4FAND

Crystal structure of wt maug in complex with pre-methylamine dehydrogenase aged 40 days
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords Methylamine utilization protein MauG
publication title Diradical intermediate within the context of tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 91
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4fanD00
3PXTD 1R5MA 3HFQA 3I8CA 5EM2B 4JD2C 4J87A 4GQ2P 3V5WB 5I5JA 2P9SC 1GOTB 3CFSB 2B5NA 5GXIA 4LG9A 2H9LA 5EARA 3SFZA 5EALA 1NR0A 3P4FA 2P9PC 5FLXg 4A0AB 5EM2A 5IJ7E 2Z2PA 5HE1B 3ODTA 5AMSA 2G9AA 3JZGA 4CZYA 1N6EA 4J8GA 3I7LA 2Z2OA 3SN6B 2CE8A 4KFMB 3SWSD 4CI3A 5HYNB 2QC5A 1SQJA 1B9XA 1SHYB 1PBYB 3UVOA 5AJAA 4PNKB 2AGXA 3SHFA 3OL2A 2P9KC 4ZOVA 2IURA 5CYKA 4PSWB 4A2LA 5GXHA 3NVQA 3RRMC 3V9FA 4OWRA 3DXKC 4GZ8A 2I3TA 3SMRA 2GNQA 1K32A 2AH0A 1P22A 1FWXA 2CN3A 2UZYB 3OTTA 5SXMA 4CY1A 3OKYA 4XYIA 1OMWB 5A2Qg 3C75H 2IUPA 4JSNC 3ORVD 2PBIB 4JSXC 3RFGA 3JPXA 3E0CA 4QQEA 3L4OD 4GM3A 1YFQA 2XU7A 4Y5RD 4O45A 3UR4A 5FKQA 3I8EA 4FB1D 5HE2B 2H9MA 4LG8A 2EBSA 3A0FA 3K27A 5EMMB 4J73A 5GSAA 2I0TA 3RN1D 4G56B 4PBYA 5FXYA 2HJBA 5B4WA 4OZUA 3EI3B 2W18A 4FA4D 3EI1A 4U7AA 2YNNA 5K19A 3IKOA 3AH8B 4A09A 3EMHA 3I7HA 1TBGA 3RFHA 5K1CC 4BL0A 3VA6A 5I5MA 4X3EA 5GMKn 2HKRA 4GGDA 5C9ZB 3GFCA 3ULEC 3SBRA 3MKSB 3AFCA 3N0EA 1SQ9A 3JB9L 1RI6A 2P9IC 2XL3A 3IIWA 2J57G 4N14A 3I7OA 2J56H 5TDHB 5THAA 2OIZA 3VGZA 4H5JA 2YB8B 2H47A 3RSEC 3W15A 2H68A 3UVNA 5IT9g 4J77A 2YBAA 3DWLC 4J8BA 4QL1A 3OKWA 1ERJA 2HXCA 2Q7QA 4ERQA 5HE3B 5AFU3 3SBPA 2I0RA 5H1MA 4JSPC 4AEZA 3JROA 4JSVC 4CY3A 2TRCB 1S4UX 1TYQC 3SBQA 1PGUA 3OL2B 4ZOZA 2CN2A 5CYKB 4L9OA 4QT8A 5FA5B 1XIPA 2OVRB 2H6KA 2J55H 5FKSA 2P9NC 3L4MD 3SVWD 2OK4A 3IJCA 3UVLA 1B9YA 3JZNA 3SJLD 3RLMD 2AH1A 4MK0B 5FKRA 2HKMA 4X60B 4IA9A 1U2VC 3AL9A 3PSLA 2P9UC 3OKYB 4J86A 2AQ5A 2PM7B 2OVQB 2GC7A 4FA1D 3J81g 4J84A 2PM9A 4A11B 3OW8A 4JXMA 2G99A 2H3XA 3SCYA 4ERYA 1MDAH 4AOWA 4ESGA 4A0BA 5I5IA 2UZXB 3AL8B 3JRPA 3EI1B 2AGLA 4A09B 4J78A 4FAVD 4J0WA 4CI2A 4CY5A 5EAPA 1QNIA 4A11A 4GM8A 5H17A 3IJ0A 2AGYA 4FA9D 3SXTD 4XEIC 5HQGA 4JT5C 4X63B 4A08A 4O3TB 4ERZA 5CXCB 4NSXA 3I7NA 3K26A 4FWWA 3JAMg 3DM0A 1MG2A 3AL8A 4CI8A 4XYHA 3F3PA 3SLED 5TEEA 3UKRC 4CI1A 3EG6A 3MZKA 5FKTA 2CO0A 2CNXA 1L0QA 1XHMA 4J81A 4TZ4A 4D6VA 2H6QA 3CFVA 3BG0A 4YVDA 4FHLA 3FGBA 2IWFA 2P9LC 5CXCA 2HYEA 5TF2A 4E5ZB 4K3ID 1GG2B 4L1QD 3N0DA 3DXMC 2IWKA 1XKSA 2QXVA 3GREA 2XL2A 4D0KA 5EMJB 2I3SA 1OLZA 2MTAH 2YNPA 4FA5D 4BUJC 3RN0D 4J0XA 2AGWA 3UVMA 4E5ZA 4R7AB 4O3UB 3NVNA 3C9CA 4ZOYA 1Q47A 2XYIA 3PXSD 4PBZA 3MMYA 3IIYA 1N6FA 3PSCB 5EMLB 1JJUB 4PC0A 2BBKH 3KRWB 4PXWA 1JMZB 3I2NA 2PM9B 4L3HD 2OJYA 3VH0A 4UI9R 4GGCA 3KRXB 2AGZA 3MXXA 3ZWLB 4CZVA 4L3GD 1U4CA 4BH6A 4A0BB 3CIKB 3EWEA 4QRJA 2H13A 5H14A 4EWRA 1JMXB 2Z2NA 2CO0C 3FM0A 2B5MA 5HE0B 1N6DA 4GMBA 5IGOA 1NEXB 2H9NA 4PSXB 2OK6A 4CC9A 1PEVA 4A0AA 2H9PA 3UVKA 4GQ1A 4GQBB 4A08B 1VYHC 2OVPB 3EI2B 3IJ1A 3FRXA 4ES0A 3J80g 5IGQA 4J82A 3PE7A 4ZOXA 3B7FA 3I7KA 2B5LA 5C2VB 2BCJB 1GXRA 4ZN4A 3PVUB 1MG3A 3C5MA 5TEFA 3NVXA 5JWZA 4I79A 2PM6B 3JZHA 5EAMA 5FQDA 3EI2A 4O1QD 5KDOB 2YMUA 3U4YA 4CY2A 3RMZD 3UKUC 2HESX 3EU7A 3OKTA 4GM9A 2I0SA 4K3JB 4J79A 4E54B 2IUVA 3BWSA 3DSMA 4A2MA 5C2WB 2B4EA 5EMKB 1GP2B 2CE9A 1A0RB 3MZLA 4H5IA 5CXBB 2O9KA 4HDJA 2H14A 4LGNA 3EI4B 3C99A 4Y7RA 5IC7A 4JT6C 4GGAA 4U1EI 4O9DA 2YNOA 4CZXA 4A7JA 2GC4A 4X61B 1PI6A 4E54A 2IAAA 2HJ4A 2IUQA 4Z8LA 1K8KC 2H6NA 3F3FA 3BG1A 3MKQA 5CXBA 3I7PA 3PXWD 1JOFA 3EI4A 3I89A 3V7DB 4FAND 3EI3A 3PVWB 5IJ8E 3F3GA 4IMMA
