4FAND

Crystal structure of wt maug in complex with pre-methylamine dehydrogenase aged 40 days
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Diradical intermediate within the context of tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 91
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4fanD00
4IMMA 4ESGA 4BUJC 3GFCA 3PXWD 2IURA 5JWZA 2H6NA 3MKQA 5HE0B 2HYEA 1MG3A 4IA9A 5SXMA 3MXXA 4A09B 4HDJA 3P4FA 3UR4A 4YVDA 3RLMD 1OMWB 3OKYB 2XYIA 3ODTA 4CC9A 4CY1A 5FKSA 3I89A 4FA9D 1MG2A 2OJYA 3EI4B 3PXSD 2IWKA 2CE9A 3U4YA 3ORVD 2P9KC 2IUVA 4A2LA 2B5NA 3DSMA 3RN1D 1SHYB 3JROA 3EI3B 1YFQA 4FA4D 4GM8A 2AGWA 3NVNA 4J81A 3I7NA 4JD2C 1TYQC 1PI6A 2AQ5A 5EMKB 4CI3A 4N14A 3DM0A 3MZLA 3W15A 2UZYB 4J86A 5AMSA 3NVQA 2Z2NA 3C99A 3AL9A 4A09A 3EI1B 3I7KA 2YNPA 5C9ZB 3OKYA 3KRWB 4O45A 4QT8A 3BG0A 2UZXB 1K32A 3OL2B 3JAMg 3EI4A 5H14A 5TDHB 2CO0C 5CXCB 4E54B 4AEZA 4L3GD 4J73A 2TRCB 5H17A 5AFU3 3F3GA 3IIWA 3EI3A 4AOWA 3UVKA 4O3TB 1NEXB 1GP2B 5THAA 4J79A 2PM9B 3RFGA 2O9KA 4XYIA 5C2VB 2XL2A 3V9FA 3PXTD 4D0KA 2PBIB 1N6FA 4CI8A 3UVNA 4PBYA 4A2MA 2IUQA 4KFMB 4G56B 5IGOA 2P9UC 2H9LA 3EI1A 3EI2B 1XKSA 5I5JA 4J82A 3OL2A 4PXWA 4J87A 4A0BB 2OVQB 3E0CA 5CXCA 4E54A 3MMYA 3I7PA 2W18A 3EU7A 4JSXC 1N6EA 5HE2B 5EAPA 5GMKn 3IJCA 3RFHA 2H6QA 4GM3A 4JT6C 3SN6B 3OKWA 4PSWB 3IKOA 2PM9A 4ZOYA 2IAAA 2PM7B 4JSNC 5IC7A 4CY3A 4FWWA 4LG8A 3J81g 3PVUB 3SLED 4UI9R 5HYNB 1JOFA 2B5LA 3DWLC 1SQ9A 3OKTA 1OLZA 2CNXA 3K26A 3MZKA 3EI2A 2I0RA 2CO0A 2QC5A 3K27A 4I79A 2CN3A 4PC0A 5EMJB 4OWRA 1NR0A 2AH1A 2H13A 5EM2B 3I8EA 3EMHA 2J56H 2BBKH 3N0DA 3SBRA 2HXCA 4L3HD 3IJ0A 4J84A 2MTAH 4ZOZA 3F3FA 3I7HA 3C75H 4GMBA 2YB8B 4GQ1A 1B9YA 4JXMA 3PE7A 2H9NA 4GZ8A 3JZNA 2YBAA 2AH0A 4QQEA 2BCJB 3CIKB 3SMRA 5FKTA 2XL3A 2CN2A 5IGQA 1GG2B 5CYKB 1L0QA 2P9NC 1FWXA 2YNOA 2H9MA 5CXBB 4JT5C 4O3UB 2Z2OA 4CI2A 4Y7RA 5GXIA 4FHLA 4CY5A 5K1CC 4J78A 4XEIC 3UKUC 3L4OD 4O9DA 4U7AA 4ZOXA 4BH6A 5EMLB 1MDAH 3I2NA 2I0TA 4FAVD 3OW8A 3AH8B 4JSVC 3JZGA 3JRPA 3CFSB 2HKRA 3UKRC 4LG9A 5TF2A 3CFVA 2I3TA 3BWSA 2H14A 3PSLA 4X63B 5EALA 3SVWD 3VA6A 3I8CA 2AGLA 4J8GA 5IJ8E 3EG6A 1U4CA 4PNKB 3SFZA 4FAND 3SBPA 5CYKA 2GNQA 5FA5B 4OZUA 4MK0B 3SBQA 2B4EA 5CXBA 2AGZA 3RN0D 5KDOB 5FKRA 3SCYA 5HE3B 4A7JA 4EWRA 3KRXB 4CI1A 4A11B 4PSXB 5FKQA 4GQ2P 1U2VC 5I5MA 3OTTA 2EBSA 3RMZD 2GC4A 2P9IC 4ERQA 4TZ4A 2GC7A 4ZOVA 3L4MD 2HKMA 4E5ZB 3C5MA 1JJUB 2HESX 3EWEA 3SJLD 1K8KC 3SHFA 5IT9g 2P9SC 3JB9L 2P9PC 4J0WA 4ES0A 2HJ4A 2OIZA 3B7FA 3PVWB 5FQDA 1GXRA 4FA5D 3I7LA 4GQBB 3UVLA 4CY2A 4L1QD 3RSEC 3SWSD 4A08B 3FRXA 5HE1B 4A0BA 3MKSB 3GREA 5I5IA 5AJAA 3UVOA 4X61B 3FM0A 2H3XA 5C2WB 4K3ID 3RRMC 1QNIA 4A11A 5IJ7E 3BG1A 1TBGA 2G9AA 4A0AB 4GM9A 2PM6B 4GGAA 4ERZA 2XU7A 4L9OA 2H9PA 2QXVA 5A2Qg 4XYHA 4E5ZA 3A0FA 5EMMB 4H5JA 4CZYA 3SXTD 5H1MA 4PBZA 3VGZA 1A0RB 4K3JB 3J80g 3VH0A 4H5IA 2P9LC 2OVPB 1RI6A 4CZVA 4O1QD 2H6KA 3V5WB 4J77A 2AGXA 3PSCB 4A08A 1S4UX 1GOTB 1N6DA 5EM2A 3JZHA 4R7AB 5K19A 2CE8A 4LGNA 2HJBA 3I7OA 4CZXA 2J55H 5HQGA 3ZWLB 3AFCA 4A0AA 2J57G 4JSPC 5GSAA 2YNNA 3ULEC 4D6VA 1VYHC 3JPXA 1PGUA 5EAMA 3AL8B 3F3PA 5TEEA 5B4WA 2Z2PA 3IIYA 3C9CA 4X3EA 1Q47A 4Z8LA 4ERYA 2H68A 4QL1A 4QRJA 2B5MA 1B9XA 1P22A 2G99A 5FLXg 2I3SA 4FA1D 2AGYA 1SQJA 1PEVA 1R5MA 4NSXA 2IWFA 2H47A 1XHMA 2OK6A 4GGDA 4J8BA 5GXHA 3HFQA 4FB1D 3NVXA 4U1EI 5EARA 4GGCA 3UVMA 2OVRB 2Q7QA 1ERJA 2I0SA 2YMUA 3FGBA 2OK4A 4BL0A 4ZN4A 4Y5RD 3DXMC 3IJ1A 2IUPA 4J0XA 3DXKC 1JMXB 1PBYB 5TEFA 1JMZB 3AL8A 4X60B 1XIPA 3N0EA 5FXYA 3V7DB
