4IA9A

Crystal structure of human wd repeat domain 5 in complex with 2-chloro-4-fluoro-3-methyl-n-[2-(4-methylpiperazin-1-yl)-5-nitrophenyl]benzamide
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
305
structure length
305
Chain Sequence
PVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title Synthesis, Optimization, and Evaluation of Novel Small Molecules as Antagonists of WDR5-MLL Interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 103
structure length 305
sequence length 305
ec nomenclature
pdb deposition date 2012-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4ia9A00
4FA5D 3AH8B 3EI4B 3ZWLB 1PBYB 3PVWB 3VH0A 3I8EA 4ESGA 4Y7RA 5IC7A 5CXBB 3JZHA 1N6EA 4ZOVA 1MG2A 4LG8A 5A2Qg 4O1QD 1OLZA 2GC4A 3EU7A 2PM6B 4BUJC 2Z2NA 5GXHA 4X61B 4GQ1A 1GOTB 2QXVA 3N0DA 4FB1D 3DWLC 1VYHC 3FRXA 2J56H 4FA4D 2P9SC 3RFGA 2CE8A 3DXKC 3I7PA 3BWSA 1N6FA 4ZOXA 5C2VB 3RLMD 4NSXA 3SHFA 2I0SA 4GMBA 4HDJA 4XEIC 4A2MA 2H9MA 5EALA 4IMMA 3ODTA 3PSCB 4O9DA 4A0BA 2W18A 1Q47A 1OMWB 4JD2C 5FKSA 2EBSA 2I3TA 2XU7A 2HYEA 2H9LA 4KFMB 1QNIA 4CC9A 4UI9R 3UVLA 2XYIA 3RRMC 4E5ZA 4J79A 3AL8B 4J8BA 5CYKA 1GXRA 5FXYA 3ORVD 3JB9L 5C2WB 4JXMA 2YNPA 4K3JB 4PBYA 3L4MD 4GGAA 3UVNA 5H1MA 4X60B 3MMYA 4LG9A 4QQEA 3RN1D 1SQJA 5I5MA 4ES0A 2CE9A 2Q7QA 5CXCA 3SVWD 4A09A 3I7NA 4O3UB 1N6DA 4Y5RD 5TDHB 4GGDA 4J73A 4XYHA 4FAVD 3AFCA 5EMKB 4CI1A 1U4CA 2G9AA 1B9XA 4ZN4A 1FWXA 2H13A 3C75H 2H6KA 2PBIB 2I0TA 3FGBA 5HYNB 4Z8LA 3FM0A 3SXTD 2AGLA 2HKRA 2MTAH 3SN6B 2PM7B 3MKSB 2OJYA 3I2NA 2AH1A 2BBKH 2Z2PA 4PNKB 1JJUB 4PSWB 1GP2B 3JZGA 4PC0A 5IT9g 4CY5A 1NR0A 3JRPA 4H5IA 2OK6A 1R5MA 5FA5B 4CZXA 4L1QD 2H3XA 4A2LA 4GM3A 5IGQA 3IIYA 4H5JA 3C9CA 3VA6A 4A0AA 4A08A 5HE1B 2OIZA 3SMRA 4BH6A 4J84A 4JSVC 4CY3A 4R7AB 3PXSD 5AFU3 2HJBA 5KDOB 2O9KA 2H6NA 2IUPA 5H14A 2PM9B 2P9IC 3MXXA 3PE7A 3EI1A 3DM0A 3I7OA 1XIPA 4EWRA 5FKQA 1K8KC 3SBQA 3SCYA 1ERJA 3KRWB 3OKYB 3K26A 3ULEC 1MDAH 5EM2A 3VGZA 3OL2A 5TEEA 3V5WB 4D6VA 2P9UC 3RSEC 3PXTD 4L9OA 3NVQA 4CZVA 2P9NC 5AJAA 4CY2A 5IGOA 4A11A 2HKMA 2IUQA 3W15A 1RI6A 4I79A 4E54A 3HFQA 3MZKA 5HE2B 2CO0C 3EI4A 2OVPB 1K32A 3BG0A 3CFVA 3EI2B 3I8CA 3I7LA 3C99A 4ERZA 5CXBA 4FHLA 4X3EA 3PXWD 3J80g 2J55H 2H14A 4JSXC 5HE0B 3V9FA 2IWFA 3EI3B 3RN0D 5B4WA 2H9PA 4ERYA 3GREA 1TYQC 1XHMA 3MKQA 4PXWA 5SXMA 2AGZA 4OZUA 2CO0A 3DXMC 