4CY2A

Crystal structure of the kansl1-wdr5-kansl2 complex.
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords WD REPEAT-CONTAINING PROTEIN 5
publication title Structural Analysis of the Kansl1/Wdr5/Kansl2 Complex Reveals that Wdr5 is Required for Efficient Assembly and Chromatin Targeting of the Nsl Complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 102
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2014-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4cy2A00
1FWXA 1JMZB 2UZYB 5C2WB 4Y7RA 3IIYA 3EU7A 3BG1A 5FLXg 3V7DB 3JZNA 3GFCA 5FKRA 5FKQA 2XL2A 3UKRC 2OIZA 5TEEA 3PXTD 5FXYA 2IWKA 4GZ8A 4A08A 1N6EA 3K26A 3AFCA 3I7HA 2P9UC 3SBPA 4CI2A 5SXMA 5TF2A 2YNNA 4LG8A 1NEXB 2OVQB 3SMRA 4OZUA 2AGLA 4GGDA 4J82A 3CIKB 3FGBA 4NSXA 3BWSA 4A09B 1B9YA 2PBIB 5TDHB 2P9IC 4O1QD 3OL2A 4UI9R 4Y5RD 1MDAH 4O9DA 3E0CA 4O45A 4BH6A 4ESGA 3EI1B 2Q7QA 4H5IA 2Z2PA 3RFGA 3PVWB 3I7LA 5EMKB 2PM9A 2H9NA 4PBYA 1JJUB 3SWSD 3OW8A 4A0BB 5K19A 3F3GA 3FM0A 4FA1D 4E5ZB 4PSWB 2CE9A 2OK6A 3OKYA 4ERYA 1K32A 2HJBA 2CO0A 4O3TB 4PXWA 4X61B 2P9PC 5CXBA 3PSLA 1OLZA 1Q47A 2YB8B 3EMHA 3V5WB 1N6FA 5EAMA 1A0RB 2XL3A 3UKUC 4L3GD 1L0QA 2HXCA 4A11A 2IURA 3JPXA 5B4WA 1TBGA 5AMSA 5A2Qg 3PXWD 5IGOA 4QT8A 1U4CA 3W15A 3L4OD 2G9AA 4LGNA 4CZVA 3EI4A 2I3SA 3F3FA 4X63B 1SQ9A 3PE7A 3EI3B 5IJ7E 3JB9L 1MG2A 2XYIA 2G99A 3KRWB 3UVLA 4FAVD 4CI8A 3RFHA 2CO0C 5HE3B 4FA4D 3NVXA 2B5LA 4I79A 2MTAH 1VYHC 3I8CA 3N0DA 4PSXB 1ERJA 3C5MA 2Z2OA 4CC9A 3V9FA 4CZYA 4GM9A 3RRMC 5JWZA 2CNXA 4CZXA 4L9OA 2GC7A 3ORVD 4GGAA 2CN3A 3MKSB 3KRXB 3OTTA 3K27A 4ERQA 4A7JA 2HKMA 2H6QA 4J77A 3IKOA 5C2VB 4ZOZA 4EWRA 3RN1D 3UVNA 2J57G 1GG2B 4IA9A 4JT5C 1NR0A 3DXMC 1QNIA 4X60B 5TEFA 1PGUA 2CE8A 2H13A 2H3XA 3JZGA 3VA6A 5EM2B 5C9ZB 4JSPC 3MXXA 2B5MA 3MMYA 4E54A 3ULEC 4GGCA 4LG9A 4FA9D 1PI6A 2H9LA 5I5JA 3U4YA 3P4FA 5EARA 3I7OA 5H17A 2AGYA 3OL2B 3SXTD 3SBQA 3C75H 4A0AB 2PM9B 1GOTB 2J55H 5IJ8E 4QRJA 3I7NA 1R5MA 3DXKC 4JD2C 5CYKA 2QC5A 4GM8A 5EMJB 4BL0A 3EI2A 3PXSD 2I0SA 3OKYB 3C9CA 2HKRA 2QXVA 3L4MD 1MG3A 3DM0A 4J81A 4QL1A 4GQ2P 1SQJA 3JAMg 2P9NC 5CXBB 3I2NA 3C99A 4N14A 4J8GA 3DWLC 4JXMA 3AL8A 3RLMD 4A11B 4GQ1A 4K3JB 2IUPA 3RMZD 4YVDA 3SFZA 1PBYB 4GMBA 4J73A 4TZ4A 2B5NA 4A2LA 3FRXA 4BUJC 4PC0A 3VGZA 3J81g 5HQGA 5AFU3 5THAA 3EI4B 3DSMA 3HFQA 2OJYA 5H14A 2H9PA 5HYNB 3JROA 2HJ4A 5HE1B 2UZXB 3ODTA 4AOWA 2J56H 2AGXA 5IGQA 2IUQA 4D0KA 1OMWB 1PEVA 3MZKA 5FKSA 5EALA 4J0WA 2GNQA 4PNKB 2IUVA 4XEIC 1GP2B 4JSXC 3SJLD 3A0FA 4H5JA 2AH0A 4CY2A 3IJ1A 3UVOA 1U2VC 4OWRA 4KFMB 3MZLA 5H1MA 5GXHA 4X3EA 5IT9g 2HESX 2CN2A 5CXCB 1N6DA 2P9KC 3B7FA 1RI6A 3MKQA 4JT6C 5EMLB 1TYQC 1XIPA 3SLED 3RSEC 2OVPB 3BG0A 2H47A 4FA5D 5EAPA 1GXRA 3NVQA 2AH1A 4PBZA 2BBKH 2I3TA 4A08B 4CY1A 3PSCB 4CI3A 3EG6A 4K3ID 4FHLA 3VH0A 4E54B 3F3PA 4JSVC 2YBAA 3JRPA 3I7PA 3OKWA 4XYIA 5IC7A 3AH8B 4ZOVA 5EMMB 3CFVA 3RN0D 3OKTA 5EM2A 2BCJB 3GREA 4J84A 4G56B 3J80g 2YMUA 4A09A 2I0RA 4ZOYA 3NVNA 3UR4A 4L1QD 2EBSA 5K1CC 5GMKn 1JOFA 3I7KA 5CYKB 4ERZA 4R7AB 2H6KA 2AQ5A 3SVWD 3EI1A 3EI2B 4J8BA 4GQBB 3SBRA 3SHFA 5GSAA 4MK0B 2P9SC 3I8EA 5AJAA 5I5IA 4A2MA 5FA5B 4A0AA 4J86A 3UVMA 1B9XA 2O9KA 4A0BA 2TRCB 2YNPA 2B4EA 4E5ZA 4U1EI 3CFSB 3ZWLB 2YNOA 3UVKA 5FKTA 3AL8B 3IJ0A 3SCYA 2H14A 4U7AA 4FWWA 2OK4A 2I0TA 4XYHA 5HE0B 2GC4A 4FB1D 3JZHA 1SHYB 2OVRB 1K8KC 3N0EA 4ZOXA 5GXIA 2AGWA 2PM6B 3I89A 4GM3A 5I5MA 1P22A 4ES0A 4HDJA 4AEZA 1JMXB 2PM7B 2P9LC 1XHMA 4JSNC 2HYEA 2H68A 3IIWA 2XU7A 3EI3A 4J87A 2H9MA 4CY5A 2W18A 4IMMA 1S4UX 2AGZA 4L3HD 1XKSA 2IWFA 2Z2NA 3EWEA 4CI1A 4J79A 4J78A 4FAND 3AL9A 5KDOB 3SN6B 4ZN4A 3IJCA 4QQEA 4CY3A 4D6VA 4J0XA 4O3UB 5HE2B 3PVUB 5FQDA 1YFQA 2H6NA 4Z8LA 5CXCA 2IAAA
