4CY2A

Crystal structure of the kansl1-wdr5-kansl2 complex.
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
b'VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD REPEAT-CONTAINING PROTEIN 5
publication title Structural Analysis of the Kansl1/Wdr5/Kansl2 Complex Reveals that Wdr5 is Required for Efficient Assembly and Chromatin Targeting of the Nsl Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 102
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2014-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4cy2A00
3C75H 1B9YA 2YNNA 1PI6A 4CY5A 3IJCA 3VH0A 3PXSD 3RMZD 5AMSA 3ORVD 4L3GD 4U7AA 3EU7A 4GQ2P 4ZOXA 5FXYA 2UZXB 3KRXB 4FB1D 3U4YA 4JD2C 5KDOB 3J81g 5EALA 3JAMg 2HESX 3A0FA 3EG6A 5HQGA 5C2WB 4U1EI 4PSWB 3CFSB 4HDJA 4MK0B 4J73A 4JXMA 3SMRA 1SHYB 5CXCB 2H9LA 2H68A 4J82A 2YBAA 2P9NC 5EAPA 1B9XA 3PE7A 2IUPA 1MG3A 2AGXA 2HKRA 1K8KC 4GM3A 4CZYA 4GGDA 3RFGA 3JB9L 2OVPB 3CFVA 5K1CC 1RI6A 4L1QD 2IUQA 2B5NA 3EI2B 5FKRA 4L9OA 3C5MA 2IWFA 4FA4D 4GQ1A 2I0TA 4A08B 3RLMD 2H9NA 5AJAA 4J8BA 3PVWB 3UVLA 3K27A 2HKMA 2PM9A 3BG1A 4ZN4A 4FAVD 3SHFA 4J86A 4E5ZB 3I8CA 3V5WB 5EAMA 3PSCB 1L0QA 4L3HD 5HE0B 4GZ8A 5H17A 4QRJA 3IKOA 4A0AA 3BWSA 3EMHA 1A0RB 4PXWA 3B7FA 3F3PA 2P9SC 3IJ1A 2OVQB 2PM6B 3DXKC 3I7OA 5I5IA 1SQJA 5TEEA 4O3TB 3OW8A 5C2VB 4E54A 2B5MA 3RRMC 2H6QA 4X63B 2H14A 3PXWD 3OL2A 5TEFA 5A2Qg 4CC9A 4J78A 5GXHA 2GNQA 3SBRA 2P9IC 3IIWA 4GMBA 2J57G 4ZOZA 4D0KA 3UR4A 5EMJB 2I3TA 5H14A 5FKQA 3F3GA 3EI4A 3MZKA 5EM2B 2UZYB 2H9MA 1OLZA 2CO0C 3UVOA 2HJ4A 5CXBA 5K19A 2HYEA 5THAA 1U4CA 4O3UB 2OJYA 2CN3A 4FA5D 1MG2A 2IAAA 2P9LC 2QC5A 3I89A 3I7LA 3NVXA 5TDHB 1JMZB 2J55H 2Z2NA 2AGLA 1GP2B 3DXMC 2YNPA 3E0CA 3FM0A 2H6KA 2CE9A 3VGZA 4J0WA 2B4EA 1PEVA 2CO0A 1N6DA 5HE1B 2XL2A 3C99A 4O1QD 5B4WA 4LGNA 4KFMB 3I7PA 4H5JA 4FAND 2P9PC 2H13A 4TZ4A 4FWWA 3RN0D 2OVRB 5IJ7E 4BL0A 5HE3B 3SXTD 3V9FA 4K3JB 4PBZA 4PSXB 2Q7QA 4O9DA 3AL8B 3EI1B 4JSNC 4NSXA 4N14A 2AQ5A 4ES0A 4ESGA 4J8GA 1TYQC 4OWRA 1ERJA 2TRCB 5CXCA 2AH1A 3IIYA 4A11B 2AGWA 5EMMB 3L4OD 3MXXA 3OKYB 1K32A 1QNIA 4J87A 5IJ8E 3C9CA 3MMYA 4FHLA 2MTAH 4CZVA 2J56H 2CNXA 4JSXC 3JZGA 2Z2OA 2IURA 3DWLC 3RFHA 3F3FA 2PBIB 3ULEC 4JSVC 2P9UC 2BCJB 3EI2A 1PBYB 2OK4A 3I7HA 4PBYA 4QQEA 2GC4A 4A09B 4ERYA 4FA1D 3FRXA 3PSLA 2H6NA 4A08A 5CYKB 4JT6C 3K26A 1NR0A 4H5IA 4A0BB 4G56B 4GM8A 1MDAH 3EI3B 3IJ0A 2IWKA 2XYIA 5SXMA 5IGOA 4CY3A 4J81A 5HE2B 3J80g 4E5ZA 2H47A 3RSEC 3PVUB 4OZUA 4ZOVA 3SJLD 5H1MA 4J79A 3ZWLB 2CN2A 5JWZA 3AL9A 3CIKB 5GMKn 4X61B 3UKUC 4AOWA 5GXIA 4R7AB 3OKTA 5I5JA 4CY2A 3UVMA 5FKTA 4CI3A 1GOTB 4YVDA 5C9ZB 3VA6A 1TBGA 2GC7A 3BG0A 2BBKH 4XEIC 4IA9A 3SWSD 4A2LA 3EWEA 3N0EA 1R5MA 2HXCA 3OKWA 4CI2A 3JZHA 4CY1A 2QXVA 1FWXA 4CZXA 3ODTA 4QL1A 5FKSA 1SQ9A 3SFZA 5IC7A 3SVWD 3MZLA 3I8EA 2P9KC 3JZNA 4Y5RD 1YFQA 4GGAA 2G9AA 1JMXB 2W18A 3W15A 3SLED 2I3SA 3UKRC 5EMLB 3PXTD 4GM9A 5EM2A 2B5LA 3NVNA 3JRPA 3SBPA 4D6VA 1U2VC 2XU7A 2OK6A 5FQDA 4LG8A 3SCYA 4X60B 3P4FA 4ZOYA 4BUJC 2AGZA 2CE8A 2YMUA 4I79A 4JT5C 4ERQA 2PM9B 4PNKB 4GGCA 3SN6B 1VYHC 3SBQA 4XYIA 4EWRA 3MKSB 2H3XA 3RN1D 2XL3A 3L4MD 4ERZA 2Z2PA 3N0DA 4A7JA 4A0AB 1N6EA 4FA9D 4BH6A 2I0SA 1GXRA 4A2MA 4GQBB 1NEXB 5GSAA 4QT8A 1GG2B 4Z8LA 2PM7B 1JOFA 5EMKB 3UVNA 4J77A 3I2NA 4CI8A 5IT9g 2IUVA 4UI9R 3AL8A 4O45A 3EI1A 4LG9A 3MKQA 4E54B 4PC0A 3OTTA 3DM0A 3UVKA 2I0RA 2YNOA 5TF2A 4J84A 3OL2B 4IMMA 3JROA 3HFQA 3V7DB 2AH0A 3JPXA 3DSMA 4A11A 2O9KA 3OKYA 3FGBA 4Y7RA 3AFCA 2AGYA 1XIPA 3EI4B 5FLXg 1N6FA 2HJBA 5EARA 3NVQA 2G99A 4CI1A 4X3EA 5I5MA 3I7KA 3AH8B 3KRWB 4K3ID 4J0XA 2EBSA 1PGUA 5CXBB 2H9PA 2OIZA 3I7NA 2YB8B 1Q47A 1XHMA 4AEZA 3GFCA 4JSPC 1S4UX 4XYHA 4A09A 5AFU3 5CYKA 5HYNB 5FA5B 1JJUB 4A0BA 3GREA 3EI3A 1XKSA 1P22A 1OMWB 5IGQA
