4CY2A

Crystal structure of the kansl1-wdr5-kansl2 complex.
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD REPEAT-CONTAINING PROTEIN 5
publication title Structural Analysis of the Kansl1/Wdr5/Kansl2 Complex Reveals that Wdr5 is Required for Efficient Assembly and Chromatin Targeting of the Nsl Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 102
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2014-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4cy2A00
5EM2B 4CC9A 5EARA 2AGYA 5HE3B 1PGUA 2HESX 3VA6A 5H17A 4GQ1A 2H68A 4I79A 2YBAA 2HJBA 4FA9D 5IGQA 2UZXB 2P9SC 4E54B 5FKTA 2UZYB 4X3EA 3E0CA 1GOTB 2I0SA 4J82A 3AL8A 4X61B 3NVXA 5KDOB 3SBPA 3OL2B 2P9IC 4FAND 2YB8B 2Q7QA 3I7OA 4PBZA 2H9NA 4JXMA 4Y5RD 3MXXA 3RFGA 2B5LA 3MMYA 1SQ9A 4N14A 4U1EI 3VGZA 4GZ8A 3C99A 3J81g 4GGAA 2XU7A 2PM9A 4A2MA 4ZOVA 2IWFA 2I0TA 4MK0B 2P9NC 1MDAH 3OKTA 4GM3A 3SJLD 5HQGA 3F3FA 3SBRA 2CE9A 3I2NA 5GSAA 3V7DB 2H6NA 2XL3A 2AH1A 3GFCA 3AH8B 4HDJA 3B7FA 3I8CA 1MG3A 2I3SA 3FRXA 4A11A 1U4CA 1JJUB 3N0EA 3OW8A 1XHMA 2AH0A 2EBSA 4CZVA 4A0AB 2AGZA 2J56H 3K26A 4A0BB 5CXBA 2YNPA 2HKMA 2H9PA 3OKYA 2CO0C 3C9CA 5EMJB 5FKQA 5AMSA 2G99A 4E5ZB 2Z2NA 1N6FA 3EI3B 5EM2A 3SFZA 2HYEA 4FA5D 5JWZA 3KRWB 4IMMA 2H13A 4FAVD 3I7PA 3PVUB 5FKSA 4EWRA 1K8KC 4FB1D 5FXYA 4ZOZA 1U2VC 4X63B 2IUVA 4D6VA 4J8GA 3BG0A 3IIYA 3OL2A 3EI1B 2AGWA 3RSEC 4KFMB 2OVRB 5IJ7E 1TBGA 3JRPA 3U4YA 4A09B 1A0RB 3L4OD 2BBKH 4K3ID 3SWSD 3JPXA 5EAMA 4AEZA 4J73A 2J57G 3OKWA 2OK4A 3SLED 4A2LA 2YMUA 5FLXg 3IKOA 1PEVA 3SMRA 5GXIA 4CY5A 3N0DA 3SCYA 1K32A 4A08B 4K3JB 5H14A 2H6KA 2H9MA 3HFQA 1GXRA 3IJ0A 4GQ2P 3JB9L 3MZLA 4TZ4A 5IT9g 3SHFA 2P9KC 3W15A 4ERQA 4J77A 5C2WB 1JMXB 3UVKA 4J84A 2YNNA 5FQDA 4LG9A 1N6EA 3AFCA 4NSXA 4A0AA 4CI3A 4J78A 2I0RA 4A0BA 1JOFA 5GXHA 3PVWB 3EI2B 4ES0A 1B9YA 4GM9A 3IIWA 5EMLB 4FWWA 2CN3A 3SVWD 4XEIC 5B4WA 5TF2A 3A0FA 5A2Qg 2OJYA 2Z2PA 3RRMC 3CFSB 2GC7A 4L9OA 4E5ZA 4LGNA 3EI3A 3RMZD 3F3PA 4CI1A 4QT8A 3UVLA 1R5MA 3CIKB 3PSLA 4JSVC 4OZUA 4GMBA 3F3GA 4JD2C 4JSXC 3RFHA 2QXVA 2HJ4A 4YVDA 2BCJB 5EMKB 3KRXB 4J0WA 4BL0A 3RN1D 2B5NA 4L3HD 1P22A 2QC5A 5TEFA 3EI1A 2Z2OA 3BG1A 1SHYB 1OLZA 4A09A 4GM8A 4ZOYA 4PBYA 2XL2A 5HE1B 4CI8A 5IJ8E 1L0QA 1XIPA 3EI4B 1XKSA 2XYIA 1ERJA 3RLMD 2IUQA 1B9XA 4A08A 3I7LA 3JZNA 4J79A 3UVOA 4CZXA 2OK6A 4PSXB 5K19A 5I5MA 4E54A 3BWSA 3FM0A 5IGOA 5TEEA 4XYIA 2YNOA 3DXMC 3J80g 4Y7RA 3I7KA 4CY3A 4XYHA 4BH6A 3EU7A 1GG2B 3MZKA 4H5IA 1TYQC 1OMWB 2MTAH 2B4EA 5HE2B 5K1CC 3UKUC 4GGDA 4L1QD 4D0KA 5AJAA 3PXWD 5I5JA 2AGLA 4ESGA 3EMHA 4FHLA 3VH0A 3NVQA 5GMKn 3I89A 5CXCB 3DXKC 4O3UB 5HE0B 4FA4D 2IURA 3IJCA 4J8BA 4CZYA 5H1MA 3MKQA 3ORVD 4QL1A 3V9FA 3ZWLB 3OKYB 4J87A 1PBYB 1GP2B 4JT6C 4JSPC 4Z8LA 4PSWB 2H9LA 2P9PC 2J55H 3UR4A 5C9ZB 4OWRA 4CI2A 4JSNC 3EG6A 1N6DA 2GC4A 2HKRA 3NVNA 4CY1A 3IJ1A 3JAMg 4O3TB 2AGXA 4GGCA 5CYKB 2IUPA 4U7AA 3GREA 4LG8A 4IA9A 3EI4A 3C5MA 4GQBB 5TDHB 4QRJA 3UVNA 3PXSD 2G9AA 3SN6B 1VYHC 1YFQA 4PXWA 2P9UC 1NR0A 5FA5B 3L4MD 1FWXA 4O9DA 3I7HA 3DWLC 3PXTD 5IC7A 3DSMA 3CFVA 4PC0A 4J0XA 2CO0A 1JMZB 3SBQA 4ERYA 3ODTA 1Q47A 5THAA 4X60B 5EAPA 3UVMA 1QNIA 3AL8B 3ULEC 2PM7B 4JT5C 5I5IA 3EWEA 2PM6B 2TRCB 3DM0A 3PSCB 4H5JA 3PE7A 2W18A 2AQ5A 3JROA 4J86A 4PNKB 3OTTA 5CXCA 3P4FA 2OIZA 4UI9R 4BUJC 2GNQA 2PM9B 3UKRC 5AFU3 4G56B 2CE8A 2O9KA 3MKSB 4ZOXA 2PBIB 3V5WB 3JZHA 3SXTD 2OVPB 4L3GD 4A7JA 2I3TA 1RI6A 3FGBA 2OVQB 4ZN4A 4R7AB 2H14A 2CNXA 4AOWA 3JZGA 3K27A 5EMMB 2CN2A 4FA1D 2IWKA 4A11B 2H6QA 3AL9A 3EI2A 2HXCA 5SXMA 3C75H 2H3XA 4O1QD 5CYKA 3I7NA 5EALA 4O45A 5HYNB 5C2VB 5CXBB 1PI6A 5FKRA 4J81A 3RN0D 4CY2A 1S4UX 1MG2A 2H47A 2P9LC 4QQEA 1SQJA 2B5MA 4ERZA 3I8EA 2IAAA 1NEXB