chains in the Genus database with same CATH superfamily
1FWXA 1JMZB 3O4GA 2UZYB 5C2WB 4Y7RA 1O6FA 3IIYA 3EU7A 3BG1A 5FLXg 3EQ8A 3V7DB 3JZNA 3GFCA 5FKRA 5FKQA 2XL2A 3UKRC 2OIZA 5TEEA 2EICA 3PXTD 5FXYA 2IWKA 4GZ8A 4A08A 1N6EA 3K26A 3AFCA 1A12A 3I7HA 5E6SA 2P9UC 3SBPA 4CI2A 5SXMA 5TF2A 2YNNA 1YR2A 4LG8A 1NEXB 2OVQB 3SMRA 4OZUA 2AGLA 4GGDA 4J82A 3K71A 3CIKB 3FGBA 4NSXA 3BWSA 4A09B 4NBMA 1H2XA 4O2WA 1B9YA 1H2YA 2PBIB 2P9IC 4O1QD 5TDHB 3OL2A 4UI9R 4Y5RD 1MDAH 4O9DA 3E0CA 4O45A 4BH6A 4ESGA 5M5VA 3EI1B 2Q7QA 4H5IA 2Z2PA 1BPOA 3RFGA 3PVWB 4AMZA 3I7LA 3O4HA 5EMKB 2PM9A 2H9NA 4BCCA 3FCSA 4PBYA 1JJUB 3SWSD 3OW8A 3T3PA 4A0BB 5K19A 3F3GA 3FM0A 4FA1D 4E5ZB 4PSWB 4QAMA 2CE9A 3ZDYA 1T2XA 2OK6A 3OKYA 4ERYA 1K32A 2HJBA 4UM9A 5FFGA 2CO0A 4O3TB 4PXWA 4X61B 2P9PC 5CXBA 1I2MB 1UTCA 1C9IA 1OLZA 3PSLA 1Q47A 2YB8B 3EMHA 3V5WB 1N6FA 2QZPA 5EAMA 1A0RB 2XL3A 3UKUC 4L3GD 1L0QA 2HXCA 4A11A 3IUQA 5FFOA 4Z7NA 2XDWA 2IURA 3JPXA 5B4WA 1TBGA 5AMSA 5A2Qg 3PXWD 3DDUA 4G1EA 5IGOA 4QT8A 1UOPA 1U4CA 3W15A 3L4OD 2G9AA 4LGNA 4CZVA 3EI4A 2I3SA 3F3FA 3QHYB 4X63B 1SQ9A 3PE7A 4Z7QA 3EI3B 5IJ7E 3JB9L 1MG2A 2XYIA 2G99A 3KRWB 3UVLA 4FAVD 4CI8A 3RFHA 2CO0C 5HE3B 4FA4D 3NVXA 2B5LA 4I79A 1UOQA 2MTAH 1VYHC 3I8CA 4WJKA 3N0DA 4PSXB 1ERJA 3C5MA 2Z2OA 4CC9A 3V9FA 4CZYA 4GM9A 3ZDZA 3RRMC 5JWZA 2CNXA 4CZXA 4L9OA 3NIGA 2GC7A 3ORVD 3FCUA 4GGAA 2CN3A 3MKSB 3KRXB 3OTTA 2VDRA 3ZE0A 3K27A 4ERQA 4A7JA 5CXCA 2HKMA 2H6QA 4J77A 3IKOA 5C2VB 4ZOZA 4EWRA 3RN1D 3UVNA 2J57G 1GG2B 4IA9A 4JT5C 3EQ9A 1NR0A 3DXMC 2VDMA 1QNIA 4X60B 5TEFA 1PGUA 2CE8A 2HU5A 2H13A 1E8MA 2H3XA 2VDLA 3JZGA 3VA6A 5EM2B 3MVDK 5C9ZB 3MXXA 4JSPC 2B5MA 3MMYA 3O4JA 3ULEC 4E54A 1M1XA 4GGCA 3IURA 4LG9A 4FA9D 1H2WA 1PI6A 2H9LA 5I5JA 3U4YA 3P4FA 2VC2A 3I7OA 5EARA 3O4IA 5H17A 2AGYA 3OL2B 3SXTD 3SBQA 1C9LA 1VE7A 4DNVA 3C75H 1GOFA 3IUMA 4A0AB 2PM9B 4D9SA 1GOTB 2J55H 5IJ8E 4QRJA 4BCDA 3I7NA 1R5MA 3DXKC 4JD2C 5CYKA 2EIEA 2QC5A 4GM8A 5EMJB 3IJEA 4G1MA 4BL0A 3IUJA 3EI2A 3PXSD 2I0SA 3OKYB 3C9CA 5HDBA 2HKRA 2QXVA 3L4MD 1MG3A 3DM0A 4J81A 4QL1A 4GQ2P 1SQJA 1VZ3A 3JAMg 2P9NC 2VDKA 5CXBB 3I2NA 4AX4A 3C99A 1GOHA 1K3IA 4J8GA 3DWLC 4JXMA 4N14A 3AL8A 4RE6A 3RLMD 4A11B 4GQ1A 4K3JB 2IUPA 3RMZD 3V4VA 2WQ8A 4YVDA 3SFZA 1PBYB 4GMBA 4J73A 4TZ4A 2B5NA 4A2LA 3FRXA 4IRZA 3VI4A 4BUJC 2VDQA 4PC0A 3VGZA 3J81g 4JHPC 3KCIA 4AN0A 5HQGA 5AFU3 5THAA 1VE6A 3EI4B 3DSMA 3HFQA 2OJYA 5H14A 4BP9A 2H9PA 2VDOA 4O02A 5HYNB 3JROA 2HJ4A 5HE1B 2UZXB 3ODTA 4AOWA 2J56H 2AGXA 5IGQA 2IUQA 1QFMA 3EQ7A 4L1MA 4D0KA 1OMWB 1PEVA 3MZKA 3OF7A 5FKSA 5EALA 3ZE1A 4J0WA 2GNQA 4PNKB 2IUVA 4NENA 4XEIC 1GP2B 3NIFA 4JSXC 3A0FA 4H5JA 2AH0A 2HU7A 3SJLD 4CY2A 5C86A 3IJ1A 3UVOA 1U2VC 2HU8A 2VDPA 4NAAA 4MMYA 4OWRA 4KFMB 3MZLA 5H1MA 3QI0A 4AMYA 1L5GA 4JHNA 5GXHA 4WK0A 4X3EA 5IT9g 2HESX 2CN2A 5CXCB 1N6DA 2P9KC 3B7FA 1RI6A 3MKQA 4JT6C 5EMLB 1TYQC 1XIPA 3GC3B 4Z7OA 3NIDA 3SLED 1JTDB 1TYEA 2OVPB 3RSEC 3BG0A 2H47A 4FA5D 5EAPA 4BP8A 1GXRA 3NVQA 2AH1A 4PBZA 2BBKH 2VDNA 4WK4A 2I3TA 3IVMA 3ZE2A 4DNUA 4A08B 4CY1A 3PSCB 4CI3A 3EG6A 2VZ3A 4K3ID 4FHLA 3VH0A 1H2ZA 4BCBA 5M5UA 1JV2A 3F3PA 4JSVC 