chains in the Genus database with same CATH superfamily
3PXTD 1R5MA 3HFQA 3I8CA 5EM2B 4JD2C 2EIEA 4J87A 1JV2A 4GQ2P 3V5WB 2VZ1A 5I5JA 2P9SC 1I2MB 1GOTB 3CFSB 2QZPA 4WJKA 2B5NA 5GXIA 4AMYA 4LG9A 2H9LA 5EARA 3SFZA 5EALA 3VI3A 1NR0A 3P4FA 2P9PC 5FLXg 2VDMA 4A0AB 4AX4A 3IJEA 4QAMA 5EM2A 1QFMA 3V4PA 5IJ7E 2Z2PA 5HE1B 4D9SA 1U8CA 3IUMA 5HDBA 3ODTA 4WK2A 3T3MA 5AMSA 2G9AA 3JZGA 4CZYA 1C9LA 1N6EA 4J8GA 3I7LA 2Z2OA 3SN6B 2CE8A 4KFMB 3SWSD 4CI3A 5HYNB 3DDUA 2QC5A 1SQJA 1B9XA 4JHNA 1SHYB 4BCBA 1PBYB 3UVOA 5AJAA 4PNKB 5FFGA 3K6SA 2AGXA 3SHFA 3OL2A 2P9KC 4ZOVA 2IURA 2XE4A 5CYKA 4PSWB 3ZDXA 4A2LA 5GXHA 3NVQA 1H2YA 2QR5A 3RRMC 3V9FA 4OWRA 3DXKC 4RE5A 4GZ8A 2I3TA 3SMRA 2GNQA 1K32A 5M5TA 4AN0A 4BCDA 2AH0A 1P22A 4DNUA 1FWXA 2CN3A 1A12A 2UZYB 3OTTA 5SXMA 4CY1A 2VDNA 3OKYA 2EICA 4Z7NA 4XYIA 1OMWB 5A2Qg 3C75H 2IUPA 4JSNC 3ORVD 1YR2A 2PBIB 4JSXC 3RFGA 1VZ2A 3JPXA 3E0CA 4QQEA 3L4OD 4GM3A 3V4VA 1YFQA 2XU7A 4Y5RD 4O45A 3UR4A 4G1EA 5FKQA 3I8EA 4FB1D 5HE2B 2HU5A 2H9MA 2EBSA 3A0FA 3K27A 4LG8A 5EMMB 4J73A 5GSAA 3QHYB 2I0TA 3RN1D 4G56B 4PBYA 4NBMA 5FXYA 2HJBA 5B4WA 4OZUA 3EI3B 2W18A 4FA4D 3EI1A 4U7AA 2YNNA 5C92A 5K19A 3IKOA 3AH8B 4A09A 3EMHA 3I7HA 1TBGA 3RFHA 5K1CC 4BL0A 3VA6A 4AN1A 5I5MA 4X3EA 4G55A 5GMKn 2HKRA 4GGDA 4O2WA 5C9ZB 3GFCA 1H2ZA 3ULEC 3SBRA 3O4HA 3MKSB 3AFCA 3N0EA 1SQ9A 3JB9L 1M1XA 3IVMA 1RI6A 2EIBA 2P9IC 2XL3A 3IIWA 2J57G 2HU7A 4N14A 3I7OA 2J56H 5TDHB 5THAA 2OIZA 3VGZA 4H5JA 2YB8B 2H47A 3RSEC 3W15A 2H68A 1UOQA 3UVNA 5IT9g 4J77A 3MUNA 2YBAA 4JHPC 3DWLC 4J8BA 4QL1A 1GOFA 3OKWA 4RE6A 4UM9A 1ERJA 2HXCA 2Q7QA 4ERQA 5HE3B 5AFU3 1JTDB 3SBPA 2I0RA 5H1MA 4JSPC 4AEZA 3JROA 4JSVC 4CY3A 2TRCB 1S4UX 1TYQC 3ZDZA 1E5TA 3ZE2A 1H2XA 5M61A 3SBQA 1PGUA 1VE7A 3OL2B 2JKXA 4ZOZA 2CN2A 5CYKB 4L9OA 4QT8A 5FA5B 1XIPA 2OVRB 2H6KA 2J55H 5FKSA 2P9NC 3L4MD 3SVWD 3NIGA 2OK4A 4O02A 4WK4A 2VDPA 3IJCA 4BCCA 3UVLA 1B9YA 3JZNA 3SJLD 3RLMD 2AH1A 4MK0B 5FKRA 2HKMA 4X60B 4IA9A 3MVDK 1U2VC 3AL9A 3PSLA 2P9UC 3OKYB 4J86A 2AQ5A 2PM7B 4DNVA 2VZ3A 2OVQB 4IRZA 1QFSA 2GC7A 4FA1D 3J81g 2EIDA 5C86A 4J84A 2VC2A 2PM9A 4A11B 2WQ8A 3OW8A 4UM8A 4MMYA 4JXMA 1E8NA 2G99A 2H3XA 3IULA 3SCYA 4ERYA 1MDAH 4AOWA 4ESGA 4A0BA 5I5IA 2UZXB 1L5GA 3AL8B 3JRPA 3EI1B 2AGLA 4Z7QA 4A09B 4J78A 4FAVD 4J0WA 4CI2A 4CY5A 5EAPA 1QNIA 4A11A 4GM8A 5H17A 4BP9A 3IJ0A 3GD1I 4Z7OA 2AGYA 4FA9D 3SXTD 4XEIC 5HQGA 4JT5C 4X63B 4A08A 4O3TB 1UTCA 5E6SA 4MMZA 4ERZA 4AMZA 1VE6A 5CXCB 4NSXA 3I7NA 3K26A 4FWWA 3JAMg 3DM0A 1MG2A 3AL8A 4CI8A 4XYHA 3F3PA 3SLED 1GOHA 5TEEA 3T3PA 3UKRC 3KCIA 4CI1A 3EG6A 3MZKA 5FKTA 2CO0A 2CNXA 1L0QA 4L1MA 1XHMA 4NENA 4NC4A 4J81A 4TZ4A 4D6VA 1TYEA 2H6QA 3CFVA 3BG0A 3OF7A 4YVDA 4FHLA 3FGBA 2IWFA 2P9LC 5CXCA 2HYEA 4MMXA 5TF2A 3IUJA 4E5ZB 4K3ID 1GG2B 4L1QD 3N0DA 3VI4A 3DXMC 2IWKA 1XKSA 2QXVA 3GREA 2XL2A 4BP8A 4D0KA 4NAAA 5EMJB 2I3SA 5E6RA 1OLZA 2MTAH 2YNPA 4FA5D 4BUJC 3RN0D 4J0XA 2AGWA 3UVMA 4E5ZA 4R7AB 4O3UB 3FCSA 3NVNA 1C9IA 3C9CA 4ZOYA 1Q47A 3GC3B 2XYIA 3PXSD 1T2XA 4PBZA 5M5VA 3MMYA 3IIYA 1N6FA 3PSCB 5EMLB 1GOGA 1JJUB 4PC0A 2BBKH 3NIDA 3KRWB 3IUNA 4PXWA 1JMZB 3I2NA 3MUOA 2PM9B 4L3HD 2OJYA 2HU8A 3VH0A 4UI9R 4GGCA 3KRXB 3NIFA 2AGZA 3MXXA 3ZWLB 4CZVA 1UOOA 4L3GD 1U4CA 4BH6A 