3J81g 5K19A 1S4UX 4QRJA 4GM8A 5EMMB 3I89A 3EMHA 2B5LA 4N14A 4PBZA 5FKRA 5HE3B 3CIKB 1XKSA 4D0KA 3JPXA 4IA9A 1MG3A 4ZOZA 1PI6A 2IAAA 4GQBB 3UKRC 4U1EI 3SBPA 1L0QA 2I0RA 5EARA 4JSNC 2H9NA 4CZYA 1SHYB 4J8GA 4J78A 2QC5A 4U7AA 3AL8A 5H17A 5HQGA 3OKWA 3K27A 2G99A 3KRXB 3SFZA 4A0BB 3SLED 2IURA 5K1CC 3A0FA 3I7KA 2P9PC 3F3GA 5IJ7E 4GZ8A 4A7JA 5I5JA 5JWZA 2IWKA 3SBRA 2XL3A 5EAPA 2B5MA 3SWSD 4J77A 3JZNA 4J81A 4E5ZB 2IUVA 5CYKB 2YBAA 5FKTA 2Z2OA 2OVQB 4CI8A 3UVMA 1PGUA 4L3HD 4O45A 3DSMA 3OW8A 4O3TB 2CN2A 4CY1A 2GC7A 4YVDA 3UR4A 5GSAA 5TF2A 2H6QA 5CXCB 4A09B 3OKTA 1JOFA 3N0EA 4J0WA 3EG6A 4QL1A 4GGCA 1SQ9A 2YB8B 4FAND 3RFHA 5IJ8E 5GXIA 2J57G 3IIWA 2CNXA 1PEVA 3NVXA 4AOWA 2P9KC 3L4OD 5I5IA 2YNNA 2B5NA 2BCJB 3C5MA 1JMZB 3GFCA 2TRCB 5FLXg 4G56B 2OVRB 3OTTA 5GMKn 4FWWA 5EMLB 1TBGA 2HESX 3P4FA 2I3SA 3IJ1A 5EAMA 2H47A 4QT8A 4TZ4A 3E0CA 2AGWA 4PSXB 1P22A 1A0RB 3UKUC 2YMUA 4JT6C 4OWRA 4ERQA 1YFQA 2AGXA 3IJ0A 3PVUB 2AGYA 4LGNA 3EWEA 4CI2A 3NVNA 3F3FA 2OK4A 1NEXB 4JT5C 4X63B 3SJLD 2H68A 3B7FA 3RMZD 3V7DB 2PM9A 3CFSB 3UVKA 1JMXB 5C9ZB 3U4YA 5AMSA 4FA1D 4ZOYA 4A08B 4A0AB 4MK0B 4GM9A 2CN3A 3IKOA 3F3PA 4J87A 3OKYA 1U2VC 4L3GD 4K3ID 2B4EA 5FQDA 5TEFA 3UVOA 3JAMg 2AQ5A 4J82A 3I7HA 3BG1A 1GG2B 2P9LC 2GNQA 3EI1B 2YNOA 2HXCA 1B9YA 4J0XA 4BL0A 3MZLA 4XYIA 4J86A 5EMJB 2AH0A 4AEZA 3JROA 2XL2A 3EI2A 4CI3A 2UZXB 5EM2B 3OL2B 4JSPC 3AL9A 2UZYB 3IJCA 3EI3A 5THAA 2HJ4A 4FA9D 4A11B 4GQ2P 4E54B 3PSLA
chains in the Genus database with same CATH superfamily
3O4JA 4FA5D 4BCCA 3AH8B 3EI4B 3ZWLB 1PBYB 3PVWB 3VH0A 3I8EA 4ESGA 4Y7RA 1O6GA 3FCSA 5IC7A 3ZDZA 4D9SA 5CXBB 3JZHA 1N6EA 2WQ8A 4ZOVA 1MG2A 4LG8A 5A2Qg 4O1QD 4AMZA 1OLZA 2GC4A 3EU7A 2PM6B 4BUJC 2Z2NA 5GXHA 1GOGA 4X61B 4Z7OA 4GQ1A 1GOTB 2QXVA 3N0DA 4FB1D 3O4IA 2VDPA 3DWLC 1VYHC 3FRXA 2J56H 4FA4D 2P9SC 3RFGA 1UOQA 2CE8A 3DXKC 3I7PA 3BWSA 1N6FA 4O2WA 4ZOXA 3RLMD 4NSXA 3SHFA 5E6RA 2I0SA 4GMBA 4HDJA 4XEIC 4A2MA 2H9MA 1C9LA 5EALA 4IMMA 3GC3B 3ODTA 3PSCB 4O9DA 4A0BA 3O4GA 2W18A 1Q47A 1OMWB 4JD2C 5FKSA 2EBSA 1E8NA 2I3TA 2XU7A 2BKLA 2EICA 4BCBA 2HYEA 2H9LA 4KFMB 1QNIA 2QZPA 4CC9A 4UI9R 3UVLA 3T3PA 1YR2A 2XYIA 4WK2A 3RRMC 4AX4A 4E5ZA 4J79A 3AL8B 4J8BA 1JV2A 5CYKA 1GXRA 5M61A 5FXYA 3ORVD 3JB9L 5C2WB 3IUMA 4JXMA 2YNPA 4K3JB 4PBYA 3L4MD 4GGAA 3UVNA 2QR5A 5H1MA 4X60B 3MMYA 4LG9A 4MMZA 4NAAA 4QQEA 3RN1D 