chains in the Genus database with same CATH superfamily
3C75H 3KCIA 1B9YA 2YNNA 1PI6A 4CY5A 3IJCA 3VH0A 3PXSD 3RMZD 4BCCA 5AMSA 3ORVD 4L3GD 4U7AA 3EU7A 4GQ2P 4ZOXA 4JHPC 5FXYA 2UZXB 3KRXB 4FB1D 3U4YA 2EIEA 5M5VA 4JD2C 5KDOB 1K3IA 3IUJA 4G1EA 3J81g 5EALA 3JAMg 2HESX 3A0FA 3EG6A 5HQGA 5C2WB 4U1EI 1T2XA 4PSWB 3CFSB 4HDJA 4MK0B 2WQ8A 4J73A 4JXMA 3SMRA 1SHYB 3O4IA 5CXCB 1JV2A 2H9LA 2HU7A 3O4HA 2H68A 4J82A 2YBAA 2XDWA 2P9NC 3NIDA 5EAPA 3IUNA 3IUMA 1B9XA 4WK0A 3PE7A 2IUPA 1MG3A 2AGXA 2VDKA 2HKRA 3K6SA 1YR2A 1K8KC 4GM3A 4CZYA 1QFMA 4GGDA 3RFGA 3FCSA 3JB9L 3GD1I 2OVPB 4D9SA 3CFVA 5K1CC 1RI6A 4UM9A 1E5TA 4L1QD 2IUQA 5FFGA 2VDOA 2B5NA 3EQ7A 3EI2B 4BCBA 5FKRA 4L9OA 3C5MA 2IWFA 4AN0A 4FA4D 4MMXA 4GQ1A 2I0TA 5HDBA 4A08B 3RLMD 5M5UA 2H9NA 5AJAA 4J8BA 3PVWB 3UVLA 3K27A 2HKMA 2PM9A 1H2ZA 3BG1A 4ZN4A 5E6RA 4FAVD 1BPOA 3SHFA 4J86A 4JHNA 4E5ZB 3I8CA 3V5WB 5EAMA 3PSCB 1L0QA 4L3HD 5HE0B 1E8NA 4GZ8A 5H17A 4QRJA 3IKOA 4A0AA 4NENA 1A12A 3EQ8A 3BWSA 3EMHA 1A0RB 4PXWA 3B7FA 3F3PA 5M5RA 2P9SC 3IJ1A 2OVQB 2PM6B 3DXKC 3I7OA 5I5IA 4BP8A 3T3PA 1SQJA 5TEEA 4O3TB 3OW8A 5C2VB 4Z7NA 4E54A 2VDMA 2B5MA 2HU5A 3RRMC 2H6QA 4X63B 2H14A 3PXWD 3OL2A 2VC2A 5TEFA 4IRZA 5A2Qg 4CC9A 4J78A 5GXHA 2GNQA 3SBRA 5M5SA 2P9IC 2QZPA 3IIWA 4GMBA 2J57G 4ZOZA 4D0KA 3UR4A 5EMJB 2I3TA 5H14A 5FKQA 4DNUA 3F3GA 3EI4A 3MZKA 5EM2B 2UZYB 2H9MA 1OLZA 4BCDA 2CO0C 4DNWA 3UVOA 2HJ4A 5CXBA 5K19A 2HYEA 5THAA 5E6UA 1U4CA 3MUOA 2QR5A 4O3UB 2OJYA 2CN3A 4NBMA 4FA5D 4MMYA 1MG2A 2IAAA 2P9LC 2XZGA 2QC5A 3I89A 3ZE1A 3I7LA 3NVXA 5TDHB 1JMZB 2J55H 2Z2NA 2AGLA 1GP2B 3V4PA 3DXMC 3ZDZA 2YNPA 3E0CA 3FM0A 2H6KA 1H2XA 2CE9A 1H2YA 3VGZA 2VZ1A 4J0WA 2B4EA 4AMZA 3OF7A 1PEVA 2CO0A 1N6DA 5HE1B 4WK2A 2XL2A 3C99A 4O1QD 5B4WA 4LGNA 4KFMB 3I7PA 4H5JA 4FAND 2P9PC 2H13A 4TZ4A 4FWWA 3RN0D 2OVRB 5IJ7E 4MMZA 4BL0A 5HE3B 4G1MA 3SXTD 3V9FA 5C86A 4K3JB 4PBZA 4PSXB 1O6GA 2Q7QA 3AL8B 3IUQA 4O9DA 3EI1B 4JSNC 4NSXA 4N14A 2AQ5A 1M1XA 4ES0A 4UM8A 4ESGA 4J8GA 1TYQC 1GOHA 4OWRA 1ERJA 3V4VA 2TRCB 5CXCA 2AH1A 3IIYA 4A11B 2AGWA 2EIDA 5EMMB 3ZE2A 3L4OD 3MXXA 3OKYB 1K32A 1QNIA 4J87A 5IJ8E 3C9CA 3MMYA 4FHLA 2MTAH 4CZVA 5M5TA 2J56H 2EICA 2CNXA 4JSXC 4WK4A 3JZGA 2Z2OA 2IURA 3DWLC 3RFHA 3F3FA 3K71A 4NAAA 1UOOA 2PBIB 3ULEC 3GC3B 4JSVC 4WJKA 2P9UC 2BCJB 3ZDXA 4Z7OA 4AX4A 3EI2A 2VDQA 1PBYB 2OK4A 3I7HA 4PBYA 4QQEA 2GC4A 2VDLA 2VDPA 4A09B 4ERYA 4FA1D 3FRXA 3PSLA 2H6NA 1GOFA 4A08A 5CYKB 4JT6C 3K26A 2EIBA 1NR0A 4H5IA 4A0BB 4G56B 4GM8A 1MDAH 3EI3B 3IJ0A 2IWKA 2XYIA 5SXMA 5IGOA 4Z7QA 4CY3A 4J81A 4RE5A 5HE2B 3J80g 2VDNA 4E5ZA 2H47A 3RSEC 4O2WA 3VI3A 3PVUB 4OZUA 4ZOVA 3SJLD 5H1MA 3FCUA 4J79A 3MVDK 3QI0A 3ZWLB 2CN2A 5JWZA 3AL9A 3CIKB 5GMKn 4X61B 3UKUC 4AOWA 5GXIA 4R7AB 3ZE0A 3OKTA 5I5JA 4CY2A 3UVMA 5FKTA 4CI3A 1GOTB 4YVDA 5C9ZB 3VA6A 1TBGA 2GC7A 3BG0A 3MUNA 2BBKH 4XEIC 4IA9A 3SWSD 4A2LA 3EWEA 3N0EA 1UOPA 1R5MA 2HXCA 3OKWA 4CI2A 3JZHA 4CY1A 2QXVA 1UTCA 3T3MA 1FWXA 4CZXA 3ODTA 4QL1A 5FKSA 1SQ9A 3SFZA 1E8MA 5IC7A 3SVWD 3MZLA 3I8EA 2P9KC 3JZNA 1GOGA 4Y5RD 1YFQA 4GGAA 2G9AA 1JMXB 2W18A 3W15A 3SLED 4AMYA 