4FAND

Crystal structure of wt maug in complex with pre-methylamine dehydrogenase aged 40 days
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diradical intermediate within the context of tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
molecule keywords Methylamine utilization protein MauG
total genus 91
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4fanD00
4ESGA 2HESX 5C9ZB 1QNIA 4JSVC 4A0AA 3AL8B 2YB8B 3JZHA 4CY3A 3ODTA 4PBYA 3PXWD 4O3UB 4ERQA 3RFGA 3SMRA 5AJAA 4D0KA 3CFVA 3CFSB 3SBPA 2H9MA 2BBKH 4IMMA 1R5MA 1N6FA 5FQDA 2IURA 4X60B 4J84A 4A0BA 4AOWA 3NVQA 3JROA 5KDOB 3U4YA 2GC4A 3DXMC 2OVPB 3FRXA 4A0AB 5TF2A 3V7DB 1RI6A 3P4FA 3I7PA 2OIZA 2AGWA 2GC7A 4PNKB 4MK0B 3ZWLB 2H9LA 4CI8A 5H17A 4A2MA 3I7HA 4CZXA 2J57G 5I5IA 3JZNA 3MZLA 4E5ZA 2P9SC 3KRXB 2H47A 4NSXA 5H14A 2XYIA 3PSLA 2EBSA 2HXCA 2AGLA 3OL2B 3GFCA 5EAMA 4O3TB 4CI1A 5CXCB 4FA5D 2YNNA 4L9OA 4ZN4A 5FA5B 3GREA 5GSAA 3SBQA 1XIPA 4QL1A 2G9AA 3BG0A 2H13A 3PVUB 2HYEA 5EMMB 4J0WA 5FKQA 5CYKA 4J79A 5CXBA 5EAPA 5I5JA 3NVXA 4J87A 2YNOA 1B9XA 3SHFA 4X3EA 1N6EA 4A11A 3IJ0A 2CNXA 2TRCB 2I0TA 2H3XA 4D6VA 5HE1B 2B5LA 4E54A 1ERJA 3EI4A 3C5MA 4I79A 5H1MA 1JOFA 2PM6B 4A08B 4ERZA 2H6QA 3SXTD 2UZXB 5HE2B 4OWRA 2W18A 3RRMC 4JT6C 3V9FA 3N0EA 3I2NA 1GG2B 2HJBA 4CZVA 1VYHC 2PM9B 5EARA 3OL2A 1XHMA 5K1CC 1FWXA 3OKTA 3VA6A 3IJ1A 5IGOA 5TEFA 1S4UX 3DSMA 3AH8B 4LG9A 4GZ8A 4GMBA 3JRPA 3RLMD 4QT8A 4BUJC 2IWKA 1YFQA 4J8GA 5JWZA 4PXWA 1PBYB 1XKSA 2P9UC 5EM2B 4J82A 5SXMA 2OJYA 3AL9A 3JZGA 4XYIA 4GGCA 2OVQB 4U1EI 1OLZA 2AH1A 3JPXA 5IJ8E 1JJUB 3OKYB 3SN6B 4O9DA 4BH6A 3K26A 5B4WA 5HYNB 3J81g 1K32A 4CY2A 3RSEC 2IUVA 3F3PA 2Q7QA 3FM0A 4J73A 4GQ1A 4CI3A 4ES0A 2PBIB 1NEXB 3UVLA 3B7FA 3DWLC 3EMHA 3MKQA 4A09A 5A2Qg 3DM0A 4JSNC 2AGYA 4XYHA 4A0BB 5HE0B 3MZKA 2CO0C 2Z2PA 4CZYA 1U4CA 3RN0D 2H14A 4O1QD 3W15A 5CXBB 2P9IC 1L0QA 2CN2A 3I89A 3C9CA 4PC0A 4FA4D 1N6DA 2P9PC 3UVMA 5HQGA 3AL8A 4K3ID 1GXRA 2MTAH 2YBAA 3EI1B 2IAAA 2P9KC 1JMZB 4TZ4A 5IC7A 5CYKB 3UKRC 3EI3A 4Z8LA 2UZYB 4J78A 2OK6A 4QRJA 2HKRA 3I7NA 3RMZD 4A7JA 5I5MA 2P9LC 4J8BA 4R7AB 4X63B 4PBZA 3UVKA 5TEEA 3PE7A 3EI4B 4JD2C 2J56H 4YVDA 4L1QD 3MXXA 3L4MD 4L3HD 3C75H 1PI6A 1NR0A 3PXSD 3I7OA 4O45A 5TDHB 3SFZA 4GM8A 2I0RA 4K3JB 3F3GA 3IIYA 4UI9R 3BG1A 1SQJA 3OTTA 3DXKC 5HE3B 3UVOA 2AGZA 4JXMA 2CN3A 4ZOZA 3RN1D 5THAA 4A11B 2Z2NA 1GP2B 4PSWB 4E54B 4LGNA 3JAMg 3I8CA 3C99A 4FHLA 4GGDA 2CE8A 3MKSB 2CO0A 3NVNA 5IT9g 3PVWB 2J55H 3CIKB 3I8EA 3EI2B 1SHYB 3I7KA 4CC9A 4J77A 1TBGA 2OVRB 3N0DA 4CY1A 5IJ7E 5FKSA 3KRWB 2XU7A 5GXIA 1Q47A 1GOTB 2G99A 2QXVA 1A0RB 1MDAH 2GNQA 3FGBA 4FB1D 3BWSA 5FKTA 3PSCB 3EWEA 2QC5A 1TYQC 4PSXB 4ZOVA 3V5WB 1SQ9A 4H5JA 3VH0A 3OKWA 1B9YA 3SJLD 4A2LA 4ZOYA 4G56B 2H6NA 2AGXA 3UR4A 3EI2A 3AFCA 5EM2A 3EI3B 3F3FA 4ZOXA 5CXCA 3VGZA 4N14A 2Z2OA 4IA9A 4QQEA 3JB9L 3IKOA 5EALA 5AFU3 4FAND 3OKYA 1PEVA 3K27A 4CY5A 5K19A 3SVWD 2IUPA 4U7AA 5C2WB 5EMJB 5FKRA 3UVNA 2HKMA 4FWWA 2I0SA 3E0CA 4A09B 4AEZA 2IWFA 5IGQA 2HJ4A 1MG2A 2YNPA 3L4OD 4E5ZB 4Y5RD 4GQ2P 4H5IA 3PXTD 3SLED 3IIWA 2YMUA 4OZUA 4X61B 4FA1D 1U2VC 3IJCA 4LG8A 3SWSD 1JMXB 1MG3A 1OMWB 4JSPC 4GM9A 3EI1A 4A08A 4GM3A 3SBRA 4FA9D 3SCYA 2BCJB 4KFMB 5GMKn 4J0XA 2H9PA 5FXYA 4EWRA 1P22A 5EMKB 2B5NA 2XL3A 2O9KA 5C2VB 2PM9A 2AQ5A 3EU7A 3OW8A 5FLXg 2B5MA 2P9NC 3UKUC 3MMYA 3I7LA 1PGUA 3J80g 2H9NA 4HDJA 2I3SA 4GGAA 4Y7RA 3ORVD 2AH0A 2XL2A 4XEIC 4JT5C 5GXHA 2H6KA 4J86A 4CI2A 3HFQA 2PM7B 5AMSA 2IUQA 4GQBB 2CE9A 4L3GD 3EG6A 3A0FA 4BL0A 2H68A 4ERYA 3ULEC 2I3TA 4FAVD 1K8KC 2B4EA 4J81A 3RFHA 2OK4A 5EMLB 4JSXC
