4IA9A

Crystal structure of human wd repeat domain 5 in complex with 2-chloro-4-fluoro-3-methyl-n-[2-(4-methylpiperazin-1-yl)-5-nitrophenyl]benzamide
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
305
structure length
305
Chain Sequence
b'PVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title Synthesis, Optimization, and Evaluation of Novel Small Molecules as Antagonists of WDR5-MLL Interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 103
structure length 305
sequence length 305
ec nomenclature
pdb deposition date 2012-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4ia9A00
2H6QA 1N6DA 5A2Qg 4OZUA 4PBZA 3U4YA 4J73A 3NVXA 3EMHA 5H14A 2PBIB 2H6NA 2P9PC 3EWEA 4GGDA 5HQGA 3CFSB 4ESGA 2AGWA 5HE3B 5I5JA 3ULEC 2H68A 2CE9A 4LGNA 4K3JB 3OL2A 2B5NA 3PXWD 2EBSA 2IWKA 3I8CA 2XL3A 2YB8B 4A08A 5FKTA 4E54A 2I0TA 4JT6C 4A0AA 3IIYA 2O9KA 4EWRA 4A7JA 5K19A 3VGZA 2OVPB 3KRXB 4X63B 4L1QD 5EARA 1GP2B 4JSVC 2HJBA 2Z2NA 3FGBA 3J81g 3UKRC 5FKSA 2AH1A 3IJ1A 1RI6A 3AFCA 4XYIA 1XKSA 2H3XA 4J86A 4CZXA 4A09B 5H1MA 5CXBA 3EI2A 2Z2OA 3GFCA 5GMKn 2PM9B 5C9ZB 3OW8A 4CY2A 4N14A 3BG0A 3JPXA 5IJ7E 3I7KA 3ZWLB 3PXTD 4U7AA 2Q7QA 3BWSA 4TZ4A 5KDOB 1K32A 5TF2A 4K3ID 4PNKB 5GXHA 4GM8A 3L4OD 4QL1A 3C75H 3SWSD 2H14A 3AH8B 3PSCB 4D0KA 2HJ4A 4X61B 4CY1A 2GNQA 3CIKB 4J81A 4GZ8A 2I0RA 3A0FA 2IAAA 4A09A 3UVNA 3SN6B 2J55H 4ZOZA 4PC0A 2P9IC 3PXSD 2OVQB 4GMBA 2YMUA 2BCJB 2H9LA 5HE0B 2CNXA 4J0WA 5IGOA 4A08B 4HDJA 4CI3A 2UZYB 4E54B 2AH0A 2GC4A 5FQDA 4FAND 1P22A 3EI1A 4JSPC 2H13A 3RMZD 3UKUC 3MKSB 4PXWA 4FWWA 3DWLC 3OKWA 1JOFA 4X60B 1N6FA 3MMYA 4IA9A 4QT8A 5AMSA 2IUPA 2Z2PA 4O45A 4FA1D 2PM6B 4BH6A 5AFU3 3MZLA 1GOTB 5CXBB 3EI2B 3BG1A 2QC5A 1MG2A 5FA5B 4Y7RA 1QNIA 3FM0A 5K1CC 3SHFA 2AGYA 5EMJB 2PM7B 2AGXA 2G99A 4A2MA 3RLMD 1S4UX 2IWFA 4D6VA 2OIZA 3RN1D 2H9PA 4JT5C 3E0CA 3EI3B 3SVWD 2P9KC 2B5LA 3RFHA 4BUJC 3DXKC 4J0XA 5EMKB 3W15A 2H6KA 3RSEC 2I0SA 4GGAA 3SBPA 3L4MD 1L0QA 3DSMA 5B4WA 3SCYA 4L3GD 5C2VB 4X3EA 4ERQA 3I7NA 2YNOA 3V5WB 1U4CA 4ES0A 3UR4A 1MDAH 5AJAA 2IUVA 3B7FA 3JZHA 3SLED 2J57G 1PGUA 3UVMA 2HYEA 3EI4A 2J56H 3IIWA 4FB1D 3EI3A 4U1EI 2CN2A 3UVKA 4NSXA 4LG8A 3NVNA 1SHYB 3P4FA 4J79A 5IJ8E 3EI1B 2YNNA 4KFMB 4YVDA 2HKRA 2XL2A 5I5IA 3K26A 3DM0A 5EM2A 5THAA 5EALA 3OTTA 5SXMA 2UZXB 5EAPA 3F3PA 4IMMA 4JSNC 2AQ5A 4ZOYA 2G9AA 4GQ2P 4H5IA 4QRJA 3JRPA 2OK4A 4O3TB 1R5MA 4OWRA 4CY3A 4GQBB 3IJ0A 1JMXB 4ZN4A 4CY5A 1YFQA 2GC7A 5H17A 1Q47A 2TRCB 4CI1A 4A0BA 5EMLB 4UI9R 3OKTA 3SFZA 4CC9A 4J8BA 4CI8A 3JAMg 4E5ZB 5IC7A 1ERJA 2IURA 4ERYA 2H47A 3N0DA 3PVUB 2P9SC 1OLZA 1VYHC 3I7HA 2B5MA 2IUQA 4O3UB 3RFGA 5CYKA 5TEEA 3VH0A 2QXVA 4XEIC 1JJUB 1PEVA 1B9XA 2P9UC 5TEFA 3I89A 5C2WB 2HXCA 2YNPA 3JZGA 2P9NC 3FRXA 1B9YA 3PSLA 4A2LA 1NR0A 4JSXC 4AEZA 4FAVD 5HE1B 1PBYB 5EMMB 3AL9A 3EI4B 4JD2C 1NEXB 4O9DA 2I3SA 3EU7A 4BL0A 1FWXA 4E5ZA 5TDHB 4MK0B 3SBQA 2CO0A 3C99A 3C9CA 4O1QD 1MG3A 4PSWB 3ORVD 2MTAH 3SBRA 5I5MA 5EM2B 4FA4D 1XIPA 4QQEA 3JZNA 4GQ1A 2HESX 1JMZB 4CZYA 4J87A 4ERZA 4I79A 1K8KC 2HKMA 2H9MA 4J77A 3RRMC 1XHMA 5FKQA 5GSAA 4JXMA 4LG9A 3VA6A 2OVRB 2XU7A 2H9NA 4G56B 4R7AB 3SXTD 1GXRA 4Y5RD 3I7OA 1SQ9A 3RN0D 3I8EA 3C5MA 4PSXB 4A0BB 2OK6A 1A0RB 1U2VC 3I7PA 3EG6A 3HFQA 4GGCA 2CN3A 3KRWB 3J80g 3MXXA 4CZVA 2OJYA 2B4EA 3OKYB 3CFVA 4L3HD 3V7DB 3AL8B 2P9LC 4PBYA 5GXIA 2CO0C 1SQJA 3MZKA 3SMRA 4A11B 5IT9g 5HYNB 4XYHA 4GM3A 5CYKB 5CXCB 4J8GA 5JWZA 4Z8LA 5HE2B 4L9OA 3K27A 3MKQA 2AGZA 3F3FA 3F3GA 3JROA 4ZOXA 5FKRA 3PVWB 2AGLA 2BBKH 2YBAA 4GM9A 4J78A 3JB9L 3NVQA 3DXMC 5FLXg 3UVLA 5IGQA 1TBGA 1GG2B 3ODTA 4FHLA 5EAMA 3IJCA 4AOWA 3UVOA 3IKOA 3SJLD 2CE8A 3I7LA 2I3TA 2PM9A 2W18A 3OKYA 1OMWB 1PI6A 2XYIA 3OL2B 3AL8A 4FA5D 5FXYA 4A11A 3N0EA 4J84A 1N6EA 3V9FA 4CI2A 4FA9D 3I2NA 3PE7A 5CXCA 4A0AB 1TYQC 4J82A 4H5JA 4ZOVA 3GREA