chains in the Genus database with same CATH superfamily
4IMMA 4ESGA 4BUJC 3GFCA 3PXWD 2IURA 5JWZA 2QZPA 2H6NA 5E6SA 3MKQA 1VZ3A 1L5GA 1A12A 5HE0B 2HYEA 1MG3A 4IA9A 3ZDYA 5SXMA 3MXXA 4A09B 4HDJA 3P4FA 3UR4A 4YVDA 3RLMD 1OMWB 3QHYB 3OKYB 2XYIA 3ODTA 4CC9A 4CY1A 5M5UA 5FKSA 3I89A 4FA9D 1MG2A 2OJYA 3EI4B 3PXSD 2IWKA 2CE9A 3IUNA 3U4YA 3ORVD 2P9KC 3EQ8A 2IUVA 4A2LA 1C9IA 2B5NA 3DSMA 2VDOA 4G1MA 3RN1D 1YR2A 1SHYB 3JROA 3NIGA 3EI3B 1YFQA 4FA4D 4GM8A 2AGWA 3NVNA 1UOOA 1I2MB 2HU7A 4J81A 3I7NA 4JD2C 1TYQC 3K6SA 1PI6A 2AQ5A 3GC3B 5EMKB 4CI3A 4N14A 3DM0A 3MZLA 3W15A 2UZYB 4MMXA 4J86A 5AMSA 3NVQA 1O6FA 4BCBA 2Z2NA 3C99A 3AL9A 4A09A 3EI1B 3I7KA 2YNPA 5C9ZB 3OKYA 3KRWB 4O45A 4QT8A 3BG0A 3EQ7A 2BKLA 2UZXB 1K32A 3OL2B 3NIDA 3JAMg 3EI4A 5H14A 5TDHB 2CO0C 5CXCB 4E54B 4AEZA 4L3GD 4J73A 2TRCB 5H17A 1QFSA 5AFU3 3F3GA 2VDRA 4NBMA 3IIWA 3EI3A 4AOWA 3UVKA 4O3TB 1NEXB 1GP2B 5THAA 4J79A 4AN1A 2PM9B 3RFGA 2O9KA 4XYIA 3VI4A 5C2VB 2XL2A 3V9FA 3PXTD 4D0KA 4IRZA 2PBIB 1N6FA 4CI8A 3UVNA 3EQ9A 4PBYA 3V4PA 4A2MA 2IUQA 4KFMB 2XDWA 4O02A 4G56B 4MMZA 5IGOA 2P9UC 2H9LA 4UM8A 3EI1A 3EI2B 1XKSA 5I5JA 4J82A 1BPOA 4JHPC 3MVDK 1UOQA 3OL2A 4WK4A 4PXWA 4J87A 4A0BB 2XE4A 2OVQB 3E0CA 5CXCA 4E54A 1JTDB 3MMYA 3I7PA 2W18A 3EU7A 4JSXC 1N6EA 5HE2B 5EAPA 5GMKn 3IJCA 3RFHA 2H6QA 4GM3A 4JT6C 3SN6B 3OKWA 1K3IA 2VDQA 4PSWB 3IKOA 2PM9A 4ZOYA 2IAAA 2PM7B 4JSNC 5IC7A 4CY3A 4FWWA 4LG8A 3J81g 3PVUB 3SLED 4UI9R 5HYNB 4Z7OA 5M5VA 1JOFA 2B5LA 3DWLC 1GOFA 1SQ9A 3OKTA 1OLZA 1UOPA 4O2WA 3MUOA 2CNXA 3K26A 3MZKA 4AX4A 3EI2A 2I0RA 2CO0A 2QC5A 3K27A 5C92A 4RE5A 4I79A 2CN3A 4PC0A 3FCUA 5EMJB 4OWRA 1NR0A 2AH1A 2H13A 5EM2B 3I8EA 4WK0A 3EMHA 2J56H 2BBKH 3N0DA 3SBRA 2HXCA 4L3HD 3IJ0A 3QI0A 4J84A 5M5RA 2MTAH 4ZOZA 3F3FA 3I7HA 3VI3A 3C75H 3IJEA 1JV2A 4GMBA 2YB8B 4DNUA 4GQ1A 1B9YA 4JXMA 3PE7A 3K72A 3DDUA 2H9NA 4GZ8A 3JZNA 2YBAA 2AH0A 4QQEA 2BCJB 3CIKB 1U8CA 3SMRA 5FKTA 2XL3A 2CN2A 5IGQA 1GG2B 5CYKB 1L0QA 2P9NC 3IURA 1FWXA 2YNOA 2H9MA 3GD1I 5CXBB 1TYEA 4JT5C 2Z2OA 4O3UB 4CI2A 4Y7RA 5GXIA 1M1XA 4FHLA 2HU8A 4BP9A 2EIBA 4CY5A 5K1CC 1VE7A 4DNWA 4J78A 4QAMA 4XEIC 4NAAA 3UKUC 1O6GA 3L4OD 4O9DA 4U7AA 4ZOXA 4BH6A 5EMLB 4G55A 1MDAH 3I2NA 2I0TA 5FFOA 4FAVD 3OW8A 3AH8B 4JSVC 3JZGA 3JRPA 3CFSB 2HKRA 3UKRC 4LG9A 4RE6A 5TF2A 3CFVA 2I3TA 3BWSA 3ZDXA 2H14A 3PSLA 4X63B 5EALA 1H2XA 3O4GA 4Z7QA 3SVWD 2VDNA 3VA6A 3I8CA 2AGLA 4J8GA 5IJ8E 3ZDZA 3ZE2A 3EG6A 1U4CA 4PNKB 3SFZA 4FAND 4DNVA 3SBPA 5CYKA 3T3MA 2GNQA 5FA5B 3T3PA 4OZUA 4AMYA 4MK0B 3SBQA 2B4EA 1E5TA 5CXBA 2AGZA 3RN0D 5KDOB 5FKRA 3SCYA 5HE3B 4A7JA 4EWRA 3KRXB 4CI1A 4A11B 4PSXB 5FKQA 4GQ2P 1U2VC 5I5MA 3OTTA 2EBSA 3RMZD 2GC4A 2P9IC 4ERQA 4TZ4A 2GC7A 4ZOVA 3KCIA 3L4MD 2HKMA 4E5ZB 3C5MA 4Z7NA 1JJUB 2HESX 1VZ2A 3EWEA 3SJLD 1H2WA 1K8KC 3SHFA 5IT9g 2P9SC 4UM9A 3JB9L 2P9PC 4J0WA 4ES0A 2HJ4A 2OIZA 3B7FA 3OF7A 3PVWB 3IUMA 5FQDA 5M5SA 5M5TA 1VE6A 2JKXA 2VDLA 1GXRA 4FA5D 3I7LA 4GQBB 3UVLA 5E6UA 4CY2A 4L1QD 3RSEC 3SWSD 4A08B 3FRXA 5HE1B 4A0BA 2EICA 1GOHA 3MKSB 3O4HA 3GREA 4L1MA 5I5IA 5AJAA 3UVOA 4X61B 3FM0A 2H3XA 5C2WB 4K3ID 3RRMC 1QNIA 3ZE1A 5FFGA 4A11A 4D9SA 5IJ7E 3BG1A 1TBGA 4WJKA 2G9AA 4A0AB 4GM9A 2PM6B 4GGAA 4ERZA 2XU7A 3ZE0A 4L9OA 2VDKA 2H9PA 2QXVA 5A2Qg 4G1EA 4XYHA 4E5ZA 3A0FA 5EMMB 