chains in the Genus database with same CATH superfamily
4ESGA 2HESX 3VI4A 3IJEA 5C9ZB 1QNIA 4JSVC 4A0AA 2QZPA 3AL8B 2YB8B 3JZHA 2VDLA 4CY3A 3ODTA 4PBYA 3PXWD 4O3UB 4ERQA 3OF7A 3RFGA 3SMRA 2EIEA 2XE4A 1E8NA 5AJAA 5HDBA 4D0KA 3CFVA 3CFSB 3SBPA 2H9MA 3VI3A 1JV2A 2BBKH 4IMMA 1R5MA 5FFOA 1N6FA 5FQDA 2IURA 4X60B 4J84A 4BCBA 4A0BA 4AOWA 1TYEA 3QHYB 3T3PA 1M1XA 1VE7A 3NVQA 3JROA 3IUJA 5KDOB 3U4YA 2GC4A 3DXMC 4G55A 2OVPB 3FRXA 4A0AB 5TF2A 3V4PA 3DDUA 1RI6A 3P4FA 3V7DB 3I7PA 2OIZA 2AGWA 2GC7A 4PNKB 4MK0B 3ZWLB 2H9LA 4MMXA 4CI8A 5H17A 4A2MA 5E6UA 3I7HA 4CZXA 2J57G 5I5IA 3JZNA 4AMYA 3MZLA 4E5ZA 2P9SC 3KRXB 2H47A 4NSXA 5H14A 1H2YA 2XYIA 3PSLA 2EBSA 2HXCA 2AGLA 3OL2B 3GFCA 5EAMA 4O3TB 4CI1A 5CXCB 4FA5D 4AMZA 2YNNA 1O6GA 4Z7QA 4L9OA 4ZN4A 5FA5B 3GREA 5GSAA 3SBQA 1XIPA 4WK2A 4QL1A 2G9AA 3BG0A 5M5SA 2H13A 3PVUB 5C92A 4WJKA 2HYEA 2VDQA 3ZE2A 5EMMB 3NIFA 4J0WA 5FKQA 5CYKA 4J79A 5CXBA 5EAPA 5I5JA 3NVXA 1GOGA 4J87A 3ZE0A 1QFMA 2YNOA 1B9XA 3SHFA 4X3EA 1N6EA 4A11A 3IJ0A 4BP8A 2CNXA 2TRCB 2EIBA 2I0TA 1UOQA 2H3XA 4D6VA 5HE1B 1QFSA 1YR2A 2B5LA 2EIDA 4E54A 1ERJA 1VZ3A 3EI4A 3C5MA 4I79A 5H1MA 1JOFA 2PM6B 2BKLA 4ERZA 2H6QA 4A08B 3SXTD 3GD1I 2UZXB 5HE2B 4OWRA 2W18A 3RRMC 4JT6C 3V9FA 3O4JA 4UM8A 4Z7NA 3K6SA 3N0EA 3I2NA 1GG2B 2HJBA 1E5TA 4CZVA 1U8CA 1VYHC 2PM9B 5EARA 3OL2A 3IURA 1XHMA 5K1CC 1FWXA 3OKTA 3VA6A 3IJ1A 5IGOA 5TEFA 1S4UX 3DSMA 3AH8B 4G1MA 4LG9A 4GZ8A 4GMBA 3JRPA 5M5TA 3ZDYA 3RLMD 4QT8A 4BUJC 2IWKA 1YFQA 5E6SA 4J8GA 3NIDA 5JWZA 4PXWA 1PBYB 1XKSA 2P9UC 5EM2B 4J82A 5SXMA 3JZGA 2OJYA 3AL9A 4XYIA 4Z7OA 4GGCA 2OVQB 4U1EI 1OLZA 2AH1A 3JPXA 1GOHA 5IJ8E 1JJUB 3OKYB 3SN6B 4O9DA 4BH6A 3K26A 5B4WA 5HYNB 3J81g 1K32A 4NAAA 4CY2A 3MVDK 3RSEC 4L1MA 2IUVA 2HU5A 4IRZA 3F3PA 5M5RA 2Q7QA 3FM0A 4J73A 4NBMA 2VDOA 4GQ1A 4CI3A 4ES0A 2PBIB 1NEXB 3UVLA 3O4HA 3B7FA 4QAMA 3DWLC 1BPOA 3EMHA 3MKQA 4DNWA 5A2Qg 4A09A 3DM0A 4JSNC 2AGYA 4XYHA 3O4GA 4A0BB 5HE0B 3MZKA 2CO0C 2Z2PA 4CZYA 1U4CA 2XDWA 3RN0D 2VC2A 2H14A 4O1QD 3W15A 5CXBB 2P9IC 1L0QA 2CN2A 3I89A 4NENA 3C9CA 4PC0A 4FA4D 1N6DA 2P9PC 2XZGA 3UVMA 2VDMA 5HQGA 3KCIA 3AL8A 5E6RA 4K3ID 1GXRA 4AN0A 2MTAH 2YBAA 4WK4A 3EI1B 2IAAA 2P9KC 1JMZB 4TZ4A 5IC7A 5M61A 5CYKB 3UKRC 3EI3A 4Z8LA 2UZYB 4J78A 1C9LA 3IUQA 2OK6A 4QRJA 2HKRA 3I7NA 3RMZD 4A7JA 5I5MA 2P9LC 4J8BA 5M5UA 1UOPA 4R7AB 4X63B 4PBZA 3UVKA 4WK0A 1K3IA 5TEEA 3PE7A 3EI4B 4JD2C 2J56H 4YVDA 4L1QD 3MXXA 3L4MD 4L3HD 1H2ZA 3C75H 5FFGA 1PI6A 1NR0A 3PXSD 4D9SA 1VZ2A 3I7OA 2WQ8A 1JTDB 4O45A 5TDHB 3SFZA 4AX4A 4GM8A 2I0RA 4K3JB 3F3GA 3IIYA 4UI9R 3BG1A 1A12A 1SQJA 3DXKC 3OTTA 4UM9A 5HE3B 3UVOA 2AGZA 3EQ9A 4JXMA 2CN3A 4ZOZA 1L5GA 1GOFA 3RN1D 5THAA 4A11B 2Z2NA 4RE6A 4MMYA 1GP2B 4PSWB 4E54B 4LGNA 3JAMg 4O02A 3I8CA 3C99A 4FHLA 3EQ8A 4GGDA 4BP9A 2CE8A 3MKSB 2CO0A 3NVNA 5IT9g 4BCDA 3PVWB 4RE5A 2J55H 3CIKB 3I8EA 3EI2B 1SHYB 2EICA 2HU8A 3I7KA 4CC9A 4J77A 1TBGA 1VE6A 2OVRB 3N0DA 4MMZA 2QR5A 4CY1A 5IJ7E 5FKSA 3KRWB 2XU7A 5GXIA 1E8MA 3MUOA 5M5VA 4AN1A 1Q47A 4BCCA 1GOTB 2G99A 2QXVA 1A0RB 1MDAH 2GNQA 3FGBA 4FB1D 3BWSA 5FKTA 3PSCB 3EWEA 2QC5A 2JKXA 1TYQC 4PSXB 4ZOVA 3V5WB 1SQ9A 4H5JA 3VH0A 3OKWA 1B9YA 3SJLD 4A2LA 4ZOYA 4G56B 2H6NA 2AGXA 3UR4A 3EI2A 3AFCA 5EM2A 