1C9LA 2I3SA 3UKRC 5EMLB 3ZDYA 1I2MB 1O6FA 3PXTD 4GM9A 5EM2A 2B5LA 3NVNA 3JRPA 3SBPA 4D6VA 1U2VC 2XU7A 2OK6A 3K72A 5FQDA 4LG8A 1U8CA 3SCYA 4X60B 3P4FA 4ZOYA 4BUJC 2AGZA 2CE8A 2YMUA 4I79A 4JT5C 4ERQA 2PM9B 4PNKB 4GGCA 3SN6B 3DDUA 1VYHC 3SBQA 4XYIA 4EWRA 3IULA 4NC4A 5C92A 3MKSB 2H3XA 3RN1D 2XL3A 3L4MD 4ERZA 4QAMA 2Z2PA 3N0DA 4A7JA 4A0AB 1N6EA 4FA9D 4BH6A 2I0SA 2VDRA 1GXRA 4A2MA 4GQBB 1NEXB 5GSAA 4QT8A 1VE7A 1GG2B 4Z8LA 2PM7B 3IJEA 5E6SA 1JOFA 5EMKB 1VE6A 5M61A 3UVNA 4J77A 3I2NA 3O4JA 4CI8A 5IT9g 2IUVA 2VZ3A 4UI9R 3AL8A 4O45A 3IVMA 4LG9A 3MKQA 3EI1A 4PC0A 3OTTA 3DM0A 4E54B 3UVKA 2I0RA 2YNOA 5TF2A 3IURA 4J84A 1H2WA 3OL2B 4IMMA 3JROA 3HFQA 1L5GA 3QHYB 3V7DB 2AH0A 4L1MA 3VI4A 3JPXA 2HU8A 4O02A 3DSMA 4A11A 2O9KA 3OKYA 1VZ3A 3FGBA 4Y7RA 3AFCA 2AGYA 1XIPA 3EI4B 5FLXg 1N6FA 2HJBA 1TYEA 5EARA 3NVQA 1QFSA 1C9IA 2G99A 4X3EA 4DNVA 4CI1A 5I5MA 3I7KA 3AH8B 3KRWB 4K3ID 4J0XA 2EBSA 1PGUA 5CXBB 4BP9A 2XE4A 2H9PA 3NIGA 2OIZA 3I7NA 2YB8B 1Q47A 2BKLA 1XHMA 1VZ2A 4AEZA 3GFCA 4JSPC 4AN1A 1JTDB 3NIFA 1S4UX 4RE6A 4XYHA 4A09A 5AFU3 2JKXA 5CYKA 1UOQA 4G55A 5HYNB 3EQ9A 5FFOA 5FA5B 1JJUB 4A0BA 3GREA 3EI3A 1XKSA 1P22A 1OMWB 5IGQA 3O4GA
chains in the Genus database with same CATH topology
3C75H 1B9YA 2YNNA 1PI6A 4CY5A 3IJCA 3VH0A 3PXSD 3RMZD 5AMSA 3ORVD 4L3GD 4U7AA 3EU7A 4GQ2P 4ZOXA 5FXYA 2UZXB 3KRXB 4FB1D 3U4YA 4JD2C 5KDOB 3J81g 5EALA 3JAMg 2HESX 3A0FA 3EG6A 5HQGA 5C2WB 4U1EI 4PSWB 3CFSB 4HDJA 4MK0B 4J73A 4JXMA 3SMRA 1SHYB 5CXCB 2H9LA 2H68A 4J82A 2YBAA 2P9NC 5EAPA 1B9XA 3PE7A 2IUPA 1MG3A 2AGXA 2HKRA 1K8KC 4GM3A 4CZYA 4GGDA 3RFGA 3JB9L 2OVPB 3CFVA 5K1CC 1RI6A 4L1QD 2IUQA 2B5NA 3EI2B 5FKRA 4L9OA 3C5MA 2IWFA 4FA4D 4GQ1A 2I0TA 4A08B 3RLMD 2H9NA 5AJAA 4J8BA 3PVWB 3UVLA 3K27A 2HKMA 2PM9A 3BG1A 4ZN4A 4FAVD 3SHFA 4J86A 4E5ZB 3I8CA 3V5WB 5EAMA 3PSCB 1L0QA 4L3HD 5HE0B 4GZ8A 5H17A 4QRJA 3IKOA 4A0AA 3BWSA 3EMHA 1A0RB 4PXWA 3B7FA 3F3PA 2P9SC 3IJ1A 2OVQB 2PM6B 3DXKC 3I7OA 5I5IA 1SQJA 5TEEA 4O3TB 3OW8A 5C2VB 4E54A 2B5MA 3RRMC 2H6QA 4X63B 2H14A 3PXWD 3OL2A 5TEFA 5A2Qg 4CC9A 4J78A 5GXHA 2GNQA 3SBRA 2P9IC 3IIWA 4GMBA 2J57G 4ZOZA 4D0KA 3UR4A 5EMJB 2I3TA 5H14A 5FKQA 3F3GA 3EI4A 3MZKA 5EM2B 2UZYB 2H9MA 1OLZA 2CO0C 3UVOA 2HJ4A 5CXBA 5K19A 2HYEA 5THAA 1U4CA 4O3UB 2OJYA 2CN3A 4FA5D 1MG2A 2IAAA 2P9LC 2QC5A 3I89A 3I7LA 3NVXA 5TDHB 1JMZB 2J55H 2Z2NA 2AGLA 1GP2B 3DXMC 2YNPA 3E0CA 3FM0A 2H6KA 2CE9A 3VGZA 4J0WA 2B4EA 1PEVA 2CO0A 1N6DA 5HE1B 2XL2A 3C99A 4O1QD 5B4WA 4LGNA 4KFMB 3I7PA 4H5JA 4FAND 2P9PC 2H13A 4TZ4A 4FWWA 3RN0D 2OVRB 5IJ7E 4BL0A 5HE3B 3SXTD 3V9FA 4K3JB 4PBZA 4PSXB 2Q7QA 4O9DA 3AL8B 3EI1B 4JSNC 4NSXA 4N14A 2AQ5A 4ES0A 4ESGA 4J8GA 1TYQC 4OWRA 1ERJA 2TRCB 5CXCA 2AH1A 3IIYA 4A11B 2AGWA 5EMMB 3L4OD 3MXXA 3OKYB 1K32A 1QNIA 4J87A 5IJ8E 3C9CA 3MMYA 4FHLA 2MTAH 4CZVA 2J56H 2CNXA 4JSXC 3JZGA 2Z2OA 2IURA 3DWLC 3RFHA 3F3FA 2PBIB 3ULEC 4JSVC 2P9UC 2BCJB 3EI2A 1PBYB 2OK4A 3I7HA 4PBYA 4QQEA 2GC4A 4A09B 4ERYA 4FA1D 3FRXA 3PSLA 2H6NA 4A08A 5CYKB 4JT6C 3K26A 1NR0A 4H5IA 4A0BB 4G56B 4GM8A 1MDAH 3EI3B 3IJ0A 2IWKA 2XYIA 5SXMA 5IGOA 4CY3A 4J81A 5HE2B 3J80g 4E5ZA 2H47A 3RSEC 3PVUB 4OZUA 4ZOVA 3SJLD 5H1MA 4J79A 3ZWLB 2CN2A 5JWZA 3AL9A 3CIKB 5GMKn 4X61B 3UKUC 4AOWA 5GXIA 4R7AB 3OKTA 5I5JA 4CY2A 3UVMA 5FKTA 4CI3A 1GOTB 4YVDA 5C9ZB 3VA6A 1TBGA 2GC7A 3BG0A 2BBKH 4XEIC 4IA9A 3SWSD 4A2LA 3EWEA 3N0EA 1R5MA 2HXCA 3OKWA 4CI2A 3JZHA 4CY1A 2QXVA 1FWXA 4CZXA 