1SQJA 3EQ9A 4ES0A 4Z7NA 5I5MA 2CE9A 1H2WA 3V4VA 2Q7QA 5CXCA 3SVWD 1T2XA 4A09A 3I7NA 4O3UB 1N6DA 4Y5RD 5TDHB 2VDKA 4GGDA 4J73A 4XYHA 4FAVD 3AFCA 5EMKB 4CI1A 1U4CA 2G9AA 1B9XA 5E6SA 3VI3A 4ZN4A 1FWXA 2H13A 3C75H 2H6KA 2PBIB 2I0TA 3FGBA 5HYNB 4Z8LA 3FM0A 4WK4A 2VC2A 3SXTD 2VDQA 2AGLA 2HKRA 2MTAH 3SN6B 2PM7B 3MKSB 2OJYA 3I2NA 2AH1A 3K72A 2BBKH 4NC4A 2Z2PA 3VI4A 4PNKB 1JJUB 4PSWB 1GP2B 1VE6A 3JZGA 4PC0A 4AN0A 2VDOA 5IT9g 4CY5A 3MUOA 1NR0A 3JRPA 4H5IA 2OK6A 1R5MA 5FA5B 4CZXA 4L1QD 2H3XA 4A2LA 4GM3A 5IGQA 4WK0A 4G55A 3IULA 3IIYA 2VDNA 4H5JA 3C9CA 3VA6A 4A0AA 4A08A 5HE1B 2OIZA 3SMRA 4BH6A 1I2MB 4J84A 4JSVC 4CY3A 4R7AB 3PXSD 5AFU3 1A12A 2HJBA 5KDOB 2O9KA 2H6NA 2IUPA 5H14A 3K71A 2PM9B 1E5TA 2P9IC 3MXXA 3PE7A 3EI1A 3DM0A 1H2ZA 1XIPA 3I7OA 3NIFA 4EWRA 5FKQA 1K8KC 3T3MA 3SBQA 3SCYA 1ERJA 1E8MA 3KRWB 3GD1I 3OKYB 1H2XA 3K26A 3ULEC 2XZGA 4AMYA 1MDAH 4DNUA 5EM2A 3VGZA 3OL2A 5TEEA 3V5WB 4D6VA 2P9UC 3RSEC 3PXTD 1U8CA 4L9OA 1L5GA 3NVQA 4CZVA 3K6SA 2P9NC 3ZDXA 4BP8A 5AJAA 4CY2A 2HU5A 5IGOA 4A11A 2HKMA 2IUQA 3W15A 1RI6A 4I79A 4E54A 3MZKA 3HFQA 3QHYB 2CO0C 3EI4A 1O6FA 5HE2B 2OVPB 1K32A 2VDRA 2XDWA 3EQ7A 3BG0A 4IRZA 3CFVA 3EI2B 3I8CA 3I7LA 3C99A 4ERZA 3NIGA 5CXBA 4FHLA 4G1MA 4X3EA 3PXWD 3J80g 2J55H 2H14A 4JSXC 5HE0B 3V9FA 2IWFA 3EI3B 3RN0D 5M5VA 5B4WA 2H9PA 4ERYA 1TYEA 3ZE1A 3GREA 1TYQC 2EIDA 3QI0A 1BPOA 1XHMA 3MKQA 4PXWA 5SXMA 2AGZA 4OZUA 2CO0A 3DXMC 3J81g 5K19A 2VZ3A 1S4UX 4QRJA 4GM8A 5EMMB 3I89A 3EMHA 3IJEA 2B5LA 4N14A 4PBZA 5FKRA 5HE3B 1K3IA 4DNVA 4JHPC 3CIKB 1XKSA 3EQ8A 4D0KA 3JPXA 4IA9A 4QAMA 1MG3A 4ZOZA 1PI6A 2IAAA 4GQBB 3UKRC 4U1EI 3SBPA 1L0QA 2I0RA 5EARA 4JSNC 2H9NA 4CZYA 3V4PA 1SHYB 4J8GA 4J78A 4G1EA 4JHNA 2QC5A 4U7AA 3AL8A 5H17A 5HQGA 3OKWA 1C9IA 3ZE0A 3K27A 2G99A 2JKXA 3KRXB 3OF7A 3SFZA 4A0BB 3SLED 2IURA 5K1CC 4L1MA 3A0FA 3IVMA 3I7KA 2P9PC 3F3GA 5IJ7E 1M1XA 4GZ8A 4O02A 4A7JA 5I5JA 5JWZA 2IWKA 3SBRA 2XL3A 4DNWA 5EAPA 2B5MA 3SWSD 4UM9A 4J77A 3JZNA 4J81A 4E5ZB 2IUVA 3O4HA 5CYKB 2YBAA 5FKTA 3KCIA 2OVQB 4CI8A 3UVMA 1PGUA 4L3HD 4O45A 3DSMA 3OW8A 5C2VB 5C92A 3NIDA 4O3TB 2CN2A 4CY1A 2GC7A 4YVDA 3UR4A 1VZ3A 5GSAA 3IUNA 5TF2A 2H6QA 4NBMA 5CXCB 4A09B 3OKTA 1JOFA 3N0EA 4J0WA 3EG6A 4QL1A 4GGCA 1SQ9A 2YB8B 4FAND 3RFHA 4RE6A 2VZ1A 5IJ8E 1VE7A 2XE4A 5GXIA 2J57G 1VZ2A 3IIWA 2CNXA 1PEVA 2HU8A 4BCDA 3NVXA 4AOWA 2P9KC 4RE5A 