chains in the Genus database with same CATH superfamily
2H6QA 1N6DA 5A2Qg 4OZUA 4PBZA 4AMZA 3U4YA 4J73A 3NVXA 3EMHA 4QAMA 5H14A 2PBIB 4Z7OA 3VI4A 3FCUA 2H6NA 1T2XA 2P9PC 3EWEA 3IUJA 4GGDA 5HQGA 3CFSB 4ESGA 2AGWA 2HU5A 5HE3B 5I5JA 4WJKA 3ULEC 2H68A 2CE9A 5M5TA 4LGNA 2XZGA 4K3JB 3OL2A 3V4VA 2B5NA 3PXWD 2EBSA 2IWKA 3I8CA 2XL3A 2YB8B 4A08A 1UOOA 1UOQA 1H2YA 5FKTA 4E54A 4RE6A 2I0TA 4JT6C 4A0AA 3IIYA 2VDPA 2O9KA 4EWRA 4JHPC 4A7JA 2EIDA 3T3PA 5K19A 3VGZA 2OVPB 3KRXB 4X63B 4L1QD 5EARA 1GP2B 4JSVC 2HJBA 2Z2NA 1JV2A 3FGBA 3J81g 3UKRC 5FKSA 2AH1A 3IJ1A 3IULA 1RI6A 3IVMA 3AFCA 4XYIA 1XKSA 2H3XA 4J86A 3ZDXA 4CZXA 4A09B 1E8NA 2VDMA 5H1MA 3OF7A 5CXBA 3EI2A 2Z2OA 3GFCA 5GMKn 2PM9B 5C9ZB 3OW8A 4CY2A 3O4IA 5FFGA 4N14A 3BG0A 3ZDYA 1QFSA 2VDNA 1O6GA 3MVDK 3JPXA 5IJ7E 3I7KA 3ZWLB 3PXTD 4U7AA 2Q7QA 3BWSA 4TZ4A 4AN1A 5E6UA 5KDOB 1K32A 3MUOA 5TF2A 4K3ID 4PNKB 3EQ7A 2VDKA 5GXHA 4GM8A 3L4OD 4QL1A 1VE7A 3C75H 3SWSD 2H14A 3AH8B 3PSCB 3K71A 4D0KA 2HJ4A 4X61B 4CY1A 2GNQA 3CIKB 4J81A 4GZ8A 4WK0A 4MMXA 2I0RA 3A0FA 2IAAA 4A09A 3UVNA 3SN6B 5HDBA 3ZDZA 2J55H 4ZOZA 4PC0A 4AMYA 2P9IC 3PXSD 2OVQB 4GMBA 2YMUA 2BCJB 2H9LA 5HE0B 2CNXA 4J0WA 5IGOA 4A08B 4HDJA 4CI3A 2UZYB 4E54B 2VDRA 2AH0A 2GC4A 3EQ9A 5FQDA 4FAND 1P22A 3EI1A 4Z7NA 2QZPA 4AN0A 3O4GA 4IRZA 4JSPC 1E5TA 3T3MA 2H13A 3RMZD 3UKUC 2VDQA 3MKSB 4PXWA 4FWWA 3DWLC 3OKWA 1JOFA 4X60B 1N6FA 2VDOA 3IUNA 3MMYA 4IA9A 4QT8A 5AMSA 2IUPA 2Z2PA 4O45A 4FA1D 2PM6B 4BH6A 5AFU3 3MZLA 1GOTB 5CXBB 3EI2B 2XDWA 3O4HA 3BG1A 2QC5A 1MG2A 5FA5B 4Y7RA 1QNIA 3FM0A 3IURA 5E6SA 5K1CC 4AX4A 3SHFA 2AGYA 5EMJB 2PM7B 2AGXA 2G99A 4A2MA 3RLMD 1S4UX 1H2ZA 2IWFA 4D6VA 2OIZA 4WK4A 3RN1D 2H9PA 4JT5C 3E0CA 3EI3B 3SVWD 2P9KC 1E8MA 2B5LA 3RFHA 4BUJC 1TYEA 3DXKC 4J0XA 5EMKB 5M5SA 3W15A 2H6KA 3RSEC 2I0SA 4GGAA 4O02A 3SBPA 3L4MD 1L0QA 3DSMA 4G55A 5B4WA 3SCYA 4L3GD 3DDUA 5C2VB 1C9LA 2HU7A 4X3EA 1L5GA 4ERQA 3I7NA 2YNOA 3V5WB 1U4CA 4ES0A 1QFMA 3UR4A 5M5VA 3ZE0A 1MDAH 5AJAA 1VE6A 2IUVA 3B7FA 3JZHA 3SLED 3EQ8A 2J57G 2VZ3A 1PGUA 3FCSA 3UVMA 2HYEA 4Z7QA 3EI4A 2JKXA 2J56H 3IIWA 4FB1D 3EI3A 4DNWA 4U1EI 2CN2A 3UVKA 4NSXA 4LG8A 3NVNA 1SHYB 3P4FA 4J79A 5IJ8E 3QHYB 3EI1B 2YNNA 4KFMB 4YVDA 2HKRA 2XL2A 5I5IA 3K72A 1YR2A 3K26A 3ZE2A 4DNUA 4NBMA 3DM0A 4NC4A 5EM2A 5EALA 5THAA 3OTTA 5SXMA 2UZXB 1JTDB 5EAPA 3F3PA 4IMMA 4JSNC 2AQ5A 4ZOYA 5M5UA 2G9AA 4GQ2P 4H5IA 3NIGA 4QRJA 3JRPA 2OK4A 4O3TB 1R5MA 4OWRA 5FFOA 4CY3A 2VDLA 4DNVA 4GQBB 3IJ0A 2VZ1A 1JMXB 4ZN4A 4CY5A 4NAAA 1YFQA 2GC7A 5H17A 1Q47A 4JHNA 2TRCB 4CI1A 4A0BA 2BKLA 5EMLB 4UI9R 3OKTA 3K6SA 3SFZA 4CC9A 4J8BA 4CI8A 2HU8A 3JAMg 4BCBA 4E5ZB 5IC7A 1ERJA 2IURA 3VI3A 1H2WA 4ERYA 2H47A 3N0DA 3PVUB 3V4PA 2P9SC 1OLZA 1VYHC 3I7HA 2B5MA 2IUQA 4O3UB 3RFGA 5CYKA 5TEEA 3VH0A 2QXVA 4XEIC 1JJUB 1PEVA 1B9XA 2P9UC 5TEFA 3NIDA 3I89A 5C2WB 2HXCA 2YNPA 1VZ3A 3JZGA 2P9NC 3FRXA 1B9YA 3PSLA 4A2LA 1NR0A 4JSXC 4AEZA 4FAVD 5HE1B 3IUMA 1PBYB 5EMMB 2XE4A 3AL9A 3EI4B 4JD2C 1NEXB 4O9DA 2WQ8A 2I3SA 3EU7A 4BL0A 1FWXA 5C86A 1H2XA 1M1XA 4E5ZA 2EICA 