4A0BB 3CIKB 2VDOA 1E8MA 3EWEA 4QRJA 2H13A 5H14A 4EWRA 1JMXB 2Z2NA 2CO0C 3FM0A 2B5MA 5HE0B 1UOPA 1N6DA 4GMBA 5IGOA 1NEXB 5M5UA 3IUQA 2H9NA 4PSXB 3ZE1A 2OK6A 4CC9A 1PEVA 5M5RA 4A0AA 2H9PA 3UVKA 4GQ1A 4GQBB 4A08B 1VYHC 4WK0A 2OVPB 3EI2B 1H2WA 3IJ1A 3FRXA 4ES0A 3J80g 5IGQA 4J82A 3PE7A 4ZOXA 3IURA 3B7FA 3I7KA 2B5LA 5C2VB 3FCUA 2BCJB 1GXRA 4ZN4A 3PVUB 1MG3A 2XDWA 3C5MA 5TEFA 3NVXA 2VDLA 5JWZA 3O4IA 1VZ3A 4I79A 2PM6B 3JZHA 1O6FA 5EAMA 5FQDA 3EI2A 4O1QD 3EQ7A 5KDOB 5FFOA 2YMUA 3U4YA 4CY2A 3RMZD 3UKUC 2HESX 3EU7A 3EQ8A 3OKTA 4DNWA 3ZDYA 1O6GA 2I0SA 4GM9A 4K3JB 4J79A 4E54B 2IUVA 3BWSA 3DSMA 3K71A 4A2MA 5C2WB 2B4EA 5EMKB 1GP2B 2CE9A 1A0RB 3MZLA 4H5IA 5CXBB 3QI0A 2O9KA 4HDJA 2H14A 4LGNA 3EI4B 3C99A 4Y7RA 5IC7A 4JT6C 5E6UA 5M5SA 3K72A 4GGAA 4U1EI 3O4GA 4O9DA 2VDRA 2VDKA 2BKLA 2YNOA 4CZXA 4A7JA 2GC4A 4X61B 1BPOA 1K3IA 1PI6A 4E54A 2XZGA 2VDQA 2IAAA 2HJ4A 2IUQA 4G1MA 4Z8LA 1K8KC 2H6NA 3ZE0A 3F3FA 3BG1A 3EQ9A 3MKQA 5CXBA 3I7PA 3O4JA 3PXWD 1JOFA 3EI4A 3I89A 3V7DB 4FAND 3EI3A 3PVWB 5IJ8E 3F3GA 4IMMA
chains in the Genus database with same CATH topology
3PXTD 1R5MA 3HFQA 3I8CA 5EM2B 4JD2C 4J87A 4GQ2P 3V5WB 5I5JA 2P9SC 1GOTB 3CFSB 2B5NA 5GXIA 4LG9A 2H9LA 5EARA 3SFZA 5EALA 1NR0A 3P4FA 2P9PC 5FLXg 4A0AB 5EM2A 5IJ7E 2Z2PA 5HE1B 3ODTA 5AMSA 2G9AA 3JZGA 4CZYA 1N6EA 4J8GA 3I7LA 2Z2OA 3SN6B 2CE8A 4KFMB 3SWSD 4CI3A 5HYNB 2QC5A 1SQJA 1B9XA 1SHYB 1PBYB 3UVOA 5AJAA 4PNKB 2AGXA 3SHFA 3OL2A 2P9KC 4ZOVA 2IURA 5CYKA 4PSWB 4A2LA 5GXHA 3NVQA 3RRMC 3V9FA 4OWRA 3DXKC 4GZ8A 2I3TA 3SMRA 2GNQA 1K32A 2AH0A 1P22A 1FWXA 2CN3A 2UZYB 3OTTA 5SXMA 4CY1A 3OKYA 4XYIA 1OMWB 5A2Qg 3C75H 2IUPA 4JSNC 3ORVD 2PBIB 4JSXC 3RFGA 3JPXA 3E0CA 4QQEA 3L4OD 4GM3A 1YFQA 2XU7A 4Y5RD 4O45A 3UR4A 5FKQA 3I8EA 4FB1D 5HE2B 2H9MA 4LG8A 2EBSA 3A0FA 3K27A 5EMMB 4J73A 5GSAA 2I0TA 3RN1D 4G56B 4PBYA 5FXYA 2HJBA 5B4WA 4OZUA 3EI3B 2W18A 4FA4D 3EI1A 4U7AA 2YNNA 5K19A 3IKOA 3AH8B 4A09A 3EMHA 3I7HA 1TBGA 3RFHA 5K1CC 4BL0A 3VA6A 5I5MA 4X3EA 5GMKn 2HKRA 4GGDA 5C9ZB 3GFCA 3ULEC 3SBRA 3MKSB 3AFCA 3N0EA 1SQ9A 3JB9L 1RI6A 2P9IC 2XL3A 3IIWA 2J57G 4N14A 3I7OA 2J56H 5TDHB 5THAA 2OIZA 3VGZA 4H5JA 2YB8B 2H47A 3RSEC 3W15A 2H68A 3UVNA 5IT9g 4J77A 2YBAA 3DWLC 4J8BA 4QL1A 3OKWA 1ERJA 2HXCA 2Q7QA 4ERQA 5HE3B 5AFU3 3SBPA 2I0RA 5H1MA 4JSPC 4AEZA 3JROA 4JSVC 4CY3A 2TRCB 1S4UX 1TYQC 3SBQA 1PGUA 3OL2B 4ZOZA 2CN2A 5CYKB 4L9OA 4QT8A 5FA5B 1XIPA 2OVRB 2H6KA 2J55H 5FKSA 2P9NC 3L4MD 3SVWD 2OK4A 3IJCA 3UVLA 1B9YA 3JZNA 3SJLD 3RLMD 2AH1A 4MK0B 5FKRA 2HKMA 4X60B 4IA9A 1U2VC 3AL9A 3PSLA 2P9UC 3OKYB 4J86A 2AQ5A 2PM7B 2OVQB 2GC7A 4FA1D 3J81g 4J84A 2PM9A 4A11B 3OW8A 4JXMA 2G99A 2H3XA 3SCYA 4ERYA 1MDAH 4AOWA 4ESGA 4A0BA 5I5IA 2UZXB 3AL8B 3JRPA 3EI1B 2AGLA 4A09B 4J78A 4FAVD 4J0WA 4CI2A 4CY5A 5EAPA 1QNIA 4A11A 4GM8A 5H17A 3IJ0A 2AGYA 4FA9D 3SXTD 4XEIC 5HQGA 4JT5C 4X63B 4A08A 4O3TB 4ERZA 5CXCB 4NSXA 3I7NA 3K26A 4FWWA 3JAMg 3DM0A 1MG2A 3AL8A 4CI8A 4XYHA 3F3PA 3SLED 5TEEA 3UKRC 4CI1A 3EG6A 3MZKA 5FKTA 2CO0A 2CNXA 1L0QA 1XHMA 4J81A 4TZ4A 4D6VA 2H6QA 3CFVA 3BG0A 4YVDA 4FHLA 3FGBA 2IWFA 2P9LC 5CXCA 2HYEA 5TF2A 4E5ZB 4K3ID 1GG2B 4L1QD 3N0DA 3DXMC 2IWKA 1XKSA 2QXVA 3GREA 2XL2A 4D0KA 5EMJB 2I3SA 1OLZA 2MTAH 2YNPA 4FA5D 4BUJC 3RN0D 4J0XA 2AGWA 3UVMA 4E5ZA 4R7AB 4O3UB 3NVNA 3C9CA 4ZOYA 1Q47A 2XYIA 3PXSD 4PBZA 3MMYA 3IIYA 1N6FA 3PSCB 5EMLB 1JJUB 4PC0A 2BBKH 3KRWB 4PXWA 1JMZB 3I2NA 