4H5JA 4CZYA 3O4IA 3SXTD 5H1MA 4PBZA 3VGZA 2HU5A 1A0RB 4K3JB 3J80g 3VH0A 1QFMA 4H5IA 2P9LC 2OVPB 1RI6A 4CZVA 4O1QD 1H2ZA 2H6KA 3V5WB 3O4JA 4J77A 1T2XA 4JHNA 2AGXA 2VC2A 3PSCB 4A08A 3IUQA 1S4UX 1GOTB 1N6DA 2WQ8A 5EM2A 4BCDA 5E6RA 3JZHA 4R7AB 4NC4A 1H2YA 4MMYA 2VDPA 5K19A 2CE8A 4LGNA 2HJBA 3I7OA 4CZXA 2J55H 5HQGA 4WK2A 3ZWLB 3AFCA 4A0AA 2J57G 4JSPC 5GSAA 2YNNA 1C9LA 3ULEC 4D6VA 1VYHC 3JPXA 1PGUA 2VZ1A 5EAMA 3AL8B 3F3PA 5HDBA 5TEEA 5B4WA 2Z2PA 5C86A 1E8NA 2EIEA 3K71A 3IIYA 3C9CA 4X3EA 1Q47A 4Z8LA 4ERYA 2H68A 3IUJA 4QL1A 4QRJA 2B5MA 3FCSA 1B9XA 1P22A 1UTCA 4AMZA 2G99A 5FLXg 2I3SA 3IULA 4FA1D 2AGYA 1SQJA 1PEVA 1R5MA 2EIDA 1E8MA 4NSXA 2IWFA 2H47A 2VDMA 1XHMA 2OK6A 4GGDA 4J8BA 4NENA 4BP8A 5GXHA 3IVMA 3HFQA 4FB1D 4BCCA 1GOGA 3NVXA 4U1EI 5EARA 4GGCA 3UVMA 2OVRB 2QR5A 2Q7QA 2VZ3A 2XZGA 1ERJA 2I0SA 2YMUA 5M61A 3FGBA 4AN0A 2OK4A 4BL0A 4ZN4A 4Y5RD 3DXMC 3IJ1A 2IUPA 4J0XA 3DXKC 3V4VA 1JMXB 3MUNA 3NIFA 1PBYB 5TEFA 1JMZB 3AL8A 4X60B 1XIPA 3N0EA 5FXYA 3V7DB
chains in the Genus database with same CATH topology
4IMMA 4ESGA 4BUJC 3GFCA 3PXWD 2IURA 5JWZA 2H6NA 3MKQA 5HE0B 2HYEA 1MG3A 4IA9A 5SXMA 3MXXA 4A09B 4HDJA 3P4FA 3UR4A 4YVDA 3RLMD 1OMWB 3OKYB 2XYIA 3ODTA 4CC9A 4CY1A 5FKSA 3I89A 4FA9D 1MG2A 2OJYA 3EI4B 3PXSD 2IWKA 2CE9A 3U4YA 3ORVD 2P9KC 2IUVA 4A2LA 2B5NA 3DSMA 3RN1D 1SHYB 3JROA 3EI3B 1YFQA 4FA4D 4GM8A 2AGWA 3NVNA 4J81A 3I7NA 4JD2C 1TYQC 1PI6A 2AQ5A 5EMKB 4CI3A 4N14A 3DM0A 3MZLA 3W15A 2UZYB 4J86A 5AMSA 3NVQA 2Z2NA 3C99A 3AL9A 4A09A 3EI1B 3I7KA 2YNPA 5C9ZB 3OKYA 3KRWB 4O45A 4QT8A 3BG0A 2UZXB 1K32A 3OL2B 3JAMg 3EI4A 5H14A 5TDHB 2CO0C 5CXCB 4E54B 4AEZA 4L3GD 4J73A 2TRCB 5H17A 5AFU3 3F3GA 3IIWA 3EI3A 4AOWA 3UVKA 4O3TB 1NEXB 1GP2B 5THAA 4J79A 2PM9B 3RFGA 2O9KA 4XYIA 5C2VB 2XL2A 3V9FA 3PXTD 4D0KA 2PBIB 1N6FA 4CI8A 3UVNA 4PBYA 4A2MA 2IUQA 4KFMB 4G56B 5IGOA 2P9UC 2H9LA 3EI1A 3EI2B 1XKSA 5I5JA 4J82A 3OL2A 4PXWA 4J87A 4A0BB 2OVQB 3E0CA 5CXCA 4E54A 3MMYA 3I7PA 2W18A 3EU7A 4JSXC 1N6EA 5HE2B 5EAPA 5GMKn 3IJCA 3RFHA 2H6QA 4GM3A 4JT6C 3SN6B 3OKWA 4PSWB 3IKOA 2PM9A 4ZOYA 2IAAA 2PM7B 4JSNC 5IC7A 4CY3A 4FWWA 4LG8A 3J81g 3PVUB 3SLED 4UI9R 5HYNB 1JOFA 2B5LA 3DWLC 1SQ9A 3OKTA 1OLZA 2CNXA 3K26A 3MZKA 3EI2A 2I0RA 2CO0A 2QC5A 3K27A 4I79A 2CN3A 4PC0A 5EMJB 4OWRA 1NR0A 2AH1A 2H13A 5EM2B 3I8EA 3EMHA 2J56H 2BBKH 3N0DA 3SBRA 2HXCA 4L3HD 3IJ0A 4J84A 2MTAH 4ZOZA 3F3FA 3I7HA 3C75H 4GMBA 2YB8B 4GQ1A 1B9YA 4JXMA 3PE7A 2H9NA 4GZ8A 3JZNA 2YBAA 2AH0A 4QQEA 2BCJB 3CIKB 3SMRA 5FKTA 2XL3A 2CN2A 5IGQA 1GG2B 5CYKB 1L0QA 2P9NC 1FWXA 2YNOA 2H9MA 5CXBB 4JT5C 4O3UB 2Z2OA 4CI2A 4Y7RA 5GXIA 4FHLA 4CY5A 5K1CC 4J78A 4XEIC 3UKUC 3L4OD 4O9DA 4U7AA 4ZOXA 4BH6A 5EMLB 1MDAH 3I2NA 2I0TA 4FAVD 3OW8A 3AH8B 4JSVC 3JZGA 3JRPA 3CFSB 2HKRA 3UKRC 4LG9A 5TF2A 3CFVA 2I3TA 3BWSA 2H14A 3PSLA 4X63B 5EALA 3SVWD 3VA6A 3I8CA 2AGLA 4J8GA 5IJ8E 3EG6A 1U4CA 4PNKB 3SFZA 4FAND 3SBPA 5CYKA 2GNQA 5FA5B 4OZUA 4MK0B 3SBQA 2B4EA 5CXBA 2AGZA 3RN0D 5KDOB 5FKRA 3SCYA 5HE3B 4A7JA 4EWRA 3KRXB 4CI1A 4A11B 4PSXB 5FKQA 4GQ2P 1U2VC 5I5MA 3OTTA 2EBSA 3RMZD 2GC4A 2P9IC 4ERQA 4TZ4A 2GC7A 4ZOVA 3L4MD 2HKMA 4E5ZB 3C5MA 1JJUB 2HESX 3EWEA 3SJLD 1K8KC 3SHFA 5IT9g 2P9SC 3JB9L 2P9PC 4J0WA 4ES0A 2HJ4A 2OIZA 3B7FA 3PVWB 5FQDA 1GXRA 4FA5D 3I7LA 4GQBB 3UVLA 4CY2A 4L1QD 3RSEC 3SWSD 4A08B 3FRXA 5HE1B 4A0BA 3MKSB 3GREA 5I5IA 5AJAA 3UVOA 4X61B 3FM0A 2H3XA 5C2WB 4K3ID 