chains in the Genus database with same CATH superfamily
5EM2B 4CC9A 5EARA 2AGYA 5HE3B 1O6GA 1PGUA 1UOQA 2HESX 5H17A 3VA6A 4GQ1A 2H68A 4I79A 2HU8A 2VDNA 2YBAA 2HJBA 4FA9D 5IGQA 2UZXB 2P9SC 4E54B 5FKTA 2UZYB 4X3EA 3E0CA 1GOTB 2QZPA 2I0SA 4J82A 5HDBA 3AL8A 1E8NA 3NVXA 4X61B 5KDOB 3SBPA 3OL2B 2P9IC 4JHPC 4FAND 2YB8B 2Q7QA 3I7OA 4PBZA 2H9NA 4JXMA 4Y5RD 2HU7A 3MXXA 3RFGA 2B5LA 2JKXA 3MMYA 1SQ9A 4N14A 4U1EI 3VGZA 4GZ8A 1JTDB 3C99A 3IJEA 3NIFA 3J81g 4GGAA 2XU7A 1VZ3A 2PM9A 4A2MA 4ZOVA 2EIBA 3GD1I 2IWFA 2I0TA 2XDWA 4MK0B 2P9NC 1MDAH 3OKTA 3ZDZA 4GM3A 3SJLD 5HQGA 3F3FA 5FFOA 3ZDYA 3SBRA 2CE9A 3I2NA 5GSAA 3V7DB 3O4IA 2H6NA 2XL3A 2AH1A 4DNUA 3GFCA 4G1EA 3AH8B 1YR2A 4HDJA 3B7FA 3T3PA 2WQ8A 3I8CA 1MG3A 2I3SA 3FRXA 4A11A 1U4CA 1JJUB 3N0EA 3OW8A 1XHMA 3ZE0A 4MMYA 2AH0A 2EBSA 4CZVA 3MUNA 4A0AB 2AGZA 2J56H 3K26A 3QHYB 3K71A 4L1MA 4A0BB 1VZ2A 2EICA 5CXBA 2YNPA 2HKMA 2H9PA 3ZE1A 3OKYA 2CO0C 3C9CA 5EMJB 5FKQA 5AMSA 4WK0A 2G99A 4E5ZB 2Z2NA 1N6FA 3EI3B 1O6FA 5EM2A 3SFZA 2HYEA 4FA5D 5JWZA 3KRWB 4IMMA 2H13A 4FAVD 3I7PA 3PVUB 5FKSA 4EWRA 1K8KC 4FB1D 5FXYA 3MVDK 2VDOA 4ZOZA 3DDUA 1U2VC 4X63B 2IUVA 4D6VA 1UTCA 4J8GA 5M5SA 3BG0A 3IIYA 3OL2A 3EI1B 2AGWA 4AN0A 3RSEC 4NENA 4KFMB 2OVRB 3OF7A 5IJ7E 1TBGA 2EIEA 3JRPA 3U4YA 4A09B 4DNWA 1A0RB 3L4OD 2BBKH 4K3ID 3SWSD 3JPXA 5EAMA 4AEZA 4J73A 2J57G 3OKWA 2OK4A 3SLED 4A2LA 2YMUA 5FLXg 2VC2A 3IKOA 1PEVA 3SMRA 5GXIA 4CY5A 3V4VA 3N0DA 3SCYA 1K32A 2VDRA 4A08B 4K3JB 5H14A 2H6KA 2H9MA 3HFQA 1GXRA 3IJ0A 4GQ2P 3JB9L 4Z7OA 3MZLA 4TZ4A 4WK2A 5IT9g 3SHFA 2P9KC 5E6RA 3W15A 4ERQA 4J77A 4AX4A 1QFSA 5C2WB 1JMXB 5M5UA 3UVKA 4J84A 2YNNA 3VI3A 5FQDA 1VE6A 1T2XA 1N6EA 4G1MA 4LG9A 3AFCA 1U8CA 1E5TA 4NSXA 4CI3A 4A0AA 4J78A 2I0RA 4A0BA 1JOFA 5GXHA 3PVWB 3EI2B 4ES0A 3EQ8A 1B9YA 4GM9A 1TYEA 3IIWA 4MMXA 5EMLB 4BCBA 4NAAA 4FWWA 2CN3A 3SVWD 1A12A 4XEIC 5B4WA 5TF2A 3A0FA 5A2Qg 2OJYA 2Z2PA 3RRMC 3CFSB 2GC7A 4L9OA 4E5ZA 4LGNA 3EI3A 1GOGA 4WK4A 3RMZD 3F3PA 4CI1A 4QT8A 3UVLA 1R5MA 3CIKB 3PSLA 4JSVC 4OZUA 4AN1A 4GMBA 3F3GA 4JD2C 4JSXC 3RFHA 2QXVA 2HJ4A 4YVDA 2VDMA 2BCJB 4O2WA 5EMKB 3KRXB 4J0WA 4BL0A 2EIDA 4NC4A 3RN1D 3MUOA 2B5NA 4L3HD 1P22A 2QC5A 5TEFA 3EI1A 1UOOA 1QFMA 2XZGA 2Z2OA 3BG1A 1SHYB 1OLZA 4A09A 4GM8A 4ZOYA 1GOHA 2XL2A 3O4JA 1UOPA 4PBYA 5HE1B 4CI8A 5IJ8E 1L0QA 3K72A 1XIPA 2VDLA 5M61A 3EI4B 1XKSA 2QR5A 1VE7A 4AMZA 1I2MB 2XYIA 1ERJA 3RLMD 2IUQA 1B9XA 4A08A 3I7LA 3JZNA 4J79A 3UVOA 4CZXA 4JHNA 2OK6A 4PSXB 5K19A 4UM9A 5I5MA 4E54A 3BWSA 3FM0A 4RE6A 5IGOA 5TEEA 4BCCA 4XYIA 5E6SA 2YNOA 3DXMC 3J80g 4Y7RA 3I7KA 4CY3A 1H2ZA 4XYHA 4BH6A 3EU7A 1GG2B 3MZKA 4H5IA 1TYQC 1OMWB 2MTAH 3GC3B 2B4EA 3EQ7A 5HE2B 5K1CC 3UKUC 4GGDA 4L1QD 4D0KA 5AJAA 3PXWD 2VZ3A 5I5JA 4DNVA 2AGLA 4ESGA 3EMHA 4FHLA 3VH0A 3NVQA 5GMKn 3I89A 5CXCB 3DXKC 4O3UB 3NIGA 5HE0B 4FA4D 2IURA 3IJCA 4J8BA 4D9SA 4CZYA 4Z7NA 5H1MA 3ZE2A 3MKQA 3ORVD 4QL1A 3V9FA 3ZWLB 3OKYB 4J87A 1PBYB 1GP2B 3EQ9A 4JT6C 4UM8A 4JSPC 4Z8LA 5M5VA 4PSWB 2H9LA 2P9PC 4WJKA 4BCDA 1C9LA 2J55H 3UR4A 3VI4A 5C9ZB 4OWRA 4CI2A 2VDPA 5M5RA 4O02A 4JSNC 3EG6A 1N6DA 2GC4A 2HKRA 3NVNA 3T3MA 4CY1A 3IJ1A 5FFGA 3IUNA 