3ODTA 4QL1A 5FKSA 1SQ9A 3SFZA 5IC7A 3SVWD 3MZLA 3I8EA 2P9KC 3JZNA 4Y5RD 1YFQA 4GGAA 2G9AA 1JMXB 2W18A 3W15A 3SLED 2I3SA 3UKRC 5EMLB 3PXTD 4GM9A 5EM2A 2B5LA 3NVNA 3JRPA 3SBPA 4D6VA 1U2VC 2XU7A 2OK6A 5FQDA 4LG8A 3SCYA 4X60B 3P4FA 4ZOYA 4BUJC 2AGZA 2CE8A 2YMUA 4I79A 4JT5C 4ERQA 2PM9B 4PNKB 4GGCA 3SN6B 1VYHC 3SBQA 4XYIA 4EWRA 3MKSB 2H3XA 3RN1D 2XL3A 3L4MD 4ERZA 2Z2PA 3N0DA 4A7JA 4A0AB 1N6EA 4FA9D 4BH6A 2I0SA 1GXRA 4A2MA 4GQBB 1NEXB 5GSAA 4QT8A 1GG2B 4Z8LA 2PM7B 1JOFA 5EMKB 3UVNA 4J77A 3I2NA 4CI8A 5IT9g 2IUVA 4UI9R 3AL8A 4O45A 3EI1A 4LG9A 3MKQA 4E54B 4PC0A 3OTTA 3DM0A 3UVKA 2I0RA 2YNOA 5TF2A 4J84A 3OL2B 4IMMA 3JROA 3HFQA 3V7DB 2AH0A 3JPXA 3DSMA 4A11A 2O9KA 3OKYA 3FGBA 4Y7RA 3AFCA 2AGYA 1XIPA 3EI4B 5FLXg 1N6FA 2HJBA 5EARA 3NVQA 2G99A 4CI1A 4X3EA 5I5MA 3I7KA 3AH8B 3KRWB 4K3ID 4J0XA 2EBSA 1PGUA 5CXBB 2H9PA 2OIZA 3I7NA 2YB8B 1Q47A 1XHMA 4AEZA 3GFCA 4JSPC 1S4UX 4XYHA 4A09A 5AFU3 5CYKA 5HYNB 5FA5B 1JJUB 4A0BA 3GREA 3EI3A 1XKSA 1P22A 1OMWB 5IGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C75 H;  1B9Y A;  2YNN A;  1PI6 A;  4CY5 A;  3IJC A;  3VH0 A;  3PXS D;  3RMZ D;  5AMS A;  3ORV D;  4L3G D;  4U7A A;  3EU7 A;  4GQ2 P;  4ZOX A;  5FXY A;  2UZX B;  3KRX B;  4FB1 D;  3U4Y A;  4JD2 C;  5KDO B;  3J81 g;  5EAL A;  3JAM g;  2HES X;  3A0F A;  3EG6 A;  5HQG A;  5C2W B;  4U1E I;  4PSW B;  3CFS B;  4HDJ A;  4MK0 B;  4J73 A;  4JXM A;  3SMR A;  1SHY B;  5CXC B;  2H9L A;  2H68 A;  4J82 A;  2YBA A;  2P9N C;  5EAP A;  1B9X A;  3PE7 A;  2IUP A;  1MG3 A;  2AGX A;  2HKR A;  1K8K C;  4GM3 A;  4CZY A;  4GGD A;  3RFG A;  3JB9 L;  2OVP B;  3CFV A;  5K1C C;  1RI6 A;  4L1Q D;  2IUQ A;  2B5N A;  3EI2 B;  5FKR A;  4L9O A;  3C5M A;  2IWF A;  4FA4 D;  4GQ1 A;  2I0T A;  4A08 B;  3RLM D;  2H9N A;  5AJA A;  4J8B A;  3PVW B;  3UVL A;  3K27 A;  2HKM A;  2PM9 A;  3BG1 A;  4ZN4 A;  4FAV D;  3SHF A;  4J86 A;  4E5Z B;  3I8C A;  3V5W B;  5EAM A;  3PSC B;  1L0Q A;  4L3H D;  5HE0 B;  4GZ8 A;  5H17 A;  4QRJ A;  3IKO A;  4A0A A;  3BWS A;  3EMH A;  1A0R B;  4PXW A;  3B7F A;  3F3P A;  2P9S C;  3IJ1 A;  2OVQ B;  2PM6 B;  3DXK C;  3I7O A;  5I5I A;  1SQJ A;  5TEE A;  4O3T B;  3OW8 A;  5C2V B;  4E54 A;  2B5M A;  3RRM C;  2H6Q A;  4X63 B;  2H14 A;  3PXW D;  3OL2 A;  5TEF A;  5A2Q g;  4CC9 A;  4J78 A;  5GXH A;  2GNQ A;  3SBR A;  2P9I C;  3IIW A;  4GMB A;  2J57 G;  4ZOZ A;  4D0K A;  3UR4 A;  5EMJ B;  2I3T A;  5H14 A;  5FKQ A;  3F3G A;  3EI4 A;  3MZK A;  5EM2 B;  2UZY B;  2H9M A;  1OLZ A;  2CO0 C;  3UVO A;  2HJ4 A;  5CXB A;  5K19 A;  2HYE A;  5THA A;  1U4C A;  4O3U B;  2OJY A;  2CN3 A;  4FA5 D;  1MG2 A;  2IAA A;  2P9L C;  2QC5 A;  3I89 A;  3I7L A;  3NVX A;  5TDH B;  1JMZ B;  2J55 H;  2Z2N A;  2AGL A;  1GP2 B;  3DXM C;  2YNP A;  3E0C A;  3FM0 A;  2H6K A;  2CE9 A;  3VGZ A;  4J0W A;  2B4E A;  1PEV A;  2CO0 A;  1N6D A;  5HE1 B;  2XL2 A;  3C99 A;  4O1Q D;  5B4W A;  4LGN A;  4KFM B;  3I7P A;  4H5J A;  4FAN D;  2P9P C;  2H13 A;  4TZ4 A;  4FWW A;  3RN0 D;  2OVR B;  5IJ7 E;  4BL0 A;  5HE3 B;  3SXT D;  3V9F A;  4K3J B;  4PBZ A;  4PSX B;  2Q7Q A;  4O9D A;  3AL8 B;  3EI1 B;  4JSN C;  4NSX A;  4N14 A;  2AQ5 A;  4ES0 A;  4ESG A;  4J8G A;  1TYQ C;  4OWR A;  1ERJ A;  2TRC B;  5CXC A;  2AH1 A;  3IIY A;  4A11 B;  2AGW A;  5EMM B;  3L4O D;  3MXX A;  3OKY B;  1K32 A;  1QNI A;  4J87 A;  5IJ8 E;  3C9C A;  3MMY A;  4FHL A;  2MTA H;  4CZV A;  2J56 H;  