3MUNA 4MK0B 5TDHB 4BP9A 3IUQA 3SBQA 4BP8A 2CO0A 3C99A 3C9CA 2EIEA 4O1QD 1MG3A 4PSWB 1C9IA 3ORVD 4D9SA 2MTAH 5M61A 3SBRA 5I5MA 4WK2A 1GOHA 5EM2B 1U8CA 4BCCA 4FA4D 1GOGA 1XIPA 1I2MB 4MMYA 4QQEA 3JZNA 4GQ1A 3GC3B 2HESX 1JMZB 4CZYA 4J87A 4ERZA 4UM9A 4I79A 3NIFA 1K8KC 2HKMA 2H9MA 4J77A 3ZE1A 3RRMC 1XHMA 5FKQA 5GSAA 4JXMA 4LG9A 3VA6A 3QI0A 2OVRB 2XU7A 2H9NA 4G56B 4R7AB 3SXTD 1GXRA 4NENA 5E6RA 4Y5RD 3I7OA 1SQ9A 3RN0D 1K3IA 3I8EA 3C5MA 4PSXB 2QR5A 4A0BB 2OK6A 1A0RB 1VZ2A 1U2VC 3I7PA 3EG6A 3HFQA 3KCIA 4GGCA 2CN3A 3KRWB 2VC2A 3J80g 3MXXA 4CZVA 4RE5A 2OJYA 2B4EA 3OKYB 3CFVA 4L3HD 3V7DB 3AL8B 2P9LC 1UOPA 3O4JA 4PBYA 5GXIA 1SQJA 2CO0C 3MZKA 3SMRA 4A11B 4BCDA 5C92A 5IT9g 5HYNB 4XYHA 4GM3A 1GOFA 5CYKB 5CXCB 4J8GA 4UM8A 5JWZA 3GD1I 4Z8LA 4O2WA 5HE2B 4L1MA 4G1MA 4L9OA 3K27A 5M5RA 3MKQA 2AGZA 3F3FA 3F3GA 3JROA 4ZOXA 5FKRA 3PVWB 2AGLA 2BBKH 2YBAA 4GM9A 4J78A 3JB9L 3NVQA 3DXMC 5FLXg 3UVLA 5IGQA 1TBGA 1GG2B 3ODTA 4FHLA 1UTCA 1A12A 5EAMA 3IJCA 4AOWA 3UVOA 3IKOA 3SJLD 2CE8A 3I7LA 2I3TA 2PM9A 4G1EA 2W18A 1BPOA 3OKYA 1OMWB 1PI6A 2XYIA 3OL2B 3AL8A 4FA5D 3IJEA 5FXYA 4A11A 1O6FA 4MMZA 3N0EA 4J84A 1N6EA 3V9FA 4CI2A 4FA9D 3I2NA 3PE7A 5CXCA 2EIBA 4A0AB 1TYQC 4J82A 4H5JA 4ZOVA 3GREA
chains in the Genus database with same CATH topology
2H6QA 1N6DA 5A2Qg 4OZUA 4PBZA 3U4YA 4J73A 3NVXA 3EMHA 5H14A 2PBIB 2H6NA 2P9PC 3EWEA 4GGDA 5HQGA 3CFSB 4ESGA 2AGWA 5HE3B 5I5JA 3ULEC 2H68A 2CE9A 4LGNA 4K3JB 3OL2A 2B5NA 3PXWD 2EBSA 2IWKA 3I8CA 2XL3A 2YB8B 4A08A 5FKTA 4E54A 2I0TA 4JT6C 4A0AA 3IIYA 2O9KA 4EWRA 4A7JA 5K19A 3VGZA 2OVPB 3KRXB 4X63B 4L1QD 5EARA 1GP2B 4JSVC 2HJBA 2Z2NA 3FGBA 3J81g 3UKRC 5FKSA 2AH1A 3IJ1A 1RI6A 3AFCA 4XYIA 1XKSA 2H3XA 4J86A 4CZXA 4A09B 5H1MA 5CXBA 3EI2A 2Z2OA 3GFCA 5GMKn 2PM9B 5C9ZB 3OW8A 4CY2A 4N14A 3BG0A 3JPXA 5IJ7E 3I7KA 3ZWLB 3PXTD 4U7AA 2Q7QA 3BWSA 4TZ4A 5KDOB 1K32A 5TF2A 4K3ID 4PNKB 5GXHA 4GM8A 3L4OD 4QL1A 3C75H 3SWSD 2H14A 3AH8B 3PSCB 4D0KA 2HJ4A 4X61B 4CY1A 2GNQA 3CIKB 4J81A 4GZ8A 2I0RA 3A0FA 2IAAA 4A09A 3UVNA 3SN6B 2J55H 4ZOZA 4PC0A 2P9IC 3PXSD 2OVQB 4GMBA 2YMUA 2BCJB 2H9LA 5HE0B 2CNXA 4J0WA 5IGOA 4A08B 4HDJA 4CI3A 2UZYB 4E54B 2AH0A 2GC4A 5FQDA 4FAND 1P22A 3EI1A 4JSPC 2H13A 3RMZD 3UKUC 3MKSB 4PXWA 4FWWA 3DWLC 3OKWA 1JOFA 4X60B 1N6FA 3MMYA 4IA9A 4QT8A 5AMSA 2IUPA 2Z2PA 4O45A 4FA1D 2PM6B 4BH6A 5AFU3 3MZLA 1GOTB 5CXBB 3EI2B 3BG1A 2QC5A 1MG2A 5FA5B 4Y7RA 1QNIA 3FM0A 5K1CC 3SHFA 2AGYA 5EMJB 2PM7B 2AGXA 2G99A 4A2MA 3RLMD 1S4UX 2IWFA 4D6VA 2OIZA 3RN1D 2H9PA 4JT5C 3E0CA 3EI3B 3SVWD 2P9KC 2B5LA 3RFHA 4BUJC 3DXKC 4J0XA 5EMKB 3W15A 2H6KA 3RSEC 2I0SA 4GGAA 3SBPA 3L4MD 1L0QA 3DSMA 5B4WA 3SCYA 4L3GD 5C2VB 4X3EA 4ERQA 3I7NA 2YNOA 3V5WB 1U4CA 4ES0A 3UR4A 1MDAH 5AJAA 2IUVA 3B7FA 3JZHA 3SLED 2J57G 1PGUA 3UVMA 2HYEA 3EI4A 2J56H 3IIWA 4FB1D 3EI3A 4U1EI 2CN2A 3UVKA 4NSXA 4LG8A 3NVNA 1SHYB 3P4FA 4J79A 5IJ8E 3EI1B 2YNNA 4KFMB 4YVDA 2HKRA 2XL2A 5I5IA 3K26A 3DM0A 5EM2A 5THAA 5EALA 3OTTA 5SXMA 2UZXB 5EAPA 3F3PA 4IMMA 4JSNC 2AQ5A 4ZOYA 2G9AA 4GQ2P 4H5IA 4QRJA 3JRPA 2OK4A 4O3TB 1R5MA 4OWRA 4CY3A 4GQBB 3IJ0A 1JMXB 4ZN4A 4CY5A 1YFQA 2GC7A 5H17A 1Q47A 2TRCB 4CI1A 4A0BA 5EMLB 4UI9R 3OKTA 3SFZA 4CC9A 4J8BA 4CI8A 3JAMg 4E5ZB 5IC7A 1ERJA 2IURA 4ERYA 2H47A 3N0DA 3PVUB 2P9SC 1OLZA 1VYHC 3I7HA 2B5MA 2IUQA 4O3UB 3RFGA 5CYKA 5TEEA 3VH0A 2QXVA 4XEIC 1JJUB 1PEVA 1B9XA 2P9UC 5TEFA 3I89A 5C2WB 2HXCA 2YNPA 3JZGA 2P9NC 3FRXA 1B9YA 3PSLA 4A2LA 