2YBAA 4E54B 3JRPA 3I7PA 3OKWA 4XYIA 5IC7A 3AH8B 4ZOVA 4G55A 5EMMB 3CFVA 3MUOA 3RN0D 5M5RA 4DNWA 3OKTA 5EM2A 3T3MA 2BCJB 3GREA 4J84A 4G56B 3J80g 2YMUA 2EIDA 4A09A 2I0RA 4ZOYA 3NVNA 3UR4A 4L1QD 2EBSA 5K1CC 3V4PA 5GMKn 1JOFA 2EIBA 3I7KA 5CYKB 4ERZA 4R7AB 2H6KA 2BKLA 2AQ5A 3SVWD 3EI1A 5C92A 3EI2B 4J8BA 4GQBB 3SBRA 3SHFA 5GSAA 4MK0B 1E5TA 2P9SC 3I8EA 5AJAA 5I5IA 4A2MA 3K72A 5FA5B 5M5SA 4A0AA 1O6GA 4J86A 3UVMA 1B9XA 2O9KA 4A0BA 2TRCB 2YNPA 2B4EA 4E5ZA 4U1EI 3CFSB 1QFSA 3ZWLB 2YNOA 3UVKA 2VZ1A 5FKTA 1GOGA 3AL8B 3IJ0A 3SCYA 3K6SA 5E6RA 2H14A 4U7AA 3VI3A 4FWWA 2OK4A 2I0TA 4XYHA 4UM8A 5HE0B 2GC4A 4FB1D 3JZHA 1SHYB 2OVRB 1K8KC 3N0EA 4ZOXA 5GXIA 3MUNA 2AGWA 4MMXA 2XZGA 3IUNA 2PM6B 3I89A 4GM3A 5I5MA 1P22A 4ES0A 4HDJA 4RE5A 4AEZA 1JMXB 2PM7B 2P9LC 1XHMA 5M61A 4JSNC 2HYEA 2H68A 2JKXA 3IIWA 2XU7A 3EI3A 4J87A 2H9MA 4CY5A 4NC4A 5E6UA 4AN1A 2QR5A 2W18A 4IMMA 1S4UX 3GD1I 2AGZA 1VZ2A 4L3HD 1XKSA 2IWFA 3ZDXA 4WK2A 2Z2NA 3EWEA 4CI1A 4J79A 5M5TA 4J78A 4FAND 3AL9A 5KDOB 3SN6B 1U8CA 2XE4A 4ZN4A 3IJCA 4QQEA 4CY3A 1E8NA 3IULA 4J0XA 4O3UB 5HE2B 4MMZA 4D6VA 3PVUB 5FQDA 1YFQA 2H6NA 4Z8LA 1UOOA 2IAAA
chains in the Genus database with same CATH topology
1FWXA 1JMZB 2UZYB 5C2WB 4Y7RA 3IIYA 3EU7A 3BG1A 5FLXg 3V7DB 3JZNA 3GFCA 5FKRA 5FKQA 2XL2A 3UKRC 2OIZA 5TEEA 3PXTD 5FXYA 2IWKA 4GZ8A 4A08A 1N6EA 3K26A 3AFCA 3I7HA 2P9UC 3SBPA 4CI2A 5SXMA 5TF2A 2YNNA 4LG8A 1NEXB 2OVQB 3SMRA 4OZUA 2AGLA 4GGDA 4J82A 3CIKB 3FGBA 4NSXA 3BWSA 4A09B 1B9YA 2PBIB 5TDHB 2P9IC 4O1QD 3OL2A 4UI9R 4Y5RD 1MDAH 4O9DA 3E0CA 4O45A 4BH6A 4ESGA 3EI1B 2Q7QA 4H5IA 2Z2PA 3RFGA 3PVWB 3I7LA 5EMKB 2PM9A 2H9NA 4PBYA 1JJUB 3SWSD 3OW8A 4A0BB 5K19A 3F3GA 3FM0A 4FA1D 4E5ZB 4PSWB 2CE9A 2OK6A 3OKYA 4ERYA 1K32A 2HJBA 2CO0A 4O3TB 4PXWA 4X61B 2P9PC 5CXBA 3PSLA 1OLZA 1Q47A 2YB8B 3EMHA 3V5WB 1N6FA 5EAMA 1A0RB 2XL3A 3UKUC 4L3GD 1L0QA 2HXCA 4A11A 2IURA 3JPXA 5B4WA 1TBGA 5AMSA 5A2Qg 3PXWD 5IGOA 4QT8A 1U4CA 3W15A 3L4OD 2G9AA 4LGNA 4CZVA 3EI4A 2I3SA 3F3FA 4X63B 1SQ9A 3PE7A 3EI3B 5IJ7E 3JB9L 1MG2A 2XYIA 2G99A 3KRWB 3UVLA 4FAVD 4CI8A 3RFHA 2CO0C 5HE3B 4FA4D 3NVXA 2B5LA 4I79A 2MTAH 1VYHC 3I8CA 3N0DA 4PSXB 1ERJA 3C5MA 2Z2OA 4CC9A 3V9FA 4CZYA 4GM9A 3RRMC 5JWZA 2CNXA 4CZXA 4L9OA 2GC7A 3ORVD 4GGAA 2CN3A 3MKSB 3KRXB 3OTTA 3K27A 4ERQA 4A7JA 2HKMA 2H6QA 4J77A 3IKOA 5C2VB 4ZOZA 4EWRA 3RN1D 3UVNA 2J57G 1GG2B 4IA9A 4JT5C 1NR0A 3DXMC 1QNIA 4X60B 5TEFA 1PGUA 2CE8A 2H13A 2H3XA 3JZGA 3VA6A 5EM2B 5C9ZB 4JSPC 3MXXA 2B5MA 3MMYA 4E54A 3ULEC 4GGCA 4LG9A 4FA9D 1PI6A 2H9LA 5I5JA 3U4YA 3P4FA 5EARA 3I7OA 5H17A 2AGYA 3OL2B 3SXTD 3SBQA 3C75H 4A0AB 2PM9B 1GOTB 2J55H 5IJ8E 4QRJA 3I7NA 1R5MA 3DXKC 4JD2C 5CYKA 2QC5A 4GM8A 5EMJB 4BL0A 3EI2A 3PXSD 2I0SA 3OKYB 3C9CA 2HKRA 2QXVA 3L4MD 1MG3A 3DM0A 4J81A 4QL1A 4GQ2P 1SQJA 3JAMg 2P9NC 5CXBB 3I2NA 3C99A 4N14A 4J8GA 3DWLC 4JXMA 3AL8A 3RLMD 4A11B 4GQ1A 4K3JB 2IUPA 3RMZD 4YVDA 3SFZA 1PBYB 4GMBA 4J73A 4TZ4A 2B5NA 4A2LA 3FRXA 4BUJC 4PC0A 3VGZA 3J81g 5HQGA 5AFU3 5THAA 3EI4B 3DSMA 3HFQA 2OJYA 5H14A 2H9PA 5HYNB 3JROA 2HJ4A 5HE1B 2UZXB 3ODTA 4AOWA 2J56H 2AGXA 5IGQA 2IUQA 4D0KA 1OMWB 1PEVA 3MZKA 5FKSA 5EALA 4J0WA 2GNQA 4PNKB 2IUVA 4XEIC 1GP2B 4JSXC 3SJLD 3A0FA 4H5JA 2AH0A 4CY2A 3IJ1A 3UVOA 1U2VC 4OWRA 4KFMB 3MZLA 5H1MA 5GXHA 4X3EA 5IT9g 2HESX 2CN2A 5CXCB 1N6DA 2P9KC 3B7FA 1RI6A 3MKQA 4JT6C 5EMLB 1TYQC 1XIPA 3SLED 3RSEC 2OVPB 3BG0A 2H47A 4FA5D 5EAPA 1GXRA 