2XZGA

Clathrin terminal domain complexed with pitstop 1
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
358
structure length
358
Chain Sequence
FMAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLATHRIN HEAVY CHAIN 1
publication title Role of the Clathrin Terminal Domain in Regulating Coated Pit Dynamics Revealed by Small Molecule Inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis
total genus 80
structure length 358
sequence length 358
ec nomenclature
pdb deposition date 2010-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01394 Clathrin_propel Clathrin propeller repeat
A PF09268 Clathrin-link Clathrin, heavy-chain linker
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.110 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Clathrin heavy-chain terminal domain 2xzgA00
5M5VA 5M5SA 1UTCA 3GD1I 1C9LA 5M5UA 5M5TA 5M61A 2XZGA 1BPOA 1C9IA 5M5RA 3GC3B 4G55A
chains in the Genus database with same CATH superfamily
4X63B 4A11B 4K3JB 2GC4A 4ERYA 4E54B 3IUMA 5THAA 4GZ8A 4J84A 2CN3A 4X61B 1QFMA 5IGQA 2OVPB 4BCCA 5EARA 4BCDA 3KRWB 3DDUA 5FKTA 4O3UB 4GM9A 3OL2A 4H5IA 3O4HA 4K3ID 4Z7OA 4BP9A 2EIDA 2IWFA 3FCUA 3EI2A 4CI2A 4A0AA 5C2VB 3K27A 4QL1A 3SBPA 2OIZA 4GGDA 4CZXA 1SQ9A 3I8EA 3IULA 4UI9R 2TRCB 4O1QD 2H14A 4E5ZA 4ERQA 3KRXB 1XIPA 4CY5A 3O4IA 1UTCA 4FWWA 4FAND 2IUPA 1JJUB 2B5MA 1VE7A 4GGAA 4J73A 3KCIA 3AH8B 4ZOYA 3OF7A 2CNXA 5FFGA 4PBYA 3MUOA 3AL8A 2HESX 2VDRA 2AGLA 3JRPA 1UOQA 3NIGA 2I0SA 1MDAH 2Q7QA 4BL0A 4A11A 4LG9A 2H6QA 3EI3B 5EAPA 3F3GA 1C9IA 2P9SC 1JMXB 4Y7RA 2HU8A 2YB8B 3PSCB 2YNPA 4GQBB 3DXMC 4WK0A 3I7NA 2VDQA 4U1EI 4DNWA 4Z7QA 4FB1D 3UKUC 2BBKH 1GOGA 3B7FA 3NVQA 1K8KC 3EI4B 1UOPA 4ZOXA 3MZKA 5FKRA 4O9DA 5FFOA 2GNQA 3SFZA 2H13A 1FWXA 4J79A 3BWSA 5CYKB 3UR4A 1B9YA 3JZNA 5M5TA 1K32A 2P9UC 5IJ7E 1U2VC 2PM6B 4JSXC 3SLED 4D9SA 4ZN4A 2H9MA 2UZXB 2VZ3A 4J81A 2VDNA 4CY1A 4GGCA 3VI4A 3SBRA 3UVNA 3PXTD 5B4WA 5M5UA 3JAMg 2O9KA 4DNVA 3K71A 1GXRA 5E6UA 1GG2B 4J0WA 1A0RB 