1NR0A 4JSXC 4AEZA 4FAVD 5HE1B 1PBYB 5EMMB 3AL9A 3EI4B 4JD2C 1NEXB 4O9DA 2I3SA 3EU7A 4BL0A 1FWXA 4E5ZA 5TDHB 4MK0B 3SBQA 2CO0A 3C99A 3C9CA 4O1QD 1MG3A 4PSWB 3ORVD 2MTAH 3SBRA 5I5MA 5EM2B 4FA4D 1XIPA 4QQEA 3JZNA 4GQ1A 2HESX 1JMZB 4CZYA 4J87A 4ERZA 4I79A 1K8KC 2HKMA 2H9MA 4J77A 3RRMC 1XHMA 5FKQA 5GSAA 4JXMA 4LG9A 3VA6A 2OVRB 2XU7A 2H9NA 4G56B 4R7AB 3SXTD 1GXRA 4Y5RD 3I7OA 1SQ9A 3RN0D 3I8EA 3C5MA 4PSXB 4A0BB 2OK6A 1A0RB 1U2VC 3I7PA 3EG6A 3HFQA 4GGCA 2CN3A 3KRWB 3J80g 3MXXA 4CZVA 2OJYA 2B4EA 3OKYB 3CFVA 4L3HD 3V7DB 3AL8B 2P9LC 4PBYA 5GXIA 2CO0C 1SQJA 3MZKA 3SMRA 4A11B 5IT9g 5HYNB 4XYHA 4GM3A 5CYKB 5CXCB 4J8GA 5JWZA 4Z8LA 5HE2B 4L9OA 3K27A 3MKQA 2AGZA 3F3FA 3F3GA 3JROA 4ZOXA 5FKRA 3PVWB 2AGLA 2BBKH 2YBAA 4GM9A 4J78A 3JB9L 3NVQA 3DXMC 5FLXg 3UVLA 5IGQA 1TBGA 1GG2B 3ODTA 4FHLA 5EAMA 3IJCA 4AOWA 3UVOA 3IKOA 3SJLD 2CE8A 3I7LA 2I3TA 2PM9A 2W18A 3OKYA 1OMWB 1PI6A 2XYIA 3OL2B 3AL8A 4FA5D 5FXYA 4A11A 3N0EA 4J84A 1N6EA 3V9FA 4CI2A 4FA9D 3I2NA 3PE7A 5CXCA 4A0AB 1TYQC 4J82A 4H5JA 4ZOVA 3GREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H6Q A;  1N6D A;  5A2Q g;  4OZU A;  4PBZ A;  3U4Y A;  4J73 A;  3NVX A;  3EMH A;  5H14 A;  2PBI B;  2H6N A;  2P9P C;  3EWE A;  4GGD A;  5HQG A;  3CFS B;  4ESG A;  2AGW A;  5HE3 B;  5I5J A;  3ULE C;  2H68 A;  2CE9 A;  4LGN A;  4K3J B;  3OL2 A;  2B5N A;  3PXW D;  2EBS A;  2IWK A;  3I8C A;  2XL3 A;  2YB8 B;  4A08 A;  5FKT A;  4E54 A;  2I0T A;  4JT6 C;  4A0A A;  3IIY A;  2O9K A;  4EWR A;  4A7J A;  5K19 A;  3VGZ A;  2OVP B;  3KRX B;  4X63 B;  4L1Q D;  5EAR A;  1GP2 B;  4JSV C;  2HJB A;  2Z2N A;  3FGB A;  3J81 g;  3UKR C;  5FKS A;  2AH1 A;  3IJ1 A;  1RI6 A;  3AFC A;  4XYI A;  1XKS A;  2H3X A;  4J86 A;  4CZX A;  4A09 B;  5H1M A;  5CXB A;  3EI2 A;  2Z2O A;  3GFC A;  5GMK n;  2PM9 B;  5C9Z B;  3OW8 A;  4CY2 A;  4N14 A;  3BG0 A;  3JPX A;  5IJ7 E;  3I7K A;  3ZWL B;  3PXT D;  4U7A A;  2Q7Q A;  3BWS A;  4TZ4 A;  5KDO B;  1K32 A;  5TF2 A;  4K3I D;  4PNK B;  5GXH A;  4GM8 A;  3L4O D;  4QL1 A;  3C75 H;  3SWS D;  2H14 A;  3AH8 B;  3PSC B;  4D0K A;  2HJ4 A;  4X61 B;  4CY1 A;  2GNQ A;  3CIK B;  4J81 A;  4GZ8 A;  2I0R A;  3A0F A;  2IAA A;  4A09 A;  3UVN A;  3SN6 B;  2J55 H;  4ZOZ A;  4PC0 A;  2P9I C;  3PXS D;  2OVQ B;  4GMB A;  2YMU A;  2BCJ B;  2H9L A;  5HE0 B;  2CNX A;  4J0W A;  5IGO A;  4A08 B;  4HDJ A;  4CI3 A;  2UZY B;  4E54 B;  2AH0 A;  2GC4 A;  5FQD A;  4FAN D;  1P22 A;  3EI1 A;  4JSP C;  2H13 A;  3RMZ D;  3UKU C;  3MKS B;  4PXW A;  4FWW A;  3DWL C;  3OKW A;  1JOF A;  4X60 B;  1N6F A;  3MMY A;  4IA9 A;  4QT8 A;  5AMS A;  2IUP A;  2Z2P A;  4O45 A;  4FA1 D;  2PM6 B;  4BH6 A;  5AFU 3;  3MZL A;  1GOT B;  5CXB B;  3EI2 B;  3BG1 A;  2QC5 A;  1MG2 A;  5FA5 B;  4Y7R A;  1QNI A;  3FM0 A;  5K1C C;  3SHF A;  2AGY A;  5EMJ B;  2PM7 B;  2AGX A;  2G99 A;  4A2M A;  3RLM D;  1S4U X;  2IWF A;  4D6V A;  2OIZ A;  3RN1 D;  2H9P A;  4JT5 C;  3E0C A;  3EI3 B;  3SVW D;  2P9K C;  2B5L A;  3RFH A;  4BUJ C;  3DXK C;  4J0X A;  5EMK B;  3W15 A;  2H6K A;  3RSE C;  2I0S A;  4GGA A;  3SBP A;  3L4M D;  1L0Q A;  3DSM A;  5B4W A;  3SCY A;  4L3G D;  5C2V B;  4X3E A;  4ERQ A;  3I7N A;  2YNO A;  3V5W B;  1U4C A;  4ES0 A;  3UR4 A;  1MDA H;  5AJA A;  2IUV A;  3B7F A;  3JZH A;  3SLE D;  2J57 G;  1PGU A;  3UVM A;  2HYE A;  3EI4 A;  2J56 H;  3IIW A;  4FB1 D;  3EI3 A;  4U1E I;  2CN2 A;  3UVK A;  4NSX A;  4LG8 A;  3NVN A;  1SHY B;  3P4F A;  4J79 A;  5IJ8 E;  3EI1 B;  2YNN A;  4KFM B;  4YVD A;  2HKR A;  2XL2 A;  5I5I A;  3K26 A;  3DM0 A;  5EM2 A;  5THA A;  5EAL A;  3OTT A;  5SXM A;  2UZX B;  5EAP A;  3F3P A;  4IMM A;  4JSN C;  2AQ5 A;  4ZOY A;  2G9A A;  4GQ2 P;  4H5I A;  4QRJ A;  3JRP A;  2OK4 A;  4O3T B;  1R5M A;  4OWR A;  4CY3 A;  4GQB B;  3IJ0 A;  1JMX B;  4ZN4 A;  4CY5 A;  1YFQ A;  2GC7 A;  5H17 A;  1Q47 A;  2TRC B;  4CI1 A;  4A0B A;  5EML B;  4UI9 R;  3OKT A;  3SFZ A;  4CC9 A;  4J8B A;  4CI8 A;  3JAM g;  4E5Z B;  5IC7 A;  1ERJ A;  2IUR A;  4ERY A;  2H47 A;  3N0D A;  3PVU B;  2P9S C;  1OLZ A;  1VYH C;  3I7H A;  2B5M A;  2IUQ A;  4O3U B;  3RFG A;  5CYK A;  5TEE A;  3VH0 A;  2QXV A;  4XEI C;  1JJU B;  1PEV A;  1B9X A;  2P9U C;  5TEF A;  3I89 A;  5C2W B;  2HXC A;  2YNP A;  3JZG A;  2P9N C;  3FRX A;  1B9Y A;  3PSL A;  4A2L A;  1NR0 A;  4JSX C;  4AEZ A;  4FAV D;  5HE1 B;  1PBY B;  5EMM B;  3AL9 A;  3EI4 B;  4JD2 C;  1NEX B;  4O9D A;  2I3S A;  3EU7 A;  4BL0 A;  1FWX A;  4E5Z A;  5TDH B;  4MK0 B;  3SBQ A;  2CO0 A;  3C99 A;  3C9C A;  4O1Q D;  1MG3 A;  4PSW B;  3ORV D;  2MTA H;  3SBR A;  5I5M A;  5EM2 B;  4FA4 D;  1XIP A;  4QQE A;  3JZN A;  4GQ1 A;  2HES X;  1JMZ B;  4CZY A;  4J87 A;  4ERZ A;  4I79 A;  1K8K C;  2HKM A;  2H9M A;  4J77 A;  3RRM C;  1XHM A;  5FKQ A;  5GSA A;  4JXM A;  4LG9 A;  3VA6 A;  2OVR B;  2XU7 A;  2H9N A;  4G56 B;  4R7A B;  3SXT D;  1GXR A;  4Y5R D;  3I7O A;  1SQ9 A;  3RN0 D;  3I8E A;  3C5M A;  4PSX B;  4A0B B;  2OK6 A;  1A0R B;  1U2V C;  3I7P A;  3EG6 A;  3HFQ A;  4GGC A;  2CN3 A;  3KRW B;  3J80 g;  3MXX A;  4CZV A;  2OJY A;  2B4E A;  3OKY B;  3CFV A;  4L3H D;  3V7D B;  3AL8 B;  2P9L C;  4PBY A;  5GXI A;  2CO0 C;  1SQJ A;  3MZK A;  3SMR A;  4A11 B;  5IT9 g;  5HYN B;  4XYH A;  4GM3 A;  5CYK B;  5CXC B;  4J8G A;  5JWZ A;  4Z8L A;  5HE2 B;  4L9O A;  3K27 A;  3MKQ A;  2AGZ A;  3F3F A;  3F3G A;  3JRO A;  4ZOX A;  5FKR A;  3PVW B;  2AGL A;  2BBK H;  2YBA A;  4GM9 A;  4J78 A;  3JB9 L;  3NVQ A;  3DXM C;  5FLX g;  3UVL A;  5IGQ A;  1TBG A;  1GG2 B;  3ODT A;  4FHL A;  5EAM A;  3IJC A;  4AOW A;  3UVO A;  3IKO A;  3SJL D;  2CE8 A;  3I7L A;  2I3T A;  2PM9 A;  2W18 A;  3OKY A;  1OMW B;  1PI6 A;  2XYI A;  3OL2 B;  3AL8 A;  4FA5 D;  5FXY A;  4A11 A;  3N0E A;  4J84 A;  1N6E A;  3V9F A;  4CI2 A;  4FA9 D;  3I2N A;  3PE7 A;  5CXC A;  4A0A B;  1TYQ C;  4J82 A;  4H5J A;  4ZOV A;  3GRE A; 
#chains in the Genus database with same CATH topology
 2H6Q A;  1N6D A;  5A2Q g;  4OZU A;  4PBZ A;  4AMZ A;  3U4Y A;  4J73 A;  3NVX A;  3EMH A;  4QAM A;  5H14 A;  2PBI B;  4Z7O A;  3VI4 A;  3FCU A;  2H6N A;  1T2X A;  2P9P C;  3EWE A;  3IUJ A;  4GGD A;  5HQG A;  3CFS B;  4ESG A;  2AGW A;  2HU5 A;  5HE3 B;  5I5J A;  4WJK A;  3ULE C;  2H68 A;  2CE9 A;  5M5T A;  4LGN A;  2XZG A;  4K3J B;  3OL2 A;  3V4V A;  2B5N A;  3PXW D;  2EBS A;  2IWK A;  3I8C A;  2XL3 A;  2YB8 B;  4A08 A;  1UOO A;  1UOQ A;  1H2Y A;  5FKT A;  4E54 A;  4RE6 A;  2I0T A;  4JT6 C;  4A0A A;  3IIY A;  2VDP A;  2O9K A;  4EWR A;  4JHP C;  4A7J A;  2EID A;  3T3P A;  5K19 A;  3VGZ A;  2OVP B;  3KRX B;  4X63 B;  4L1Q D;  5EAR A;  1GP2 B;  4JSV C;  2HJB A;  2Z2N A;  1JV2 A;  3FGB A;  3J81 g;  3UKR C;  5FKS A;  2AH1 A;  3IJ1 A;  3IUL A;  1RI6 A;  3IVM A;  3AFC A;  4XYI A;  1XKS A;  2H3X A;  4J86 A;  3ZDX A;  4CZX A;  4A09 B;  1E8N A;  2VDM A;  5H1M A;  3OF7 A;  