3L4OD 5I5IA 2YNNA 2B5NA 2BCJB 5M5RA 3C5MA 1JMZB 3GFCA 2TRCB 5FLXg 3MVDK 4G56B 2OVRB 4Z7QA 3OTTA 5GMKn 2EIEA 4FWWA 4BP9A 3ZDYA 5EMLB 1TBGA 2HESX 3FCUA 3P4FA 3IUQA 2I3SA 3IJ1A 5EAMA 5M5SA 2H47A 4QT8A 4TZ4A 3E0CA 2AGWA 4PSXB 1P22A 1A0RB 3UKUC 2YMUA 4JT6C 4OWRA 5E6UA 4ERQA 1YFQA 2AGXA 3IJ0A 3PVUB 2AGYA 2VDLA 4LGNA 4UM8A 2HU7A 3EWEA 4CI2A 3NVNA 3F3FA 2OK4A 1NEXB 4JT5C 3MUNA 4X63B 3SJLD 4MMYA 3PSLA 2H68A 2VDMA 3B7FA 3RMZD 3V7DB 2PM9A 3CFSB 3UVKA 1JMXB 5C9ZB 4WJKA 3U4YA 5AMSA 4FA1D 4ZOYA 4A08B 4A0AB 4MK0B 3IUJA 4GM9A 2CN3A 3IKOA 5HDBA 1UOOA 3F3PA 4J87A 3ZE2A 5M5TA 3OKYA 1U2VC 4L3GD 4K3ID 2B4EA 5FQDA 5TEFA 3IURA 3UVOA 4NENA 3JAMg 2AQ5A 4J82A 2EIBA 3I7HA 5FFOA 3BG1A 1GG2B 1QFMA 1UTCA 2P9LC 2GNQA 3EI1B 2YNOA 2HXCA 5C86A 1B9YA 4J0XA 4BL0A 3DDUA 3MZLA 4XYIA 5M5UA 1GOHA 4J86A 5EMJB 2AH0A 4AEZA 3JROA 2XL2A 4MMXA 3EI2A 4CI3A 2UZXB 5EM2B 3OL2B 4AN1A 1UOPA 4JSPC 3AL9A 2UZYB 1QFSA 3IJCA 3EI3A 5THAA 1GOFA 1JTDB 2HJ4A 4FA9D 4A11B 5FFGA 4GQ2P 4E54B 1H2YA 2Z2OA
chains in the Genus database with same CATH topology
4FA5D 3AH8B 3EI4B 3ZWLB 1PBYB 3PVWB 3VH0A 3I8EA 4ESGA 4Y7RA 5IC7A 5CXBB 3JZHA 1N6EA 4ZOVA 1MG2A 4LG8A 5A2Qg 4O1QD 1OLZA 2GC4A 3EU7A 2PM6B 4BUJC 2Z2NA 5GXHA 4X61B 4GQ1A 1GOTB 2QXVA 3N0DA 4FB1D 3DWLC 1VYHC 3FRXA 2J56H 4FA4D 2P9SC 3RFGA 2CE8A 3DXKC 3I7PA 3BWSA 1N6FA 4ZOXA 5C2VB 3RLMD 4NSXA 3SHFA 2I0SA 4GMBA 4HDJA 4XEIC 4A2MA 2H9MA 5EALA 4IMMA 3ODTA 3PSCB 4O9DA 4A0BA 2W18A 1Q47A 1OMWB 4JD2C 5FKSA 2EBSA 2I3TA 2XU7A 2HYEA 2H9LA 4KFMB 1QNIA 4CC9A 4UI9R 3UVLA 2XYIA 3RRMC 4E5ZA 4J79A 3AL8B 4J8BA 5CYKA 1GXRA 5FXYA 3ORVD 3JB9L 5C2WB 4JXMA 2YNPA 4K3JB 4PBYA 3L4MD 4GGAA 3UVNA 5H1MA 4X60B 3MMYA 4LG9A 4QQEA 3RN1D 1SQJA 5I5MA 4ES0A 2CE9A 2Q7QA 5CXCA 3SVWD 4A09A 3I7NA 4O3UB 1N6DA 4Y5RD 5TDHB 4GGDA 4J73A 4XYHA 4FAVD 3AFCA 5EMKB 4CI1A 1U4CA 2G9AA 1B9XA 4ZN4A 1FWXA 2H13A 3C75H 2H6KA 2PBIB 2I0TA 3FGBA 5HYNB 4Z8LA 3FM0A 3SXTD 2AGLA 2HKRA 2MTAH 3SN6B 2PM7B 3MKSB 2OJYA 3I2NA 2AH1A 2BBKH 2Z2PA 4PNKB 1JJUB 4PSWB 1GP2B 3JZGA 4PC0A 5IT9g 4CY5A 1NR0A 3JRPA 4H5IA 2OK6A 1R5MA 5FA5B 4CZXA 4L1QD 2H3XA 4A2LA 4GM3A 5IGQA 3IIYA 4H5JA 3C9CA 3VA6A 4A0AA 4A08A 5HE1B 2OIZA 3SMRA 4BH6A 4J84A 4JSVC 4CY3A 4R7AB 3PXSD 5AFU3 2HJBA 5KDOB 2O9KA 2H6NA 2IUPA 5H14A 2PM9B 2P9IC 3MXXA 3PE7A 3EI1A 3DM0A 3I7OA 1XIPA 4EWRA 5FKQA 1K8KC 3SBQA 3SCYA 1ERJA 