1R5MA 2XYIA 3UVKA 2JKXA 5E6RA 2MTAH 3VH0A 4A0AB 1PEVA 4Z7NA 5A2Qg 4G56B 1TYQC 3V7DB 2G99A 4MMZA 2W18A 3AL9A 3CFSB 4D0KA 2AQ5A 2P9KC 3P4FA 3PSLA 1P22A 1JTDB 3UVMA 4QAMA 3ZDXA 2BCJB 5K19A 2P9NC 1K3IA 4XYHA 4A2MA 2VDLA 1GOHA 1OMWB 1GOFA 2VDOA 5I5JA 2IUVA 1E8MA 5GXHA 4J82A 4O02A 5C86A 1E8NA 4CI3A 3EI4A 5FKSA 5M5SA 2HKRA 5EALA 2H9NA 3HFQA 4Y5RD 5CYKA 4OWRA 5GSAA 3EI1B 3IJ1A 2IAAA 1GOTB 1I2MB 1XHMA 4JT6C 2EIBA 3N0DA 4X3EA 1GP2B 2B4EA 3FCSA 4A7JA 3PE7A 5TEEA 2AGWA 4O3TB 3OKWA 5TF2A 4XEIC 3ZWLB 5TEFA 2VDPA 2XL2A 2VDMA 3BG1A 4DNUA 3IURA 2HJ4A 3A0FA 1H2ZA 4Z8LA 4O2WA 4J86A 2EICA 2QXVA 2UZYB 4JHPC 3UVLA 1OLZA 5AFU3 4D6VA 4L3GD 2XE4A 4J8GA 5I5IA 2GC7A 4L3HD 4AMYA 4PBZA 2YMUA 4ERZA 2AH0A 3SJLD 3ULEC 3SBQA 3I8CA 4A0BB 5E6SA 2PBIB 2OVRB 4QT8A 4X60B 4TZ4A 4MMXA 3ZE2A 3MKQA 3RFGA 3ORVD 3V5WB 1YFQA 4ESGA 3U4YA 1UOOA 5C2WB 5EM2B 4CI1A 1YR2A 2AGZA 5FQDA 3NIDA 1XKSA 5IT9g 3EI1A 5SXMA 1Q47A 2HKMA 2OK6A 5H17A 3V9FA 3I7KA 4AX4A 2J56H 2CO0C 3OKYB 4WJKA 5CXCB 3MMYA 3F3PA 4G55A 3DSMA 5FA5B 3JROA 1VYHC 4PC0A 4U7AA 5EMMB 3VGZA 2H9PA 4JHNA 2XL3A 3ZE1A 1BPOA 5HE3B 5M5VA 3SMRA 2WQ8A 3FRXA 3I7LA 3N0EA 3EQ9A 4IA9A 1PI6A 5FLXg 2H6NA 3SWSD 3V4PA 3DWLC 3SVWD 4O45A 3UKRC 5M5RA 1M1XA 4J8BA 3DM0A 5AJAA 4ES0A 4UM9A 3EU7A 4AMZA 4FA9D 4XYIA 5H1MA 3PVWB 3RN1D 5AMSA 2H68A 4BCBA 2Z2OA 2CN2A 3SXTD 4A0BA 1U4CA 5I5MA 3I89A 3RN0D 4CC9A 1H2XA 1PBYB 5C9ZB 3SN6B 2CO0A 4JSNC 3GFCA 3JPXA 5GMKn 5EM2A 2IURA 3UVOA 4EWRA 4A09B 2H6KA 3IJ0A 4FAVD 5JWZA 2P9IC 3IUJA 2YBAA 3QHYB 3PXSD 3IKOA 1SHYB 2EBSA 4PSXB 5HE0B 5CXBB 3MZLA 3OKYA 5CXCA 2G9AA 3O4JA 4FA5D 3EWEA 3RLMD 2PM9B 2AH1A 2HU7A 4I79A 3EMHA 3F3FA 5HYNB 4NBMA 5HQGA 3IJCA 4CZVA 4CI8A 1RI6A 4PXWA 2I0TA 3I7PA 4GM8A 3MVDK 3GC3B 3OW8A 1VE6A 1S4UX 2H9LA 4JSVC 4PNKB 5FXYA 2J55H 3NVXA 1H2WA 5EMJB 3V4VA 3T3MA 2I3SA 2XU7A 3JB9L 1A12A 2CE8A 4J0XA 5HE1B 4CY2A 4A09A 3JZGA 2OJYA 3SCYA 3BG0A 3RSEC 3I2NA 4PSWB 4H5JA 4GQ1A 4JT5C 2VZ1A 2XZGA 4AN1A 4LGNA 4A08B 2B5LA 2QR5A 3ODTA 4FHLA 4A2LA 5CXBA 1ERJA 1N6EA 2XDWA 