5GXH A;  5H17 A;  3EI3 B;  2CE8 A;  3V4P A;  4CC9 A;  4WK4 A;  3EI4 B;  2EIC A;  5EMK B;  2YNN A;  2TRC B;  3ZDZ A;  4WJK A;  1TBG A;  4JT5 C;  5THA A;  4FA5 D;  3K6S A;  4Z8L A;  1XIP A;  2VDO A;  2OK6 A;  3EI2 B;  3I8E A;  4GGC A;  3K27 A;  4G56 B;  2YB8 B;  1N6D A;  3O4I A;  2P9N C;  4J8G A;  2VDQ A;  4Y5R D;  3SFZ A;  3K72 A;  2VDM A;  1QNI A;  3SVW D;  2AH0 A;  3PSL A;  2PM7 B;  4AOW A;  5JWZ A;  2GC7 A;  2HU7 A;  3FGB A;  3N0D A;  2P9I C;  3F3F A;  5FQD A;  2IUV A;  2GC4 A;  1K32 A;  1JMX B;  3UR4 A;  4J82 A;  3AL8 B;  5H14 A;  3IUM A;  5CXC A;  5FKS A;  4AX4 A;  2H68 A;  4CY1 A;  4LG9 A;  4GGD A;  2I3S A;  2QZP A;  4UM8 A;  3ZWL B;  4CI8 A;  5FFO A;  1U4C A;  1B9X A;  2AGL A;  3K26 A;  5EML B;  4CZY A;  3T3P A;  4FB1 D;  3RFG A;  4E54 A;  4XEI C;  4A08 A;  2HYE A;  5EAM A;  5HE0 B;  4FA9 D;  1QFM A;  3PSC B;  3F3P A;  3PXW D;  4H5I A;  4ZOZ A;  5AFU 3;  3ZE0 A;  3GRE A;  4FA1 D;  3VGZ A;  3JAM g;  3NVN A;  3FCS A;  3EI3 A;  1U2V C;  4QAM A;  2H14 A;  2XL3 A;  3EI4 A;  1SQJ A;  3I7O A;  4XYH A;  5E6S A;  4ZN4 A;  4JSV C;  4L3G D;  4ERZ A;  3DSM A;  4L1M A;  1B9Y A;  3ODT A;  4O2W A;  2HJ4 A;  3OF7 A;  4J8B A;  3EI2 A;  2OVP B;  4PSW B;  4PBY A;  1JTD B;  4WK2 A;  4E5Z A;  4O1Q D;  4FHL A;  2XZG A;  3VI3 A;  5C92 A;  5IJ7 E;  2HKM A;  3AL9 A;  4J79 A;  4GQB B;  1OMW B;  3SBP A;  3MKQ A;  3ZE1 A;  5C86 A;  3MUN A;  5HE1 B;  2IWK A;  4U1E I;  4A0A B;  3JRP A;  5IGQ A;  3O4J A;  4A2M A;  3I89 A;  3OL2 B;  2AGW A;  3P4F A;  2B5N A;  4HDJ A;  2CE9 A;  4D6V A;  4AMY A;  5EMJ B;  3OW8 A;  3SMR A;  2HXC A;  3CFV A;  4JD2 C;  5EAR A;  2Z2O A;  5FA5 B;  5EMM B;  1K8K C;  1UOO A;  1S4U X;  5E6U A;  3VH0 A;  1N6F A;  1JJU B;  3AH8 B;  3I7N A;  4BCB A;  4ERY A;  3HFQ A;  3ORV D;  1L0Q A;  3JPX A;  3NVQ A;  4AN1 A;  2QR5 A;  4EWR A;  2CO0 C;  4PXW A;  1TYQ C;  2HU8 A;  2P9S C;  4RE6 A;  4CZX A;  2Z2P A;  4I79 A;  2PM9 B;  5C2W B;  4J86 A;  3GFC A;  4O45 A;  3OTT A;  4U7A A;  3RLM D;  3KRX B;  4JT6 C;  3IJ1 A;  3IIY A;  4CI2 A;  3A0F A;  4AMZ A;  2YBA A;  1PGU A;  3GD1 I;  4NAA A;  4OWR A;  2J57 G;  4LGN A;  2HJB A;  3I7H A;  4GQ1 A;  4NC4 A;  1PEV A;  3C99 A;  3UVL A;  2W18 A;  1VZ3 A;  4IRZ A;  2UZX B;  2B5L A;  3EQ7 A;  3RMZ D;  5M5R A;  4G55 A;  4KFM B;  5CXB B;  3IVM A;  3SXT D;  2EIB A;  3UKU C;  1O6F A;  2EIE A;  3C75 H;  3VA6 A;  2J55 H;  3QI0 A;  4CY5 A;  4PSX B;  2XL2 A;  3PVU B;  3SN6 B;  2CO0 A;  2Q7Q A;  4L3H D;  3K71 A;  5HQG A;  4QQE A;  3EU7 A;  5FLX g;  2OIZ A;  4FAV D;  4FWW A;  4DNU A;  2AH1 A;  1QFS A;  2XU7 A;  5AMS A;  3OKT A;  2BKL A;  2VDP A;  4MMZ A;  4A2L A;  1YR2 A;  4GZ8 A;  1A12 A;  4BCC