3NVQA 2AH1A 4PBZA 2BBKH 2I3TA 4A08B 4CY1A 3PSCB 4CI3A 3EG6A 4K3ID 4FHLA 3VH0A 4E54B 3F3PA 4JSVC 2YBAA 3JRPA 3I7PA 3OKWA 4XYIA 5IC7A 3AH8B 4ZOVA 5EMMB 3CFVA 3RN0D 3OKTA 5EM2A 2BCJB 3GREA 4J84A 4G56B 3J80g 2YMUA 4A09A 2I0RA 4ZOYA 3NVNA 3UR4A 4L1QD 2EBSA 5K1CC 5GMKn 1JOFA 3I7KA 5CYKB 4ERZA 4R7AB 2H6KA 2AQ5A 3SVWD 3EI1A 3EI2B 4J8BA 4GQBB 3SBRA 3SHFA 5GSAA 4MK0B 2P9SC 3I8EA 5AJAA 5I5IA 4A2MA 5FA5B 4A0AA 4J86A 3UVMA 1B9XA 2O9KA 4A0BA 2TRCB 2YNPA 2B4EA 4E5ZA 4U1EI 3CFSB 3ZWLB 2YNOA 3UVKA 5FKTA 3AL8B 3IJ0A 3SCYA 2H14A 4U7AA 4FWWA 2OK4A 2I0TA 4XYHA 5HE0B 2GC4A 4FB1D 3JZHA 1SHYB 2OVRB 1K8KC 3N0EA 4ZOXA 5GXIA 2AGWA 2PM6B 3I89A 4GM3A 5I5MA 1P22A 4ES0A 4HDJA 4AEZA 1JMXB 2PM7B 2P9LC 1XHMA 4JSNC 2HYEA 2H68A 3IIWA 2XU7A 3EI3A 4J87A 2H9MA 4CY5A 2W18A 4IMMA 1S4UX 2AGZA 4L3HD 1XKSA 2IWFA 2Z2NA 3EWEA 4CI1A 4J79A 4J78A 4FAND 3AL9A 5KDOB 3SN6B 4ZN4A 3IJCA 4QQEA 4CY3A 4D6VA 4J0XA 4O3UB 5HE2B 3PVUB 5FQDA 1YFQA 2H6NA 4Z8LA 5CXCA 2IAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FWX A;  1JMZ B;  2UZY B;  5C2W B;  4Y7R A;  3IIY A;  3EU7 A;  3BG1 A;  5FLX g;  3V7D B;  3JZN A;  3GFC A;  5FKR A;  5FKQ A;  2XL2 A;  3UKR C;  2OIZ A;  5TEE A;  3PXT D;  5FXY A;  2IWK A;  4GZ8 A;  4A08 A;  1N6E A;  3K26 A;  3AFC A;  3I7H A;  2P9U C;  3SBP A;  4CI2 A;  5SXM A;  5TF2 A;  2YNN A;  4LG8 A;  1NEX B;  2OVQ B;  3SMR A;  4OZU A;  2AGL A;  4GGD A;  4J82 A;  3CIK B;  3FGB A;  4NSX A;  3BWS A;  4A09 B;  1B9Y A;  2PBI B;  5TDH B;  2P9I C;  4O1Q D;  3OL2 A;  4UI9 R;  4Y5R D;  1MDA H;  4O9D A;  3E0C A;  4O45 A;  4BH6 A;  4ESG A;  3EI1 B;  2Q7Q A;  4H5I A;  2Z2P A;  3RFG A;  3PVW B;  3I7L A;  5EMK B;  2PM9 A;  2H9N A;  4PBY A;  1JJU B;  3SWS D;  3OW8 A;  4A0B B;  5K19 A;  3F3G A;  3FM0 A;  4FA1 D;  4E5Z B;  4PSW B;  2CE9 A;  2OK6 A;  3OKY A;  4ERY A;  1K32 A;  2HJB A;  2CO0 A;  4O3T B;  4PXW A;  4X61 B;  2P9P C;  5CXB A;  3PSL A;  1OLZ A;  1Q47 A;  2YB8 B;  3EMH A;  3V5W B;  1N6F A;  5EAM A;  1A0R B;  2XL3 A;  3UKU C;  4L3G D;  1L0Q A;  2HXC A;  4A11 A;  2IUR A;  3JPX A;  5B4W A;  1TBG A;  5AMS A;  5A2Q g;  3PXW D;  5IGO A;  4QT8 A;  1U4C A;  3W15 A;  3L4O D;  2G9A A;  4LGN A;  4CZV A;  3EI4 A;  2I3S A;  3F3F A;  4X63 B;  1SQ9 A;  3PE7 A;  3EI3 B;  5IJ7 E;  3JB9 L;  1MG2 A;  2XYI A;  2G99 A;  3KRW B;  3UVL A;  4FAV D;  4CI8 A;  3RFH A;  2CO0 C;  5HE3 B;  4FA4 D;  3NVX A;  2B5L A;  4I79 A;  2MTA H;  1VYH C;  3I8C A;  3N0D A;  4PSX B;  1ERJ A;  3C5M A;  2Z2O A;  4CC9 A;  3V9F A;  4CZY A;  4GM9 A;  3RRM C;  5JWZ A;  2CNX A;  4CZX A;  4L9O A;  2GC7 A;  3ORV D;  4GGA A;  2CN3 A;  3MKS B;  3KRX B;  3OTT A;  3K27 A;  4ERQ A;  4A7J A;  2HKM A;  2H6Q A;  4J77 A;  3IKO A;  5C2V B;  4ZOZ A;  4EWR A;  3RN1 D;  3UVN A;  2J57 G;  1GG2 B;  4IA9 A;  4JT5 C;  1NR0 A;  3DXM C;  1QNI A;  4X60 B;  5TEF A;  1PGU A;  2CE8 A;  2H13 A;  2H3X A;  3JZG A;  3VA6 A;  5EM2 B;  5C9Z B;  4JSP C;  3MXX A;  2B5M A;  3MMY A;  4E54 A;  3ULE C;  4GGC A;  4LG9 A;  4FA9 D;  1PI6 A;  2H9L A;  5I5J A;  3U4Y A;  3P4F A;  5EAR A;  3I7O A;  5H17 A;  2AGY A;  3OL2 B;  3SXT D;  3SBQ A;  3C75 H;  4A0A B;  2PM9 B;  1GOT B;  2J55 H;  5IJ8 E;  4QRJ A;  3I7N A;  1R5M A;  3DXK C;  4JD2 C;  5CYK A;  2QC5 A;  4GM8 A;  5EMJ B;  4BL0 A;  3EI2 A;  3PXS D;  2I0S A;  3OKY B;  3C9C A;  2HKR A;  2QXV A;  3L4M D;  1MG3 A;  3DM0 A;  4J81 A;  4QL1 A;  4GQ2 P;  1SQJ A;  3JAM