3JAMg 4O3TB 2AGXA 4IRZA 4GGCA 3O4HA 5CYKB 2IUPA 4U7AA 3O4GA 4RE5A 1M1XA 3IVMA 3GREA 4IA9A 4LG8A 3EI4A 1GOFA 1K3IA 4MMZA 4BP8A 3C5MA 4GQBB 1H2WA 5TDHB 2VDKA 4QRJA 3UVNA 3PXSD 2G9AA 3SN6B 1VYHC 3IULA 1YFQA 4PXWA 2P9UC 1NR0A 5FA5B 3K6SA 3L4MD 1FWXA 4O9DA 2VZ1A 3I7HA 3DWLC 3PXTD 5IC7A 3DSMA 3CFVA 4PC0A 2XE4A 3KCIA 4J0XA 3FCSA 5M5TA 2CO0A 1JMZB 3SBQA 4G55A 4ERYA 1H2XA 3ODTA 3FCUA 1Q47A 5THAA 1BPOA 4X60B 5EAPA 3UVMA 1QNIA 3IUMA 3AL8B 4Z7QA 3ULEC 2PM7B 4JT5C 3IURA 5I5IA 5C92A 3EWEA 3IUQA 2PM6B 2TRCB 3DM0A 3PSCB 4H5JA 3PE7A 2HU5A 2W18A 2AQ5A 1E8MA 3JROA 4J86A 4PNKB 3OTTA 5CXCA 3P4FA 2OIZA 4UI9R 4BUJC 2GNQA 2PM9B 3UKRC 5AFU3 4G56B 2CE8A 2O9KA 3MKSB 4NBMA 2PBIB 4ZOXA 3V5WB 3JZHA 5E6UA 1L5GA 2OVPB 3SXTD 4L3GD 2BKLA 4A7JA 2I3TA 1RI6A 3IUJA 3FGBA 3QI0A 2OVQB 3ZDXA 4R7AB 4ZN4A 2H14A 2CNXA 4AOWA 3JZGA 3K27A 4AMYA 5EMMB 3V4PA 4BP9A 2CN2A 4FA1D 2IWKA 4A11B 2H6QA 1JV2A 3AL9A 3EI2A 2HXCA 1C9IA 1H2YA 5SXMA 3C75H 3NIDA 2H3XA 4O1QD 4QAMA 3I7NA 5CYKA 5EALA 4O45A 5HYNB 5C2VB 5CXBB 1PI6A 5FKRA 4J81A 3RN0D 4CY2A 1S4UX 1MG2A 2H47A 2P9LC 4QQEA 1SQJA 2VDQA 2B5MA 4ERZA 5C86A 3I8EA 2IAAA 1NEXB
chains in the Genus database with same CATH topology
5EM2B 4CC9A 5EARA 2AGYA 5HE3B 1PGUA 2HESX 3VA6A 5H17A 4GQ1A 2H68A 4I79A 2YBAA 2HJBA 4FA9D 5IGQA 2UZXB 2P9SC 4E54B 5FKTA 2UZYB 4X3EA 3E0CA 1GOTB 2I0SA 4J82A 3AL8A 4X61B 3NVXA 5KDOB 3SBPA 3OL2B 2P9IC 4FAND 2YB8B 2Q7QA 3I7OA 4PBZA 2H9NA 4JXMA 4Y5RD 3MXXA 3RFGA 2B5LA 3MMYA 1SQ9A 4N14A 4U1EI 3VGZA 4GZ8A 3C99A 3J81g 4GGAA 2XU7A 2PM9A 4A2MA 4ZOVA 2IWFA 2I0TA 4MK0B 2P9NC 1MDAH 3OKTA 4GM3A 3SJLD 5HQGA 3F3FA 3SBRA 2CE9A 3I2NA 5GSAA 3V7DB 2H6NA 2XL3A 2AH1A 3GFCA 3AH8B 4HDJA 3B7FA 3I8CA 1MG3A 2I3SA 3FRXA 4A11A 1U4CA 1JJUB 3N0EA 3OW8A 1XHMA 2AH0A 2EBSA 4CZVA 4A0AB 2AGZA 2J56H 3K26A 4A0BB 5CXBA 2YNPA 2HKMA 2H9PA 3OKYA 2CO0C 3C9CA 5EMJB 5FKQA 5AMSA 2G99A 4E5ZB 2Z2NA 1N6FA 3EI3B 5EM2A 3SFZA 2HYEA 4FA5D 5JWZA 3KRWB 4IMMA 2H13A 4FAVD 3I7PA 3PVUB 5FKSA 4EWRA 1K8KC 4FB1D 5FXYA 4ZOZA 1U2VC 4X63B 2IUVA 4D6VA 4J8GA 3BG0A 3IIYA 3OL2A 3EI1B 2AGWA 3RSEC 4KFMB 2OVRB 5IJ7E 1TBGA 3JRPA 3U4YA 4A09B 1A0RB 3L4OD 2BBKH 4K3ID 3SWSD 3JPXA 5EAMA 4AEZA 4J73A 2J57G 3OKWA 2OK4A 3SLED 4A2LA 2YMUA 5FLXg 3IKOA 1PEVA 3SMRA 5GXIA 4CY5A 3N0DA 3SCYA 1K32A 4A08B 4K3JB 5H14A 2H6KA 2H9MA 3HFQA 1GXRA 3IJ0A 4GQ2P 3JB9L 3MZLA 4TZ4A 5IT9g 3SHFA 2P9KC 3W15A 4ERQA 4J77A 5C2WB 1JMXB 3UVKA 4J84A 2YNNA 5FQDA 4LG9A 1N6EA 3AFCA 4NSXA 4A0AA 4CI3A 4J78A 2I0RA 4A0BA 1JOFA 5GXHA 3PVWB 3EI2B 4ES0A 1B9YA 4GM9A 3IIWA 5EMLB 4FWWA 2CN3A 3SVWD 4XEIC 5B4WA 5TF2A 3A0FA 5A2Qg 2OJYA 2Z2PA 3RRMC 3CFSB 2GC7A 4L9OA 4E5ZA 4LGNA 3EI3A 3RMZD 3F3PA 4CI1A 4QT8A 3UVLA 1R5MA 3CIKB 3PSLA 4JSVC 4OZUA 4GMBA 3F3GA 4JD2C 4JSXC 3RFHA 2QXVA 2HJ4A 4YVDA 2BCJB 5EMKB 3KRXB 4J0WA 4BL0A 3RN1D 2B5NA 4L3HD 1P22A 2QC5A 5TEFA 3EI1A 2Z2OA 3BG1A 1SHYB 1OLZA 4A09A 4GM8A 4ZOYA 4PBYA 2XL2A 5HE1B 4CI8A 5IJ8E 1L0QA 1XIPA 3EI4B 1XKSA 2XYIA 1ERJA 3RLMD 2IUQA 1B9XA 4A08A 3I7LA 3JZNA 4J79A 3UVOA 4CZXA 2OK6A 4PSXB 5K19A 5I5MA 4E54A 3BWSA 3FM0A 5IGOA 5TEEA 4XYIA 2YNOA 3DXMC 3J80g 4Y7RA 3I7KA 4CY3A 4XYHA 4BH6A 3EU7A 1GG2B 3MZKA 4H5IA 1TYQC 1OMWB 2MTAH 2B4EA 5HE2B 5K1CC 3UKUC 4GGDA 4L1QD 4D0KA 5AJAA 3PXWD 5I5JA 2AGLA 4ESGA 3EMHA 4FHLA 3VH0A 3NVQA 5GMKn 3I89A 5CXCB 3DXKC 4O3UB 5HE0B 4FA4D 2IURA 3IJCA 4J8BA 4CZYA 5H1MA 3MKQA 3ORVD 4QL1A 3V9FA 3ZWLB 3OKYB 4J87A 1PBYB 1GP2B 