3V4VA 3EI3B 3F3FA 4ZOXA 1UOOA 5CXCA 3VGZA 4N14A 4NC4A 2Z2OA 4IA9A 4QQEA 3JB9L 3IKOA 3EQ7A 5EALA 5AFU3 4FAND 3OKYA 3IUMA 1PEVA 3K27A 4CY5A 5K19A 3SVWD 2IUPA 4U7AA 5C2WB 5EMJB 2VZ1A 5FKRA 3UVNA 2HKMA 4FWWA 3ZE1A 3O4IA 2VDRA 2I0SA 3E0CA 4A09B 4AEZA 2IWFA 3T3MA 5IGQA 2HJ4A 1MG2A 2VZ3A 2YNPA 3L4OD 4E5ZB 4Y5RD 4GQ2P 4H5IA 3FCUA 3PXTD 3SLED 3IIWA 2YMUA 4OZUA 4X61B 4FA1D 2VDNA 1U2VC 3IJCA 1T2XA 4LG8A 1H2XA 3SWSD 3IUNA 3IVMA 1JMXB 1MG3A 1OMWB 3FCSA 3GC3B 4JSPC 4GM9A 3EI1A 1O6FA 4A08A 4GM3A 3SBRA 4FA9D 3SCYA 2BCJB 4KFMB 5GMKn 4J0XA 3MUNA 2H9PA 5FXYA 4EWRA 1P22A 5EMKB 2B5NA 5C86A 2XL3A 2O9KA 5C2VB 1C9IA 2PM9A 3NIGA 2VDKA 2AQ5A 3EU7A 4DNVA 3OW8A 5FLXg 2B5MA 2P9NC 3UKUC 3MMYA 3K72A 3IULA 3I7LA 1PGUA 3ZDZA 3J80g 2H9NA 4HDJA 2I3SA 4GGAA 4Y7RA 3ORVD 2AH0A 1I2MB 4O2WA 2XL2A 4DNUA 2VDPA 4XEIC 4JT5C 5GXHA 2H6KA 4G1EA 3ZDXA 4J86A 2HU7A 4CI2A 3HFQA 2PM7B 5AMSA 1H2WA 4JHPC 2IUQA 4GQBB 2CE9A 3QI0A 4L3GD 3EG6A 3A0FA 4BL0A 2H68A 4ERYA 3ULEC 2I3TA 4FAVD 1K8KC 2B4EA 4J81A 1UTCA 3K71A 4JHNA 3RFHA 2OK4A 5EMLB 4JSXC
chains in the Genus database with same CATH topology
4ESGA 2HESX 5C9ZB 1QNIA 4JSVC 4A0AA 3AL8B 2YB8B 3JZHA 4CY3A 3ODTA 4PBYA 3PXWD 4O3UB 4ERQA 3RFGA 3SMRA 5AJAA 4D0KA 3CFVA 3CFSB 3SBPA 2H9MA 2BBKH 4IMMA 1R5MA 1N6FA 5FQDA 2IURA 4X60B 4J84A 4A0BA 4AOWA 3NVQA 3JROA 5KDOB 3U4YA 2GC4A 3DXMC 2OVPB 3FRXA 4A0AB 5TF2A 3V7DB 1RI6A 3P4FA 3I7PA 2OIZA 2AGWA 2GC7A 4PNKB 4MK0B 3ZWLB 2H9LA 4CI8A 5H17A 4A2MA 3I7HA 4CZXA 2J57G 5I5IA 3JZNA 3MZLA 4E5ZA 2P9SC 3KRXB 2H47A 4NSXA 5H14A 2XYIA 3PSLA 2EBSA 2HXCA 2AGLA 3OL2B 3GFCA 5EAMA 4O3TB 4CI1A 5CXCB 4FA5D 2YNNA 4L9OA 4ZN4A 5FA5B 3GREA 5GSAA 3SBQA 1XIPA 4QL1A 2G9AA 3BG0A 2H13A 3PVUB 2HYEA 5EMMB 4J0WA 5FKQA 5CYKA 4J79A 5CXBA 5EAPA 5I5JA 3NVXA 4J87A 2YNOA 1B9XA 3SHFA 4X3EA 1N6EA 4A11A 3IJ0A 2CNXA 2TRCB 2I0TA 2H3XA 4D6VA 5HE1B 2B5LA 4E54A 1ERJA 3EI4A 3C5MA 4I79A 5H1MA 1JOFA 2PM6B 4A08B 4ERZA 2H6QA 3SXTD 2UZXB 5HE2B 4OWRA 2W18A 3RRMC 4JT6C 3V9FA 3N0EA 3I2NA 1GG2B 2HJBA 4CZVA 1VYHC 2PM9B 5EARA 3OL2A 1XHMA 5K1CC 1FWXA 3OKTA 3VA6A 3IJ1A 5IGOA 5TEFA 1S4UX 3DSMA 3AH8B 4LG9A 4GZ8A 4GMBA 3JRPA 3RLMD 4QT8A 4BUJC 2IWKA 1YFQA 4J8GA 5JWZA 4PXWA 1PBYB 1XKSA 2P9UC 5EM2B 4J82A 5SXMA 2OJYA 3AL9A 3JZGA 4XYIA 4GGCA 2OVQB 4U1EI 1OLZA 2AH1A 3JPXA 5IJ8E 1JJUB 3OKYB 3SN6B 4O9DA 4BH6A 3K26A 5B4WA 5HYNB 3J81g 1K32A 4CY2A 3RSEC 2IUVA 3F3PA 2Q7QA 3FM0A 4J73A 4GQ1A 4CI3A 4ES0A 2PBIB 1NEXB 3UVLA 3B7FA 3DWLC 3EMHA 3MKQA 4A09A 5A2Qg 3DM0A 4JSNC 2AGYA 4XYHA 4A0BB 5HE0B 3MZKA 2CO0C 2Z2PA 4CZYA 1U4CA 3RN0D 2H14A 4O1QD 3W15A 5CXBB 2P9IC 1L0QA 2CN2A 3I89A 3C9CA 4PC0A 4FA4D 1N6DA 2P9PC 3UVMA 5HQGA 3AL8A 4K3ID 1GXRA 2MTAH 2YBAA 3EI1B 2IAAA 2P9KC 1JMZB 4TZ4A 5IC7A 5CYKB 3UKRC 3EI3A 4Z8LA 2UZYB 4J78A 2OK6A 4QRJA 2HKRA 3I7NA 3RMZD 4A7JA 5I5MA 2P9LC 4J8BA 4R7AB 4X63B 4PBZA 3UVKA 5TEEA 3PE7A 3EI4B 4JD2C 2J56H 4YVDA 4L1QD 3MXXA 3L4MD 4L3HD 3C75H 1PI6A 1NR0A 3PXSD 3I7OA 4O45A 5TDHB 3SFZA 4GM8A 2I0RA 4K3JB 3F3GA 3IIYA 4UI9R 3BG1A 1SQJA 3OTTA 3DXKC 5HE3B 3UVOA 2AGZA 4JXMA 2CN3A 4ZOZA 3RN1D 5THAA 4A11B 2Z2NA 1GP2B 4PSWB 4E54B 4LGNA 3JAMg 3I8CA 3C99A 4FHLA 4GGDA 2CE8A 3MKSB 2CO0A 3NVNA 5IT9g 3PVWB 2J55H 3CIKB 3I8EA 3EI2B 1SHYB 3I7KA 4CC9A 4J77A 1TBGA 2OVRB 3N0DA 4CY1A 5IJ7E 5FKSA 3KRWB 2XU7A 5GXIA 1Q47A 1GOTB 2G99A 2QXVA 1A0RB 1MDAH 2GNQA 3FGBA 4FB1D 3BWSA 5FKTA 3PSCB 3EWEA 2QC5A 1TYQC 4PSXB 