g;  2P9N C;  5CXB B;  3I2N A;  3C99 A;  4N14 A;  4J8G A;  3DWL C;  4JXM A;  3AL8 A;  3RLM D;  4A11 B;  4GQ1 A;  4K3J B;  2IUP A;  3RMZ D;  4YVD A;  3SFZ A;  1PBY B;  4GMB A;  4J73 A;  4TZ4 A;  2B5N A;  4A2L A;  3FRX A;  4BUJ C;  4PC0 A;  3VGZ A;  3J81 g;  5HQG A;  5AFU 3;  5THA A;  3EI4 B;  3DSM A;  3HFQ A;  2OJY A;  5H14 A;  2H9P A;  5HYN B;  3JRO A;  2HJ4 A;  5HE1 B;  2UZX B;  3ODT A;  4AOW A;  2J56 H;  2AGX A;  5IGQ A;  2IUQ A;  4D0K A;  1OMW B;  1PEV A;  3MZK A;  5FKS A;  5EAL A;  4J0W A;  2GNQ A;  4PNK B;  2IUV A;  4XEI C;  1GP2 B;  4JSX C;  3SJL D;  3A0F A;  4H5J A;  2AH0 A;  4CY2 A;  3IJ1 A;  3UVO A;  1U2V C;  4OWR A;  4KFM B;  3MZL A;  5H1M A;  5GXH A;  4X3E A;  5IT9 g;  2HES X;  2CN2 A;  5CXC B;  1N6D A;  2P9K C;  3B7F A;  1RI6 A;  3MKQ A;  4JT6 C;  5EML B;  1TYQ C;  1XIP A;  3SLE D;  3RSE C;  2OVP B;  3BG0 A;  2H47 A;  4FA5 D;  5EAP A;  1GXR A;  3NVQ A;  2AH1 A;  4PBZ A;  2BBK H;  2I3T A;  4A08 B;  4CY1 A;  3PSC B;  4CI3 A;  3EG6 A;  4K3I D;  4FHL A;  3VH0 A;  4E54 B;  3F3P A;  4JSV C;  2YBA A;  3JRP A;  3I7P A;  3OKW A;  4XYI A;  5IC7 A;  3AH8 B;  4ZOV A;  5EMM B;  3CFV A;  3RN0 D;  3OKT A;  5EM2 A;  2BCJ B;  3GRE A;  4J84 A;  4G56 B;  3J80 g;  2YMU A;  4A09 A;  2I0R A;  4ZOY A;  3NVN A;  3UR4 A;  4L1Q D;  2EBS A;  5K1C C;  5GMK n;  1JOF A;  3I7K A;  5CYK B;  4ERZ A;  4R7A B;  2H6K A;  2AQ5 A;  3SVW D;  3EI1 A;  3EI2 B;  4J8B A;  4GQB B;  3SBR A;  3SHF A;  5GSA A;  4MK0 B;  2P9S C;  3I8E A;  5AJA A;  5I5I A;  4A2M A;  5FA5 B;  4A0A A;  4J86 A;  3UVM A;  1B9X A;  2O9K A;  4A0B A;  2TRC B;  2YNP A;  2B4E A;  4E5Z A;  4U1E I;  3CFS B;  3ZWL B;  2YNO A;  3UVK A;  5FKT A;  3AL8 B;  3IJ0 A;  3SCY A;  2H14 A;  4U7A A;  4FWW A;  2OK4 A;  2I0T A;  4XYH A;  5HE0 B;  2GC4 A;  4FB1 D;  3JZH A;  1SHY B;  2OVR B;  1K8K C;  3N0E A;  4ZOX A;  5GXI A;  2AGW A;  2PM6 B;  3I89 A;  4GM3 A;  5I5M A;  1P22 A;  4ES0 A;  4HDJ A;  4AEZ A;  1JMX B;  2PM7 B;  2P9L C;  1XHM A;  4JSN C;  2HYE A;  2H68 A;  3IIW A;  2XU7 A;  3EI3 A;  4J87 A;  2H9M A;  4CY5 A;  2W18 A;  4IMM A;  1S4U X;  2AGZ A;  4L3H D;  1XKS A;  2IWF A;  2Z2N A;  3EWE A;  4CI1 A;  4J79 A;  4J78 A;  4FAN D;  3AL9 A;  5KDO B;  3SN6 B;  4ZN4 A;  3IJC A;  4QQE A;  4CY3 A;  4D6V A;  4J0X A;  4O3U B;  5HE2 B;  3PVU B;  5FQD A;  1YFQ A;  2H6N A;  4Z8L A;  5CXC A;  2IAA A; 
#chains in the Genus database with same CATH topology
 1FWX A;  1JMZ B;  3O4G A;  2UZY B;  5C2W B;  4Y7R A;  1O6F A;  3IIY A;  3EU7 A;  3BG1 A;  5FLX g;  3EQ8 A;  3V7D B;  3JZN A;  3GFC A;  5FKR A;  5FKQ A;  2XL2 A;  3UKR C;  2OIZ A;  5TEE A;  2EIC A;  3PXT D;  5FXY A;  2IWK A;  4GZ8 A;  4A08 A;  1N6E A;  3K26 A;  3AFC A;  1A12 A;  3I7H A;  5E6S A;  2P9U C;  3SBP A;  4CI2 A;  5SXM A;  5TF2 A;  2YNN A;  1YR2 A;  4LG8 A;  1NEX B;  2OVQ B;  3SMR A;  4OZU A;  2AGL A;  4GGD A;  4J82 A;  3K71 A;  3CIK B;  3FGB A;  4NSX A;  3BWS A;  4A09 B;  4NBM A;  1H2X A;  4O2W A;  1B9Y A;  1H2Y A;  2PBI B;  2P9I C;  4O1Q D;  5TDH B;  3OL2 A;  4UI9 R;  4Y5R D;  1MDA H;  4O9D A;  3E0C A;  4O45 A;  4BH6 A;  4ESG A;  5M5V A;  3EI1 B;  2Q7Q A;  4H5I A;  2Z2P A;  1BPO A;  3RFG A;  3PVW B;  4AMZ A;  3I7L A;  3O4H A;  5EMK B;  2PM9 A;  2H9N A;  4BCC A;  3FCS A;  4PBY A;  1JJU B;  3SWS D;  3OW8 A;  3T3P A;  4A0B B;  5K19 A;  3F3G A;  3FM0 A;  4FA1 D;  4E5Z B;  4PSW B;  4QAM A;  2CE9 