2Z2NA 4IMMA 3MXXA 3DXKC 1QFSA 2PM9A 4J78A 3O4GA 3GD1I 5HE2B 4AN0A 2IUQA 3EQ7A 2HXCA 3K6SA 4G1MA 3QI0A 1SQJA 5TDHB 4N14A 3NIFA 2IWKA 1JV2A 3RFHA 4R7AB 4G1EA 2P9LC 1N6FA 3MUNA 3RMZD 1L5GA 1N6DA 2YNNA 4MMYA 4KFMB 3FM0A 4GQ2P 4FA1D 1JMZB 3RRMC 4JXMA 3T3PA 3FGBA 3AFCA 2CE9A 3L4MD 4NSXA 5EMLB 4WK2A 5IGOA 1JOFA 4IRZA 4CY3A 1H2YA 3IUQA 3L4OD 4JSPC 4CZYA 4E54A 3VI3A 1TBGA 3IIWA 4A08A 1PGUA 4AEZA 3I7OA 3IUNA 3J81g 4WK4A 3C75H 4YVDA 2I3TA 4L1QD 1TYEA 2VC2A 2OVQB 2EIEA 4GM3A 4QQEA 4AOWA 1VZ3A 2I0RA 4QRJA 3CFVA 3VA6A 2AGYA 2HU5A 1B9XA 3IIYA 1O6GA 4FA4D 4L1MA 3ZDYA 4L9OA 4ZOVA 1MG3A 3I7HA 3SHFA 3K26A 2VDKA 3JZHA 4LG8A 5H14A 4NENA 3J80g 3MKSB 3E0CA 3IJEA 4HDJA 3ZDZA 4MK0B 4NAAA 2HJBA 2H3XA 4BH6A 5IJ8E 3C9CA 1NEXB 1O6FA 3EQ8A 5HDBA 2B5NA 2QZPA 3GREA 4NC4A 4UM8A 3K72A 3OL2B 3ZE0A 2BKLA 4BUJC 2Z2PA 5EAMA 2P9PC 4GMBA 1MG2A 4JD2C 3EI2B 1T2XA 5M61A 4RE5A 4ZOZA 5K1CC 2H47A 3EI3A 2QC5A 4OZUA 3W15A 5C92A 3NVNA 1QNIA 3OTTA 2HYEA 2OK4A 4E5ZB 1E5TA 3CIKB 5IC7A 2AGXA 5EMKB 3PVUB 5GXIA 4BP8A 3C5MA 3EG6A 4J87A 4J77A 1NR0A 3IVMA 5FKQA 1VZ2A 5KDOB 1U8CA 2YNOA 2J57G 1C9LA 1L0QA 3PXWD 3OKTA 2PM7B 3AL8B 3C99A 4RE6A
chains in the Genus database with same CATH topology
5M5VA 5M5SA 1UTCA 3GD1I 1C9LA 5M5UA 5M5TA 5M61A 2XZGA 1BPOA 1C9IA 5M5RA 3GC3B 4G55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M5V A;  5M5S A;  1UTC A;  3GD1 I;  1C9L A;  5M5U A;  5M5T A;  5M61 A;  2XZG A;  1BPO A;  1C9I A;  5M5R A;  3GC3 B;  4G55 A; 
#chains in the Genus database with same CATH topology
 4X63 B;  4A11 B;  4K3J B;  2GC4 A;  4ERY A;  4E54 B;  3IUM A;  5THA A;  4GZ8 A;  4J84 A;  2CN3 A;  4X61 B;  1QFM A;  5IGQ A;  2OVP B;  4BCC A;  5EAR A;  4BCD A;  3KRW B;  3DDU A;  5FKT A;  4O3U B;  4GM9 A;  3OL2 A;  4H5I A;  3O4H A;  4K3I D;  4Z7O A;  4BP9 A;  2EID A;  2IWF A;  3FCU A;  3EI2 A;  4CI2 A;  4A0A A;  5C2V B;  3K27 A;  4QL1 A;  3SBP A;  2OIZ A;  4GGD A;  4CZX A;  1SQ9 A;  3I8E A;  3IUL A;  4UI9 R;  2TRC B;  4O1Q D;  2H14 A;  4E5Z A;  4ERQ A;  3KRX B;  1XIP A;  4CY5 A;  3O4I A;  1UTC A;  4FWW A;  4FAN D;  2IUP A;  1JJU B;  2B5M A;  1VE7 A;  4GGA A;  4J73 A;  3KCI A;  3AH8 B;  4ZOY A;  3OF7 A;  2CNX A;  5FFG A;  4PBY A;  3MUO A;  3AL8 A;  2HES X;  2VDR A;  2AGL A;  3JRP A;  1UOQ A;  3NIG A;  2I0S A;  1MDA H;  2Q7Q A;  4BL0 A;  4A11 A;  4LG9 A;  2H6Q A;  3EI3 B;  5EAP A;  3F3G A;  1C9I A;  2P9S C;  1JMX B;  4Y7R A;  2HU8 A;  2YB8 B;  3PSC B;  2YNP A;  4GQB B;  3DXM C;  4WK0 A;  3I7N A;  2VDQ A;  4U1E I;  4DNW A;  4Z7Q A;  4FB1 D;  3UKU C;  2BBK H;  1GOG A;  3B7F A;  3NVQ A;  1K8K C;  3EI4 B;  1UOP A;  4ZOX A;  3MZK A;  5FKR A;  4O9D A;  5FFO A;  2GNQ A;  3SFZ A;  2H13 A;  1FWX A;  4J79 A;  3BWS A;  5CYK B;  3UR4 A;  1B9Y A;  3JZN A;  5M5T A;  1K32 A;  2P9U C;  5IJ7 E;  1U2V C;  2PM6 B;  4JSX C;  3SLE D;  4D9S A;  4ZN4 A;  2H9M A;  2UZX B;  2VZ3 A;  4J81 A;  2VDN A;  4CY1 A;  4GGC A;  3VI4 A;  3SBR A;  3UVN A;  3PXT D;  5B4W A;  5M5U A;  3JAM g;  2O9K A;  4DNV A;  3K71 A;  1GXR A;  5E6U A;  1GG2 B;  4J0W A;  1A0R B;  1R5M A;  2XYI A;  3UVK A;  2JKX A;  5E6R A;  2MTA H;  3VH0 A;  4A0A B;  1PEV A;  4Z7N A;  5A2Q g;  4G56 B;  1TYQ C;  3V7D B;  2G99 A;  4MMZ A;  2W18 A;  3AL9 A;  3CFS B;  4D0K A;  2AQ5 A;  2P9K C;  3P4F A;  3PSL A;  1P22 A;  1JTD B;  3UVM A;  4QAM A;  3ZDX A;  2BCJ B;  5K19 A;  2P9N C;  1K3I A;  4XYH A;  4A2M A;  2VDL A;  1GOH A;  1OMW B;  1GOF A;  2VDO A;  5I5J A;  2IUV A;  1E8M A;  5GXH A;  4J82 A;  4O02 A;  5C86 A;  1E8N A;  4CI3 A;  3EI4 A;  5FKS A;  5M5S A;  2HKR A;  5EAL A;  2H9N A;  3HFQ A;  4Y5R D;  5CYK A;  4OWR A;  5GSA A;  3EI1 B;  3IJ1 A;  2IAA A;  1GOT B;  1I2M B;  1XHM A;  4JT6 C;  2EIB A;  3N0D A;  4X3E A;  1GP2 B;  2B4E A;  3FCS A;  4A7J A;  3PE7 A;  5TEE A;  2AGW A;  4O3T B;  3OKW A;  5TF2 A;  4XEI C;  3ZWL B;  5TEF A;  2VDP A;  2XL2 A;  2VDM A;  3BG1 A;  4DNU A;  3IUR A;  2HJ4 A;  3A0F A;  1H2Z A;  4Z8L A;  4O2W A;  4J86 A;  2EIC A;  2QXV A;  2UZY B;  4JHP C;  3UVL A;  1OLZ A;  5AFU 3;  4D6V