3KRWB 3OKYB 3K26A 3ULEC 1MDAH 5EM2A 3VGZA 3OL2A 5TEEA 3V5WB 4D6VA 2P9UC 3RSEC 3PXTD 4L9OA 3NVQA 4CZVA 2P9NC 5AJAA 4CY2A 5IGOA 4A11A 2HKMA 2IUQA 3W15A 1RI6A 4I79A 4E54A 3HFQA 3MZKA 5HE2B 2CO0C 3EI4A 2OVPB 1K32A 3BG0A 3CFVA 3EI2B 3I8CA 3I7LA 3C99A 4ERZA 5CXBA 4FHLA 4X3EA 3PXWD 3J80g 2J55H 2H14A 4JSXC 5HE0B 3V9FA 2IWFA 3EI3B 3RN0D 5B4WA 2H9PA 4ERYA 3GREA 1TYQC 1XHMA 3MKQA 4PXWA 5SXMA 2AGZA 4OZUA 2CO0A 3DXMC 3J81g 5K19A 1S4UX 4QRJA 4GM8A 5EMMB 3I89A 3EMHA 2B5LA 4N14A 4PBZA 5FKRA 5HE3B 3CIKB 1XKSA 4D0KA 3JPXA 4IA9A 1MG3A 4ZOZA 1PI6A 2IAAA 4GQBB 3UKRC 4U1EI 3SBPA 1L0QA 2I0RA 5EARA 4JSNC 2H9NA 4CZYA 1SHYB 4J8GA 4J78A 2QC5A 4U7AA 3AL8A 5H17A 5HQGA 3OKWA 3K27A 2G99A 3KRXB 3SFZA 4A0BB 3SLED 2IURA 5K1CC 3A0FA 3I7KA 2P9PC 3F3GA 5IJ7E 4GZ8A 4A7JA 5I5JA 5JWZA 2IWKA 3SBRA 2XL3A 5EAPA 2B5MA 3SWSD 4J77A 3JZNA 4J81A 4E5ZB 2IUVA 5CYKB 2YBAA 5FKTA 2Z2OA 2OVQB 4CI8A 3UVMA 1PGUA 4L3HD 4O45A 3DSMA 3OW8A 4O3TB 2CN2A 4CY1A 2GC7A 4YVDA 3UR4A 5GSAA 5TF2A 2H6QA 5CXCB 4A09B 3OKTA 1JOFA 3N0EA 4J0WA 3EG6A 4QL1A 4GGCA 1SQ9A 2YB8B 4FAND 3RFHA 5IJ8E 5GXIA 2J57G 3IIWA 2CNXA 1PEVA 3NVXA 4AOWA 2P9KC 3L4OD 5I5IA 2YNNA 2B5NA 2BCJB 3C5MA 1JMZB 3GFCA 2TRCB 5FLXg 4G56B 2OVRB 3OTTA 5GMKn 4FWWA 5EMLB 1TBGA 2HESX 3P4FA 2I3SA 3IJ1A 5EAMA 2H47A 4QT8A 4TZ4A 3E0CA 2AGWA 4PSXB 1P22A 1A0RB 3UKUC 2YMUA 4JT6C 4OWRA 4ERQA 1YFQA 2AGXA 3IJ0A 3PVUB 2AGYA 4LGNA 3EWEA 4CI2A 3NVNA 3F3FA 2OK4A 1NEXB 4JT5C 4X63B 3SJLD 2H68A 3B7FA 3RMZD 3V7DB 2PM9A 3CFSB 3UVKA 1JMXB 5C9ZB 3U4YA 5AMSA 4FA1D 4ZOYA 4A08B 4A0AB 4MK0B 4GM9A 2CN3A 3IKOA 3F3PA 4J87A 3OKYA 1U2VC 4L3GD 4K3ID 2B4EA 5FQDA 5TEFA 3UVOA 3JAMg 2AQ5A 4J82A 3I7HA 3BG1A 1GG2B 2P9LC 2GNQA 3EI1B 2YNOA 2HXCA 1B9YA 4J0XA 4BL0A 3MZLA 4XYIA 4J86A 5EMJB 2AH0A 4AEZA 3JROA 2XL2A 3EI2A 4CI3A 2UZXB 5EM2B 3OL2B 4JSPC 3AL9A 2UZYB 3IJCA 3EI3A 5THAA 2HJ4A 4FA9D 4A11B 4GQ2P 4E54B 3PSLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FA5 D;  3AH8 B;  3EI4 B;  3ZWL B;  1PBY B;  3PVW B;  3VH0 A;  3I8E A;  4ESG A;  4Y7R A;  5IC7 A;  5CXB B;  3JZH A;  1N6E A;  4ZOV A;  1MG2 A;  4LG8 A;  5A2Q g;  4O1Q D;  1OLZ A;  2GC4 A;  3EU7 A;  2PM6 B;  4BUJ C;  2Z2N A;  5GXH A;  4X61 B;  4GQ1 A;  1GOT B;  2QXV A;  3N0D A;  4FB1 D;  3DWL C;  1VYH C;  3FRX A;  2J56 H;  4FA4 D;  2P9S C;  3RFG A;  2CE8 A;  3DXK C;  3I7P A;  3BWS A;  1N6F A;  