A;  3ZDY A;  1T2X A;  2OK6 A;  3OKY A;  4ERY A;  1K32 A;  2HJB A;  4UM9 A;  5FFG A;  2CO0 A;  4O3T B;  4PXW A;  4X61 B;  2P9P C;  5CXB A;  1I2M B;  1UTC A;  1C9I A;  1OLZ A;  3PSL A;  1Q47 A;  2YB8 B;  3EMH A;  3V5W B;  1N6F A;  2QZP A;  5EAM A;  1A0R B;  2XL3 A;  3UKU C;  4L3G D;  1L0Q A;  2HXC A;  4A11 A;  3IUQ A;  5FFO A;  4Z7N A;  2XDW A;  2IUR A;  3JPX A;  5B4W A;  1TBG A;  5AMS A;  5A2Q g;  3PXW D;  3DDU A;  4G1E A;  5IGO A;  4QT8 A;  1UOP A;  1U4C A;  3W15 A;  3L4O D;  2G9A A;  4LGN A;  4CZV A;  3EI4 A;  2I3S A;  3F3F A;  3QHY B;  4X63 B;  1SQ9 A;  3PE7 A;  4Z7Q A;  3EI3 B;  5IJ7 E;  3JB9 L;  1MG2 A;  2XYI A;  2G99 A;  3KRW B;  3UVL A;  4FAV D;  4CI8 A;  3RFH A;  2CO0 C;  5HE3 B;  4FA4 D;  3NVX A;  2B5L A;  4I79 A;  1UOQ A;  2MTA H;  1VYH C;  3I8C A;  4WJK A;  3N0D A;  4PSX B;  1ERJ A;  3C5M A;  2Z2O A;  4CC9 A;  3V9F A;  4CZY A;  4GM9 A;  3ZDZ A;  3RRM C;  5JWZ A;  2CNX A;  4CZX A;  4L9O A;  3NIG A;  2GC7 A;  3ORV D;  3FCU A;  4GGA A;  2CN3 A;  3MKS B;  3KRX B;  3OTT A;  2VDR A;  3ZE0 A;  3K27 A;  4ERQ A;  4A7J A;  5CXC A;  2HKM A;  2H6Q A;  4J77 A;  3IKO A;  5C2V B;  4ZOZ A;  4EWR A;  3RN1 D;  3UVN A;  2J57 G;  1GG2 B;  4IA9 A;  4JT5 C;  3EQ9 A;  1NR0 A;  3DXM C;  2VDM A;  1QNI A;  4X60 B;  5TEF A;  1PGU A;  2CE8 A;  2HU5 A;  2H13 A;  1E8M A;  2H3X A;  2VDL A;  3JZG A;  3VA6 A;  5EM2 B;  3MVD K;  5C9Z B;  3MXX A;  4JSP C;  2B5M A;  3MMY A;  3O4J A;  3ULE C;  4E54 A;  1M1X A;  4GGC A;  3IUR A;  4LG9 A;  4FA9 D;  1H2W A;  1PI6 A;  2H9L A;  5I5J A;  3U4Y A;  3P4F A;  2VC2 A;  3I7O A;  5EAR A;  3O4I A;  5H17 A;  2AGY A;  3OL2 B;  3SXT D;  3SBQ A;  1C9L A;  1VE7 A;  4DNV A;  3C75 H;  1GOF A;  3IUM A;  4A0A B;  2PM9 B;  4D9S A;  1GOT B;  2J55 H;  5IJ8 E;  4QRJ A;  4BCD A;  3I7N A;  1R5M A;  3DXK C;  4JD2 C;  5CYK A;  2EIE A;  2QC5 A;  4GM8 A;  5EMJ B;  3IJE A;  4G1M A;  4BL0 A;  3IUJ A;  3EI2 A;  3PXS D;  2I0S A;  3OKY B;  3C9C A;  5HDB A;  2HKR A;  2QXV A;  3L4M D;  1MG3 A;  3DM0 A;  4J81 A;  4QL1 A;  4GQ2 P;  1SQJ A;  1VZ3 A;  3JAM g;  2P9N C;  2VDK A;  5CXB B;  3I2N A;  4AX4 A;  3C99 A;  1GOH A;  1K3I A;  4J8G A;  3DWL C;  4JXM A;  4N14 A;  3AL8 A;  4RE6 A;  3RLM D;  4A11 B;  4GQ1 A;  4K3J B;  2IUP A;  3RMZ D;  3V4V A;  2WQ8 A;  4YVD A;  3SFZ A;  1PBY B;  4GMB A;  4J73 A;  4TZ4 A;  2B5N A;  4A2L A;  3FRX A;  4IRZ A;  3VI4 A;  4BUJ C;  2VDQ A;  4PC0 A;  3VGZ A;  3J81 g;  4JHP C;  3KCI A;  4AN0 A;  5HQG A;  5AFU 3;  5THA A;  1VE6 A;  3EI4 B;  3DSM A;  3HFQ A;  2OJY A;  5H14 A;  4BP9 A;  2H9P A;  2VDO A;  4O02 A;  5HYN B;  3JRO A;  2HJ4 A;  5HE1 B;  2UZX B;  3ODT A;  4AOW A;  2J56 H;  2AGX A;  5IGQ A;  2IUQ A;  1QFM A;  3EQ7 A;  4L1M A;  4D0K A;  1OMW B;  1PEV A;  3MZK A;  3OF7 A;  5FKS A;  5EAL A;  3ZE1 A;  4J0W A;  2GNQ A;  4PNK B;  2IUV A;  4NEN A;  4XEI C;  1GP2 B;  3NIF A;  4JSX C;  3A0F A;  4H5J A;  2AH0 A;  2HU7 A;  3SJL D;  4CY2 A;  5C86 A;  3IJ1 A;  3UVO A;  1U2V C;  2HU8 A;  2VDP A;  4NAA A;  4MMY A;  4OWR A;  4KFM B;  3MZL A;  5H1M A;  3QI0 A;  4AMY A;  1L5G A;  4JHN A;  5GXH A;  4WK0 A;  4X3E A;  5IT9 g;  2HES X;  2CN2 A;  5CXC B;  1N6D A;  2P9K C;  3B7F A;  1RI6 A;  3MKQ A;  4JT6 C;  5EML B;  1TYQ C;  1XIP A;  3GC3 B;  4Z7O A;  3NID A;  3SLE D;  1JTD B;  1TYE A;  2OVP B;  3RSE C;  3BG0 A;  2H47 A;  4FA5 D;  5EAP A;  4BP8 A;  1GXR A;  3NVQ A;  2AH1 A;  