4JT6C 4JSPC 4Z8LA 4PSWB 2H9LA 2P9PC 2J55H 3UR4A 5C9ZB 4OWRA 4CI2A 4JSNC 3EG6A 1N6DA 2GC4A 2HKRA 3NVNA 4CY1A 3IJ1A 3JAMg 4O3TB 2AGXA 4GGCA 5CYKB 2IUPA 4U7AA 3GREA 4LG8A 4IA9A 3EI4A 3C5MA 4GQBB 5TDHB 4QRJA 3UVNA 3PXSD 2G9AA 3SN6B 1VYHC 1YFQA 4PXWA 2P9UC 1NR0A 5FA5B 3L4MD 1FWXA 4O9DA 3I7HA 3DWLC 3PXTD 5IC7A 3DSMA 3CFVA 4PC0A 4J0XA 2CO0A 1JMZB 3SBQA 4ERYA 3ODTA 1Q47A 5THAA 4X60B 5EAPA 3UVMA 1QNIA 3AL8B 3ULEC 2PM7B 4JT5C 5I5IA 3EWEA 2PM6B 2TRCB 3DM0A 3PSCB 4H5JA 3PE7A 2W18A 2AQ5A 3JROA 4J86A 4PNKB 3OTTA 5CXCA 3P4FA 2OIZA 4UI9R 4BUJC 2GNQA 2PM9B 3UKRC 5AFU3 4G56B 2CE8A 2O9KA 3MKSB 4ZOXA 2PBIB 3V5WB 3JZHA 3SXTD 2OVPB 4L3GD 4A7JA 2I3TA 1RI6A 3FGBA 2OVQB 4ZN4A 4R7AB 2H14A 2CNXA 4AOWA 3JZGA 3K27A 5EMMB 2CN2A 4FA1D 2IWKA 4A11B 2H6QA 3AL9A 3EI2A 2HXCA 5SXMA 3C75H 2H3XA 4O1QD 5CYKA 3I7NA 5EALA 4O45A 5HYNB 5C2VB 5CXBB 1PI6A 5FKRA 4J81A 3RN0D 4CY2A 1S4UX 1MG2A 2H47A 2P9LC 4QQEA 1SQJA 2B5MA 4ERZA 3I8EA 2IAAA 1NEXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EM2 B;  4CC9 A;  5EAR A;  2AGY A;  5HE3 B;  1PGU A;  2HES X;  3VA6 A;  5H17 A;  4GQ1 A;  2H68 A;  4I79 A;  2YBA A;  2HJB A;  4FA9 D;  5IGQ A;  2UZX B;  2P9S C;  4E54 B;  5FKT A;  2UZY B;  4X3E A;  3E0C A;  1GOT B;  2I0S A;  4J82 A;  3AL8 A;  4X61 B;  3NVX A;  5KDO B;  3SBP A;  3OL2 B;  2P9I C;  4FAN D;  2YB8 B;  2Q7Q A;  3I7O A;  4PBZ A;  2H9N A;  4JXM A;  4Y5R D;  3MXX A;  3RFG A;  2B5L A;  3MMY A;  1SQ9 A;  4N14 A;  4U1E I;  3VGZ A;  4GZ8 A;  3C99 A;  3J81 g;  4GGA A;  2XU7 A;  2PM9 A;  4A2M A;  4ZOV A;  2IWF A;  2I0T A;  4MK0 B;  2P9N C;  1MDA H;  3OKT A;  4GM3 A;  3SJL D;  5HQG A;  3F3F A;  3SBR A;  2CE9 A;  3I2N A;  5GSA A;  3V7D B;  2H6N A;  2XL3 A;  2AH1 A;  3GFC A;  3AH8 B;  4HDJ A;  3B7F A;  3I8C A;  1MG3 A;  2I3S A;  3FRX A;  4A11 A;  1U4C A;  1JJU B;  3N0E A;  3OW8 A;  1XHM A;  2AH0 A;  2EBS A;  4CZV A;  4A0A B;  2AGZ A;  2J56 H;  3K26 A;  4A0B B;  5CXB A;  2YNP A;  2HKM A;  2H9P A;  3OKY A;  2CO0 C;  3C9C A;  5EMJ B;  5FKQ A;  5AMS A;  2G99 A;  4E5Z B;  2Z2N A;  1N6F A;  3EI3 B;  5EM2 A;  3SFZ A;  2HYE A;  4FA5 D;  5JWZ A;  3KRW B;  4IMM A;  2H13 A;  4FAV D;  3I7P A;  3PVU B;  5FKS A;  4EWR A;  1K8K C;  4FB1 D;  5FXY A;  4ZOZ A;  1U2V C;  4X63 B;  2IUV A;  4D6V A;  4J8G A;  3BG0 A;  3IIY A;  3OL2 A;  3EI1 B;  2AGW A;  3RSE C;  4KFM B;  2OVR B;  5IJ7 E;  1TBG A;  3JRP A;  3U4Y A;  4A09 B;  1A0R B;  3L4O D;  2BBK H;  4K3I D;  3SWS D;  3JPX A;  5EAM A;  4AEZ A;  4J73 A;  2J57 G;  3OKW A;  2OK4 A;  3SLE D;  4A2L A;  2YMU A;  5FLX g;  3IKO A;  1PEV A;  3SMR A;  5GXI A;  4CY5 A;  3N0D A;  3SCY A;  1K32 A;  4A08 B;  4K3J B;  5H14 A;  2H6K A;  2H9M A;  3HFQ A;  1GXR A;  3IJ0 A;  4GQ2 P;  3JB9 L;  3MZL A;  4TZ4 A;  5IT9 g;  3SHF A;  2P9K C;  3W15 A;  4ERQ A;  4J77 A;  5C2W B;  1JMX B;  3UVK A;  4J84 A;  2YNN A;  5FQD A;  4LG9 A;  1N6E A;  3AFC A;  4NSX A;  4A0A A;  4CI3 A;  4J78 A;  2I0R A;  4A0B A;  1JOF A;  5GXH A;  3PVW B;  3EI2 B;  4ES0 A;  1B9Y A;  4GM9 A;  3IIW A;  5EML B;  4FWW A;  2CN3 A;  3SVW D;  4XEI C;  5B4W A;  5TF2 A;  3A0F A;  5A2Q g;  2OJY A;  2Z2P A;  3RRM C;  3CFS B;  2GC7 A;  4L9O A;  4E5Z A;  4LGN A;  3EI3 A;  3RMZ D;  3F3P A;  4CI1 A;  4QT8 A;  3UVL A;  1R5M A;  3CIK B;  3PSL A;  4JSV C;  4OZU A;  4GMB A;  3F3G A;  4JD2 C;  4JSX C;  3RFH A;  2QXV A;  2HJ4 A;  4YVD A;  2BCJ B;  5EMK B;  3KRX B;  