2CNX A;  4JSX C;  3JZG A;  2Z2O A;  2IUR A;  3DWL C;  3RFH A;  3F3F A;  2PBI B;  3ULE C;  4JSV C;  2P9U C;  2BCJ B;  3EI2 A;  1PBY B;  2OK4 A;  3I7H A;  4PBY A;  4QQE A;  2GC4 A;  4A09 B;  4ERY A;  4FA1 D;  3FRX A;  3PSL A;  2H6N A;  4A08 A;  5CYK B;  4JT6 C;  3K26 A;  1NR0 A;  4H5I A;  4A0B B;  4G56 B;  4GM8 A;  1MDA H;  3EI3 B;  3IJ0 A;  2IWK A;  2XYI A;  5SXM A;  5IGO A;  4CY3 A;  4J81 A;  5HE2 B;  3J80 g;  4E5Z A;  2H47 A;  3RSE C;  3PVU B;  4OZU A;  4ZOV A;  3SJL D;  5H1M A;  4J79 A;  3ZWL B;  2CN2 A;  5JWZ A;  3AL9 A;  3CIK B;  5GMK n;  4X61 B;  3UKU C;  4AOW A;  5GXI A;  4R7A B;  3OKT A;  5I5J A;  4CY2 A;  3UVM A;  5FKT A;  4CI3 A;  1GOT B;  4YVD A;  5C9Z B;  3VA6 A;  1TBG A;  2GC7 A;  3BG0 A;  2BBK H;  4XEI C;  4IA9 A;  3SWS D;  4A2L A;  3EWE A;  3N0E A;  1R5M A;  2HXC A;  3OKW A;  4CI2 A;  3JZH A;  4CY1 A;  2QXV A;  1FWX A;  4CZX A;  3ODT A;  4QL1 A;  5FKS A;  1SQ9 A;  3SFZ A;  5IC7 A;  3SVW D;  3MZL A;  3I8E A;  2P9K C;  3JZN A;  4Y5R D;  1YFQ A;  4GGA A;  2G9A A;  1JMX B;  2W18 A;  3W15 A;  3SLE D;  2I3S A;  3UKR C;  5EML B;  3PXT D;  4GM9 A;  5EM2 A;  2B5L A;  3NVN A;  3JRP A;  3SBP A;  4D6V A;  1U2V C;  2XU7 A;  2OK6 A;  5FQD A;  4LG8 A;  3SCY A;  4X60 B;  3P4F A;  4ZOY A;  4BUJ C;  2AGZ A;  2CE8 A;  2YMU A;  4I79 A;  4JT5 C;  4ERQ A;  2PM9 B;  4PNK B;  4GGC A;  3SN6 B;  1VYH C;  3SBQ A;  4XYI A;  4EWR A;  3MKS B;  2H3X A;  3RN1 D;  2XL3 A;  3L4M D;  4ERZ A;  2Z2P A;  3N0D A;  4A7J A;  4A0A B;  1N6E A;  4FA9 D;  4BH6 A;  2I0S A;  1GXR A;  4A2M A;  4GQB B;  1NEX B;  5GSA A;  4QT8 A;  1GG2 B;  4Z8L A;  2PM7 B;  1JOF A;  5EMK B;  3UVN A;  4J77 A;  3I2N A;  4CI8 A;  5IT9 g;  2IUV A;  4UI9 R;  3AL8 A;  4O45 A;  3EI1 A;  4LG9 A;  3MKQ A;  4E54 B;  4PC0 A;  3OTT A;  3DM0 A;  3UVK A;  2I0R A;  2YNO A;  5TF2 A;  4J84 A;  3OL2 B;  4IMM A;  3JRO A;  3HFQ A;  3V7D B;  2AH0 A;  3JPX A;  3DSM A;  4A11 A;  2O9K A;  3OKY A;  3FGB A;  4Y7R A;  3AFC A;  2AGY A;  1XIP A;  3EI4 B;  5FLX g;  1N6F A;  2HJB A;  5EAR A;  3NVQ A;  2G99 A;  4CI1 A;  4X3E A;  5I5M A;  3I7K A;  3AH8 B;  3KRW B;  4K3I D;  4J0X A;  2EBS A;  1PGU A;  5CXB B;  2H9P A;  2OIZ A;  3I7N A;  2YB8 B;  1Q47 A;  1XHM A;  4AEZ A;  3GFC A;  4JSP C;  1S4U X;  4XYH A;  4A09 A;  5AFU 3;  5CYK A;  5HYN B;  5FA5 B;  1JJU B;  4A0B A;  3GRE A;  3EI3 A;  1XKS A;  1P22 A;  1OMW B;  5IGQ A; 
#chains in the Genus database with same CATH topology
 3C75 H;  3KCI A;  1B9Y A;  2YNN A;  1PI6 A;  4CY5 A;  3IJC A;  3VH0 A;  3PXS D;  3RMZ D;  4BCC A;  5AMS A;  3ORV D;  4L3G D;  4U7A A;  3EU7 A;  4GQ2 P;  4ZOX A;  4JHP C;  5FXY A;  2UZX B;  3KRX B;  4FB1 D;  3U4Y A;  2EIE A;  5M5V A;  4JD2 C;  5KDO B;  1K3I A;  3IUJ A;  4G1E A;  3J81 g;  5EAL A;  3JAM g;  2HES X;  3A0F A;  3EG6 A;  5HQG A;  5C2W B;  4U1E I;  1T2X A;  4PSW B;  3CFS B;  4HDJ A;  4MK0 B;  2WQ8 A;  4J73 A;  4JXM A;  3SMR A;  1SHY B;  3O4I A;  5CXC B;  1JV2 A;  2H9L A;  2HU7 A;  3O4H A;  2H68 A;  4J82 A;  2YBA A;  2XDW A;  2P9N C;  3NID A;  5EAP A;  3IUN A;  3IUM A;  1B9X A;  4WK0 A;  3PE7 A;  2IUP A;  1MG3 A;  2AGX A;  2VDK A;  2HKR A;  3K6S A;  1YR2 A;  1K8K C;  4GM3 A;  4CZY A;  1QFM A;  4GGD A;  3RFG A;  3FCS A;  3JB9 L;  3GD1 I;  2OVP B;  4D9S A;  3CFV A;  5K1C C;  1RI6 A;  4UM9 A;  1E5T A;  4L1Q D;  2IUQ A;  5FFG A;  2VDO A;  2B5N A;  3EQ7 A;  3EI2 B;  4BCB A;  5FKR A;  