4ZOVA 3V5WB 1SQ9A 4H5JA 3VH0A 3OKWA 1B9YA 3SJLD 4A2LA 4ZOYA 4G56B 2H6NA 2AGXA 3UR4A 3EI2A 3AFCA 5EM2A 3EI3B 3F3FA 4ZOXA 5CXCA 3VGZA 4N14A 2Z2OA 4IA9A 4QQEA 3JB9L 3IKOA 5EALA 5AFU3 4FAND 3OKYA 1PEVA 3K27A 4CY5A 5K19A 3SVWD 2IUPA 4U7AA 5C2WB 5EMJB 5FKRA 3UVNA 2HKMA 4FWWA 2I0SA 3E0CA 4A09B 4AEZA 2IWFA 5IGQA 2HJ4A 1MG2A 2YNPA 3L4OD 4E5ZB 4Y5RD 4GQ2P 4H5IA 3PXTD 3SLED 3IIWA 2YMUA 4OZUA 4X61B 4FA1D 1U2VC 3IJCA 4LG8A 3SWSD 1JMXB 1MG3A 1OMWB 4JSPC 4GM9A 3EI1A 4A08A 4GM3A 3SBRA 4FA9D 3SCYA 2BCJB 4KFMB 5GMKn 4J0XA 2H9PA 5FXYA 4EWRA 1P22A 5EMKB 2B5NA 2XL3A 2O9KA 5C2VB 2PM9A 2AQ5A 3EU7A 3OW8A 5FLXg 2B5MA 2P9NC 3UKUC 3MMYA 3I7LA 1PGUA 3J80g 2H9NA 4HDJA 2I3SA 4GGAA 4Y7RA 3ORVD 2AH0A 2XL2A 4XEIC 4JT5C 5GXHA 2H6KA 4J86A 4CI2A 3HFQA 2PM7B 5AMSA 2IUQA 4GQBB 2CE9A 4L3GD 3EG6A 3A0FA 4BL0A 2H68A 4ERYA 3ULEC 2I3TA 4FAVD 1K8KC 2B4EA 4J81A 3RFHA 2OK4A 5EMLB 4JSXC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ESG A;  2HES X;  5C9Z B;  1QNI A;  4JSV C;  4A0A A;  3AL8 B;  2YB8 B;  3JZH A;  4CY3 A;  3ODT A;  4PBY A;  3PXW D;  4O3U B;  4ERQ A;  3RFG A;  3SMR A;  5AJA A;  4D0K A;  3CFV A;  3CFS B;  3SBP A;  2H9M A;  2BBK H;  4IMM A;  1R5M A;  1N6F A;  5FQD A;  2IUR A;  4X60 B;  4J84 A;  4A0B A;  4AOW A;  3NVQ A;  3JRO A;  5KDO B;  3U4Y A;  2GC4 A;  3DXM C;  2OVP B;  3FRX A;  4A0A B;  5TF2 A;  3V7D B;  1RI6 A;  3P4F A;  3I7P A;  2OIZ A;  2AGW A;  2GC7 A;  4PNK B;  4MK0 B;  3ZWL B;  2H9L A;  4CI8 A;  5H17 A;  4A2M A;  3I7H A;  4CZX A;  2J57 G;  5I5I A;  3JZN A;  3MZL A;  4E5Z A;  2P9S C;  3KRX B;  2H47 A;  4NSX A;  5H14 A;  2XYI A;  3PSL A;  2EBS A;  2HXC A;  2AGL A;  3OL2 B;  3GFC A;  5EAM A;  4O3T B;  4CI1 A;  5CXC B;  4FA5 D;  2YNN A;  4L9O A;  4ZN4 A;  5FA5 B;  3GRE A;  5GSA A;  3SBQ A;  1XIP A;  4QL1 A;  2G9A A;  3BG0 A;  2H13 A;  3PVU B;  2HYE A;  5EMM B;  4J0W A;  5FKQ A;  5CYK A;  4J79 A;  5CXB A;  5EAP A;  5I5J A;  3NVX A;  4J87 A;  2YNO A;  1B9X A;  3SHF A;  4X3E A;  1N6E A;  4A11 A;  3IJ0 A;  2CNX A;  2TRC B;  2I0T A;  2H3X A;  4D6V A;  5HE1 B;  2B5L A;  4E54 A;  1ERJ A;  3EI4 A;  3C5M A;  4I79 A;  5H1M A;  1JOF A;  2PM6 B;  4A08 B;  4ERZ A;  2H6Q A;  3SXT D;  2UZX B;  5HE2 B;  4OWR A;  2W18 A;  3RRM C;  4JT6 C;  3V9F A;  3N0E A;  3I2N A;  1GG2 B;  2HJB A;  4CZV A;  1VYH C;  2PM9 B;  5EAR A;  3OL2 A;  1XHM A;  5K1C C;  1FWX A;  3OKT A;  3VA6 A;  3IJ1 A;  5IGO A;  5TEF A;  1S4U X;  3DSM A;  3AH8 B;  4LG9 A;  4GZ8 A;  4GMB A;  3JRP A;  3RLM D;  4QT8 A;  4BUJ C;  2IWK A;  1YFQ A;  4J8G A;  5JWZ A;  4PXW A;  1PBY B;  1XKS A;  2P9U C;  5EM2 B;  4J82 A;  5SXM A;  2OJY A;  3AL9 A;  3JZG A;  4XYI A;  4GGC A;  2OVQ B;  4U1E I;  1OLZ A;  2AH1 A;  3JPX A;  5IJ8 E;  1JJU B;  3OKY B;  3SN6 B;  4O9D A;  4BH6 A;  3K26 A;  5B4W A;  5HYN B;  3J81 g;  1K32 A;  4CY2 A;  3RSE C;  2IUV A;  3F3P A;  2Q7Q A;  3FM0 A;  4J73 A;  4GQ1 A;  4CI3 A;  4ES0 A;  2PBI B;  1NEX B;  3UVL A;  3B7F A;  3DWL C;  3EMH A;  3MKQ A;  4A09 A;  5A2Q g;  3DM0 A;  4JSN C;  2AGY A;  4XYH A;  4A0B B;  5HE0 B;  3MZK A;  2CO0 C;  2Z2P A;  4CZY A;  1U4C A;  3RN0 D;  2H14 A;  4O1Q D;  3W15 A;  5CXB B;  2P9I C;  1L0Q A;  2CN2 A;  3I89 A;  3C9C A;  4PC0 A;  4FA4 D;  1N6D A;  2P9P C;  3UVM A;  5HQG A;  3AL8 A;  4K3I D;  1GXR A;  2MTA H;  2YBA A;  3EI1 B;  2IAA A;  2P9K C;  1JMZ B;  4TZ4 A;  5IC7 A;  5CYK B;  3UKR C;  3EI3 