4J0W A;  4BL0 A;  3RN1 D;  2B5N A;  4L3H D;  1P22 A;  2QC5 A;  5TEF A;  3EI1 A;  2Z2O A;  3BG1 A;  1SHY B;  1OLZ A;  4A09 A;  4GM8 A;  4ZOY A;  4PBY A;  2XL2 A;  5HE1 B;  4CI8 A;  5IJ8 E;  1L0Q A;  1XIP A;  3EI4 B;  1XKS A;  2XYI A;  1ERJ A;  3RLM D;  2IUQ A;  1B9X A;  4A08 A;  3I7L A;  3JZN A;  4J79 A;  3UVO A;  4CZX A;  2OK6 A;  4PSX B;  5K19 A;  5I5M A;  4E54 A;  3BWS A;  3FM0 A;  5IGO A;  5TEE A;  4XYI A;  2YNO A;  3DXM C;  3J80 g;  4Y7R A;  3I7K A;  4CY3 A;  4XYH A;  4BH6 A;  3EU7 A;  1GG2 B;  3MZK A;  4H5I A;  1TYQ C;  1OMW B;  2MTA H;  2B4E A;  5HE2 B;  5K1C C;  3UKU C;  4GGD A;  4L1Q D;  4D0K A;  5AJA A;  3PXW D;  5I5J A;  2AGL A;  4ESG A;  3EMH A;  4FHL A;  3VH0 A;  3NVQ A;  5GMK n;  3I89 A;  5CXC B;  3DXK C;  4O3U B;  5HE0 B;  4FA4 D;  2IUR A;  3IJC A;  4J8B A;  4CZY A;  5H1M A;  3MKQ A;  3ORV D;  4QL1 A;  3V9F A;  3ZWL B;  3OKY B;  4J87 A;  1PBY B;  1GP2 B;  4JT6 C;  4JSP C;  4Z8L A;  4PSW B;  2H9L A;  2P9P C;  2J55 H;  3UR4 A;  5C9Z B;  4OWR A;  4CI2 A;  4JSN C;  3EG6 A;  1N6D A;  2GC4 A;  2HKR A;  3NVN A;  4CY1 A;  3IJ1 A;  3JAM g;  4O3T B;  2AGX A;  4GGC A;  5CYK B;  2IUP A;  4U7A A;  3GRE A;  4LG8 A;  4IA9 A;  3EI4 A;  3C5M A;  4GQB B;  5TDH B;  4QRJ A;  3UVN A;  3PXS D;  2G9A A;  3SN6 B;  1VYH C;  1YFQ A;  4PXW A;  2P9U C;  1NR0 A;  5FA5 B;  3L4M D;  1FWX A;  4O9D A;  3I7H A;  3DWL C;  3PXT D;  5IC7 A;  3DSM A;  3CFV A;  4PC0 A;  4J0X A;  2CO0 A;  1JMZ B;  3SBQ A;  4ERY A;  3ODT A;  1Q47 A;  5THA A;  4X60 B;  5EAP A;  3UVM A;  1QNI A;  3AL8 B;  3ULE C;  2PM7 B;  4JT5 C;  5I5I A;  3EWE A;  2PM6 B;  2TRC B;  3DM0 A;  3PSC B;  4H5J A;  3PE7 A;  2W18 A;  2AQ5 A;  3JRO A;  4J86 A;  4PNK B;  3OTT A;  5CXC A;  3P4F A;  2OIZ A;  4UI9 R;  4BUJ C;  2GNQ A;  2PM9 B;  3UKR C;  5AFU 3;  4G56 B;  2CE8 A;  2O9K A;  3MKS B;  4ZOX A;  2PBI B;  3V5W B;  3JZH A;  3SXT D;  2OVP B;  4L3G D;  4A7J A;  2I3T A;  1RI6 A;  3FGB A;  2OVQ B;  4ZN4 A;  4R7A B;  2H14 A;  2CNX A;  4AOW A;  3JZG A;  3K27 A;  5EMM B;  2CN2 A;  4FA1 D;  2IWK A;  4A11 B;  2H6Q A;  3AL9 A;  3EI2 A;  2HXC A;  5SXM A;  3C75 H;  2H3X A;  4O1Q D;  5CYK A;  3I7N A;  5EAL A;  4O45 A;  5HYN B;  5C2V B;  5CXB B;  1PI6 A;  5FKR A;  4J81 A;  3RN0 D;  4CY2 A;  1S4U X;  1MG2 A;  2H47 A;  2P9L C;  4QQE A;  1SQJ A;  2B5M A;  4ERZ A;  3I8E A;  2IAA A;  1NEX B; 
#chains in the Genus database with same CATH topology
 5EM2 B;  4CC9 A;  5EAR A;  2AGY A;  5HE3 B;  1O6G A;  1PGU A;  1UOQ A;  2HES X;  5H17 A;  3VA6 A;  4GQ1 A;  2H68 A;  4I79 A;  2HU8 A;  2VDN A;  2YBA A;  2HJB A;  4FA9 D;  5IGQ A;  2UZX B;  2P9S C;  4E54 B;  5FKT A;  2UZY B;  4X3E A;  3E0C A;  1GOT B;  2QZP A;  2I0S A;  4J82 A;  5HDB A;  3AL8 A;  1E8N A;  3NVX A;  4X61 B;  5KDO B;  3SBP A;  3OL2 B;  2P9I C;  4JHP C;  4FAN D;  2YB8 B;  2Q7Q A;  3I7O A;  4PBZ A;  2H9N A;  4JXM A;  4Y5R D;  2HU7 A;  3MXX A;  3RFG A;  2B5L A;  2JKX A;  3MMY A;  1SQ9 A;  4N14 A;  4U1E I;  3VGZ A;  4GZ8 A;  1JTD B;  3C99 A;  3IJE A;  3NIF A;  3J81 g;  4GGA A;  2XU7 A;  1VZ3 A;  2PM9 A;  4A2M A;  4ZOV A;  2EIB A;  3GD1 I;  2IWF A;  2I0T A;  2XDW A;  4MK0 B;  2P9N C;  1MDA H;  3OKT A;  3ZDZ A;  4GM3 A;  3SJL D;  5HQG A;  3F3F A;  5FFO A;  3ZDY A;  3SBR A;  2CE9 A;  3I2N A;  5GSA A;  3V7D B;  3O4I A;  2H6N A;  2XL3 A;  2AH1 A;  4DNU A;  3GFC A;  4G1E A;  3AH8 B;  1YR2 A;  4HDJ A;  