4ZOX A;  5C2V B;  3RLM D;  4NSX A;  3SHF A;  2I0S A;  4GMB A;  4HDJ A;  4XEI C;  4A2M A;  2H9M A;  5EAL A;  4IMM A;  3ODT A;  3PSC B;  4O9D A;  4A0B A;  2W18 A;  1Q47 A;  1OMW B;  4JD2 C;  5FKS A;  2EBS A;  2I3T A;  2XU7 A;  2HYE A;  2H9L A;  4KFM B;  1QNI A;  4CC9 A;  4UI9 R;  3UVL A;  2XYI A;  3RRM C;  4E5Z A;  4J79 A;  3AL8 B;  4J8B A;  5CYK A;  1GXR A;  5FXY A;  3ORV D;  3JB9 L;  5C2W B;  4JXM A;  2YNP A;  4K3J B;  4PBY A;  3L4M D;  4GGA A;  3UVN A;  5H1M A;  4X60 B;  3MMY A;  4LG9 A;  4QQE A;  3RN1 D;  1SQJ A;  5I5M A;  4ES0 A;  2CE9 A;  2Q7Q A;  5CXC A;  3SVW D;  4A09 A;  3I7N A;  4O3U B;  1N6D A;  4Y5R D;  5TDH B;  4GGD A;  4J73 A;  4XYH A;  4FAV D;  3AFC A;  5EMK B;  4CI1 A;  1U4C A;  2G9A A;  1B9X A;  4ZN4 A;  1FWX A;  2H13 A;  3C75 H;  2H6K A;  2PBI B;  2I0T A;  3FGB A;  5HYN B;  4Z8L A;  3FM0 A;  3SXT D;  2AGL A;  2HKR A;  2MTA H;  3SN6 B;  2PM7 B;  3MKS B;  2OJY A;  3I2N A;  2AH1 A;  2BBK H;  2Z2P A;  4PNK B;  1JJU B;  4PSW B;  1GP2 B;  3JZG A;  4PC0 A;  5IT9 g;  4CY5 A;  1NR0 A;  3JRP A;  4H5I A;  2OK6 A;  1R5M A;  5FA5 B;  4CZX A;  4L1Q D;  2H3X A;  4A2L A;  4GM3 A;  5IGQ A;  3IIY A;  4H5J A;  3C9C A;  3VA6 A;  4A0A A;  4A08 A;  5HE1 B;  2OIZ A;  3SMR A;  4BH6 A;  4J84 A;  4JSV C;  4CY3 A;  4R7A B;  3PXS D;  5AFU 3;  2HJB A;  5KDO B;  2O9K A;  2H6N A;  2IUP A;  5H14 A;  2PM9 B;  2P9I C;  3MXX A;  3PE7 A;  3EI1 A;  3DM0 A;  3I7O A;  1XIP A;  4EWR A;  5FKQ A;  1K8K C;  3SBQ A;  3SCY A;  1ERJ A;  3KRW B;  3OKY B;  3K26 A;  3ULE C;  1MDA H;  5EM2 A;  3VGZ A;  3OL2 A;  5TEE A;  3V5W B;  4D6V A;  2P9U C;  3RSE C;  3PXT D;  4L9O A;  3NVQ A;  4CZV A;  2P9N C;  5AJA A;  4CY2 A;  5IGO A;  4A11 A;  2HKM A;  2IUQ A;  3W15 A;  1RI6 A;  4I79 A;  4E54 A;  3HFQ A;  3MZK A;  5HE2 B;  2CO0 C;  3EI4 A;  2OVP B;  1K32 A;  3BG0 A;  3CFV A;  3EI2 B;  3I8C A;  3I7L A;  3C99 A;  4ERZ A;  5CXB A;  4FHL A;  4X3E A;  3PXW D;  3J80 g;  2J55 H;  2H14 A;  4JSX C;  5HE0 B;  3V9F A;  2IWF A;  3EI3 B;  3RN0 D;  5B4W A;  2H9P A;  4ERY A;  3GRE A;  1TYQ C;  1XHM A;  3MKQ A;  4PXW A;  5SXM A;  2AGZ A;  4OZU A;  2CO0 A;  3DXM C;  3J81 g;  5K19 A;  1S4U X;  4QRJ A;  4GM8 A;  5EMM B;  3I89 A;  3EMH A;  2B5L A;  4N14 A;  4PBZ A;  5FKR A;  5HE3 B;  3CIK B;  1XKS A;  4D0K A;  3JPX A;  4IA9 A;  1MG3 A;  4ZOZ A;  1PI6 A;  