A;  4Z8L A;  2UZY B;  4J78 A;  2OK6 A;  4QRJ A;  2HKR A;  3I7N A;  3RMZ D;  4A7J A;  5I5M A;  2P9L C;  4J8B A;  4R7A B;  4X63 B;  4PBZ A;  3UVK A;  5TEE A;  3PE7 A;  3EI4 B;  4JD2 C;  2J56 H;  4YVD A;  4L1Q D;  3MXX A;  3L4M D;  4L3H D;  3C75 H;  1PI6 A;  1NR0 A;  3PXS D;  3I7O A;  4O45 A;  5TDH B;  3SFZ A;  4GM8 A;  2I0R A;  4K3J B;  3F3G A;  3IIY A;  4UI9 R;  3BG1 A;  1SQJ A;  3OTT A;  3DXK C;  5HE3 B;  3UVO A;  2AGZ A;  4JXM A;  2CN3 A;  4ZOZ A;  3RN1 D;  5THA A;  4A11 B;  2Z2N A;  1GP2 B;  4PSW B;  4E54 B;  4LGN A;  3JAM g;  3I8C A;  3C99 A;  4FHL A;  4GGD A;  2CE8 A;  3MKS B;  2CO0 A;  3NVN A;  5IT9 g;  3PVW B;  2J55 H;  3CIK B;  3I8E A;  3EI2 B;  1SHY B;  3I7K A;  4CC9 A;  4J77 A;  1TBG A;  2OVR B;  3N0D A;  4CY1 A;  5IJ7 E;  5FKS A;  3KRW B;  2XU7 A;  5GXI A;  1Q47 A;  1GOT B;  2G99 A;  2QXV A;  1A0R B;  1MDA H;  2GNQ A;  3FGB A;  4FB1 D;  3BWS A;  5FKT A;  3PSC B;  3EWE A;  2QC5 A;  1TYQ C;  4PSX B;  4ZOV A;  3V5W B;  1SQ9 A;  4H5J A;  3VH0 A;  3OKW A;  1B9Y A;  3SJL D;  4A2L A;  4ZOY A;  4G56 B;  2H6N A;  2AGX A;  3UR4 A;  3EI2 A;  3AFC A;  5EM2 A;  3EI3 B;  3F3F A;  4ZOX A;  5CXC A;  3VGZ A;  4N14 A;  2Z2O A;  4IA9 A;  4QQE A;  3JB9 L;  3IKO A;  5EAL A;  5AFU 3;  4FAN D;  3OKY A;  1PEV A;  3K27 A;  4CY5 A;  5K19 A;  3SVW D;  2IUP A;  4U7A A;  5C2W B;  5EMJ B;  5FKR A;  3UVN A;  2HKM A;  4FWW A;  2I0S A;  3E0C A;  4A09 B;  4AEZ A;  2IWF A;  5IGQ A;  2HJ4 A;  1MG2 A;  2YNP A;  3L4O D;  4E5Z B;  4Y5R D;  4GQ2 P;  4H5I A;  3PXT D;  3SLE D;  3IIW A;  2YMU A;  4OZU A;  4X61 B;  4FA1 D;  1U2V C;  3IJC A;  4LG8 A;  3SWS D;  1JMX B;  1MG3 A;  1OMW B;  4JSP C;  4GM9 A;  3EI1 A;  4A08 A;  4GM3 A;  3SBR A;  4FA9 D;  3SCY A;  2BCJ B;  4KFM B;  5GMK n;  4J0X A;  2H9P A;  5FXY A;  4EWR A;  1P22 A;  5EMK B;  2B5N A;  2XL3 A;  2O9K A;  5C2V B;  2PM9 A;  2AQ5 A;  3EU7 A;  3OW8 A;  5FLX g;  2B5M A;  2P9N C;  3UKU C;  3MMY A;  3I7L A;  1PGU A;  3J80 g;  2H9N A;  4HDJ A;  2I3S A;  4GGA A;  4Y7R A;  3ORV D;  2AH0 A;  2XL2 A;  4XEI C;  4JT5 C;  5GXH A;  2H6K A;  4J86 A;  4CI2 A;  3HFQ A;  2PM7 B;  5AMS A;  2IUQ A;  4GQB B;  2CE9 A;  4L3G D;  3EG6 A;  3A0F A;  4BL0 A;  2H68 A;  4ERY A;  3ULE C;  2I3T A;  4FAV D;  1K8K C;  2B4E A;  4J81 A;  3RFH A;  2OK4 A;  5EML B;  4JSX C; 
#chains in the Genus database with same CATH topology
 4ESG A;  2HES X;  3VI4 A;  3IJE A;  5C9Z B;  1QNI A;  4JSV C;  4A0A A;  2QZP A;  3AL8 B;  2YB8 B;  3JZH A;  2VDL A;  4CY3 A;  3ODT A;  4PBY A;  3PXW D;  4O3U B;  4ERQ A;  3OF7 A;  3RFG A;  3SMR A;  2EIE A;  2XE4 A;  1E8N A;  5AJA A;  5HDB A;  4D0K A;  3CFV A;  3CFS B;  3SBP A;  2H9M A;  3VI3 A;  1JV2 A;  2BBK H;  4IMM A;  1R5M A;  5FFO A;  1N6F A;  5FQD A;  2IUR A;  4X60 B;  4J84 A;  4BCB A;  4A0B A;  4AOW A;  1TYE A;  3QHY B;  3T3P A;  1M1X A;  1VE7 A;  3NVQ A;  3JRO A;  3IUJ A;  5KDO B;  3U4Y A;  2GC4 A;  3DXM C;  4G55 A;  2OVP B;  3FRX A;  4A0A B;  5TF2 A;  3V4P A;  3DDU A;  1RI6 A;  3P4F A;  3V7D B;  3I7P A;  2OIZ A;  2AGW A;  2GC7 A;  4PNK B;  4MK0 B;  3ZWL B;  2H9L A;  4MMX A;  4CI8 A;  5H17 A;  4A2M A;  5E6U A;  3I7H A;  4CZX A;  2J57 G;  5I5I A;  3JZN A;  4AMY A;  3MZL A;  4E5Z A;  2P9S C;  3KRX B;  2H47 A;  4NSX A;  5H14 A;  1H2Y A;  2XYI A;  3PSL A;  2EBS A;  2HXC A;  2AGL A;  3OL2 B;  3GFC A;  5EAM A;  4O3T B;  4CI1 A;  5CXC B;  4FA5 