3B7F A;  3T3P A;  2WQ8 A;  3I8C A;  1MG3 A;  2I3S A;  3FRX A;  4A11 A;  1U4C A;  1JJU B;  3N0E A;  3OW8 A;  1XHM A;  3ZE0 A;  4MMY A;  2AH0 A;  2EBS A;  4CZV A;  3MUN A;  4A0A B;  2AGZ A;  2J56 H;  3K26 A;  3QHY B;  3K71 A;  4L1M A;  4A0B B;  1VZ2 A;  2EIC A;  5CXB A;  2YNP A;  2HKM A;  2H9P A;  3ZE1 A;  3OKY A;  2CO0 C;  3C9C A;  5EMJ B;  5FKQ A;  5AMS A;  4WK0 A;  2G99 A;  4E5Z B;  2Z2N A;  1N6F A;  3EI3 B;  1O6F A;  5EM2 A;  3SFZ A;  2HYE A;  4FA5 D;  5JWZ A;  3KRW B;  4IMM A;  2H13 A;  4FAV D;  3I7P A;  3PVU B;  5FKS A;  4EWR A;  1K8K C;  4FB1 D;  5FXY A;  3MVD K;  2VDO A;  4ZOZ A;  3DDU A;  1U2V C;  4X63 B;  2IUV A;  4D6V A;  1UTC A;  4J8G A;  5M5S A;  3BG0 A;  3IIY A;  3OL2 A;  3EI1 B;  2AGW A;  4AN0 A;  3RSE C;  4NEN A;  4KFM B;  2OVR B;  3OF7 A;  5IJ7 E;  1TBG A;  2EIE A;  3JRP A;  3U4Y A;  4A09 B;  4DNW A;  1A0R B;  3L4O D;  2BBK H;  4K3I D;  3SWS D;  3JPX A;  5EAM A;  4AEZ A;  4J73 A;  2J57 G;  3OKW A;  2OK4 A;  3SLE D;  4A2L A;  2YMU A;  5FLX g;  2VC2 A;  3IKO A;  1PEV A;  3SMR A;  5GXI A;  4CY5 A;  3V4V A;  3N0D A;  3SCY A;  1K32 A;  2VDR A;  4A08 B;  4K3J B;  5H14 A;  2H6K A;  2H9M A;  3HFQ A;  1GXR A;  3IJ0 A;  4GQ2 P;  3JB9 L;  4Z7O A;  3MZL A;  4TZ4 A;  4WK2 A;  5IT9 g;  3SHF A;  2P9K C;  5E6R A;  3W15 A;  4ERQ A;  4J77 A;  4AX4 A;  1QFS A;  5C2W B;  1JMX B;  5M5U A;  3UVK A;  4J84 A;  2YNN A;  3VI3 A;  5FQD A;  1VE6 A;  1T2X A;  1N6E A;  4G1M A;  4LG9 A;  3AFC A;  1U8C A;  1E5T A;  4NSX A;  4CI3 A;  4A0A A;  4J78 A;  2I0R A;  4A0B A;  1JOF A;  5GXH A;  3PVW B;  3EI2 B;  4ES0 A;  3EQ8 A;  1B9Y A;  4GM9 A;  1TYE A;  3IIW A;  4MMX A;  5EML B;  4BCB A;  4NAA A;  4FWW A;  2CN3 A;  3SVW D;  1A12 A;  4XEI C;  5B4W A;  5TF2 A;  3A0F A;  5A2Q g;  2OJY A;  2Z2P A;  3RRM C;  3CFS B;  2GC7 A;  4L9O A;  4E5Z A;  4LGN A;  3EI3 A;  1GOG A;  4WK4 A;  3RMZ D;  3F3P A;  4CI1 A;  4QT8 A;  3UVL A;  1R5M A;  3CIK B;  3PSL A;  4JSV C;  4OZU A;  4AN1 A;  4GMB A;  3F3G A;  4JD2 C;  4JSX C;  3RFH A;  2QXV A;  2HJ4 A;  4YVD A;  2VDM A;  2BCJ B;  4O2W A;  5EMK B;  3KRX B;  4J0W A;  4BL0 A;  2EID A;  4NC4 A;  3RN1 D;  3MUO A;  2B5N A;  4L3H D;  1P22 A;  2QC5 A;  5TEF A;  3EI1 A;  1UOO A;  1QFM A;  2XZG A;  2Z2O A;  3BG1 A;  1SHY B;  1OLZ A;  4A09 A;  4GM8 A;  4ZOY A;  1GOH A;  2XL2 A;  3O4J A;  1UOP A;  4PBY A;  5HE1 B;  4CI8 A;  5IJ8 E;  1L0Q A;  3K72 A;  1XIP A;  2VDL A;  5M61 A;  3EI4 B;  1XKS A;  2QR5 A;  1VE7 A;  4AMZ A;  1I2M B;  2XYI A;  1ERJ A;  3RLM D;  2IUQ A;  1B9X A;  4A08 A;  3I7L A;  3JZN A;  4J79 A;  3UVO A;  4CZX A;  4JHN A;  2OK6 A;  4PSX B;  5K19 A;  4UM9 A;  5I5M A;  4E54 A;  3BWS A;  3FM0 A;  4RE6 A;  5IGO A;  5TEE A;  4BCC A;  4XYI A;  5E6S A;  2YNO A;  3DXM C;  3J80 g;  4Y7R A;  3I7K A;  4CY3 A;  1H2Z A;  4XYH A;  4BH6 A;  3EU7 A;  1GG2 B;  3MZK A;  4H5I A;  1TYQ C;  1OMW B;  2MTA H;  3GC3 B;  2B4E A;  3EQ7 A;  5HE2 B;  5K1C C;  3UKU C;  4GGD A;  4L1Q D;  4D0K A;  5AJA A;  3PXW D;  2VZ3 A;  5I5J A;  4DNV A;  2AGL A;  4ESG A;  3EMH A;  4FHL A;  3VH0 A;  3NVQ A;  5GMK n;  3I89 A;  5CXC B;  3DXK C;  4O3U B;  3NIG A;  5HE0 B;  4FA4 D;  2IUR A;  3IJC A;  4J8B A;  4D9S A;  4CZY A;  4Z7N A;  5H1M A;  3ZE2 A;  3MKQ A;  3ORV D;  4QL1 A;  3V9F A;  3ZWL B;  3OKY B;  4J87 A;  1PBY B;  1GP2 B;  3EQ9 A;  4JT6 C;  4UM8 A;  4JSP C;  4Z8L A;  5M5V A;  4PSW B;  2H9L A;  2P9P