4PBZ A;  2BBK H;  2VDN A;  4WK4 A;  2I3T A;  3IVM A;  3ZE2 A;  4DNU A;  4A08 B;  4CY1 A;  3PSC B;  4CI3 A;  3EG6 A;  2VZ3 A;  4K3I D;  4FHL A;  3VH0 A;  1H2Z A;  4BCB A;  5M5U A;  1JV2 A;  3F3P A;  4JSV C;  2YBA A;  4E54 B;  3JRP A;  3I7P A;  3OKW A;  4XYI A;  5IC7 A;  3AH8 B;  4ZOV A;  4G55 A;  5EMM B;  3CFV A;  3MUO A;  3RN0 D;  5M5R A;  4DNW A;  3OKT A;  5EM2 A;  3T3M A;  2BCJ B;  3GRE A;  4J84 A;  4G56 B;  3J80 g;  2YMU A;  2EID A;  4A09 A;  2I0R A;  4ZOY A;  3NVN A;  3UR4 A;  4L1Q D;  2EBS A;  5K1C C;  3V4P A;  5GMK n;  1JOF A;  2EIB A;  3I7K A;  5CYK B;  4ERZ A;  4R7A B;  2H6K A;  2BKL A;  2AQ5 A;  3SVW D;  3EI1 A;  5C92 A;  3EI2 B;  4J8B A;  4GQB B;  3SBR A;  3SHF A;  5GSA A;  4MK0 B;  1E5T A;  2P9S C;  3I8E A;  5AJA A;  5I5I A;  4A2M A;  3K72 A;  5FA5 B;  5M5S A;  4A0A A;  1O6G A;  4J86 A;  3UVM A;  1B9X A;  2O9K A;  4A0B A;  2TRC B;  2YNP A;  2B4E A;  4E5Z A;  4U1E I;  3CFS B;  1QFS A;  3ZWL B;  2YNO A;  3UVK A;  2VZ1 A;  5FKT A;  1GOG A;  3AL8 B;  3IJ0 A;  3SCY A;  3K6S A;  5E6R A;  2H14 A;  4U7A A;  3VI3 A;  4FWW A;  2OK4 A;  2I0T A;  4XYH A;  4UM8 A;  5HE0 B;  2GC4 A;  4FB1 D;  3JZH A;  1SHY B;  2OVR B;  1K8K C;  3N0E A;  4ZOX A;  5GXI A;  3MUN A;  2AGW A;  4MMX A;  2XZG A;  3IUN A;  2PM6 B;  3I89 A;  4GM3 A;  5I5M A;  1P22 A;  4ES0 A;  4HDJ A;  4RE5 A;  4AEZ A;  1JMX B;  2PM7 B;  2P9L C;  1XHM A;  5M61 A;  4JSN C;  2HYE A;  2H68 A;  2JKX A;  3IIW A;  2XU7 A;  3EI3 A;  4J87 A;  2H9M A;  4CY5 A;  4NC4 A;  5E6U A;  4AN1 A;  2QR5 A;  2W18 A;  4IMM A;  1S4U X;  3GD1 I;  2AGZ A;  1VZ2 A;  4L3H D;  1XKS A;  2IWF A;  3ZDX A;  4WK2 A;  2Z2N A;  3EWE A;  4CI1 A;  4J79 A;  5M5T A;  4J78 A;  4FAN D;  3AL9 A;  5KDO B;  3SN6 B;  1U8C A;  2XE4 A;  4ZN4 A;  3IJC A;  4QQE A;  4CY3 A;  1E8N A;  3IUL A;  4J0X A;  4O3U B;  5HE2 B;  4MMZ A;  4D6V A;  3PVU B;  5FQD A;  1YFQ A;  2H6N A;  4Z8L A;  1UOO A;  2IAA A; 
#chains in the Genus database with same CATH homology
 1FWX A;  1JMZ B;  2UZY B;  5C2W B;  4Y7R A;  3IIY A;  3EU7 A;  3BG1 A;  5FLX g;  3V7D B;  3JZN A;  3GFC A;  5FKR A;  5FKQ A;  2XL2 A;  3UKR C;  2OIZ A;  5TEE A;  3PXT D;  5FXY A;  2IWK A;  4GZ8 A;  4A08 A;  1N6E A;  3K26 A;  3AFC A;  3I7H A;  2P9U C;  3SBP A;  4CI2 A;  5SXM A;  5TF2 A;  2YNN A;  4LG8 A;  1NEX B;  2OVQ B;  3SMR A;  4OZU A;  2AGL A;  4GGD A;  4J82 A;  3CIK B;  3FGB A;  4NSX A;  3BWS A;  4A09 B;  1B9Y A;  2PBI B;  5TDH B;  2P9I C;  4O1Q D;  3OL2 A;  4UI9 R;  4Y5R D;  1MDA H;  4O9D A;  3E0C A;  4O45 A;  4BH6 A;  4ESG A;  3EI1 B;  2Q7Q A;  4H5I A;  2Z2P A;  3RFG A;  3PVW B;  3I7L A;  5EMK B;  2PM9 A;  2H9N A;  4PBY A;  1JJU B;  3SWS D;  3OW8 A;  4A0B B;  5K19 A;  3F3G A;  3FM0 A;  4FA1 D;  4E5Z B;  4PSW B;  2CE9 A;  2OK6 A;  3OKY A;  4ERY A;  1K32 A;  2HJB A;  2CO0 A;  4O3T B;  4PXW A;  4X61 B;  2P9P C;  5CXB A;  3PSL A;  1OLZ A;  1Q47 A;  2YB8 B;  3EMH A;  3V5W B;  1N6F A;  5EAM A;  1A0R B;  2XL3 A;  3UKU C;  4L3G D;  1L0Q A;  2HXC A;  4A11 A;  2IUR A;  3JPX A;  5B4W A;  1TBG A;  5AMS A;  5A2Q g;  3PXW D;  5IGO A;  4QT8 A;  1U4C A;  3W15 A;  3L4O D;  2G9A A;  4LGN A;  4CZV A;  3EI4 A;  2I3S A;  3F3F A;  4X63 B;  1SQ9 A;  3PE7 A;  3EI3 B;  5IJ7 E;  3JB9 L;  1MG2 A;  2XYI A;  2G99 A;  3KRW B;  3UVL A;  4FAV D;  4CI8 A;  3RFH A;  2CO0 C;  5HE3 B;  4FA4 D;  3NVX A;  2B5L A;  4I79 A;  2MTA H;  1VYH C;  