D;  4AMZ A;  2YNN A;  1O6G A;  4Z7Q A;  4L9O A;  4ZN4 A;  5FA5 B;  3GRE A;  5GSA A;  3SBQ A;  1XIP A;  4WK2 A;  4QL1 A;  2G9A A;  3BG0 A;  5M5S A;  2H13 A;  3PVU B;  5C92 A;  4WJK A;  2HYE A;  2VDQ A;  3ZE2 A;  5EMM B;  3NIF A;  4J0W A;  5FKQ A;  5CYK A;  4J79 A;  5CXB A;  5EAP A;  5I5J A;  3NVX A;  1GOG A;  4J87 A;  3ZE0 A;  1QFM A;  2YNO A;  1B9X A;  3SHF A;  4X3E A;  1N6E A;  4A11 A;  3IJ0 A;  4BP8 A;  2CNX A;  2TRC B;  2EIB A;  2I0T A;  1UOQ A;  2H3X A;  4D6V A;  5HE1 B;  1QFS A;  1YR2 A;  2B5L A;  2EID A;  4E54 A;  1ERJ A;  1VZ3 A;  3EI4 A;  3C5M A;  4I79 A;  5H1M A;  1JOF A;  2PM6 B;  2BKL A;  4ERZ A;  2H6Q A;  4A08 B;  3SXT D;  3GD1 I;  2UZX B;  5HE2 B;  4OWR A;  2W18 A;  3RRM C;  4JT6 C;  3V9F A;  3O4J A;  4UM8 A;  4Z7N A;  3K6S A;  3N0E A;  3I2N A;  1GG2 B;  2HJB A;  1E5T A;  4CZV A;  1U8C A;  1VYH C;  2PM9 B;  5EAR A;  3OL2 A;  3IUR A;  1XHM A;  5K1C C;  1FWX A;  3OKT A;  3VA6 A;  3IJ1 A;  5IGO A;  5TEF A;  1S4U X;  3DSM A;  3AH8 B;  4G1M A;  4LG9 A;  4GZ8 A;  4GMB A;  3JRP A;  5M5T A;  3ZDY A;  3RLM D;  4QT8 A;  4BUJ C;  2IWK A;  1YFQ A;  5E6S A;  4J8G A;  3NID A;  5JWZ A;  4PXW A;  1PBY B;  1XKS A;  2P9U C;  5EM2 B;  4J82 A;  5SXM A;  3JZG A;  2OJY A;  3AL9 A;  4XYI A;  4Z7O A;  4GGC A;  2OVQ B;  4U1E I;  1OLZ A;  2AH1 A;  3JPX A;  1GOH A;  5IJ8 E;  1JJU B;  3OKY B;  3SN6 B;  4O9D A;  4BH6 A;  3K26 A;  5B4W A;  5HYN B;  3J81 g;  1K32 A;  4NAA A;  4CY2 A;  3MVD K;  3RSE C;  4L1M A;  2IUV A;  2HU5 A;  4IRZ A;  3F3P A;  5M5R A;  2Q7Q A;  3FM0 A;  4J73 A;  4NBM A;  2VDO A;  4GQ1 A;  4CI3 A;  4ES0 A;  2PBI B;  1NEX B;  3UVL A;  3O4H A;  3B7F A;  4QAM A;  3DWL C;  1BPO A;  3EMH A;  3MKQ A;  4DNW A;  5A2Q g;  4A09 A;  3DM0 A;  4JSN C;  2AGY A;  4XYH A;  3O4G A;  4A0B B;  5HE0 B;  3MZK A;  2CO0 C;  2Z2P A;  4CZY A;  1U4C A;  2XDW A;  3RN0 D;  2VC2 A;  2H14 A;  4O1Q D;  3W15 A;  5CXB B;  2P9I C;  1L0Q A;  2CN2 A;  3I89 A;  4NEN A;  3C9C A;  4PC0 A;  4FA4 D;  1N6D A;  2P9P C;  2XZG A;  3UVM A;  2VDM A;  5HQG A;  3KCI A;  3AL8 A;  5E6R A;  4K3I D;  1GXR A;  4AN0 A;  2MTA H;  2YBA A;  4WK4 A;  3EI1 B;  2IAA A;  2P9K C;  1JMZ B;  4TZ4 A;  5IC7 A;  5M61 A;  5CYK B;  3UKR C;  3EI3 A;  4Z8L A;  2UZY B;  4J78 A;  1C9L A;  3IUQ A;  2OK6 A;  4QRJ A;  2HKR A;  3I7N A;  3RMZ D;  4A7J A;  5I5M A;  2P9L C;  4J8B A;  5M5U A;  1UOP A;  4R7A B;  4X63 B;  4PBZ A;  3UVK A;  4WK0 A;  1K3I A;  5TEE A;  3PE7 A;  3EI4 B;  4JD2 C;  2J56 H;  4YVD A;  4L1Q D;  3MXX A;  3L4M D;  4L3H D;  1H2Z A;  3C75 H;  5FFG A;  1PI6 A;  1NR0 A;  3PXS D;  4D9S A;  1VZ2 A;  3I7O A;  2WQ8 A;  1JTD B;  4O45 A;  5TDH B;  3SFZ A;  4AX4 A;  4GM8 A;  2I0R A;  4K3J B;  3F3G A;  3IIY A;  4UI9 R;  3BG1 A;  1A12 A;  1SQJ A;  3DXK C;  3OTT A;  4UM9 A;  5HE3 B;  3UVO A;  2AGZ A;  3EQ9 A;  4JXM A;  2CN3 A;  4ZOZ A;  1L5G A;  1GOF A;  3RN1 D;  5THA A;  4A11 B;  2Z2N A;  4RE6 A;  4MMY A;  1GP2 B;  4PSW B;  4E54 B;  4LGN A;  3JAM g;  4O02 A;  3I8C A;  3C99 A;  4FHL A;  3EQ8 A;  4GGD A;  4BP9 A;  2CE8 A;  3MKS B;  2CO0 A;  3NVN A;  5IT9 g;  4BCD A;  3PVW B;  4RE5 A;  2J55 H;  3CIK B;  3I8E A;  3EI2 B;  1SHY B;  2EIC A;  2HU8 A;  3I7K A;  4CC9 A;  4J77 A;  1TBG A;  1VE6 A;  2OVR B;  3N0D A;  4MMZ A;  2QR5 A;  4CY1 A;  5IJ7 E;  5FKS A;  3KRW B;  2XU7 A;  5GXI A;  1E8M A;  3MUO A;  5M5V A;  4AN1 A;  1Q47 A;  4BCC