C;  4WJK A;  4BCD A;  1C9L A;  2J55 H;  3UR4 A;  3VI4 A;  5C9Z B;  4OWR A;  4CI2 A;  2VDP A;  5M5R A;  4O02 A;  4JSN C;  3EG6 A;  1N6D A;  2GC4 A;  2HKR A;  3NVN A;  3T3M A;  4CY1 A;  3IJ1 A;  5FFG A;  3IUN A;  3JAM g;  4O3T B;  2AGX A;  4IRZ A;  4GGC A;  3O4H A;  5CYK B;  2IUP A;  4U7A A;  3O4G A;  4RE5 A;  1M1X A;  3IVM A;  3GRE A;  4IA9 A;  4LG8 A;  3EI4 A;  1GOF A;  1K3I A;  4MMZ A;  4BP8 A;  3C5M A;  4GQB B;  1H2W A;  5TDH B;  2VDK A;  4QRJ A;  3UVN A;  3PXS D;  2G9A A;  3SN6 B;  1VYH C;  3IUL A;  1YFQ A;  4PXW A;  2P9U C;  1NR0 A;  5FA5 B;  3K6S A;  3L4M D;  1FWX A;  4O9D A;  2VZ1 A;  3I7H A;  3DWL C;  3PXT D;  5IC7 A;  3DSM A;  3CFV A;  4PC0 A;  2XE4 A;  3KCI A;  4J0X A;  3FCS A;  5M5T A;  2CO0 A;  1JMZ B;  3SBQ A;  4G55 A;  4ERY A;  1H2X A;  3ODT A;  3FCU A;  1Q47 A;  5THA A;  1BPO A;  4X60 B;  5EAP A;  3UVM A;  1QNI A;  3IUM A;  3AL8 B;  4Z7Q A;  3ULE C;  2PM7 B;  4JT5 C;  3IUR A;  5I5I A;  5C92 A;  3EWE A;  3IUQ A;  2PM6 B;  2TRC B;  3DM0 A;  3PSC B;  4H5J A;  3PE7 A;  2HU5 A;  2W18 A;  2AQ5 A;  1E8M A;  3JRO A;  4J86 A;  4PNK B;  3OTT A;  5CXC A;  3P4F A;  2OIZ A;  4UI9 R;  4BUJ C;  2GNQ A;  2PM9 B;  3UKR C;  5AFU 3;  4G56 B;  2CE8 A;  2O9K A;  3MKS B;  4NBM A;  2PBI B;  4ZOX A;  3V5W B;  3JZH A;  5E6U A;  1L5G A;  2OVP B;  3SXT D;  4L3G D;  2BKL A;  4A7J A;  2I3T A;  1RI6 A;  3IUJ A;  3FGB A;  3QI0 A;  2OVQ B;  3ZDX A;  4R7A B;  4ZN4 A;  2H14 A;  2CNX A;  4AOW A;  3JZG A;  3K27 A;  4AMY A;  5EMM B;  3V4P A;  4BP9 A;  2CN2 A;  4FA1 D;  2IWK A;  4A11 B;  2H6Q A;  1JV2 A;  3AL9 A;  3EI2 A;  2HXC A;  1C9I A;  1H2Y A;  5SXM A;  3C75 H;  3NID A;  2H3X A;  4O1Q D;  4QAM A;  3I7N A;  5CYK A;  5EAL A;  4O45 A;  5HYN B;  5C2V B;  5CXB B;  1PI6 A;  5FKR A;  4J81 A;  3RN0 D;  4CY2 A;  1S4U X;  1MG2 A;  2H47 A;  2P9L C;  4QQE A;  1SQJ A;  2VDQ A;  2B5M A;  4ERZ A;  5C86 A;  3I8E A;  2IAA A;  1NEX B; 
#chains in the Genus database with same CATH homology
 5EM2 B;  4CC9 A;  5EAR A;  2AGY A;  5HE3 B;  1PGU A;  2HES X;  3VA6 A;  5H17 A;  4GQ1 A;  2H68 A;  4I79 A;  2YBA A;  2HJB A;  4FA9 D;  5IGQ A;  2UZX B;  2P9S C;  4E54 B;  5FKT A;  2UZY B;  4X3E A;  3E0C A;  1GOT B;  2I0S A;  4J82 A;  3AL8 A;  4X61 B;  3NVX A;  5KDO B;  3SBP A;  3OL2 B;  2P9I C;  4FAN D;  2YB8 B;  2Q7Q A;  3I7O A;  4PBZ A;  2H9N A;  4JXM A;  4Y5R D;  3MXX A;  3RFG A;  2B5L A;  3MMY A;  1SQ9 A;  4N14 A;  4U1E I;  3VGZ A;  4GZ8 A;  3C99 A;  3J81 g;  4GGA A;  2XU7 A;  2PM9 A;  4A2M A;  4ZOV A;  2IWF A;  2I0T A;  4MK0 B;  2P9N C;  1MDA H;  3OKT A;  4GM3 A;  3SJL D;  5HQG A;  3F3F A;  3SBR A;  2CE9 A;  3I2N A;  5GSA A;  3V7D B;  2H6N A;  2XL3 A;  2AH1 A;  3GFC A;  3AH8 B;  4HDJ A;  3B7F A;  3I8C A;  1MG3 A;  2I3S A;  3FRX A;  4A11 A;  1U4C A;  1JJU B;  3N0E A;  3OW8 A;  1XHM A;  2AH0 A;  2EBS A;  4CZV A;  4A0A B;  2AGZ A;  2J56 H;  3K26 A;  4A0B B;  5CXB A;  2YNP A;  2HKM A;  2H9P A;  3OKY A;  2CO0 C;  3C9C A;  5EMJ B;  5FKQ A;  5AMS A;  2G99 A;  4E5Z B;  2Z2N A;  1N6F A;  3EI3 B;  5EM2 A;  3SFZ A;  2HYE A;  4FA5 D;  5JWZ A;  3KRW B;  4IMM A;  2H13 A;  4FAV D;  3I7P A;  3PVU B;  5FKS A;  4EWR A;  1K8K C;  4FB1 D;  5FXY A;  4ZOZ A;  1U2V C;  4X63 B;  2IUV A;  4D6V A;  4J8G A;  3BG0 A;  3IIY A;  3OL2 A;  3EI1 B;  2AGW A;  3RSE C;  4KFM B;  2OVR B;  5IJ7 E;  1TBG A;  3JRP A;  3U4Y A;  4A09 B;  1A0R B;  3L4O