3RRMC 1QNIA 4A11A 5IJ7E 3BG1A 1TBGA 2G9AA 4A0AB 4GM9A 2PM6B 4GGAA 4ERZA 2XU7A 4L9OA 2H9PA 2QXVA 5A2Qg 4XYHA 4E5ZA 3A0FA 5EMMB 4H5JA 4CZYA 3SXTD 5H1MA 4PBZA 3VGZA 1A0RB 4K3JB 3J80g 3VH0A 4H5IA 2P9LC 2OVPB 1RI6A 4CZVA 4O1QD 2H6KA 3V5WB 4J77A 2AGXA 3PSCB 4A08A 1S4UX 1GOTB 1N6DA 5EM2A 3JZHA 4R7AB 5K19A 2CE8A 4LGNA 2HJBA 3I7OA 4CZXA 2J55H 5HQGA 3ZWLB 3AFCA 4A0AA 2J57G 4JSPC 5GSAA 2YNNA 3ULEC 4D6VA 1VYHC 3JPXA 1PGUA 5EAMA 3AL8B 3F3PA 5TEEA 5B4WA 2Z2PA 3IIYA 3C9CA 4X3EA 1Q47A 4Z8LA 4ERYA 2H68A 4QL1A 4QRJA 2B5MA 1B9XA 1P22A 2G99A 5FLXg 2I3SA 4FA1D 2AGYA 1SQJA 1PEVA 1R5MA 4NSXA 2IWFA 2H47A 1XHMA 2OK6A 4GGDA 4J8BA 5GXHA 3HFQA 4FB1D 3NVXA 4U1EI 5EARA 4GGCA 3UVMA 2OVRB 2Q7QA 1ERJA 2I0SA 2YMUA 3FGBA 2OK4A 4BL0A 4ZN4A 4Y5RD 3DXMC 3IJ1A 2IUPA 4J0XA 3DXKC 1JMXB 1PBYB 5TEFA 1JMZB 3AL8A 4X60B 1XIPA 3N0EA 5FXYA 3V7DB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IMM A;  4ESG A;  4BUJ C;  3GFC A;  3PXW D;  2IUR A;  5JWZ A;  2H6N A;  3MKQ A;  5HE0 B;  2HYE A;  1MG3 A;  4IA9 A;  5SXM A;  3MXX A;  4A09 B;  4HDJ A;  3P4F A;  3UR4 A;  4YVD A;  3RLM D;  1OMW B;  3OKY B;  2XYI A;  3ODT A;  4CC9 A;  4CY1 A;  5FKS A;  3I89 A;  4FA9 D;  1MG2 A;  2OJY A;  3EI4 B;  3PXS D;  2IWK A;  2CE9 A;  3U4Y A;  3ORV D;  2P9K C;  2IUV A;  4A2L A;  2B5N A;  3DSM A;  3RN1 D;  1SHY B;  3JRO A;  3EI3 B;  1YFQ A;  4FA4 D;  4GM8 A;  2AGW A;  3NVN A;  4J81 A;  3I7N A;  4JD2 C;  1TYQ C;  1PI6 A;  2AQ5 A;  5EMK B;  4CI3 A;  4N14 A;  3DM0 A;  3MZL A;  3W15 A;  2UZY B;  4J86 A;  5AMS A;  3NVQ A;  2Z2N A;  3C99 A;  3AL9 A;  4A09 A;  3EI1 B;  3I7K A;  2YNP A;  5C9Z B;  3OKY A;  3KRW B;  4O45 A;  4QT8 A;  3BG0 A;  2UZX B;  1K32 A;  3OL2 B;  3JAM g;  3EI4 A;  5H14 A;  5TDH B;  2CO0 C;  5CXC B;  4E54 B;  4AEZ A;  4L3G D;  4J73 A;  2TRC B;  5H17 A;  5AFU 3;  3F3G A;  3IIW A;  3EI3 A;  4AOW A;  3UVK A;  4O3T B;  1NEX B;  1GP2 B;  5THA A;  4J79 A;  2PM9 B;  3RFG A;  2O9K A;  4XYI A;  5C2V B;  2XL2 A;  3V9F A;  3PXT D;  4D0K A;  2PBI B;  1N6F A;  4CI8 A;  3UVN A;  4PBY A;  4A2M A;  2IUQ A;  4KFM B;  4G56 B;  5IGO A;  2P9U C;  2H9L A;  3EI1 A;  3EI2 B;  1XKS A;  5I5J A;  4J82 A;  3OL2 A;  4PXW A;  4J87 A;  4A0B B;  2OVQ B;  3E0C A;  5CXC A;  4E54 A;  3MMY A;  3I7P A;  2W18 A;  3EU7 A;  4JSX C;  1N6E A;  5HE2 B;  5EAP A;  5GMK n;  3IJC A;  3RFH A;  2H6Q A;  4GM3 A;  4JT6 C;  3SN6 B;  3OKW A;  4PSW B;  3IKO A;  2PM9 A;  4ZOY A;  2IAA A;  2PM7 B;  4JSN C;  5IC7 A;  4CY3 A;  4FWW A;  4LG8 A;  3J81 g;  3PVU B;  3SLE D;  4UI9 R;  5HYN B;  1JOF A;  2B5L A;  3DWL C;  1SQ9 A;  3OKT A;  1OLZ A;  2CNX A;  3K26 A;  3MZK A;  3EI2 A;  2I0R A;  2CO0 A;  2QC5 A;  3K27 A;  4I79 A;  2CN3 A;  4PC0 A;  5EMJ B;  4OWR A;  1NR0 A;  2AH1 A;  2H13 A;  5EM2 B;  3I8E A;  3EMH A;  2J56 H;  2BBK H;  3N0D A;  3SBR A;  2HXC A;  4L3H D;  3IJ0 A;  4J84 A;  2MTA H;  4ZOZ A;  3F3F A;  3I7H A;  3C75 H;  4GMB A;  2YB8 B;  4GQ1 A;  1B9Y A;  4JXM A;  3PE7 A;  2H9N A;  4GZ8 A;  3JZN A;  2YBA A;  2AH0 A;  4QQE A;  2BCJ B;  3CIK B;  3SMR A;  5FKT A;  2XL3 A;  2CN2 A;  5IGQ A;  1GG2 B;  5CYK B;  1L0Q A;  2P9N C;  1FWX A;  2YNO A;  2H9M A;  5CXB B;  4JT5 C;  4O3U B;  2Z2O A;  4CI2 A;  4Y7R A;  5GXI A;  4FHL A;  4CY5 A;  5K1C C;  4J78 A;  4XEI C;  3UKU C;  3L4O D;  4O9D A;  4U7A A;  4ZOX A;  4BH6 A;  5EML B;  1MDA H;  3I2N A;  2I0T A;  4FAV D;  3OW8 