A;  1GOT B;  2G99 A;  2QXV A;  1A0R B;  1MDA H;  2GNQ A;  3FGB A;  4FB1 D;  3BWS A;  5FKT A;  3PSC B;  3EWE A;  2QC5 A;  2JKX A;  1TYQ C;  4PSX B;  4ZOV A;  3V5W B;  1SQ9 A;  4H5J A;  3VH0 A;  3OKW A;  1B9Y A;  3SJL D;  4A2L A;  4ZOY A;  4G56 B;  2H6N A;  2AGX A;  3UR4 A;  3EI2 A;  3AFC A;  5EM2 A;  3V4V A;  3EI3 B;  3F3F A;  4ZOX A;  1UOO A;  5CXC A;  3VGZ A;  4N14 A;  4NC4 A;  2Z2O A;  4IA9 A;  4QQE A;  3JB9 L;  3IKO A;  3EQ7 A;  5EAL A;  5AFU 3;  4FAN D;  3OKY A;  3IUM A;  1PEV A;  3K27 A;  4CY5 A;  5K19 A;  3SVW D;  2IUP A;  4U7A A;  5C2W B;  5EMJ B;  2VZ1 A;  5FKR A;  3UVN A;  2HKM A;  4FWW A;  3ZE1 A;  3O4I A;  2VDR A;  2I0S A;  3E0C A;  4A09 B;  4AEZ A;  2IWF A;  3T3M A;  5IGQ A;  2HJ4 A;  1MG2 A;  2VZ3 A;  2YNP A;  3L4O D;  4E5Z B;  4Y5R D;  4GQ2 P;  4H5I A;  3FCU A;  3PXT D;  3SLE D;  3IIW A;  2YMU A;  4OZU A;  4X61 B;  4FA1 D;  2VDN A;  1U2V C;  3IJC A;  1T2X A;  4LG8 A;  1H2X A;  3SWS D;  3IUN A;  3IVM A;  1JMX B;  1MG3 A;  1OMW B;  3FCS A;  3GC3 B;  4JSP C;  4GM9 A;  3EI1 A;  1O6F A;  4A08 A;  4GM3 A;  3SBR A;  4FA9 D;  3SCY A;  2BCJ B;  4KFM B;  5GMK n;  4J0X A;  3MUN A;  2H9P A;  5FXY A;  4EWR A;  1P22 A;  5EMK B;  2B5N A;  5C86 A;  2XL3 A;  2O9K A;  5C2V B;  1C9I A;  2PM9 A;  3NIG A;  2VDK A;  2AQ5 A;  3EU7 A;  4DNV A;  3OW8 A;  5FLX g;  2B5M A;  2P9N C;  3UKU C;  3MMY A;  3K72 A;  3IUL A;  3I7L A;  1PGU A;  3ZDZ A;  3J80 g;  2H9N A;  4HDJ A;  2I3S A;  4GGA A;  4Y7R A;  3ORV D;  2AH0 A;  1I2M B;  4O2W A;  2XL2 A;  4DNU A;  2VDP A;  4XEI C;  4JT5 C;  5GXH A;  2H6K A;  4G1E A;  3ZDX A;  4J86 A;  2HU7 A;  4CI2 A;  3HFQ A;  2PM7 B;  5AMS A;  1H2W A;  4JHP C;  2IUQ A;  4GQB B;  2CE9 A;  3QI0 A;  4L3G D;  3EG6 A;  3A0F A;  4BL0 A;  2H68 A;  4ERY A;  3ULE C;  2I3T A;  4FAV D;  1K8K C;  2B4E A;  4J81 A;  1UTC A;  3K71 A;  4JHN A;  3RFH A;  2OK4 A;  5EML B;  4JSX C; 
#chains in the Genus database with same CATH homology
 4ESG A;  2HES X;  5C9Z B;  1QNI A;  4JSV C;  4A0A A;  3AL8 B;  2YB8 B;  3JZH A;  4CY3 A;  3ODT A;  4PBY A;  3PXW D;  4O3U B;  4ERQ A;  3RFG A;  3SMR A;  5AJA A;  4D0K A;  3CFV A;  3CFS B;  3SBP A;  2H9M A;  2BBK H;  4IMM A;  1R5M A;  1N6F A;  5FQD A;  2IUR A;  4X60 B;  4J84 A;  4A0B A;  4AOW A;  3NVQ A;  3JRO A;  5KDO B;  3U4Y A;  2GC4 A;  3DXM C;  2OVP B;  3FRX A;  4A0A B;  5TF2 A;  3V7D B;  1RI6 A;  3P4F A;  3I7P A;  2OIZ A;  2AGW A;  2GC7 A;  4PNK B;  4MK0 B;  3ZWL B;  2H9L A;  4CI8 A;  5H17 A;  4A2M A;  3I7H A;  4CZX A;  2J57 G;  5I5I A;  3JZN A;  3MZL A;  4E5Z A;  2P9S C;  3KRX B;  2H47 A;  4NSX A;  5H14 A;  2XYI A;  3PSL A;  2EBS A;  2HXC A;  2AGL A;  3OL2 B;  3GFC A;  5EAM A;  4O3T B;  4CI1 A;  5CXC B;  4FA5 D;  2YNN A;  4L9O A;  4ZN4 A;  5FA5 B;  3GRE A;  5GSA A;  3SBQ A;  1XIP A;  4QL1 A;  2G9A A;  3BG0 A;  2H13 A;  3PVU B;  2HYE A;  5EMM B;  4J0W A;  5FKQ A;  5CYK A;  4J79 A;  5CXB A;  5EAP A;  5I5J A;  3NVX A;  4J87 A;  2YNO A;  1B9X A;  3SHF A;  4X3E A;  1N6E A;  4A11 A;  3IJ0 A;  2CNX A;  2TRC B;  2I0T A;  2H3X A;  4D6V A;  5HE1 B;  2B5L A;  4E54 A;  1ERJ A;  3EI4 A;  3C5M A;  4I79 A;  5H1M A;  1JOF A;  2PM6 B;  4A08 B;  4ERZ A;  2H6Q A;  3SXT D;  2UZX B;  5HE2 B;  4OWR A;  2W18 A;  3RRM C;  4JT6 C;  3V9F A;  3N0E A;  3I2N A;  1GG2 B;  2HJB A;  4CZV A;  1VYH C;  2PM9 B;  5EAR A;  3OL2 A;  1XHM A;  5K1C C;  1FWX A;  