A;  5I5M A;  4JXM A;  3MUO A;  3RRM C;  4ERQ A;  3I7L A;  5EM2 A;  3I2N A;  4J78 A;  2CNX A;  5K1C C;  1C9I A;  5IC7 A;  3NIF A;  5M5U A;  2H6K A;  4GQ2 P;  1R5M A;  2P9P C;  2PM9 A;  3BWS A;  3RN0 D;  1E8M A;  2GNQ A;  3PE7 A;  3DWL C;  2H6Q A;  4UM9 A;  2VDN A;  2H13 A;  1RI6 A;  3ULE C;  2H9P A;  4J0X A;  3DXK C;  3CIK B;  3EWE A;  1PI6 A;  5I5I A;  3RN1 D;  4A09 B;  3IUJ A;  4D0K A;  2VDL A;  2YNO A;  3UVN A;  1TYE A;  3I7P A;  1XHM A;  3C5M A;  3GC3 B;  2CN2 A;  5C2V B;  3RSE C;  4H5J A;  3MXX A;  2QC5 A;  4LG8 A;  3O4H A;  5CXB A;  5M5T A;  3NID A;  4J84 A;  5EAP A;  5FXY A;  2AGY A;  3V7D B;  3UVO A;  3J81 g;  2H9M A;  4X61 B;  2I0T A;  2P9K C;  1K3I A;  3DM0 A;  5A2Q g;  3V4V A;  4BL0 A;  2B5M A;  3B7F A;  3FCU A;  4PC0 A;  3AL8 A;  3NIG A;  3U4Y A;  2VDR A;  4Y7R A;  1SQ9 A;  5B4W A;  2I0R A;  2VZ3 A;  5SXM A;  4L1Q D;  2AGX A;  1PBY B;  3EQ8 A;  3MVD K;  5GSA A;  4GM3 A;  5HE2 B;  3OKY B;  4CY3 A;  4JSN C;  4MK0 B;  2I0S A;  1JOF A;  2O9K A;  2QXV A;  5K19 A;  1GP2 B;  4CI3 A;  3AFC A;  5FKR A;  5CXC B;  5HE3 B;  2WQ8 A;  5H1M A;  3SWS D;  4A11 B;  3KCI A;  2AGZ A;  4BP9 A;  4GM9 A;  3MKS B;  2H3X A;  4DNV A;  5C9Z B;  4A09 A;  4ES0 A;  3DDU A;  1MG3 A;  4RE5 A;  2BCJ B;  1BPO A;  4E54 B;  3FRX A;  4A08 B;  1T2X A;  2IUR A;  5CYK B;  5AJA A;  4ZOV A;  4ESG A;  3N0E A;  4PBZ A;  3FM0 A;  4AN0 A;  4NBM A;  4CI1 A;  4G1E A;  4Z7N A;  3IJ0 A;  3L4M D;  4OZU A;  3J80 g;  4BP8 A;  1GG2 B;  4A0A A;  3IUR A;  3CFS B;  4O02 A;  5M5S A;  3V9F A;  4WK0 A;  2OK4 A;  3DXM C;  1ERJ A;  3OL2 A;  3QHY B;  1NEX B;  1UOP A;  2H9L A;  2P9L C;  1VZ2 A;  2VDK A;  4IMM A;  4AEZ A;  3UVM A;  3NVX A;  1VE7 A;  2I3T A;  2JKX A;  2AQ5 A;  3IUL A;  3UKR C;  3SBR A;  3EQ9 A;  1I2M B;  3IKO A;  1GOG A;  5TEE A;  4E5Z B;  2Z2N A;  3EMH A;  4A0B B;  1MDA H;  3PVW B;  4O3U B;  2OVQ B;  2XYI A;  1JMZ B;  1H2X A;  1U8C A;  1C9L A;  1GOH A;  5E6R A;  4J87 A;  1GOF A;  5I5J A;  3OKY A;  5EAL A;  3JZN A;  4JSX C;  3SBQ A;  2VZ1 A;  3EI1 B;  1Q47 A;  3V5W B;  5GMK n;  4D9S A;  1GXR A;  4GMB A;  4JSP C;  4TZ4 A;  3IJC A;  4CZV A;  4GGA A;  4O3T B;  5FKQ A;  4A11 A;  4J77 A;  4QT8 A;  5M5V A;  4A7J A;  4J0W A;  1NR0 A;  1GOT B;  3MZK A;  1A0R B;  4L9O A;  4BCD A;  2IAA A;  5CYK A;  1YFQ A;  4Z7O A;  3I7K A;  1MG2 A;  1H2Z A;  3T3M A;  2IUQ A;  4CY2 A;  4FA4 D;  3MMY A;  1O6G A;  1OLZ A;  1E5T A;  3JRO A; 
#chains in the Genus database with same CATH homology
 1BPO A;  5M61 A;  1C9I A;  4G55 A;  3GD1 I;  2XZG A;  1UTC A;  5M5V A;  3GC3 B;  5M5S A;  5M5U A;  5M5R A;  5M5T A;  1C9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...