4L9O A;  3C5M A;  2IWF A;  4AN0 A;  4FA4 D;  4MMX A;  4GQ1 A;  2I0T A;  5HDB A;  4A08 B;  3RLM D;  5M5U A;  2H9N A;  5AJA A;  4J8B A;  3PVW B;  3UVL A;  3K27 A;  2HKM A;  2PM9 A;  1H2Z A;  3BG1 A;  4ZN4 A;  5E6R A;  4FAV D;  1BPO A;  3SHF A;  4J86 A;  4JHN A;  4E5Z B;  3I8C A;  3V5W B;  5EAM A;  3PSC B;  1L0Q A;  4L3H D;  5HE0 B;  1E8N A;  4GZ8 A;  5H17 A;  4QRJ A;  3IKO A;  4A0A A;  4NEN A;  1A12 A;  3EQ8 A;  3BWS A;  3EMH A;  1A0R B;  4PXW A;  3B7F A;  3F3P A;  5M5R A;  2P9S C;  3IJ1 A;  2OVQ B;  2PM6 B;  3DXK C;  3I7O A;  5I5I A;  4BP8 A;  3T3P A;  1SQJ A;  5TEE A;  4O3T B;  3OW8 A;  5C2V B;  4Z7N A;  4E54 A;  2VDM A;  2B5M A;  2HU5 A;  3RRM C;  2H6Q A;  4X63 B;  2H14 A;  3PXW D;  3OL2 A;  2VC2 A;  5TEF A;  4IRZ A;  5A2Q g;  4CC9 A;  4J78 A;  5GXH A;  2GNQ A;  3SBR A;  5M5S A;  2P9I C;  2QZP A;  3IIW A;  4GMB A;  2J57 G;  4ZOZ A;  4D0K A;  3UR4 A;  5EMJ B;  2I3T A;  5H14 A;  5FKQ A;  4DNU A;  3F3G A;  3EI4 A;  3MZK A;  5EM2 B;  2UZY B;  2H9M A;  1OLZ A;  4BCD A;  2CO0 C;  4DNW A;  3UVO A;  2HJ4 A;  5CXB A;  5K19 A;  2HYE A;  5THA A;  5E6U A;  1U4C A;  3MUO A;  2QR5 A;  4O3U B;  2OJY A;  2CN3 A;  4NBM A;  4FA5 D;  4MMY A;  1MG2 A;  2IAA A;  2P9L C;  2XZG A;  2QC5 A;  3I89 A;  3ZE1 A;  3I7L A;  3NVX A;  5TDH B;  1JMZ B;  2J55 H;  2Z2N A;  2AGL A;  1GP2 B;  3V4P A;  3DXM C;  3ZDZ A;  2YNP A;  3E0C A;  3FM0 A;  2H6K A;  1H2X A;  2CE9 A;  1H2Y A;  3VGZ A;  2VZ1 A;  4J0W A;  2B4E A;  4AMZ A;  3OF7 A;  1PEV A;  2CO0 A;  1N6D A;  5HE1 B;  4WK2 A;  2XL2 A;  3C99 A;  4O1Q D;  5B4W A;  4LGN A;  4KFM B;  3I7P A;  4H5J A;  4FAN D;  2P9P C;  2H13 A;  4TZ4 A;  4FWW A;  3RN0 D;  2OVR B;  5IJ7 E;  4MMZ A;  4BL0 A;  5HE3 B;  4G1M A;  3SXT D;  3V9F A;  5C86 A;  4K3J B;  4PBZ A;  4PSX B;  1O6G A;  2Q7Q A;  3AL8 B;  3IUQ A;  4O9D A;  3EI1 B;  4JSN C;  4NSX A;  4N14 A;  2AQ5 A;  1M1X A;  4ES0 A;  4UM8 A;  4ESG A;  4J8G A;  1TYQ C;  1GOH A;  4OWR A;  1ERJ A;  3V4V A;  2TRC B;  5CXC A;  2AH1 A;  3IIY A;  4A11 B;  2AGW A;  2EID A;  5EMM B;  3ZE2 A;  3L4O D;  3MXX A;  3OKY B;  1K32 A;  1QNI A;  4J87 A;  5IJ8 E;  3C9C A;  3MMY A;  4FHL A;  2MTA H;  4CZV A;  5M5T A;  2J56 H;  2EIC A;  2CNX A;  4JSX C;  4WK4 A;  3JZG A;  2Z2O A;  2IUR A;  3DWL C;  3RFH A;  3F3F A;  3K71 A;  4NAA A;  1UOO A;  2PBI B;  3ULE C;  3GC3 B;  4JSV C;  4WJK A;  2P9U C;  2BCJ B;  3ZDX A;  4Z7O A;  4AX4 A;  3EI2 A;  2VDQ A;  1PBY B;  2OK4 A;  3I7H A;  4PBY A;  4QQE A;  2GC4 A;  2VDL A;  2VDP A;  4A09 B;  4ERY A;  4FA1 D;  3FRX A;  3PSL A;  2H6N A;  1GOF A;  4A08 A;  5CYK B;  4JT6 C;  3K26 A;  2EIB A;  1NR0 A;  4H5I A;  4A0B B;  4G56 B;  4GM8 A;  1MDA H;  3EI3 B;  3IJ0 A;  2IWK A;  2XYI A;  5SXM A;  5IGO A;  4Z7Q A;  4CY3 A;  4J81 A;  4RE5 A;  5HE2 B;  3J80 g;  2VDN A;  4E5Z A;  2H47 A;  3RSE C;  4O2W A;  3VI3 A;  3PVU B;  4OZU A;  4ZOV A;  3SJL D;  5H1M A;  3FCU A;  4J79 A;  3MVD K;  3QI0 A;  3ZWL B;  2CN2 A;  5JWZ A;  3AL9 A;  3CIK B;  5GMK n;  4X61 B;  3UKU C;  4AOW A;  5GXI A;  4R7A B;  3ZE0 A;  3OKT A;  5I5J A;  4CY2 A;  3UVM A;  5FKT A;  4CI3 A;  1GOT B;  4YVD A;  5C9Z B;  3VA6 A;  1TBG A;  2GC7 A;  3BG0 A;  3MUN A;  2BBK H;  4XEI C;  4IA9 A;  3SWS D;  4A2L A;  3EWE A;  3N0E A;  1UOP A;  1R5M A;  2HXC A;  3OKW A;  4CI2 A;  3JZH A;  4CY1 A;  2QXV A;  1UTC A;  3T3M A;  1FWX A;  4CZX A;  3ODT A;  4QL1 A;  5FKS A;  1SQ9 