3OKT A;  3VA6 A;  3IJ1 A;  5IGO A;  5TEF A;  1S4U X;  3DSM A;  3AH8 B;  4LG9 A;  4GZ8 A;  4GMB A;  3JRP A;  3RLM D;  4QT8 A;  4BUJ C;  2IWK A;  1YFQ A;  4J8G A;  5JWZ A;  4PXW A;  1PBY B;  1XKS A;  2P9U C;  5EM2 B;  4J82 A;  5SXM A;  2OJY A;  3AL9 A;  3JZG A;  4XYI A;  4GGC A;  2OVQ B;  4U1E I;  1OLZ A;  2AH1 A;  3JPX A;  5IJ8 E;  1JJU B;  3OKY B;  3SN6 B;  4O9D A;  4BH6 A;  3K26 A;  5B4W A;  5HYN B;  3J81 g;  1K32 A;  4CY2 A;  3RSE C;  2IUV A;  3F3P A;  2Q7Q A;  3FM0 A;  4J73 A;  4GQ1 A;  4CI3 A;  4ES0 A;  2PBI B;  1NEX B;  3UVL A;  3B7F A;  3DWL C;  3EMH A;  3MKQ A;  4A09 A;  5A2Q g;  3DM0 A;  4JSN C;  2AGY A;  4XYH A;  4A0B B;  5HE0 B;  3MZK A;  2CO0 C;  2Z2P A;  4CZY A;  1U4C A;  3RN0 D;  2H14 A;  4O1Q D;  3W15 A;  5CXB B;  2P9I C;  1L0Q A;  2CN2 A;  3I89 A;  3C9C A;  4PC0 A;  4FA4 D;  1N6D A;  2P9P C;  3UVM A;  5HQG A;  3AL8 A;  4K3I D;  1GXR A;  2MTA H;  2YBA A;  3EI1 B;  2IAA A;  2P9K C;  1JMZ B;  4TZ4 A;  5IC7 A;  5CYK B;  3UKR C;  3EI3 A;  4Z8L A;  2UZY B;  4J78 A;  2OK6 A;  4QRJ A;  2HKR A;  3I7N A;  3RMZ D;  4A7J A;  5I5M A;  2P9L C;  4J8B A;  4R7A B;  4X63 B;  4PBZ A;  3UVK A;  5TEE A;  3PE7 A;  3EI4 B;  4JD2 C;  2J56 H;  4YVD A;  4L1Q D;  3MXX A;  3L4M D;  4L3H D;  3C75 H;  1PI6 A;  1NR0 A;  3PXS D;  3I7O A;  4O45 A;  5TDH B;  3SFZ A;  4GM8 A;  2I0R A;  4K3J B;  3F3G A;  3IIY A;  4UI9 R;  3BG1 A;  1SQJ A;  3OTT A;  3DXK C;  5HE3 B;  3UVO A;  2AGZ A;  4JXM A;  2CN3 A;  4ZOZ A;  3RN1 D;  5THA A;  4A11 B;  2Z2N A;  1GP2 B;  4PSW B;  4E54 B;  4LGN A;  3JAM g;  3I8C A;  3C99 A;  4FHL A;  4GGD A;  2CE8 A;  3MKS B;  2CO0 A;  3NVN A;  5IT9 g;  3PVW B;  2J55 H;  3CIK B;  3I8E A;  3EI2 B;  1SHY B;  3I7K A;  4CC9 A;  4J77 A;  1TBG A;  2OVR B;  3N0D A;  4CY1 A;  5IJ7 E;  5FKS A;  3KRW B;  2XU7 A;  5GXI A;  1Q47 A;  1GOT B;  2G99 A;  2QXV A;  1A0R B;  1MDA H;  2GNQ A;  3FGB A;  4FB1 D;  3BWS A;  5FKT A;  3PSC B;  3EWE A;  2QC5 A;  1TYQ C;  4PSX B;  4ZOV A;  3V5W B;  1SQ9 A;  4H5J A;  3VH0 A;  3OKW A;  1B9Y A;  3SJL D;  4A2L A;  4ZOY A;  4G56 B;  2H6N A;  2AGX A;  3UR4 A;  3EI2 A;  3AFC A;  5EM2 A;  3EI3 B;  3F3F A;  4ZOX A;  5CXC A;  3VGZ A;  4N14 A;  2Z2O A;  4IA9 A;  4QQE A;  3JB9 L;  3IKO A;  5EAL A;  5AFU 3;  4FAN D;  3OKY A;  1PEV A;  3K27 A;  4CY5 A;  5K19 A;  3SVW D;  2IUP A;  4U7A A;  5C2W B;  5EMJ B;  5FKR A;  3UVN A;  2HKM A;  4FWW A;  2I0S A;  3E0C A;  4A09 B;  4AEZ A;  2IWF A;  5IGQ A;  2HJ4 A;  1MG2 A;  2YNP A;  3L4O D;  4E5Z B;  4Y5R D;  4GQ2 P;  4H5I A;  3PXT D;  3SLE D;  3IIW A;  2YMU A;  4OZU A;  4X61 B;  4FA1 D;  1U2V C;  3IJC A;  4LG8 A;  3SWS D;  1JMX B;  1MG3 A;  1OMW B;  4JSP C;  4GM9 A;  3EI1 A;  4A08 A;  4GM3 A;  3SBR A;  4FA9 D;  3SCY A;  2BCJ B;  4KFM B;  5GMK n;  4J0X A;  2H9P A;  5FXY A;  4EWR A;  1P22 A;  5EMK B;  2B5N A;  2XL3 A;  2O9K A;  5C2V B;  2PM9 A;  2AQ5 A;  3EU7 A;  3OW8 A;  5FLX g;  2B5M A;  2P9N C;  3UKU C;  3MMY A;  3I7L A;  1PGU A;  3J80 g;  2H9N A;  4HDJ A;  2I3S A;  4GGA A;  4Y7R A;  3ORV D;  2AH0 A;  2XL2 A;  4XEI C;  4JT5 C;  5GXH A;  2H6K A;  4J86 A;  4CI2 A;  3HFQ A;  2PM7 B;  5AMS A;  2IUQ A;  4GQB B;  2CE9 A;  4L3G D;  3EG6 A;  3A0F A;  4BL0 A;  2H68 A;  4ERY A;  3ULE C;  2I3T A;  4FAV D;  1K8K C;  2B4E A;  4J81 A;  3RFH A;  2OK4 A;  5EML B;  4JSX C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...