A;  3AH8 B;  4JSV C;  3JZG A;  3JRP A;  3CFS B;  2HKR A;  3UKR C;  4LG9 A;  5TF2 A;  3CFV A;  2I3T A;  3BWS A;  2H14 A;  3PSL A;  4X63 B;  5EAL A;  3SVW D;  3VA6 A;  3I8C A;  2AGL A;  4J8G A;  5IJ8 E;  3EG6 A;  1U4C A;  4PNK B;  3SFZ A;  4FAN D;  3SBP A;  5CYK A;  2GNQ A;  5FA5 B;  4OZU A;  4MK0 B;  3SBQ A;  2B4E A;  5CXB A;  2AGZ A;  3RN0 D;  5KDO B;  5FKR A;  3SCY A;  5HE3 B;  4A7J A;  4EWR A;  3KRX B;  4CI1 A;  4A11 B;  4PSX B;  5FKQ A;  4GQ2 P;  1U2V C;  5I5M A;  3OTT A;  2EBS A;  3RMZ D;  2GC4 A;  2P9I C;  4ERQ A;  4TZ4 A;  2GC7 A;  4ZOV A;  3L4M D;  2HKM A;  4E5Z B;  3C5M A;  1JJU B;  2HES X;  3EWE A;  3SJL D;  1K8K C;  3SHF A;  5IT9 g;  2P9S C;  3JB9 L;  2P9P C;  4J0W A;  4ES0 A;  2HJ4 A;  2OIZ A;  3B7F A;  3PVW B;  5FQD A;  1GXR A;  4FA5 D;  3I7L A;  4GQB B;  3UVL A;  4CY2 A;  4L1Q D;  3RSE C;  3SWS D;  4A08 B;  3FRX A;  5HE1 B;  4A0B A;  3MKS B;  3GRE A;  5I5I A;  5AJA A;  3UVO A;  4X61 B;  3FM0 A;  2H3X A;  5C2W B;  4K3I D;  3RRM C;  1QNI A;  4A11 A;  5IJ7 E;  3BG1 A;  1TBG A;  2G9A A;  4A0A B;  4GM9 A;  2PM6 B;  4GGA A;  4ERZ A;  2XU7 A;  4L9O A;  2H9P A;  2QXV A;  5A2Q g;  4XYH A;  4E5Z A;  3A0F A;  5EMM B;  4H5J A;  4CZY A;  3SXT D;  5H1M A;  4PBZ A;  3VGZ A;  1A0R B;  4K3J B;  3J80 g;  3VH0 A;  4H5I A;  2P9L C;  2OVP B;  1RI6 A;  4CZV A;  4O1Q D;  2H6K A;  3V5W B;  4J77 A;  2AGX A;  3PSC B;  4A08 A;  1S4U X;  1GOT B;  1N6D A;  5EM2 A;  3JZH A;  4R7A B;  5K19 A;  2CE8 A;  4LGN A;  2HJB A;  3I7O A;  4CZX A;  2J55 H;  5HQG A;  3ZWL B;  3AFC A;  4A0A A;  2J57 G;  4JSP C;  5GSA A;  2YNN A;  3ULE C;  4D6V A;  1VYH C;  3JPX A;  1PGU A;  5EAM A;  3AL8 B;  3F3P A;  5TEE A;  5B4W A;  2Z2P A;  3IIY A;  3C9C A;  4X3E A;  1Q47 A;  4Z8L A;  4ERY A;  2H68 A;  4QL1 A;  4QRJ A;  2B5M A;  1B9X A;  1P22 A;  2G99 A;  5FLX g;  2I3S A;  4FA1 D;  2AGY A;  1SQJ A;  1PEV A;  1R5M A;  4NSX A;  2IWF A;  2H47 A;  1XHM A;  2OK6 A;  4GGD A;  4J8B A;  5GXH A;  3HFQ A;  4FB1 D;  3NVX A;  4U1E I;  5EAR A;  4GGC A;  3UVM A;  2OVR B;  2Q7Q A;  1ERJ A;  2I0S A;  2YMU A;  3FGB A;  2OK4 A;  4BL0 A;  4ZN4 A;  4Y5R D;  3DXM C;  3IJ1 A;  2IUP A;  4J0X A;  3DXK C;  1JMX B;  1PBY B;  5TEF A;  1JMZ B;  3AL8 A;  4X60 B;  1XIP A;  3N0E A;  5FXY A;  3V7D B; 
#chains in the Genus database with same CATH topology
 4IMM A;  4ESG A;  4BUJ C;  3GFC A;  3PXW D;  2IUR A;  5JWZ A;  2QZP A;  2H6N A;  5E6S A;  3MKQ A;  1VZ3 A;  1L5G A;  1A12 A;  5HE0 B;  2HYE A;  1MG3 A;  4IA9 A;  3ZDY A;  5SXM A;  3MXX A;  4A09 B;  4HDJ A;  3P4F A;  3UR4 A;  4YVD A;  3RLM D;  1OMW B;  3QHY B;  3OKY B;  2XYI A;  3ODT A;  4CC9 A;  4CY1 A;  5M5U A;  5FKS A;  3I89 A;  4FA9 D;  1MG2 A;  2OJY A;  3EI4 B;  3PXS D;  2IWK A;  2CE9 A;  3IUN A;  3U4Y A;  3ORV D;  2P9K C;  3EQ8 A;  2IUV A;  4A2L A;  1C9I A;  2B5N A;  3DSM A;  2VDO A;  4G1M A;  3RN1 D;  1YR2 A;  1SHY B;  3JRO A;  3NIG A;  3EI3 B;  1YFQ A;  4FA4 D;  4GM8 A;  2AGW A;  3NVN A;  1UOO A;  1I2M B;  2HU7 A;  4J81 A;  3I7N A;  4JD2 C;  1TYQ C;  3K6S A;  1PI6 A;  2AQ5 A;  3GC3 B;  5EMK B;  4CI3 A;  4N14 A;  3DM0 A;  3MZL A;  3W15 A;  2UZY B;  4MMX A;  4J86 A;  5AMS A;  3NVQ A;  1O6F A;  4BCB A;  2Z2N A;  3C99 A;  3AL9 A;  4A09 A;  3EI1 B;  3I7K A;  2YNP A;  5C9Z B;  3OKY A;  3KRW B;  4O45 A;  4QT8 A;  3BG0 A;  3EQ7 A;  2BKL A;  2UZX B;  1K32 A;  3OL2 B;  3NID