A;  3SFZ A;  1E8M A;  5IC7 A;  3SVW D;  3MZL A;  3I8E A;  2P9K C;  3JZN A;  1GOG A;  4Y5R D;  1YFQ A;  4GGA A;  2G9A A;  1JMX B;  2W18 A;  3W15 A;  3SLE D;  4AMY A;  1C9L A;  2I3S A;  3UKR C;  5EML B;  3ZDY A;  1I2M B;  1O6F A;  3PXT D;  4GM9 A;  5EM2 A;  2B5L A;  3NVN A;  3JRP A;  3SBP A;  4D6V A;  1U2V C;  2XU7 A;  2OK6 A;  3K72 A;  5FQD A;  4LG8 A;  1U8C A;  3SCY A;  4X60 B;  3P4F A;  4ZOY A;  4BUJ C;  2AGZ A;  2CE8 A;  2YMU A;  4I79 A;  4JT5 C;  4ERQ A;  2PM9 B;  4PNK B;  4GGC A;  3SN6 B;  3DDU A;  1VYH C;  3SBQ A;  4XYI A;  4EWR A;  3IUL A;  4NC4 A;  5C92 A;  3MKS B;  2H3X A;  3RN1 D;  2XL3 A;  3L4M D;  4ERZ A;  4QAM A;  2Z2P A;  3N0D A;  4A7J A;  4A0A B;  1N6E A;  4FA9 D;  4BH6 A;  2I0S A;  2VDR A;  1GXR A;  4A2M A;  4GQB B;  1NEX B;  5GSA A;  4QT8 A;  1VE7 A;  1GG2 B;  4Z8L A;  2PM7 B;  3IJE A;  5E6S A;  1JOF A;  5EMK B;  1VE6 A;  5M61 A;  3UVN A;  4J77 A;  3I2N A;  3O4J A;  4CI8 A;  5IT9 g;  2IUV A;  2VZ3 A;  4UI9 R;  3AL8 A;  4O45 A;  3IVM A;  4LG9 A;  3MKQ A;  3EI1 A;  4PC0 A;  3OTT A;  3DM0 A;  4E54 B;  3UVK A;  2I0R A;  2YNO A;  5TF2 A;  3IUR A;  4J84 A;  1H2W A;  3OL2 B;  4IMM A;  3JRO A;  3HFQ A;  1L5G A;  3QHY B;  3V7D B;  2AH0 A;  4L1M A;  3VI4 A;  3JPX A;  2HU8 A;  4O02 A;  3DSM A;  4A11 A;  2O9K A;  3OKY A;  1VZ3 A;  3FGB A;  4Y7R A;  3AFC A;  2AGY A;  1XIP A;  3EI4 B;  5FLX g;  1N6F A;  2HJB A;  1TYE A;  5EAR A;  3NVQ A;  1QFS A;  1C9I A;  2G99 A;  4X3E A;  4DNV A;  4CI1 A;  5I5M A;  3I7K A;  3AH8 B;  3KRW B;  4K3I D;  4J0X A;  2EBS A;  1PGU A;  5CXB B;  4BP9 A;  2XE4 A;  2H9P A;  3NIG A;  2OIZ A;  3I7N A;  2YB8 B;  1Q47 A;  2BKL A;  1XHM A;  1VZ2 A;  4AEZ A;  3GFC A;  4JSP C;  4AN1 A;  1JTD B;  3NIF A;  1S4U X;  4RE6 A;  4XYH A;  4A09 A;  5AFU 3;  2JKX A;  5CYK A;  1UOQ A;  4G55 A;  5HYN B;  3EQ9 A;  5FFO A;  5FA5 B;  1JJU B;  4A0B A;  3GRE A;  3EI3 A;  1XKS A;  1P22 A;  1OMW B;  5IGQ A;  3O4G A; 
#chains in the Genus database with same CATH homology
 3C75 H;  1B9Y A;  2YNN A;  1PI6 A;  4CY5 A;  3IJC A;  3VH0 A;  3PXS D;  3RMZ D;  5AMS A;  3ORV D;  4L3G D;  4U7A A;  3EU7 A;  4GQ2 P;  4ZOX A;  5FXY A;  2UZX B;  3KRX B;  4FB1 D;  3U4Y A;  4JD2 C;  5KDO B;  3J81 g;  5EAL A;  3JAM g;  2HES X;  3A0F A;  3EG6 A;  5HQG A;  5C2W B;  4U1E I;  4PSW B;  3CFS B;  4HDJ A;  4MK0 B;  4J73 A;  4JXM A;  3SMR A;  1SHY B;  5CXC B;  2H9L A;  2H68 A;  4J82 A;  2YBA A;  2P9N C;  5EAP A;  1B9X A;  3PE7 A;  2IUP A;  1MG3 A;  2AGX A;  2HKR A;  1K8K C;  4GM3 A;  4CZY A;  4GGD A;  3RFG A;  3JB9 L;  2OVP B;  3CFV A;  5K1C C;  1RI6 A;  4L1Q D;  2IUQ A;  2B5N A;  3EI2 B;  5FKR A;  4L9O A;  3C5M A;  2IWF A;  4FA4 D;  4GQ1 A;  2I0T A;  4A08 B;  3RLM D;  2H9N A;  5AJA A;  4J8B A;  3PVW B;  3UVL A;  3K27 A;  2HKM A;  2PM9 A;  3BG1 A;  4ZN4 A;  4FAV D;  3SHF A;  4J86 A;  4E5Z B;  3I8C A;  3V5W B;  5EAM A;  3PSC B;  1L0Q A;  4L3H D;  5HE0 B;  4GZ8 A;  5H17 A;  4QRJ A;  3IKO A;  4A0A A;  3BWS A;  3EMH A;  1A0R B;  4PXW A;  3B7F A;  3F3P A;  2P9S C;  3IJ1 A;  2OVQ B;  2PM6 B;  3DXK C;  3I7O A;  5I5I A;  1SQJ A;  5TEE A;  4O3T B;  3OW8 A;  5C2V B;  4E54 A;  2B5M A;  3RRM C;  2H6Q A;  4X63 B;  2H14 A;  3PXW D;  3OL2 A;  5TEF A;  5A2Q g;  4CC9 A;  4J78 A;  5GXH A;  2GNQ A;  3SBR A;  2P9I C;  3IIW A;  4GMB A;  2J57 G;  4ZOZ A;  4D0K A;  3UR4 A;  5EMJ B;  2I3T A;  5H14 A;  5FKQ A;  3F3G A;  3EI4 