5CXB A;  3EI2 A;  2Z2O A;  3GFC A;  5GMK n;  2PM9 B;  5C9Z B;  3OW8 A;  4CY2 A;  3O4I A;  5FFG A;  4N14 A;  3BG0 A;  3ZDY A;  1QFS A;  2VDN A;  1O6G A;  3MVD K;  3JPX A;  5IJ7 E;  3I7K A;  3ZWL B;  3PXT D;  4U7A A;  2Q7Q A;  3BWS A;  4TZ4 A;  4AN1 A;  5E6U A;  5KDO B;  1K32 A;  3MUO A;  5TF2 A;  4K3I D;  4PNK B;  3EQ7 A;  2VDK A;  5GXH A;  4GM8 A;  3L4O D;  4QL1 A;  1VE7 A;  3C75 H;  3SWS D;  2H14 A;  3AH8 B;  3PSC B;  3K71 A;  4D0K A;  2HJ4 A;  4X61 B;  4CY1 A;  2GNQ A;  3CIK B;  4J81 A;  4GZ8 A;  4WK0 A;  4MMX A;  2I0R A;  3A0F A;  2IAA A;  4A09 A;  3UVN A;  3SN6 B;  5HDB A;  3ZDZ A;  2J55 H;  4ZOZ A;  4PC0 A;  4AMY A;  2P9I C;  3PXS D;  2OVQ B;  4GMB A;  2YMU A;  2BCJ B;  2H9L A;  5HE0 B;  2CNX A;  4J0W A;  5IGO A;  4A08 B;  4HDJ A;  4CI3 A;  2UZY B;  4E54 B;  2VDR A;  2AH0 A;  2GC4 A;  3EQ9 A;  5FQD A;  4FAN D;  1P22 A;  3EI1 A;  4Z7N A;  2QZP A;  4AN0 A;  3O4G A;  4IRZ A;  4JSP C;  1E5T A;  3T3M A;  2H13 A;  3RMZ D;  3UKU C;  2VDQ A;  3MKS B;  4PXW A;  4FWW A;  3DWL C;  3OKW A;  1JOF A;  4X60 B;  1N6F A;  2VDO A;  3IUN A;  3MMY A;  4IA9 A;  4QT8 A;  5AMS A;  2IUP A;  2Z2P A;  4O45 A;  4FA1 D;  2PM6 B;  4BH6 A;  5AFU 3;  3MZL A;  1GOT B;  5CXB B;  3EI2 B;  2XDW A;  3O4H A;  3BG1 A;  2QC5 A;  1MG2 A;  5FA5 B;  4Y7R A;  1QNI A;  3FM0 A;  3IUR A;  5E6S A;  5K1C C;  4AX4 A;  3SHF A;  2AGY A;  5EMJ B;  2PM7 B;  2AGX A;  2G99 A;  4A2M A;  3RLM D;  1S4U X;  1H2Z A;  2IWF A;  4D6V A;  2OIZ A;  4WK4 A;  3RN1 D;  2H9P A;  4JT5 C;  3E0C A;  3EI3 B;  3SVW D;  2P9K C;  1E8M A;  2B5L A;  3RFH A;  4BUJ C;  1TYE A;  3DXK C;  4J0X A;  5EMK B;  5M5S A;  3W15 A;  2H6K A;  3RSE C;  2I0S A;  4GGA A;  4O02 A;  3SBP A;  3L4M D;  1L0Q A;  3DSM A;  4G55 A;  5B4W A;  3SCY A;  4L3G D;  3DDU A;  5C2V B;  1C9L A;  2HU7 A;  4X3E A;  1L5G A;  4ERQ A;  3I7N A;  2YNO A;  3V5W B;  1U4C A;  4ES0 A;  1QFM A;  3UR4 A;  5M5V A;  3ZE0 A;  1MDA H;  5AJA A;  1VE6 A;  2IUV A;  3B7F A;  3JZH A;  3SLE D;  3EQ8 A;  2J57 G;  2VZ3 A;  1PGU A;  3FCS A;  3UVM A;  2HYE A;  4Z7Q A;  3EI4 A;  2JKX A;  2J56 H;  3IIW A;  4FB1 D;  3EI3 A;  4DNW A;  4U1E I;  2CN2 A;  3UVK A;  4NSX A;  4LG8 A;  3NVN A;  1SHY B;  3P4F A;  4J79 A;  5IJ8 E;  3QHY B;  3EI1 B;  2YNN A;  4KFM B;  4YVD A;  2HKR A;  2XL2 A;  5I5I A;  3K72 A;  1YR2 A;  3K26 A;  3ZE2 A;  4DNU A;  4NBM A;  3DM0 A;  4NC4 A;  5EM2 A;  5EAL A;  5THA A;  3OTT A;  5SXM A;  2UZX B;  1JTD B;  5EAP A;  3F3P A;  4IMM A;  4JSN C;  2AQ5 A;  4ZOY A;  5M5U A;  2G9A A;  4GQ2 P;  4H5I A;  3NIG A;  4QRJ A;  3JRP A;  2OK4 A;  4O3T B;  1R5M A;  4OWR A;  5FFO A;  4CY3 A;  2VDL A;  4DNV A;  4GQB B;  3IJ0 A;  2VZ1 A;  1JMX B;  4ZN4 A;  4CY5 A;  4NAA A;  1YFQ A;  2GC7 A;  5H17 A;  1Q47 A;  4JHN A;  2TRC B;  4CI1 A;  4A0B A;  2BKL A;  5EML B;  4UI9 R;  3OKT A;  3K6S A;  3SFZ A;  4CC9 A;  4J8B A;  4CI8 A;  2HU8 A;  3JAM g;  4BCB A;  4E5Z B;  5IC7 A;  1ERJ A;  2IUR A;  3VI3 A;  1H2W A;  4ERY A;  2H47 A;  3N0D A;  3PVU B;  3V4P A;  2P9S C;  1OLZ A;  1VYH C;  3I7H A;  2B5M A;  2IUQ A;  4O3U B;  3RFG A;  5CYK A;  5TEE A;  3VH0 A;  2QXV A;  4XEI C;  1JJU B;  1PEV A;  1B9X A;  2P9U C;  5TEF A;  3NID A;  3I89 A;  5C2W B;  2HXC A;  2YNP A;  1VZ3 A;  3JZG A;  2P9N C;  3FRX A;  1B9Y A;  3PSL A;  4A2L A;  1NR0 A;  4JSX C;  4AEZ A;  4FAV D;  5HE1 B;  3IUM A;  1PBY B;  5EMM B;  2XE4 A;  3AL9 A;  3EI4 B;  4JD2 C;  