A;  3JAM g;  3EI4 A;  5H14 A;  5TDH B;  2CO0 C;  5CXC B;  4E54 B;  4AEZ A;  4L3G D;  4J73 A;  2TRC B;  5H17 A;  1QFS A;  5AFU 3;  3F3G A;  2VDR A;  4NBM A;  3IIW A;  3EI3 A;  4AOW A;  3UVK A;  4O3T B;  1NEX B;  1GP2 B;  5THA A;  4J79 A;  4AN1 A;  2PM9 B;  3RFG A;  2O9K A;  4XYI A;  3VI4 A;  5C2V B;  2XL2 A;  3V9F A;  3PXT D;  4D0K A;  4IRZ A;  2PBI B;  1N6F A;  4CI8 A;  3UVN A;  3EQ9 A;  4PBY A;  3V4P A;  4A2M A;  2IUQ A;  4KFM B;  2XDW A;  4O02 A;  4G56 B;  4MMZ A;  5IGO A;  2P9U C;  2H9L A;  4UM8 A;  3EI1 A;  3EI2 B;  1XKS A;  5I5J A;  4J82 A;  1BPO A;  4JHP C;  3MVD K;  1UOQ A;  3OL2 A;  4WK4 A;  4PXW A;  4J87 A;  4A0B B;  2XE4 A;  2OVQ B;  3E0C A;  5CXC A;  4E54 A;  1JTD B;  3MMY A;  3I7P A;  2W18 A;  3EU7 A;  4JSX C;  1N6E A;  5HE2 B;  5EAP A;  5GMK n;  3IJC A;  3RFH A;  2H6Q A;  4GM3 A;  4JT6 C;  3SN6 B;  3OKW A;  1K3I A;  2VDQ A;  4PSW B;  3IKO A;  2PM9 A;  4ZOY A;  2IAA A;  2PM7 B;  4JSN C;  5IC7 A;  4CY3 A;  4FWW A;  4LG8 A;  3J81 g;  3PVU B;  3SLE D;  4UI9 R;  5HYN B;  4Z7O A;  5M5V A;  1JOF A;  2B5L A;  3DWL C;  1GOF A;  1SQ9 A;  3OKT A;  1OLZ A;  1UOP A;  4O2W A;  3MUO A;  2CNX A;  3K26 A;  3MZK A;  4AX4 A;  3EI2 A;  2I0R A;  2CO0 A;  2QC5 A;  3K27 A;  5C92 A;  4RE5 A;  4I79 A;  2CN3 A;  4PC0 A;  3FCU A;  5EMJ B;  4OWR A;  1NR0 A;  2AH1 A;  2H13 A;  5EM2 B;  3I8E A;  4WK0 A;  3EMH A;  2J56 H;  2BBK H;  3N0D A;  3SBR A;  2HXC A;  4L3H D;  3IJ0 A;  3QI0 A;  4J84 A;  5M5R A;  2MTA H;  4ZOZ A;  3F3F A;  3I7H A;  3VI3 A;  3C75 H;  3IJE A;  1JV2 A;  4GMB A;  2YB8 B;  4DNU A;  4GQ1 A;  1B9Y A;  4JXM A;  3PE7 A;  3K72 A;  3DDU A;  2H9N A;  4GZ8 A;  3JZN A;  2YBA A;  2AH0 A;  4QQE A;  2BCJ B;  3CIK B;  1U8C A;  3SMR A;  5FKT A;  2XL3 A;  2CN2 A;  5IGQ A;  1GG2 B;  5CYK B;  1L0Q A;  2P9N C;  3IUR A;  1FWX A;  2YNO A;  2H9M A;  3GD1 I;  5CXB B;  1TYE A;  4JT5 C;  2Z2O A;  4O3U B;  4CI2 A;  4Y7R A;  5GXI A;  1M1X A;  4FHL A;  2HU8 A;  4BP9 A;  2EIB A;  4CY5 A;  5K1C C;  1VE7 A;  4DNW A;  4J78 A;  4QAM A;  4XEI C;  4NAA A;  3UKU C;  1O6G A;  3L4O D;  4O9D A;  4U7A A;  4ZOX A;  4BH6 A;  5EML B;  4G55 A;  1MDA H;  3I2N A;  2I0T A;  5FFO A;  4FAV D;  3OW8 A;  3AH8 B;  4JSV C;  3JZG A;  3JRP A;  3CFS B;  2HKR A;  3UKR C;  4LG9 A;  4RE6 A;  5TF2 A;  3CFV A;  2I3T A;  3BWS A;  3ZDX A;  2H14 A;  3PSL A;  4X63 B;  5EAL A;  1H2X A;  3O4G A;  4Z7Q A;  3SVW D;  2VDN A;  3VA6 A;  3I8C A;  2AGL A;  4J8G A;  5IJ8 E;  3ZDZ A;  3ZE2 A;  3EG6 A;  1U4C A;  4PNK B;  3SFZ A;  4FAN D;  4DNV A;  3SBP A;  5CYK A;  3T3M A;  2GNQ A;  5FA5 B;  3T3P A;  4OZU A;  4AMY A;  4MK0 B;  3SBQ A;  2B4E A;  1E5T A;  5CXB A;  2AGZ A;  3RN0 D;  5KDO B;  5FKR A;  3SCY A;  5HE3 B;  4A7J A;  4EWR A;  3KRX B;  4CI1 A;  4A11 B;  4PSX B;  5FKQ A;  4GQ2 P;  1U2V C;  5I5M A;  3OTT A;  2EBS A;  3RMZ D;  2GC4 A;  2P9I C;  4ERQ A;  4TZ4 A;  2GC7 A;  4ZOV A;  3KCI A;  3L4M D;  2HKM A;  4E5Z B;  3C5M A;  4Z7N A;  1JJU B;  2HES X;  1VZ2 A;  3EWE A;  3SJL D;  1H2W A;  1K8K C;  3SHF A;  5IT9 g;  2P9S C;  4UM9 A;  3JB9 L;  2P9P C;  4J0W A;  4ES0 A;  2HJ4 A;  2OIZ A;  3B7F A;  3OF7 A;  3PVW B;  3IUM A;  5FQD A;  5M5S A;  5M5T A;  1VE6 A;  2JKX A;  2VDL A;  1GXR A;  4FA5 D;  3I7L A;  4GQB B;  3UVL A;  5E6U A;  4CY2 A;  4L1Q D;  3RSE C;  3SWS D;  4A08 B;  3FRX A;  5HE1 B;  4A0B A;  2EIC A;  1GOH A;  