A;  3MZK A;  5EM2 B;  2UZY B;  2H9M A;  1OLZ A;  2CO0 C;  3UVO A;  2HJ4 A;  5CXB A;  5K19 A;  2HYE A;  5THA A;  1U4C A;  4O3U B;  2OJY A;  2CN3 A;  4FA5 D;  1MG2 A;  2IAA A;  2P9L C;  2QC5 A;  3I89 A;  3I7L A;  3NVX A;  5TDH B;  1JMZ B;  2J55 H;  2Z2N A;  2AGL A;  1GP2 B;  3DXM C;  2YNP A;  3E0C A;  3FM0 A;  2H6K A;  2CE9 A;  3VGZ A;  4J0W A;  2B4E A;  1PEV A;  2CO0 A;  1N6D A;  5HE1 B;  2XL2 A;  3C99 A;  4O1Q D;  5B4W A;  4LGN A;  4KFM B;  3I7P A;  4H5J A;  4FAN D;  2P9P C;  2H13 A;  4TZ4 A;  4FWW A;  3RN0 D;  2OVR B;  5IJ7 E;  4BL0 A;  5HE3 B;  3SXT D;  3V9F A;  4K3J B;  4PBZ A;  4PSX B;  2Q7Q A;  4O9D A;  3AL8 B;  3EI1 B;  4JSN C;  4NSX A;  4N14 A;  2AQ5 A;  4ES0 A;  4ESG A;  4J8G A;  1TYQ C;  4OWR A;  1ERJ A;  2TRC B;  5CXC A;  2AH1 A;  3IIY A;  4A11 B;  2AGW A;  5EMM B;  3L4O D;  3MXX A;  3OKY B;  1K32 A;  1QNI A;  4J87 A;  5IJ8 E;  3C9C A;  3MMY A;  4FHL A;  2MTA H;  4CZV A;  2J56 H;  2CNX A;  4JSX C;  3JZG A;  2Z2O A;  2IUR A;  3DWL C;  3RFH A;  3F3F A;  2PBI B;  3ULE C;  4JSV C;  2P9U C;  2BCJ B;  3EI2 A;  1PBY B;  2OK4 A;  3I7H A;  4PBY A;  4QQE A;  2GC4 A;  4A09 B;  4ERY A;  4FA1 D;  3FRX A;  3PSL A;  2H6N A;  4A08 A;  5CYK B;  4JT6 C;  3K26 A;  1NR0 A;  4H5I A;  4A0B B;  4G56 B;  4GM8 A;  1MDA H;  3EI3 B;  3IJ0 A;  2IWK A;  2XYI A;  5SXM A;  5IGO A;  4CY3 A;  4J81 A;  5HE2 B;  3J80 g;  4E5Z A;  2H47 A;  3RSE C;  3PVU B;  4OZU A;  4ZOV A;  3SJL D;  5H1M A;  4J79 A;  3ZWL B;  2CN2 A;  5JWZ A;  3AL9 A;  3CIK B;  5GMK n;  4X61 B;  3UKU C;  4AOW A;  5GXI A;  4R7A B;  3OKT A;  5I5J A;  4CY2 A;  3UVM A;  5FKT A;  4CI3 A;  1GOT B;  4YVD A;  5C9Z B;  3VA6 A;  1TBG A;  2GC7 A;  3BG0 A;  2BBK H;  4XEI C;  4IA9 A;  3SWS D;  4A2L A;  3EWE A;  3N0E A;  1R5M A;  2HXC A;  3OKW A;  4CI2 A;  3JZH A;  4CY1 A;  2QXV A;  1FWX A;  4CZX A;  3ODT A;  4QL1 A;  5FKS A;  1SQ9 A;  3SFZ A;  5IC7 A;  3SVW D;  3MZL A;  3I8E A;  2P9K C;  3JZN A;  4Y5R D;  1YFQ A;  4GGA A;  2G9A A;  1JMX B;  2W18 A;  3W15 A;  3SLE D;  2I3S A;  3UKR C;  5EML B;  3PXT D;  4GM9 A;  5EM2 A;  2B5L A;  3NVN A;  3JRP A;  3SBP A;  4D6V A;  1U2V C;  2XU7 A;  2OK6 A;  5FQD A;  4LG8 A;  3SCY A;  4X60 B;  3P4F A;  4ZOY A;  4BUJ C;  2AGZ A;  2CE8 A;  2YMU A;  4I79 A;  4JT5 C;  4ERQ A;  2PM9 B;  4PNK B;  4GGC A;  3SN6 B;  1VYH C;  3SBQ A;  4XYI A;  4EWR A;  3MKS B;  2H3X A;  3RN1 D;  2XL3 A;  3L4M D;  4ERZ A;  2Z2P A;  3N0D A;  4A7J A;  4A0A B;  1N6E A;  4FA9 D;  4BH6 A;  2I0S A;  1GXR A;  4A2M A;  4GQB B;  1NEX B;  5GSA A;  4QT8 A;  1GG2 B;  4Z8L A;  2PM7 B;  1JOF A;  5EMK B;  3UVN A;  4J77 A;  3I2N A;  4CI8 A;  5IT9 g;  2IUV A;  4UI9 R;  3AL8 A;  4O45 A;  3EI1 A;  4LG9 A;  3MKQ A;  4E54 B;  4PC0 A;  3OTT A;  3DM0 A;  3UVK A;  2I0R A;  2YNO A;  5TF2 A;  4J84 A;  3OL2 B;  4IMM A;  3JRO A;  3HFQ A;  3V7D B;  2AH0 A;  3JPX A;  3DSM A;  4A11 A;  2O9K A;  3OKY A;  3FGB A;  4Y7R A;  3AFC A;  2AGY A;  1XIP A;  3EI4 B;  5FLX g;  1N6F A;  2HJB A;  5EAR A;  3NVQ A;  2G99 A;  4CI1 A;  4X3E A;  5I5M A;  3I7K A;  3AH8 B;  3KRW B;  4K3I D;  4J0X A;  2EBS A;  1PGU A;  5CXB B;  2H9P A;  2OIZ A;  3I7N A;  2YB8 B;  1Q47 A;  1XHM A;  4AEZ A;  3GFC A;  4JSP C;  1S4U X;  4XYH A;  4A09 A;  5AFU 3;  5CYK A;  5HYN B;  5FA5 B;  1JJU B;  4A0B A;  3GRE A;  3EI3 A;  1XKS A;  1P22 A;  1OMW B;  5IGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...