3I8C A;  3N0D A;  4PSX B;  1ERJ A;  3C5M A;  2Z2O A;  4CC9 A;  3V9F A;  4CZY A;  4GM9 A;  3RRM C;  5JWZ A;  2CNX A;  4CZX A;  4L9O A;  2GC7 A;  3ORV D;  4GGA A;  2CN3 A;  3MKS B;  3KRX B;  3OTT A;  3K27 A;  4ERQ A;  4A7J A;  2HKM A;  2H6Q A;  4J77 A;  3IKO A;  5C2V B;  4ZOZ A;  4EWR A;  3RN1 D;  3UVN A;  2J57 G;  1GG2 B;  4IA9 A;  4JT5 C;  1NR0 A;  3DXM C;  1QNI A;  4X60 B;  5TEF A;  1PGU A;  2CE8 A;  2H13 A;  2H3X A;  3JZG A;  3VA6 A;  5EM2 B;  5C9Z B;  4JSP C;  3MXX A;  2B5M A;  3MMY A;  4E54 A;  3ULE C;  4GGC A;  4LG9 A;  4FA9 D;  1PI6 A;  2H9L A;  5I5J A;  3U4Y A;  3P4F A;  5EAR A;  3I7O A;  5H17 A;  2AGY A;  3OL2 B;  3SXT D;  3SBQ A;  3C75 H;  4A0A B;  2PM9 B;  1GOT B;  2J55 H;  5IJ8 E;  4QRJ A;  3I7N A;  1R5M A;  3DXK C;  4JD2 C;  5CYK A;  2QC5 A;  4GM8 A;  5EMJ B;  4BL0 A;  3EI2 A;  3PXS D;  2I0S A;  3OKY B;  3C9C A;  2HKR A;  2QXV A;  3L4M D;  1MG3 A;  3DM0 A;  4J81 A;  4QL1 A;  4GQ2 P;  1SQJ A;  3JAM g;  2P9N C;  5CXB B;  3I2N A;  3C99 A;  4N14 A;  4J8G A;  3DWL C;  4JXM A;  3AL8 A;  3RLM D;  4A11 B;  4GQ1 A;  4K3J B;  2IUP A;  3RMZ D;  4YVD A;  3SFZ A;  1PBY B;  4GMB A;  4J73 A;  4TZ4 A;  2B5N A;  4A2L A;  3FRX A;  4BUJ C;  4PC0 A;  3VGZ A;  3J81 g;  5HQG A;  5AFU 3;  5THA A;  3EI4 B;  3DSM A;  3HFQ A;  2OJY A;  5H14 A;  2H9P A;  5HYN B;  3JRO A;  2HJ4 A;  5HE1 B;  2UZX B;  3ODT A;  4AOW A;  2J56 H;  2AGX A;  5IGQ A;  2IUQ A;  4D0K A;  1OMW B;  1PEV A;  3MZK A;  5FKS A;  5EAL A;  4J0W A;  2GNQ A;  4PNK B;  2IUV A;  4XEI C;  1GP2 B;  4JSX C;  3SJL D;  3A0F A;  4H5J A;  2AH0 A;  4CY2 A;  3IJ1 A;  3UVO A;  1U2V C;  4OWR A;  4KFM B;  3MZL A;  5H1M A;  5GXH A;  4X3E A;  5IT9 g;  2HES X;  2CN2 A;  5CXC B;  1N6D A;  2P9K C;  3B7F A;  1RI6 A;  3MKQ A;  4JT6 C;  5EML B;  1TYQ C;  1XIP A;  3SLE D;  3RSE C;  2OVP B;  3BG0 A;  2H47 A;  4FA5 D;  5EAP A;  1GXR A;  3NVQ A;  2AH1 A;  4PBZ A;  2BBK H;  2I3T A;  4A08 B;  4CY1 A;  3PSC B;  4CI3 A;  3EG6 A;  4K3I D;  4FHL A;  3VH0 A;  4E54 B;  3F3P A;  4JSV C;  2YBA A;  3JRP A;  3I7P A;  3OKW A;  4XYI A;  5IC7 A;  3AH8 B;  4ZOV A;  5EMM B;  3CFV A;  3RN0 D;  3OKT A;  5EM2 A;  2BCJ B;  3GRE A;  4J84 A;  4G56 B;  3J80 g;  2YMU A;  4A09 A;  2I0R A;  4ZOY A;  3NVN A;  3UR4 A;  4L1Q D;  2EBS A;  5K1C C;  5GMK n;  1JOF A;  3I7K A;  5CYK B;  4ERZ A;  4R7A B;  2H6K A;  2AQ5 A;  3SVW D;  3EI1 A;  3EI2 B;  4J8B A;  4GQB B;  3SBR A;  3SHF A;  5GSA A;  4MK0 B;  2P9S C;  3I8E A;  5AJA A;  5I5I A;  4A2M A;  5FA5 B;  4A0A A;  4J86 A;  3UVM A;  1B9X A;  2O9K A;  4A0B A;  2TRC B;  2YNP A;  2B4E A;  4E5Z A;  4U1E I;  3CFS B;  3ZWL B;  2YNO A;  3UVK A;  5FKT A;  3AL8 B;  3IJ0 A;  3SCY A;  2H14 A;  4U7A A;  4FWW A;  2OK4 A;  2I0T A;  4XYH A;  5HE0 B;  2GC4 A;  4FB1 D;  3JZH A;  1SHY B;  2OVR B;  1K8K C;  3N0E A;  4ZOX A;  5GXI A;  2AGW A;  2PM6 B;  3I89 A;  4GM3 A;  5I5M A;  1P22 A;  4ES0 A;  4HDJ A;  4AEZ A;  1JMX B;  2PM7 B;  2P9L C;  1XHM A;  4JSN C;  2HYE A;  2H68 A;  3IIW A;  2XU7 A;  3EI3 A;  4J87 A;  2H9M A;  4CY5 A;  2W18 A;  4IMM A;  1S4U X;  2AGZ A;  4L3H D;  1XKS A;  2IWF A;  2Z2N A;  3EWE A;  4CI1 A;  4J79 A;  4J78 A;  4FAN D;  3AL9 A;  5KDO B;  3SN6 B;  4ZN4 A;  3IJC A;  4QQE A;  4CY3 A;  4D6V A;  4J0X A;  4O3U B;  5HE2 B;  3PVU B;  5FQD A;  1YFQ A;  2H6N A;  4Z8L A;  5CXC A;  2IAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...