2PM9B 4L3HD 2OJYA 3VH0A 4UI9R 4GGCA 3KRXB 2AGZA 3MXXA 3ZWLB 4CZVA 4L3GD 1U4CA 4BH6A 4A0BB 3CIKB 3EWEA 4QRJA 2H13A 5H14A 4EWRA 1JMXB 2Z2NA 2CO0C 3FM0A 2B5MA 5HE0B 1N6DA 4GMBA 5IGOA 1NEXB 2H9NA 4PSXB 2OK6A 4CC9A 1PEVA 4A0AA 2H9PA 3UVKA 4GQ1A 4GQBB 4A08B 1VYHC 2OVPB 3EI2B 3IJ1A 3FRXA 4ES0A 3J80g 5IGQA 4J82A 3PE7A 4ZOXA 3B7FA 3I7KA 2B5LA 5C2VB 2BCJB 1GXRA 4ZN4A 3PVUB 1MG3A 3C5MA 5TEFA 3NVXA 5JWZA 4I79A 2PM6B 3JZHA 5EAMA 5FQDA 3EI2A 4O1QD 5KDOB 2YMUA 3U4YA 4CY2A 3RMZD 3UKUC 2HESX 3EU7A 3OKTA 4GM9A 2I0SA 4K3JB 4J79A 4E54B 2IUVA 3BWSA 3DSMA 4A2MA 5C2WB 2B4EA 5EMKB 1GP2B 2CE9A 1A0RB 3MZLA 4H5IA 5CXBB 2O9KA 4HDJA 2H14A 4LGNA 3EI4B 3C99A 4Y7RA 5IC7A 4JT6C 4GGAA 4U1EI 4O9DA 2YNOA 4CZXA 4A7JA 2GC4A 4X61B 1PI6A 4E54A 2IAAA 2HJ4A 2IUQA 4Z8LA 1K8KC 2H6NA 3F3FA 3BG1A 3MKQA 5CXBA 3I7PA 3PXWD 1JOFA 3EI4A 3I89A 3V7DB 4FAND 3EI3A 3PVWB 5IJ8E 3F3GA 4IMMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PXT D;  1R5M A;  3HFQ A;  3I8C A;  5EM2 B;  4JD2 C;  4J87 A;  4GQ2 P;  3V5W B;  5I5J A;  2P9S C;  1GOT B;  3CFS B;  2B5N A;  5GXI A;  4LG9 A;  2H9L A;  5EAR A;  3SFZ A;  5EAL A;  1NR0 A;  3P4F A;  2P9P C;  5FLX g;  4A0A B;  5EM2 A;  5IJ7 E;  2Z2P A;  5HE1 B;  3ODT A;  5AMS A;  2G9A A;  3JZG A;  4CZY A;  1N6E A;  4J8G A;  3I7L A;  2Z2O A;  3SN6 B;  2CE8 A;  4KFM B;  3SWS D;  4CI3 A;  5HYN B;  2QC5 A;  1SQJ A;  1B9X A;  1SHY B;  1PBY B;  3UVO A;  5AJA A;  4PNK B;  2AGX A;  3SHF A;  3OL2 A;  2P9K C;  4ZOV A;  2IUR A;  5CYK A;  4PSW B;  4A2L A;  5GXH A;  3NVQ A;  3RRM C;  3V9F A;  4OWR A;  3DXK C;  4GZ8 A;  2I3T A;  3SMR A;  2GNQ A;  1K32 A;  2AH0 A;  1P22 A;  1FWX A;  2CN3 A;  2UZY B;  3OTT A;  5SXM A;  4CY1 A;  3OKY A;  4XYI A;  1OMW B;  5A2Q g;  3C75 H;  2IUP A;  4JSN C;  3ORV D;  2PBI B;  4JSX C;  3RFG A;  3JPX A;  3E0C A;  4QQE A;  3L4O D;  4GM3 A;  1YFQ A;  2XU7 A;  4Y5R D;  4O45 A;  3UR4 A;  5FKQ A;  3I8E A;  4FB1 D;  5HE2 B;  2H9M A;  4LG8 A;  2EBS A;  3A0F A;  3K27 A;  5EMM B;  4J73 A;  5GSA A;  2I0T A;  3RN1 D;  4G56 B;  4PBY A;  5FXY A;  2HJB A;  5B4W A;  4OZU A;  3EI3 B;  2W18 A;  4FA4 D;  3EI1 A;  4U7A A;  2YNN A;  5K19 A;  3IKO A;  3AH8 B;  4A09 A;  3EMH A;  3I7H A;  1TBG A;  3RFH A;  5K1C C;  4BL0 A;  3VA6 A;  5I5M A;  4X3E A;  5GMK n;  2HKR A;  4GGD A;  5C9Z B;  3GFC A;  3ULE C;  3SBR A;  3MKS B;  3AFC A;  3N0E A;  1SQ9 A;  3JB9 L;  1RI6 A;  2P9I C;  2XL3 A;  3IIW A;  2J57 G;  4N14 A;  3I7O A;  2J56 H;  5TDH B;  5THA A;  2OIZ A;  3VGZ A;  4H5J A;  2YB8 B;  2H47 A;  3RSE C;  3W15 A;  2H68 A;  3UVN A;  5IT9 g;  4J77 A;  2YBA A;  3DWL C;  4J8B A;  4QL1 A;  3OKW A;  1ERJ A;  2HXC A;  2Q7Q A;  4ERQ A;  5HE3 B;  5AFU 3;  3SBP A;  2I0R A;  5H1M A;  4JSP C;  4AEZ A;  3JRO A;  4JSV C;  4CY3 A;  2TRC B;  1S4U X;  1TYQ C;  3SBQ A;  1PGU A;  3OL2 B;  4ZOZ A;  2CN2 A;  5CYK B;  4L9O A;  4QT8 A;  5FA5 B;  1XIP A;  2OVR B;  2H6K A;  2J55 H;  5FKS A;  2P9N C;  3L4M D;  3SVW D;  2OK4 A;  3IJC A;  3UVL A;  1B9Y A;  3JZN A;  3SJL D;  3RLM D;  2AH1 A;  4MK0 B;  5FKR A;  2HKM A;  4X60 B;  4IA9 A;  1U2V C;  3AL9 A;  3PSL A;  2P9U C;  3OKY B;  4J86 A;  2AQ5 A;  2PM7 B;  2OVQ B;  2GC7 A;  4FA1 D;  3J81 g;  4J84 A;  2PM9 A;  4A11 B;  3OW8 A;  4JXM A;  2G99 A;  2H3X A;  3SCY A;  4ERY A;  1MDA H;  4AOW A;  4ESG A;  4A0B A;  5I5I A;  2UZX B;  3AL8 B;  3JRP A;  3EI1 B;  2AGL A;  4A09 B;  