2IAA A;  4GQB B;  3UKR C;  4U1E I;  3SBP A;  1L0Q A;  2I0R A;  5EAR A;  4JSN C;  2H9N A;  4CZY A;  1SHY B;  4J8G A;  4J78 A;  2QC5 A;  4U7A A;  3AL8 A;  5H17 A;  5HQG A;  3OKW A;  3K27 A;  2G99 A;  3KRX B;  3SFZ A;  4A0B B;  3SLE D;  2IUR A;  5K1C C;  3A0F A;  3I7K A;  2P9P C;  3F3G A;  5IJ7 E;  4GZ8 A;  4A7J A;  5I5J A;  5JWZ A;  2IWK A;  3SBR A;  2XL3 A;  5EAP A;  2B5M A;  3SWS D;  4J77 A;  3JZN A;  4J81 A;  4E5Z B;  2IUV A;  5CYK B;  2YBA A;  5FKT A;  2Z2O A;  2OVQ B;  4CI8 A;  3UVM A;  1PGU A;  4L3H D;  4O45 A;  3DSM A;  3OW8 A;  4O3T B;  2CN2 A;  4CY1 A;  2GC7 A;  4YVD A;  3UR4 A;  5GSA A;  5TF2 A;  2H6Q A;  5CXC B;  4A09 B;  3OKT A;  1JOF A;  3N0E A;  4J0W A;  3EG6 A;  4QL1 A;  4GGC A;  1SQ9 A;  2YB8 B;  4FAN D;  3RFH A;  5IJ8 E;  5GXI A;  2J57 G;  3IIW A;  2CNX A;  1PEV A;  3NVX A;  4AOW A;  2P9K C;  3L4O D;  5I5I A;  2YNN A;  2B5N A;  2BCJ B;  3C5M A;  1JMZ B;  3GFC A;  2TRC B;  5FLX g;  4G56 B;  2OVR B;  3OTT A;  5GMK n;  4FWW A;  5EML B;  1TBG A;  2HES X;  3P4F A;  2I3S A;  3IJ1 A;  5EAM A;  2H47 A;  4QT8 A;  4TZ4 A;  3E0C A;  2AGW A;  4PSX B;  1P22 A;  1A0R B;  3UKU C;  2YMU A;  4JT6 C;  4OWR A;  4ERQ A;  1YFQ A;  2AGX A;  3IJ0 A;  3PVU B;  2AGY A;  4LGN A;  3EWE A;  4CI2 A;  3NVN A;  3F3F A;  2OK4 A;  1NEX B;  4JT5 C;  4X63 B;  3SJL D;  2H68 A;  3B7F A;  3RMZ D;  3V7D B;  2PM9 A;  3CFS B;  3UVK A;  1JMX B;  5C9Z B;  3U4Y A;  5AMS A;  4FA1 D;  4ZOY A;  4A08 B;  4A0A B;  4MK0 B;  4GM9 A;  2CN3 A;  3IKO A;  3F3P A;  4J87 A;  3OKY A;  1U2V C;  4L3G D;  4K3I D;  2B4E A;  5FQD A;  5TEF A;  3UVO A;  3JAM g;  2AQ5 A;  4J82 A;  3I7H A;  3BG1 A;  1GG2 B;  2P9L C;  2GNQ A;  3EI1 B;  2YNO A;  2HXC A;  1B9Y A;  4J0X A;  4BL0 A;  3MZL A;  4XYI A;  4J86 A;  5EMJ B;  2AH0 A;  4AEZ A;  3JRO A;  2XL2 A;  3EI2 A;  4CI3 A;  2UZX B;  5EM2 B;  3OL2 B;  4JSP C;  3AL9 A;  2UZY B;  3IJC A;  3EI3 A;  5THA A;  2HJ4 A;  4FA9 D;  4A11 B;  4GQ2 P;  4E54 B;  3PSL A; 
#chains in the Genus database with same CATH topology