1NEX B;  4O9D A;  2WQ8 A;  2I3S A;  3EU7 A;  4BL0 A;  1FWX A;  5C86 A;  1H2X A;  1M1X A;  4E5Z A;  2EIC A;  3MUN A;  4MK0 B;  5TDH B;  4BP9 A;  3IUQ A;  3SBQ A;  4BP8 A;  2CO0 A;  3C99 A;  3C9C A;  2EIE A;  4O1Q D;  1MG3 A;  4PSW B;  1C9I A;  3ORV D;  4D9S A;  2MTA H;  5M61 A;  3SBR A;  5I5M A;  4WK2 A;  1GOH A;  5EM2 B;  1U8C A;  4BCC A;  4FA4 D;  1GOG A;  1XIP A;  1I2M B;  4MMY A;  4QQE A;  3JZN A;  4GQ1 A;  3GC3 B;  2HES X;  1JMZ B;  4CZY A;  4J87 A;  4ERZ A;  4UM9 A;  4I79 A;  3NIF A;  1K8K C;  2HKM A;  2H9M A;  4J77 A;  3ZE1 A;  3RRM C;  1XHM A;  5FKQ A;  5GSA A;  4JXM A;  4LG9 A;  3VA6 A;  3QI0 A;  2OVR B;  2XU7 A;  2H9N A;  4G56 B;  4R7A B;  3SXT D;  1GXR A;  4NEN A;  5E6R A;  4Y5R D;  3I7O A;  1SQ9 A;  3RN0 D;  1K3I A;  3I8E A;  3C5M A;  4PSX B;  2QR5 A;  4A0B B;  2OK6 A;  1A0R B;  1VZ2 A;  1U2V C;  3I7P A;  3EG6 A;  3HFQ A;  3KCI A;  4GGC A;  2CN3 A;  3KRW B;  2VC2 A;  3J80 g;  3MXX A;  4CZV A;  4RE5 A;  2OJY A;  2B4E A;  3OKY B;  3CFV A;  4L3H D;  3V7D B;  3AL8 B;  2P9L C;  1UOP A;  3O4J A;  4PBY A;  5GXI A;  1SQJ A;  2CO0 C;  3MZK A;  3SMR A;  4A11 B;  4BCD A;  5C92 A;  5IT9 g;  5HYN B;  4XYH A;  4GM3 A;  1GOF A;  5CYK B;  5CXC B;  4J8G A;  4UM8 A;  5JWZ A;  3GD1 I;  4Z8L A;  4O2W A;  5HE2 B;  4L1M A;  4G1M A;  4L9O A;  3K27 A;  5M5R A;  3MKQ A;  2AGZ A;  3F3F A;  3F3G A;  3JRO A;  4ZOX A;  5FKR A;  3PVW B;  2AGL A;  2BBK H;  2YBA A;  4GM9 A;  4J78 A;  3JB9 L;  3NVQ A;  3DXM C;  5FLX g;  3UVL A;  5IGQ A;  1TBG A;  1GG2 B;  3ODT A;  4FHL A;  1UTC A;  1A12 A;  5EAM A;  3IJC A;  4AOW A;  3UVO A;  3IKO A;  3SJL D;  2CE8 A;  3I7L A;  2I3T A;  2PM9 A;  4G1E A;  2W18 A;  1BPO A;  3OKY A;  1OMW B;  1PI6 A;  2XYI A;  3OL2 B;  3AL8 A;  4FA5 D;  3IJE A;  5FXY A;  4A11 A;  1O6F A;  4MMZ A;  3N0E A;  4J84 A;  1N6E A;  3V9F A;  4CI2 A;  4FA9 D;  3I2N A;  3PE7 A;  5CXC A;  2EIB A;  4A0A B;  1TYQ C;  4J82 A;  4H5J A;  4ZOV A;  3GRE A; 
#chains in the Genus database with same CATH homology
 2H6Q A;  1N6D A;  5A2Q g;  4OZU A;  4PBZ A;  3U4Y A;  4J73 A;  3NVX A;  3EMH A;  5H14 A;  2PBI B;  2H6N A;  2P9P C;  3EWE A;  4GGD A;  5HQG A;  3CFS B;  4ESG A;  2AGW A;  5HE3 B;  5I5J A;  3ULE C;  2H68 A;  2CE9 A;  4LGN A;  4K3J B;  3OL2 A;  2B5N A;  3PXW D;  2EBS A;  2IWK A;  3I8C A;  2XL3 A;  2YB8 B;  4A08 A;  5FKT A;  4E54 A;  2I0T A;  4JT6 C;  4A0A A;  3IIY A;  2O9K A;  4EWR A;  4A7J A;  5K19 A;  3VGZ A;  2OVP B;  3KRX B;  4X63 B;  4L1Q D;  5EAR A;  1GP2 B;  4JSV C;  2HJB A;  2Z2N A;  3FGB A;  3J81 g;  3UKR C;  5FKS A;  2AH1 A;  3IJ1 A;  1RI6 A;  3AFC A;  4XYI A;  1XKS A;  2H3X A;  4J86 A;  4CZX A;  4A09 B;  5H1M A;  5CXB A;  3EI2 A;  2Z2O A;  3GFC A;  5GMK n;  2PM9 B;  5C9Z B;  3OW8 A;  4CY2 A;  4N14 A;  3BG0 A;  3JPX A;  5IJ7 E;  3I7K A;  3ZWL B;  3PXT D;  4U7A A;  2Q7Q A;  3BWS A;  4TZ4 A;  5KDO B;  1K32 A;  5TF2 A;  4K3I D;  4PNK B;  5GXH A;  4GM8 A;  3L4O D;  4QL1 A;  3C75 H;  3SWS D;  2H14 A;  3AH8 B;  3PSC B;  4D0K A;  2HJ4 A;  4X61 B;  4CY1 A;  2GNQ A;  3CIK B;  4J81 A;  4GZ8 A;  2I0R A;  3A0F A;  2IAA A;  4A09 A;  3UVN A;  3SN6 B;  2J55 H;  4ZOZ A;  4PC0 A;  2P9I C;  3PXS D;  2OVQ B;  4GMB A;  2YMU A;  2BCJ B;  2H9L A;  5HE0 B;  2CNX A;  4J0W A;  5IGO A;  4A08 B;  4HDJ A;  4CI3 A;  2UZY B;  4E54 B;  2AH0 A;  2GC4 A;  5FQD A;  4FAN D;  1P22 A;  3EI1 A;  4JSP C;  2H13 A;  3RMZ D;  3UKU