4J78 A;  4FAV D;  4J0W A;  4CI2 A;  4CY5 A;  5EAP A;  1QNI A;  4A11 A;  4GM8 A;  5H17 A;  3IJ0 A;  2AGY A;  4FA9 D;  3SXT D;  4XEI C;  5HQG A;  4JT5 C;  4X63 B;  4A08 A;  4O3T B;  4ERZ A;  5CXC B;  4NSX A;  3I7N A;  3K26 A;  4FWW A;  3JAM g;  3DM0 A;  1MG2 A;  3AL8 A;  4CI8 A;  4XYH A;  3F3P A;  3SLE D;  5TEE A;  3UKR C;  4CI1 A;  3EG6 A;  3MZK A;  5FKT A;  2CO0 A;  2CNX A;  1L0Q A;  1XHM A;  4J81 A;  4TZ4 A;  4D6V A;  2H6Q A;  3CFV A;  3BG0 A;  4YVD A;  4FHL A;  3FGB A;  2IWF A;  2P9L C;  5CXC A;  2HYE A;  5TF2 A;  4E5Z B;  4K3I D;  1GG2 B;  4L1Q D;  3N0D A;  3DXM C;  2IWK A;  1XKS A;  2QXV A;  3GRE A;  2XL2 A;  4D0K A;  5EMJ B;  2I3S A;  1OLZ A;  2MTA H;  2YNP A;  4FA5 D;  4BUJ C;  3RN0 D;  4J0X A;  2AGW A;  3UVM A;  4E5Z A;  4R7A B;  4O3U B;  3NVN A;  3C9C A;  4ZOY A;  1Q47 A;  2XYI A;  3PXS D;  4PBZ A;  3MMY A;  3IIY A;  1N6F A;  3PSC B;  5EML B;  1JJU B;  4PC0 A;  2BBK H;  3KRW B;  4PXW A;  1JMZ B;  3I2N A;  2PM9 B;  4L3H D;  2OJY A;  3VH0 A;  4UI9 R;  4GGC A;  3KRX B;  2AGZ A;  3MXX A;  3ZWL B;  4CZV A;  4L3G D;  1U4C A;  4BH6 A;  4A0B B;  3CIK B;  3EWE A;  4QRJ A;  2H13 A;  5H14 A;  4EWR A;  1JMX B;  2Z2N A;  2CO0 C;  3FM0 A;  2B5M A;  5HE0 B;  1N6D A;  4GMB A;  5IGO A;  1NEX B;  2H9N A;  4PSX B;  2OK6 A;  4CC9 A;  1PEV A;  4A0A A;  2H9P A;  3UVK A;  4GQ1 A;  4GQB B;  4A08 B;  1VYH C;  2OVP B;  3EI2 B;  3IJ1 A;  3FRX A;  4ES0 A;  3J80 g;  5IGQ A;  4J82 A;  3PE7 A;  4ZOX A;  3B7F A;  3I7K A;  2B5L A;  5C2V B;  2BCJ B;  1GXR A;  4ZN4 A;  3PVU B;  1MG3 A;  3C5M A;  5TEF A;  3NVX A;  5JWZ A;  4I79 A;  2PM6 B;  3JZH A;  5EAM A;  5FQD A;  3EI2 A;  4O1Q D;  5KDO B;  2YMU A;  3U4Y A;  4CY2 A;  3RMZ D;  3UKU C;  2HES X;  3EU7 A;  3OKT A;  4GM9 A;  2I0S A;  4K3J B;  4J79 A;  4E54 B;  2IUV A;  3BWS A;  3DSM A;  4A2M A;  5C2W B;  2B4E A;  5EMK B;  1GP2 B;  2CE9 A;  1A0R B;  3MZL A;  4H5I A;  5CXB B;  2O9K A;  4HDJ A;  2H14 A;  4LGN A;  3EI4 B;  3C99 A;  4Y7R A;  5IC7 A;  4JT6 C;  4GGA A;  4U1E I;  4O9D A;  2YNO A;  4CZX A;  4A7J A;  2GC4 A;  4X61 B;  1PI6 A;  4E54 A;  2IAA A;  2HJ4 A;  2IUQ A;  4Z8L A;  1K8K C;  2H6N A;  3F3F A;  3BG1 A;  3MKQ A;  5CXB A;  3I7P A;  3PXW D;  1JOF A;  3EI4 A;  3I89 A;  3V7D B;  4FAN D;  3EI3 A;  3PVW B;  5IJ8 E;  3F3G A;  4IMM A; 
#chains in the Genus database with same CATH topology
 3PXT D;  1R5M A;  3HFQ A;  3I8C A;  5EM2 B;  4JD2 C;  2EIE A;  4J87 A;  1JV2 A;  4GQ2 P;  3V5W B;  2VZ1 A;  5I5J A;  2P9S C;  1I2M B;  1GOT B;  3CFS B;  2QZP A;  4WJK A;  2B5N A;  5GXI A;  4AMY A;  4LG9 A;  2H9L A;  5EAR A;  3SFZ A;  5EAL A;  3VI3 A;  1NR0 A;  3P4F A;  2P9P C;  5FLX g;  2VDM A;  4A0A B;  4AX4 A;  3IJE A;  4QAM A;  5EM2 A;  1QFM A;  3V4P A;  5IJ7 E;  2Z2P A;  5HE1 B;  4D9S A;  1U8C A;  3IUM A;  5HDB A;  3ODT A;  4WK2 A;  3T3M A;  5AMS A;  2G9A A;  3JZG A;  4CZY A;  1C9L A;  1N6E A;  4J8G A;  3I7L A;  2Z2O A;  3SN6 B;  2CE8 A;  4KFM B;  3SWS D;  4CI3 A;  5HYN B;  3DDU A;  2QC5 A;  1SQJ A;  1B9X A;  4JHN A;  1SHY B;  4BCB A;  1PBY B;  3UVO A;  5AJA A;  4PNK B;  5FFG A;  3K6S A;  2AGX A;  3SHF A;  3OL2 A;  2P9K C;  4ZOV A;  2IUR A;  2XE4 A;  5CYK A;  4PSW B;  3ZDX A;  4A2L A;  5GXH A;  3NVQ A;  1H2Y A;  2QR5 A;  3RRM C;  3V9F A;  4OWR A;  3DXK C;  4RE5 A;  4GZ8 A;  2I3T A;  3SMR A;  2GNQ A;  1K32 A;  5M5T A;  4AN0 A;  4BCD A;  2AH0 