3MKS B;  3O4H A;  3GRE A;  4L1M A;  5I5I A;  5AJA A;  3UVO A;  4X61 B;  3FM0 A;  2H3X A;  5C2W B;  4K3I D;  3RRM C;  1QNI A;  3ZE1 A;  5FFG A;  4A11 A;  4D9S A;  5IJ7 E;  3BG1 A;  1TBG A;  4WJK A;  2G9A A;  4A0A B;  4GM9 A;  2PM6 B;  4GGA A;  4ERZ A;  2XU7 A;  3ZE0 A;  4L9O A;  2VDK A;  2H9P A;  2QXV A;  5A2Q g;  4G1E A;  4XYH A;  4E5Z A;  3A0F A;  5EMM B;  4H5J A;  4CZY A;  3O4I A;  3SXT D;  5H1M A;  4PBZ A;  3VGZ A;  2HU5 A;  1A0R B;  4K3J B;  3J80 g;  3VH0 A;  1QFM A;  4H5I A;  2P9L C;  2OVP B;  1RI6 A;  4CZV A;  4O1Q D;  1H2Z A;  2H6K A;  3V5W B;  3O4J A;  4J77 A;  1T2X A;  4JHN A;  2AGX A;  2VC2 A;  3PSC B;  4A08 A;  3IUQ A;  1S4U X;  1GOT B;  1N6D A;  2WQ8 A;  5EM2 A;  4BCD A;  5E6R A;  3JZH A;  4R7A B;  4NC4 A;  1H2Y A;  4MMY A;  2VDP A;  5K19 A;  2CE8 A;  4LGN A;  2HJB A;  3I7O A;  4CZX A;  2J55 H;  5HQG A;  4WK2 A;  3ZWL B;  3AFC A;  4A0A A;  2J57 G;  4JSP C;  5GSA A;  2YNN A;  1C9L A;  3ULE C;  4D6V A;  1VYH C;  3JPX A;  1PGU A;  2VZ1 A;  5EAM A;  3AL8 B;  3F3P A;  5HDB A;  5TEE A;  5B4W A;  2Z2P A;  5C86 A;  1E8N A;  2EIE A;  3K71 A;  3IIY A;  3C9C A;  4X3E A;  1Q47 A;  4Z8L A;  4ERY A;  2H68 A;  3IUJ A;  4QL1 A;  4QRJ A;  2B5M A;  3FCS A;  1B9X A;  1P22 A;  1UTC A;  4AMZ A;  2G99 A;  5FLX g;  2I3S A;  3IUL A;  4FA1 D;  2AGY A;  1SQJ A;  1PEV A;  1R5M A;  2EID A;  1E8M A;  4NSX A;  2IWF A;  2H47 A;  2VDM A;  1XHM A;  2OK6 A;  4GGD A;  4J8B A;  4NEN A;  4BP8 A;  5GXH A;  3IVM A;  3HFQ A;  4FB1 D;  4BCC A;  1GOG A;  3NVX A;  4U1E I;  5EAR A;  4GGC A;  3UVM A;  2OVR B;  2QR5 A;  2Q7Q A;  2VZ3 A;  2XZG A;  1ERJ A;  2I0S A;  2YMU A;  5M61 A;  3FGB A;  4AN0 A;  2OK4 A;  4BL0 A;  4ZN4 A;  4Y5R D;  3DXM C;  3IJ1 A;  2IUP A;  4J0X A;  3DXK C;  3V4V A;  1JMX B;  3MUN A;  3NIF A;  1PBY B;  5TEF A;  1JMZ B;  3AL8 A;  4X60 B;  1XIP A;  3N0E A;  5FXY A;  3V7D B; 
#chains in the Genus database with same CATH homology
 4IMM A;  4ESG A;  4BUJ C;  3GFC A;  3PXW D;  2IUR A;  5JWZ A;  2H6N A;  3MKQ A;  5HE0 B;  2HYE A;  1MG3 A;  4IA9 A;  5SXM A;  3MXX A;  4A09 B;  4HDJ A;  3P4F A;  3UR4 A;  4YVD A;  3RLM D;  1OMW B;  3OKY B;  2XYI A;  3ODT A;  4CC9 A;  4CY1 A;  5FKS A;  3I89 A;  4FA9 D;  1MG2 A;  2OJY A;  3EI4 B;  3PXS D;  2IWK A;  2CE9 A;  3U4Y A;  3ORV D;  2P9K C;  2IUV A;  4A2L A;  2B5N A;  3DSM A;  3RN1 D;  1SHY B;  3JRO A;  3EI3 B;  1YFQ A;  4FA4 D;  4GM8 A;  2AGW A;  3NVN A;  4J81 A;  3I7N A;  4JD2 C;  1TYQ C;  1PI6 A;  2AQ5 A;  5EMK B;  4CI3 A;  4N14 A;  3DM0 A;  3MZL A;  3W15 A;  2UZY B;  4J86 A;  5AMS A;  3NVQ A;  2Z2N A;  3C99 A;  3AL9 A;  4A09 A;  3EI1 B;  3I7K A;  2YNP A;  5C9Z B;  3OKY A;  3KRW B;  4O45 A;  4QT8 A;  3BG0 A;  2UZX B;  1K32 A;  3OL2 B;  3JAM g;  3EI4 A;  5H14 A;  5TDH B;  2CO0 C;  5CXC B;  4E54 B;  4AEZ A;  4L3G D;  4J73 A;  2TRC B;  5H17 A;  5AFU 3;  3F3G A;  3IIW A;  3EI3 A;  4AOW A;  3UVK A;  4O3T B;  1NEX B;  1GP2 B;  5THA A;  4J79 A;  2PM9 B;  3RFG A;  2O9K A;  4XYI A;  5C2V B;  2XL2 A;  3V9F A;  3PXT D;  4D0K A;  2PBI B;  1N6F A;  4CI8 A;  3UVN A;  4PBY A;  4A2M A;  2IUQ A;  4KFM B;  4G56 B;  5IGO A;  2P9U C;  2H9L A;  3EI1 A;  3EI2 B;  1XKS A;  5I5J A;  4J82 A;  3OL2 A;  4PXW A;  4J87 A;  4A0B B;  2OVQ B;  3E0C A;  5CXC A;  4E54 A;  3MMY A;  3I7P A;  2W18 A;  3EU7 A;  4JSX C;  1N6E A;  5HE2 B;  5EAP A;  5GMK n;  3IJC A;  