C;  3MKS B;  4PXW A;  4FWW A;  3DWL C;  3OKW A;  1JOF A;  4X60 B;  1N6F A;  3MMY A;  4IA9 A;  4QT8 A;  5AMS A;  2IUP A;  2Z2P A;  4O45 A;  4FA1 D;  2PM6 B;  4BH6 A;  5AFU 3;  3MZL A;  1GOT B;  5CXB B;  3EI2 B;  3BG1 A;  2QC5 A;  1MG2 A;  5FA5 B;  4Y7R A;  1QNI A;  3FM0 A;  5K1C C;  3SHF A;  2AGY A;  5EMJ B;  2PM7 B;  2AGX A;  2G99 A;  4A2M A;  3RLM D;  1S4U X;  2IWF A;  4D6V A;  2OIZ A;  3RN1 D;  2H9P A;  4JT5 C;  3E0C A;  3EI3 B;  3SVW D;  2P9K C;  2B5L A;  3RFH A;  4BUJ C;  3DXK C;  4J0X A;  5EMK B;  3W15 A;  2H6K A;  3RSE C;  2I0S A;  4GGA A;  3SBP A;  3L4M D;  1L0Q A;  3DSM A;  5B4W A;  3SCY A;  4L3G D;  5C2V B;  4X3E A;  4ERQ A;  3I7N A;  2YNO A;  3V5W B;  1U4C A;  4ES0 A;  3UR4 A;  1MDA H;  5AJA A;  2IUV A;  3B7F A;  3JZH A;  3SLE D;  2J57 G;  1PGU A;  3UVM A;  2HYE A;  3EI4 A;  2J56 H;  3IIW A;  4FB1 D;  3EI3 A;  4U1E I;  2CN2 A;  3UVK A;  4NSX A;  4LG8 A;  3NVN A;  1SHY B;  3P4F A;  4J79 A;  5IJ8 E;  3EI1 B;  2YNN A;  4KFM B;  4YVD A;  2HKR A;  2XL2 A;  5I5I A;  3K26 A;  3DM0 A;  5EM2 A;  5THA A;  5EAL A;  3OTT A;  5SXM A;  2UZX B;  5EAP A;  3F3P A;  4IMM A;  4JSN C;  2AQ5 A;  4ZOY A;  2G9A A;  4GQ2 P;  4H5I A;  4QRJ A;  3JRP A;  2OK4 A;  4O3T B;  1R5M A;  4OWR A;  4CY3 A;  4GQB B;  3IJ0 A;  1JMX B;  4ZN4 A;  4CY5 A;  1YFQ A;  2GC7 A;  5H17 A;  1Q47 A;  2TRC B;  4CI1 A;  4A0B A;  5EML B;  4UI9 R;  3OKT A;  3SFZ A;  4CC9 A;  4J8B A;  4CI8 A;  3JAM g;  4E5Z B;  5IC7 A;  1ERJ A;  2IUR A;  4ERY A;  2H47 A;  3N0D A;  3PVU B;  2P9S C;  1OLZ A;  1VYH C;  3I7H A;  2B5M A;  2IUQ A;  4O3U B;  3RFG A;  5CYK A;  5TEE A;  3VH0 A;  2QXV A;  4XEI C;  1JJU B;  1PEV A;  1B9X A;  2P9U C;  5TEF A;  3I89 A;  5C2W B;  2HXC A;  2YNP A;  3JZG A;  2P9N C;  3FRX A;  1B9Y A;  3PSL A;  4A2L A;  1NR0 A;  4JSX C;  4AEZ A;  4FAV D;  5HE1 B;  1PBY B;  5EMM B;  3AL9 A;  3EI4 B;  4JD2 C;  1NEX B;  4O9D A;  2I3S A;  3EU7 A;  4BL0 A;  1FWX A;  4E5Z A;  5TDH B;  4MK0 B;  3SBQ A;  2CO0 A;  3C99 A;  3C9C A;  4O1Q D;  1MG3 A;  4PSW B;  3ORV D;  2MTA H;  3SBR A;  5I5M A;  5EM2 B;  4FA4 D;  1XIP A;  4QQE A;  3JZN A;  4GQ1 A;  2HES X;  1JMZ B;  4CZY A;  4J87 A;  4ERZ A;  4I79 A;  1K8K C;  2HKM A;  2H9M A;  4J77 A;  3RRM C;  1XHM A;  5FKQ A;  5GSA A;  4JXM A;  4LG9 A;  3VA6 A;  2OVR B;  2XU7 A;  2H9N A;  4G56 B;  4R7A B;  3SXT D;  1GXR A;  4Y5R D;  3I7O A;  1SQ9 A;  3RN0 D;  3I8E A;  3C5M A;  4PSX B;  4A0B B;  2OK6 A;  1A0R B;  1U2V C;  3I7P A;  3EG6 A;  3HFQ A;  4GGC A;  2CN3 A;  3KRW B;  3J80 g;  3MXX A;  4CZV A;  2OJY A;  2B4E A;  3OKY B;  3CFV A;  4L3H D;  3V7D B;  3AL8 B;  2P9L C;  4PBY A;  5GXI A;  2CO0 C;  1SQJ A;  3MZK A;  3SMR A;  4A11 B;  5IT9 g;  5HYN B;  4XYH A;  4GM3 A;  5CYK B;  5CXC B;  4J8G A;  5JWZ A;  4Z8L A;  5HE2 B;  4L9O A;  3K27 A;  3MKQ A;  2AGZ A;  3F3F A;  3F3G A;  3JRO A;  4ZOX A;  5FKR A;  3PVW B;  2AGL A;  2BBK H;  2YBA A;  4GM9 A;  4J78 A;  3JB9 L;  3NVQ A;  3DXM C;  5FLX g;  3UVL A;  5IGQ A;  1TBG A;  1GG2 B;  3ODT A;  4FHL A;  5EAM A;  3IJC A;  4AOW A;  3UVO A;  3IKO A;  3SJL D;  2CE8 A;  3I7L A;  2I3T A;  2PM9 A;  2W18 A;  3OKY A;  1OMW B;  1PI6 A;  2XYI A;  3OL2 B;  3AL8 A;  4FA5 D;  5FXY A;  4A11 A;  3N0E A;  4J84 A;  1N6E A;  3V9F A;  4CI2 A;  4FA9 D;  3I2N A;  3PE7 A;  5CXC A;  4A0A B;  1TYQ C;  4J82 A;  4H5J A;  4ZOV A;  3GRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...