A;  1P22 A;  4DNU A;  1FWX A;  2CN3 A;  1A12 A;  2UZY B;  3OTT A;  5SXM A;  4CY1 A;  2VDN A;  3OKY A;  2EIC A;  4Z7N A;  4XYI A;  1OMW B;  5A2Q g;  3C75 H;  2IUP A;  4JSN C;  3ORV D;  1YR2 A;  2PBI B;  4JSX C;  3RFG A;  1VZ2 A;  3JPX A;  3E0C A;  4QQE A;  3L4O D;  4GM3 A;  3V4V A;  1YFQ A;  2XU7 A;  4Y5R D;  4O45 A;  3UR4 A;  4G1E A;  5FKQ A;  3I8E A;  4FB1 D;  5HE2 B;  2HU5 A;  2H9M A;  2EBS A;  3A0F A;  3K27 A;  4LG8 A;  5EMM B;  4J73 A;  5GSA A;  3QHY B;  2I0T A;  3RN1 D;  4G56 B;  4PBY A;  4NBM A;  5FXY A;  2HJB A;  5B4W A;  4OZU A;  3EI3 B;  2W18 A;  4FA4 D;  3EI1 A;  4U7A A;  2YNN A;  5C92 A;  5K19 A;  3IKO A;  3AH8 B;  4A09 A;  3EMH A;  3I7H A;  1TBG A;  3RFH A;  5K1C C;  4BL0 A;  3VA6 A;  4AN1 A;  5I5M A;  4X3E A;  4G55 A;  5GMK n;  2HKR A;  4GGD A;  4O2W A;  5C9Z B;  3GFC A;  1H2Z A;  3ULE C;  3SBR A;  3O4H A;  3MKS B;  3AFC A;  3N0E A;  1SQ9 A;  3JB9 L;  1M1X A;  3IVM A;  1RI6 A;  2EIB A;  2P9I C;  2XL3 A;  3IIW A;  2J57 G;  2HU7 A;  4N14 A;  3I7O A;  2J56 H;  5TDH B;  5THA A;  2OIZ A;  3VGZ A;  4H5J A;  2YB8 B;  2H47 A;  3RSE C;  3W15 A;  2H68 A;  1UOQ A;  3UVN A;  5IT9 g;  4J77 A;  3MUN A;  2YBA A;  4JHP C;  3DWL C;  4J8B A;  4QL1 A;  1GOF A;  3OKW A;  4RE6 A;  4UM9 A;  1ERJ A;  2HXC A;  2Q7Q A;  4ERQ A;  5HE3 B;  5AFU 3;  1JTD B;  3SBP A;  2I0R A;  5H1M A;  4JSP C;  4AEZ A;  3JRO A;  4JSV C;  4CY3 A;  2TRC B;  1S4U X;  1TYQ C;  3ZDZ A;  1E5T A;  3ZE2 A;  1H2X A;  5M61 A;  3SBQ A;  1PGU A;  1VE7 A;  3OL2 B;  2JKX A;  4ZOZ A;  2CN2 A;  5CYK B;  4L9O A;  4QT8 A;  5FA5 B;  1XIP A;  2OVR B;  2H6K A;  2J55 H;  5FKS A;  2P9N C;  3L4M D;  3SVW D;  3NIG A;  2OK4 A;  4O02 A;  4WK4 A;  2VDP A;  3IJC A;  4BCC A;  3UVL A;  1B9Y A;  3JZN A;  3SJL D;  3RLM D;  2AH1 A;  4MK0 B;  5FKR A;  2HKM A;  4X60 B;  4IA9 A;  3MVD K;  1U2V C;  3AL9 A;  3PSL A;  2P9U C;  3OKY B;  4J86 A;  2AQ5 A;  2PM7 B;  4DNV A;  2VZ3 A;  2OVQ B;  4IRZ A;  1QFS A;  2GC7 A;  4FA1 D;  3J81 g;  2EID A;  5C86 A;  4J84 A;  2VC2 A;  2PM9 A;  4A11 B;  2WQ8 A;  3OW8 A;  4UM8 A;  4MMY A;  4JXM A;  1E8N A;  2G99 A;  2H3X A;  3IUL A;  3SCY A;  4ERY A;  1MDA H;  4AOW A;  4ESG A;  4A0B A;  5I5I A;  2UZX B;  1L5G A;  3AL8 B;  3JRP A;  3EI1 B;  2AGL A;  4Z7Q A;  4A09 B;  4J78 A;  4FAV D;  4J0W A;  4CI2 A;  4CY5 A;  5EAP A;  1QNI A;  4A11 A;  4GM8 A;  5H17 A;  4BP9 A;  3IJ0 A;  3GD1 I;  4Z7O A;  2AGY A;  4FA9 D;  3SXT D;  4XEI C;  5HQG A;  4JT5 C;  4X63 B;  4A08 A;  4O3T B;  1UTC A;  5E6S A;  4MMZ A;  4ERZ A;  4AMZ A;  1VE6 A;  5CXC B;  4NSX A;  3I7N A;  3K26 A;  4FWW A;  3JAM g;  3DM0 A;  1MG2 A;  3AL8 A;  4CI8 A;  4XYH A;  3F3P A;  3SLE D;  1GOH A;  5TEE A;  3T3P A;  3UKR C;  3KCI A;  4CI1 A;  3EG6 A;  3MZK A;  5FKT A;  2CO0 A;  2CNX A;  1L0Q A;  4L1M A;  1XHM A;  4NEN A;  4NC4 A;  4J81 A;  4TZ4 A;  4D6V A;  1TYE A;  2H6Q A;  3CFV A;  3BG0 A;  3OF7 A;  4YVD A;  4FHL A;  3FGB A;  2IWF A;  2P9L C;  5CXC A;  2HYE A;  4MMX A;  5TF2 A;  3IUJ A;  4E5Z B;  4K3I D;  1GG2 B;  4L1Q D;  3N0D A;  3VI4 A;  3DXM C;  2IWK A;  1XKS A;  2QXV A;  3GRE A;  2XL2 A;  4BP8 A;  4D0K A;  4NAA A;  5EMJ B;  2I3S A;  5E6R A;  1OLZ A;  2MTA H;  2YNP A;  4FA5 D;  4BUJ C;  3RN0 D;  4J0X A;  2AGW A;  3UVM A;  4E5Z A;  4R7A B;  4O3U B;  3FCS A;  3NVN A;  1C9I A;  3C9C A;  4ZOY A;  1Q47 A;  3GC3 B;  2XYI A;  3PXS D;  1T2X A;  4PBZ A;  5M5V A;  3MMY A;  3IIY A;  1N6F A;  3PSC B;  5EML B;  1GOG A;  1JJU B;  4PC0 A;  2BBK H;  3NID A;  3KRW B;  3IUN A;  4PXW A;  1JMZ B;  3I2N A;  3MUO A;  2PM9 B;  4L3H D;  2OJY A;  2HU8 A;  3VH0 A;  4UI9 R;  4GGC A;  3KRX B;  3NIF A;  2AGZ A;  3MXX A;  3ZWL B;  4CZV A;  1UOO A;  4L3G D;  1U4C A;  4BH6 A;  4A0B B;  3CIK B;  2VDO A;  1E8M A;  3EWE A;  4QRJ A;  2H13 A;  5H14 A;  4EWR A;  1JMX B;  2Z2N A;  2CO0 C;  3FM0 A;  2B5M A;  5HE0 B;  1UOP A;  1N6D A;  4GMB A;  5IGO A;  1NEX B;  5M5U A;  3IUQ A;  2H9N A;  4PSX B;  3ZE1 A;  2OK6 A;  4CC9 A;  1PEV A;  5M5R A;  4A0A A;  2H9P A;  3UVK A;  4GQ1 A;  4GQB B;  4A08 B;  1VYH C;  4WK0 A;  2OVP B;  3EI2 B;  1H2W A;  3IJ1 A;  3FRX A;  4ES0 A;  3J80 g;  5IGQ A;  4J82 A;  3PE7 A;  4ZOX A;  3IUR A;  3B7F A;  3I7K A;  2B5L A;  5C2V B;  3FCU A;  2BCJ B;  1GXR A;  4ZN4 A;  3PVU B;  1MG3 A;  2XDW A;  3C5M A;  5TEF A;  3NVX A;  2VDL A;  5JWZ A;  3O4I A;  1VZ3 A;  4I79 A;  2PM6 B;  3JZH A;  1O6F A;  5EAM A;  5FQD A;  3EI2 A;  4O1Q D;  3EQ7 A;  5KDO B;  5FFO A;  2YMU A;  3U4Y A;  4CY2 A;  3RMZ D;  3UKU C;  2HES X;  3EU7 A;  3EQ8 A;  3OKT A;  4DNW A;  3ZDY A;  1O6G A;  2I0S A;  4GM9 A;  4K3J B;  4J79 A;  4E54 B;  2IUV A;  3BWS A;  3DSM A;  3K71 A;  4A2M A;  5C2W B;  2B4E A;  5EMK B;  1GP2 B;  2CE9 A;  1A0R B;  3MZL A;  4H5I A;  5CXB B;  3QI0 A;  2O9K A;  4HDJ A;  2H14 A;  4LGN A;  3EI4 B;  3C99 A;  4Y7R A;  5IC7 A;  4JT6 C;  5E6U A;  5M5S A;  3K72 A;  4GGA A;  4U1E I;  3O4G A;  4O9D A;  2VDR A;  2VDK A;  2BKL A;  2YNO A;  4CZX A;  4A7J A;  2GC4 A;  4X61 B;  1BPO A;  1K3I A;  1PI6 A;  4E54 A;  2XZG A;  2VDQ A;  2IAA A;  2HJ4 A;  2IUQ A;  4G1M A;  4Z8L A;  1K8K C;  2H6N A;  3ZE0 A;  3F3F A;  3BG1 A;  3EQ9 A;  3MKQ A;  5CXB A;  3I7P A;  3O4J A;  3PXW D;  1JOF A;  3EI4 A;  3I89 A;  3V7D B;  4FAN D;  3EI3 A;  3PVW B;  5IJ8 E;  3F3G A;  4IMM A; 
#chains in the Genus database with same CATH homology
 3PXT D;  1R5M A;  3HFQ A;  3I8C A;  5EM2 B;  4JD2 C;  4J87 A;  4GQ2 P;  3V5W B;  5I5J A;  2P9S C;  1GOT B;  3CFS B;  2B5N A;  5GXI A;  4LG9 A;  2H9L A;  5EAR A;  3SFZ A;  5EAL A;  1NR0 A;  3P4F A;  2P9P C;  5FLX g;  4A0A B;  5EM2 A;  5IJ7 E;  2Z2P A;  5HE1 B;  3ODT A;  5AMS A;  2G9A A;  3JZG A;  4CZY A;  1N6E A;  4J8G A;  3I7L A;  2Z2O A;  3SN6 B;  2CE8 A;  4KFM B;  3SWS D;  4CI3 A;  5HYN B;  2QC5 A;  1SQJ A;  1B9X A;  1SHY B;  1PBY B;  3UVO A;  5AJA A;  4PNK B;  2AGX A;  3SHF A;  3OL2 A;  2P9K C;  4ZOV A;  2IUR A;  5CYK A;  4PSW B;  4A2L A;  5GXH A;  3NVQ A;  3RRM C;  3V9F A;  4OWR A;  3DXK C;  4GZ8 A;  2I3T A;  3SMR A;  2GNQ A;  1K32 A;  2AH0 A;  1P22 A;  1FWX A;  2CN3 A;  2UZY B;  3OTT A;  5SXM A;  4CY1 A;  3OKY A;  4XYI A;  1OMW B;  5A2Q g;  3C75 H;  2IUP A;  4JSN C;  3ORV D;  2PBI B;  4JSX C;  3RFG A;  3JPX A;  3E0C A;  4QQE A;  3L4O D;  4GM3 A;  1YFQ A;  2XU7 A;  4Y5R D;  4O45 A;  3UR4 A;  5FKQ A;  3I8E A;  4FB1 D;  5HE2 B;  2H9M A;  4LG8 A;  2EBS A;  3A0F A;  3K27 A;  5EMM B;  4J73 A;  5GSA A;  2I0T A;  3RN1 D;  4G56 B;  4PBY A;  5FXY A;  2HJB A;  5B4W A;  4OZU A;  3EI3 B;  2W18 A;  4FA4 D;  3EI1 A;  4U7A A;  2YNN A;  5K19 A;  3IKO A;  3AH8 B;  4A09 A;  3EMH A;  3I7H A;  1TBG A;  3RFH A;  5K1C C;  4BL0 A;  3VA6 A;  5I5M A;  4X3E A;  5GMK n;  2HKR A;  4GGD A;  5C9Z B;  3GFC A;  3ULE C;  3SBR A;  3MKS B;  3AFC A;  3N0E A;  