A;  4L3G D;  2XE4 A;  4J8G A;  5I5I A;  2GC7 A;  4L3H D;  4AMY A;  4PBZ A;  2YMU A;  4ERZ A;  2AH0 A;  3SJL D;  3ULE C;  3SBQ A;  3I8C A;  4A0B B;  5E6S A;  2PBI B;  2OVR B;  4QT8 A;  4X60 B;  4TZ4 A;  4MMX A;  3ZE2 A;  3MKQ A;  3RFG A;  3ORV D;  3V5W B;  1YFQ A;  4ESG A;  3U4Y A;  1UOO A;  5C2W B;  5EM2 B;  4CI1 A;  1YR2 A;  2AGZ A;  5FQD A;  3NID A;  1XKS A;  5IT9 g;  3EI1 A;  5SXM A;  1Q47 A;  2HKM A;  2OK6 A;  5H17 A;  3V9F A;  3I7K A;  4AX4 A;  2J56 H;  2CO0 C;  3OKY B;  4WJK A;  5CXC B;  3MMY A;  3F3P A;  4G55 A;  3DSM A;  5FA5 B;  3JRO A;  1VYH C;  4PC0 A;  4U7A A;  5EMM B;  3VGZ A;  2H9P A;  4JHN A;  2XL3 A;  3ZE1 A;  1BPO A;  5HE3 B;  5M5V A;  3SMR A;  2WQ8 A;  3FRX A;  3I7L A;  3N0E A;  3EQ9 A;  4IA9 A;  1PI6 A;  5FLX g;  2H6N A;  3SWS D;  3V4P A;  3DWL C;  3SVW D;  4O45 A;  3UKR C;  5M5R A;  1M1X A;  4J8B A;  3DM0 A;  5AJA A;  4ES0 A;  4UM9 A;  3EU7 A;  4AMZ A;  4FA9 D;  4XYI A;  5H1M A;  3PVW B;  3RN1 D;  5AMS A;  2H68 A;  4BCB A;  2Z2O A;  2CN2 A;  3SXT D;  4A0B A;  1U4C A;  5I5M A;  3I89 A;  3RN0 D;  4CC9 A;  1H2X A;  1PBY B;  5C9Z B;  3SN6 B;  2CO0 A;  4JSN C;  3GFC A;  3JPX A;  5GMK n;  5EM2 A;  2IUR A;  3UVO A;  4EWR A;  4A09 B;  2H6K A;  3IJ0 A;  4FAV D;  5JWZ A;  2P9I C;  3IUJ A;  2YBA A;  3QHY B;  3PXS D;  3IKO A;  1SHY B;  2EBS A;  4PSX B;  5HE0 B;  5CXB B;  3MZL A;  3OKY A;  5CXC A;  2G9A A;  3O4J A;  4FA5 D;  3EWE A;  3RLM D;  2PM9 B;  2AH1 A;  2HU7 A;  4I79 A;  3EMH A;  3F3F A;  5HYN B;  4NBM A;  5HQG A;  3IJC A;  4CZV A;  4CI8 A;  1RI6 A;  4PXW A;  2I0T A;  3I7P A;  4GM8 A;  3MVD K;  3GC3 B;  3OW8 A;  1VE6 A;  1S4U X;  2H9L A;  4JSV C;  4PNK B;  5FXY A;  2J55 H;  3NVX A;  1H2W A;  5EMJ B;  3V4V A;  3T3M A;  2I3S A;  2XU7 A;  3JB9 L;  1A12 A;  2CE8 A;  4J0X A;  5HE1 B;  4CY2 A;  4A09 A;  3JZG A;  2OJY A;  3SCY A;  3BG0 A;  3RSE C;  3I2N A;  4PSW B;  4H5J A;  4GQ1 A;  4JT5 C;  2VZ1 A;  2XZG A;  4AN1 A;  4LGN A;  4A08 B;  2B5L A;  2QR5 A;  3ODT A;  4FHL A;  4A2L