D;  2BBK H;  4K3I D;  3SWS D;  3JPX A;  5EAM A;  4AEZ A;  4J73 A;  2J57 G;  3OKW A;  2OK4 A;  3SLE D;  4A2L A;  2YMU A;  5FLX g;  3IKO A;  1PEV A;  3SMR A;  5GXI A;  4CY5 A;  3N0D A;  3SCY A;  1K32 A;  4A08 B;  4K3J B;  5H14 A;  2H6K A;  2H9M A;  3HFQ A;  1GXR A;  3IJ0 A;  4GQ2 P;  3JB9 L;  3MZL A;  4TZ4 A;  5IT9 g;  3SHF A;  2P9K C;  3W15 A;  4ERQ A;  4J77 A;  5C2W B;  1JMX B;  3UVK A;  4J84 A;  2YNN A;  5FQD A;  4LG9 A;  1N6E A;  3AFC A;  4NSX A;  4A0A A;  4CI3 A;  4J78 A;  2I0R A;  4A0B A;  1JOF A;  5GXH A;  3PVW B;  3EI2 B;  4ES0 A;  1B9Y A;  4GM9 A;  3IIW A;  5EML B;  4FWW A;  2CN3 A;  3SVW D;  4XEI C;  5B4W A;  5TF2 A;  3A0F A;  5A2Q g;  2OJY A;  2Z2P A;  3RRM C;  3CFS B;  2GC7 A;  4L9O A;  4E5Z A;  4LGN A;  3EI3 A;  3RMZ D;  3F3P A;  4CI1 A;  4QT8 A;  3UVL A;  1R5M A;  3CIK B;  3PSL A;  4JSV C;  4OZU A;  4GMB A;  3F3G A;  4JD2 C;  4JSX C;  3RFH A;  2QXV A;  2HJ4 A;  4YVD A;  2BCJ B;  5EMK B;  3KRX B;  4J0W A;  4BL0 A;  3RN1 D;  2B5N A;  4L3H D;  1P22 A;  2QC5 A;  5TEF A;  3EI1 A;  2Z2O A;  3BG1 A;  1SHY B;  1OLZ A;  4A09 A;  4GM8 A;  4ZOY A;  4PBY A;  2XL2 A;  5HE1 B;  4CI8 A;  5IJ8 E;  1L0Q A;  1XIP A;  3EI4 B;  1XKS A;  2XYI A;  1ERJ A;  3RLM D;  2IUQ A;  1B9X A;  4A08 A;  3I7L A;  3JZN A;  4J79 A;  3UVO A;  4CZX A;  2OK6 A;  4PSX B;  5K19 A;  5I5M A;  4E54 A;  3BWS A;  3FM0 A;  5IGO A;  5TEE A;  4XYI A;  2YNO A;  3DXM C;  3J80 g;  4Y7R A;  3I7K A;  4CY3 A;  4XYH A;  4BH6 A;  3EU7 A;  1GG2 B;  3MZK A;  4H5I A;  1TYQ C;  1OMW B;  2MTA H;  2B4E A;  5HE2 B;  5K1C C;  3UKU C;  4GGD A;  4L1Q D;  4D0K A;  5AJA A;  3PXW D;  5I5J A;  2AGL A;  4ESG A;  3EMH A;  4FHL A;  3VH0 A;  3NVQ A;  5GMK n;  3I89 A;  5CXC B;  3DXK C;  4O3U B;  5HE0 B;  4FA4 D;  2IUR A;  3IJC A;  4J8B A;  4CZY A;  5H1M A;  3MKQ A;  3ORV D;  4QL1 A;  3V9F A;  3ZWL B;  3OKY B;  4J87 A;  1PBY B;  1GP2 B;  4JT6 C;  4JSP C;  4Z8L A;  4PSW B;  2H9L A;  2P9P C;  2J55 H;  3UR4 A;  5C9Z B;  4OWR A;  4CI2 A;  4JSN C;  3EG6 A;  1N6D A;  2GC4 A;  2HKR A;  3NVN A;  4CY1 A;  3IJ1 A;  3JAM g;  4O3T B;  2AGX A;  4GGC A;  5CYK B;  2IUP A;  4U7A A;  3GRE A;  4LG8 A;  4IA9 A;  3EI4 A;  3C5M A;  4GQB B;  5TDH B;  4QRJ A;  3UVN A;  3PXS D;  2G9A A;  3SN6 B;  1VYH C;  1YFQ A;  4PXW A;  2P9U C;  1NR0 A;  5FA5 B;  3L4M D;  1FWX A;  4O9D A;  3I7H A;  3DWL C;  3PXT D;  5IC7 A;  3DSM A;  3CFV A;  4PC0 A;  4J0X A;  2CO0 A;  1JMZ B;  3SBQ A;  4ERY A;  3ODT A;  1Q47 A;  5THA A;  4X60 B;  5EAP A;  3UVM A;  1QNI A;  3AL8 B;  3ULE C;  2PM7 B;  4JT5 C;  5I5I A;  3EWE A;  2PM6 B;  2TRC B;  3DM0 A;  3PSC B;  4H5J A;  3PE7 A;  2W18 A;  2AQ5 A;  3JRO A;  4J86 A;  4PNK B;  3OTT A;  5CXC A;  3P4F A;  2OIZ A;  4UI9 R;  4BUJ C;  2GNQ A;  2PM9 B;  3UKR C;  5AFU 3;  4G56 B;  2CE8 A;  2O9K A;  3MKS B;  4ZOX A;  2PBI B;  3V5W B;  3JZH A;  3SXT D;  2OVP B;  4L3G D;  4A7J A;  2I3T A;  1RI6 A;  3FGB A;  2OVQ B;  4ZN4 A;  4R7A B;  2H14 A;  2CNX A;  4AOW A;  3JZG A;  3K27 A;  5EMM B;  2CN2 A;  4FA1 D;  2IWK A;  4A11 B;  2H6Q A;  3AL9 A;  3EI2 A;  2HXC A;  5SXM A;  3C75 H;  2H3X A;  4O1Q D;  5CYK A;  3I7N A;  5EAL A;  4O45 A;  5HYN B;  5C2V B;  5CXB B;  1PI6 A;  5FKR A;  4J81 A;  3RN0 D;  4CY2 A;  1S4U X;  1MG2 A;  2H47 A;  2P9L C;  4QQE A;  1SQJ A;  2B5M A;  4ERZ A;  3I8E A;  2IAA A;  1NEX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...