3RFH A;  2H6Q A;  4GM3 A;  4JT6 C;  3SN6 B;  3OKW A;  4PSW B;  3IKO A;  2PM9 A;  4ZOY A;  2IAA A;  2PM7 B;  4JSN C;  5IC7 A;  4CY3 A;  4FWW A;  4LG8 A;  3J81 g;  3PVU B;  3SLE D;  4UI9 R;  5HYN B;  1JOF A;  2B5L A;  3DWL C;  1SQ9 A;  3OKT A;  1OLZ A;  2CNX A;  3K26 A;  3MZK A;  3EI2 A;  2I0R A;  2CO0 A;  2QC5 A;  3K27 A;  4I79 A;  2CN3 A;  4PC0 A;  5EMJ B;  4OWR A;  1NR0 A;  2AH1 A;  2H13 A;  5EM2 B;  3I8E A;  3EMH A;  2J56 H;  2BBK H;  3N0D A;  3SBR A;  2HXC A;  4L3H D;  3IJ0 A;  4J84 A;  2MTA H;  4ZOZ A;  3F3F A;  3I7H A;  3C75 H;  4GMB A;  2YB8 B;  4GQ1 A;  1B9Y A;  4JXM A;  3PE7 A;  2H9N A;  4GZ8 A;  3JZN A;  2YBA A;  2AH0 A;  4QQE A;  2BCJ B;  3CIK B;  3SMR A;  5FKT A;  2XL3 A;  2CN2 A;  5IGQ A;  1GG2 B;  5CYK B;  1L0Q A;  2P9N C;  1FWX A;  2YNO A;  2H9M A;  5CXB B;  4JT5 C;  4O3U B;  2Z2O A;  4CI2 A;  4Y7R A;  5GXI A;  4FHL A;  4CY5 A;  5K1C C;  4J78 A;  4XEI C;  3UKU C;  3L4O D;  4O9D A;  4U7A A;  4ZOX A;  4BH6 A;  5EML B;  1MDA H;  3I2N A;  2I0T A;  4FAV D;  3OW8 A;  3AH8 B;  4JSV C;  3JZG A;  3JRP A;  3CFS B;  2HKR A;  3UKR C;  4LG9 A;  5TF2 A;  3CFV A;  2I3T A;  3BWS A;  2H14 A;  3PSL A;  4X63 B;  5EAL A;  3SVW D;  3VA6 A;  3I8C A;  2AGL A;  4J8G A;  5IJ8 E;  3EG6 A;  1U4C A;  4PNK B;  3SFZ A;  4FAN D;  3SBP A;  5CYK A;  2GNQ A;  5FA5 B;  4OZU A;  4MK0 B;  3SBQ A;  2B4E A;  5CXB A;  2AGZ A;  3RN0 D;  5KDO B;  5FKR A;  3SCY A;  5HE3 B;  4A7J A;  4EWR A;  3KRX B;  4CI1 A;  4A11 B;  4PSX B;  5FKQ A;  4GQ2 P;  1U2V C;  5I5M A;  3OTT A;  2EBS A;  3RMZ D;  2GC4 A;  2P9I C;  4ERQ A;  4TZ4 A;  2GC7 A;  4ZOV A;  3L4M D;  2HKM A;  4E5Z B;  3C5M A;  1JJU B;  2HES X;  3EWE A;  3SJL D;  1K8K C;  3SHF A;  5IT9 g;  2P9S C;  3JB9 L;  2P9P C;  4J0W A;  4ES0 A;  2HJ4 A;  2OIZ A;  3B7F A;  3PVW B;  5FQD A;  1GXR A;  4FA5 D;  3I7L A;  4GQB B;  3UVL A;  4CY2 A;  4L1Q D;  3RSE C;  3SWS D;  4A08 B;  3FRX A;  5HE1 B;  4A0B A;  3MKS B;  3GRE A;  5I5I A;  5AJA A;  3UVO A;  4X61 B;  3FM0 A;  2H3X A;  5C2W B;  4K3I D;  3RRM C;  1QNI A;  4A11 A;  5IJ7 E;  3BG1 A;  1TBG A;  2G9A A;  4A0A B;  4GM9 A;  2PM6 B;  4GGA A;  4ERZ A;  2XU7 A;  4L9O A;  2H9P A;  2QXV A;  5A2Q g;  4XYH A;  4E5Z A;  3A0F A;  5EMM B;  4H5J A;  4CZY A;  3SXT D;  5H1M A;  4PBZ A;  3VGZ A;  1A0R B;  4K3J B;  3J80 g;  3VH0 A;  4H5I A;  2P9L C;  2OVP B;  1RI6 A;  4CZV A;  4O1Q D;  2H6K A;  3V5W B;  4J77 A;  2AGX A;  3PSC B;  4A08 A;  1S4U X;  1GOT B;  1N6D A;  5EM2 A;  3JZH A;  4R7A B;  5K19 A;  2CE8 A;  4LGN A;  2HJB A;  3I7O A;  4CZX A;  2J55 H;  5HQG A;  3ZWL B;  3AFC A;  4A0A A;  2J57 G;  4JSP C;  5GSA A;  2YNN A;  3ULE C;  4D6V A;  1VYH C;  3JPX A;  1PGU A;  5EAM A;  3AL8 B;  3F3P A;  5TEE A;  5B4W A;  2Z2P A;  3IIY A;  3C9C A;  4X3E A;  1Q47 A;  4Z8L A;  4ERY A;  2H68 A;  4QL1 A;  4QRJ A;  2B5M A;  1B9X A;  1P22 A;  2G99 A;  5FLX g;  2I3S A;  4FA1 D;  2AGY A;  1SQJ A;  1PEV A;  1R5M A;  4NSX A;  2IWF A;  2H47 A;  1XHM A;  2OK6 A;  4GGD A;  4J8B A;  5GXH A;  3HFQ A;  4FB1 D;  3NVX A;  4U1E I;  5EAR A;  4GGC A;  3UVM A;  2OVR B;  2Q7Q A;  1ERJ A;  2I0S A;  2YMU A;  3FGB A;  2OK4 A;  4BL0 A;  4ZN4 A;  4Y5R D;  3DXM C;  3IJ1 A;  2IUP A;  4J0X A;  3DXK C;  1JMX B;  1PBY B;  5TEF A;  1JMZ B;  3AL8 A;  4X60 B;  1XIP A;  3N0E A;  5FXY A;  3V7D B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...