A;  5CXB A;  1ERJ A;  1N6E A;  2XDW A;  2Z2N A;  4IMM A;  3MXX A;  3DXK C;  1QFS A;  2PM9 A;  4J78 A;  3O4G A;  3GD1 I;  5HE2 B;  4AN0 A;  2IUQ A;  3EQ7 A;  2HXC A;  3K6S A;  4G1M A;  3QI0 A;  1SQJ A;  5TDH B;  4N14 A;  3NIF A;  2IWK A;  1JV2 A;  3RFH A;  4R7A B;  4G1E A;  2P9L C;  1N6F A;  3MUN A;  3RMZ D;  1L5G A;  1N6D A;  2YNN A;  4MMY A;  4KFM B;  3FM0 A;  4GQ2 P;  4FA1 D;  1JMZ B;  3RRM C;  4JXM A;  3T3P A;  3FGB A;  3AFC A;  2CE9 A;  3L4M D;  4NSX A;  5EML B;  4WK2 A;  5IGO A;  1JOF A;  4IRZ A;  4CY3 A;  1H2Y A;  3IUQ A;  3L4O D;  4JSP C;  4CZY A;  4E54 A;  3VI3 A;  1TBG A;  3IIW A;  4A08 A;  1PGU A;  4AEZ A;  3I7O A;  3IUN A;  3J81 g;  4WK4 A;  3C75 H;  4YVD A;  2I3T A;  4L1Q D;  1TYE A;  2VC2 A;  2OVQ B;  2EIE A;  4GM3 A;  4QQE A;  4AOW A;  1VZ3 A;  2I0R A;  4QRJ A;  3CFV A;  3VA6 A;  2AGY A;  2HU5 A;  1B9X A;  3IIY A;  1O6G A;  4FA4 D;  4L1M A;  3ZDY A;  4L9O A;  4ZOV A;  1MG3 A;  3I7H A;  3SHF A;  3K26 A;  2VDK A;  3JZH A;  4LG8 A;  5H14 A;  4NEN A;  3J80 g;  3MKS B;  3E0C A;  3IJE A;  4HDJ A;  3ZDZ A;  4MK0 B;  4NAA A;  2HJB A;  2H3X A;  4BH6 A;  5IJ8 E;  3C9C A;  1NEX B;  1O6F A;  3EQ8 A;  5HDB A;  2B5N A;  2QZP A;  3GRE A;  4NC4 A;  4UM8 A;  3K72 A;  3OL2 B;  3ZE0 A;  2BKL A;  4BUJ C;  2Z2P A;  5EAM A;  2P9P C;  4GMB A;  1MG2 A;  4JD2 C;  3EI2 B;  1T2X A;  5M61 A;  4RE5 A;  4ZOZ A;  5K1C C;  2H47 A;  3EI3 A;  2QC5 A;  4OZU A;  3W15 A;  5C92 A;  3NVN A;  1QNI A;  3OTT A;  2HYE A;  2OK4 A;  4E5Z B;  1E5T A;  3CIK B;  5IC7 A;  2AGX A;  5EMK B;  3PVU B;  5GXI A;  4BP8 A;  3C5M A;  3EG6 A;  4J87 A;  4J77 A;  1NR0 A;  3IVM A;  5FKQ A;  1VZ2 A;  5KDO B;  1U8C A;  2YNO A;  2J57 G;  1C9L A;  1L0Q A;  3PXW D;  3OKT A;  2PM7 B;  3AL8 B;  3C99 A;  4RE6 A; 
#chains in the Genus database with same CATH homology
 5M5V A;  5M5S A;  1UTC A;  3GD1 I;  1C9L A;  5M5U A;  5M5T A;  5M61 A;  2XZG A;  1BPO A;  1C9I A;  5M5R A;  3GC3 B;  4G55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...