1SQ9 A;  3JB9 L;  1RI6 A;  2P9I C;  2XL3 A;  3IIW A;  2J57 G;  4N14 A;  3I7O A;  2J56 H;  5TDH B;  5THA A;  2OIZ A;  3VGZ A;  4H5J A;  2YB8 B;  2H47 A;  3RSE C;  3W15 A;  2H68 A;  3UVN A;  5IT9 g;  4J77 A;  2YBA A;  3DWL C;  4J8B A;  4QL1 A;  3OKW A;  1ERJ A;  2HXC A;  2Q7Q A;  4ERQ A;  5HE3 B;  5AFU 3;  3SBP A;  2I0R A;  5H1M A;  4JSP C;  4AEZ A;  3JRO A;  4JSV C;  4CY3 A;  2TRC B;  1S4U X;  1TYQ C;  3SBQ A;  1PGU A;  3OL2 B;  4ZOZ A;  2CN2 A;  5CYK B;  4L9O A;  4QT8 A;  5FA5 B;  1XIP A;  2OVR B;  2H6K A;  2J55 H;  5FKS A;  2P9N C;  3L4M D;  3SVW D;  2OK4 A;  3IJC A;  3UVL A;  1B9Y A;  3JZN A;  3SJL D;  3RLM D;  2AH1 A;  4MK0 B;  5FKR A;  2HKM A;  4X60 B;  4IA9 A;  1U2V C;  3AL9 A;  3PSL A;  2P9U C;  3OKY B;  4J86 A;  2AQ5 A;  2PM7 B;  2OVQ B;  2GC7 A;  4FA1 D;  3J81 g;  4J84 A;  2PM9 A;  4A11 B;  3OW8 A;  4JXM A;  2G99 A;  2H3X A;  3SCY A;  4ERY A;  1MDA H;  4AOW A;  4ESG A;  4A0B A;  5I5I A;  2UZX B;  3AL8 B;  3JRP A;  3EI1 B;  2AGL A;  4A09 B;  4J78 A;  4FAV D;  4J0W A;  4CI2 A;  4CY5 A;  5EAP A;  1QNI A;  4A11 A;  4GM8 A;  5H17 A;  3IJ0 A;  2AGY A;  4FA9 D;  3SXT D;  4XEI C;  5HQG A;  4JT5 C;  4X63 B;  4A08 A;  4O3T B;  4ERZ A;  5CXC B;  4NSX A;  3I7N A;  3K26 A;  4FWW A;  3JAM g;  3DM0 A;  1MG2 A;  3AL8 A;  4CI8 A;  4XYH A;  3F3P A;  3SLE D;  5TEE A;  3UKR C;  4CI1 A;  3EG6 A;  3MZK A;  5FKT A;  2CO0 A;  2CNX A;  1L0Q A;  1XHM A;  4J81 A;  4TZ4 A;  4D6V A;  2H6Q A;  3CFV A;  3BG0 A;  4YVD A;  4FHL A;  3FGB A;  2IWF A;  2P9L C;  5CXC A;  2HYE A;  5TF2 A;  4E5Z B;  4K3I D;  1GG2 B;  4L1Q D;  3N0D A;  3DXM C;  2IWK A;  1XKS A;  2QXV A;  3GRE A;  2XL2 A;  4D0K A;  5EMJ B;  2I3S A;  1OLZ A;  2MTA H;  2YNP A;  4FA5 D;  4BUJ C;  3RN0 D;  4J0X A;  2AGW A;  3UVM A;  4E5Z A;  4R7A B;  4O3U B;  3NVN A;  3C9C A;  4ZOY A;  1Q47 A;  2XYI A;  3PXS D;  4PBZ A;  3MMY A;  3IIY A;  1N6F A;  3PSC B;  5EML B;  1JJU B;  4PC0 A;  2BBK H;  3KRW B;  4PXW A;  1JMZ B;  3I2N A;  2PM9 B;  4L3H D;  2OJY A;  3VH0 A;  4UI9 R;  4GGC A;  3KRX B;  2AGZ A;  3MXX A;  3ZWL B;  4CZV A;  4L3G D;  1U4C A;  4BH6 A;  4A0B B;  3CIK B;  3EWE A;  4QRJ A;  2H13 A;  5H14 A;  4EWR A;  1JMX B;  2Z2N A;  2CO0 C;  3FM0 A;  2B5M A;  5HE0 B;  1N6D A;  4GMB A;  5IGO A;  1NEX B;  2H9N A;  4PSX B;  2OK6 A;  4CC9 A;  1PEV A;  4A0A A;  2H9P A;  3UVK A;  4GQ1 A;  4GQB B;  4A08 B;  1VYH C;  2OVP B;  3EI2 B;  3IJ1 A;  3FRX A;  4ES0 A;  3J80 g;  5IGQ A;  4J82 A;  3PE7 A;  4ZOX A;  3B7F A;  3I7K A;  2B5L A;  5C2V B;  2BCJ B;  1GXR A;  4ZN4 A;  3PVU B;  1MG3 A;  3C5M A;  5TEF A;  3NVX A;  5JWZ A;  4I79 A;  2PM6 B;  3JZH A;  5EAM A;  5FQD A;  3EI2 A;  4O1Q D;  5KDO B;  2YMU A;  3U4Y A;  4CY2 A;  3RMZ D;  3UKU C;  2HES X;  3EU7 A;  3OKT A;  4GM9 A;  2I0S A;  4K3J B;  4J79 A;  4E54 B;  2IUV A;  3BWS A;  3DSM A;  4A2M A;  5C2W B;  2B4E A;  5EMK B;  1GP2 B;  2CE9 A;  1A0R B;  3MZL A;  4H5I A;  5CXB B;  2O9K A;  4HDJ A;  2H14 A;  4LGN A;  3EI4 B;  3C99 A;  4Y7R A;  5IC7 A;  4JT6 C;  4GGA A;  4U1E I;  4O9D A;  2YNO A;  4CZX A;  4A7J A;  2GC4 A;  4X61 B;  1PI6 A;  4E54 A;  2IAA A;  2HJ4 A;  2IUQ A;  4Z8L A;  1K8K C;  2H6N A;  3F3F A;  3BG1 A;  3MKQ A;  5CXB A;  3I7P A;  3PXW D;  1JOF A;  3EI4 A;  3I89 A;  3V7D B;  4FAN D;  3EI3 A;  3PVW B;  5IJ8 E;  3F3G A;  4IMM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...