 3O4J A;  4FA5 D;  4BCC A;  3AH8 B;  3EI4 B;  3ZWL B;  1PBY B;  3PVW B;  3VH0 A;  3I8E A;  4ESG A;  4Y7R A;  1O6G A;  3FCS A;  5IC7 A;  3ZDZ A;  4D9S A;  5CXB B;  3JZH A;  1N6E A;  2WQ8 A;  4ZOV A;  1MG2 A;  4LG8 A;  5A2Q g;  4O1Q D;  4AMZ A;  1OLZ A;  2GC4 A;  3EU7 A;  2PM6 B;  4BUJ C;  2Z2N A;  5GXH A;  1GOG A;  4X61 B;  4Z7O A;  4GQ1 A;  1GOT B;  2QXV A;  3N0D A;  4FB1 D;  3O4I A;  2VDP A;  3DWL C;  1VYH C;  3FRX A;  2J56 H;  4FA4 D;  2P9S C;  3RFG A;  1UOQ A;  2CE8 A;  3DXK C;  3I7P A;  3BWS A;  1N6F A;  4O2W A;  4ZOX A;  3RLM D;  4NSX A;  3SHF A;  5E6R A;  2I0S A;  4GMB A;  4HDJ A;  4XEI C;  4A2M A;  2H9M A;  1C9L A;  5EAL A;  4IMM A;  3GC3 B;  3ODT A;  3PSC B;  4O9D A;  4A0B A;  3O4G A;  2W18 A;  1Q47 A;  1OMW B;  4JD2 C;  5FKS A;  2EBS A;  1E8N A;  2I3T A;  2XU7 A;  2BKL A;  2EIC A;  4BCB A;  2HYE A;  2H9L A;  4KFM B;  1QNI A;  2QZP A;  4CC9 A;  4UI9 R;  3UVL A;  3T3P A;  1YR2 A;  2XYI A;  4WK2 A;  3RRM C;  4AX4 A;  4E5Z A;  4J79 A;  3AL8 B;  4J8B A;  1JV2 A;  5CYK A;  1GXR A;  5M61 A;  5FXY A;  3ORV D;  3JB9 L;  5C2W B;  3IUM A;  4JXM A;  2YNP A;  4K3J B;  4PBY A;  3L4M D;  4GGA A;  3UVN A;  2QR5 A;  5H1M A;  4X60 B;  3MMY A;  4LG9 A;  4MMZ A;  4NAA A;  4QQE A;  3RN1 D;  1SQJ A;  3EQ9 A;  4ES0 A;  4Z7N A;  5I5M A;  2CE9 A;  1H2W A;  3V4V A;  2Q7Q A;  5CXC A;  3SVW D;  1T2X A;  4A09 A;  3I7N A;  4O3U B;  1N6D A;  4Y5R D;  5TDH B;  2VDK A;  4GGD A;  4J73 A;  4XYH A;  4FAV D;  3AFC A;  5EMK B;  4CI1 A;  1U4C A;  2G9A A;  1B9X A;  5E6S A;  3VI3 A;  4ZN4 A;  1FWX A;  2H13 A;  3C75 H;  2H6K A;  2PBI B;  2I0T A;  3FGB A;  5HYN B;  4Z8L A;  3FM0 A;  4WK4 A;  2VC2 A;  3SXT D;  2VDQ A;  2AGL A;  2HKR A;  2MTA H;  3SN6 B;  2PM7 B;  3MKS B;  2OJY A;  3I2N A;  2AH1 A;  3K72 A;  2BBK H;  4NC4 A;  2Z2P A;  3VI4 A;  4PNK B;  1JJU B;  4PSW B;  1GP2 B;  1VE6 A;  3JZG A;  4PC0 A;  4AN0 A;  2VDO A;  5IT9 g;  4CY5 A;  3MUO A;  1NR0 A;  3JRP A;  4H5I A;  2OK6 A;  1R5M A;  5FA5 B;  4CZX A;  4L1Q D;  2H3X A;  4A2L A;  4GM3 A;  5IGQ A;  4WK0 A;  4G55 A;  3IUL A;  3IIY A;  2VDN A;  4H5J A;  3C9C A;  3VA6 A;  4A0A A;  4A08 A;  5HE1 B;  2OIZ A;  3SMR A;  4BH6 A;  1I2M B;  4J84 A;  4JSV C;  4CY3 A;  4R7A B;  3PXS D;  5AFU 3;  1A12 A;  2HJB A;  5KDO B;  2O9K A;  2H6N A;  2IUP A;  5H14 A;  3K71 A;  2PM9 B;  1E5T A;  2P9I C;  3MXX A;  3PE7 A;  3EI1 A;  3DM0 A;  1H2Z A;  1XIP A;  3I7O A;  3NIF A;  4EWR A;  5FKQ A;  1K8K C;  3T3M A;  3SBQ A;  3SCY A;  1ERJ A;  1E8M A;  3KRW B;  3GD1 I;  3OKY B;  1H2X A;  3K26 A;  3ULE C;  2XZG A;  4AMY A;  1MDA H;  4DNU A;  5EM2 A;  3VGZ A;  3OL2 A;  5TEE A;  3V5W B;  4D6V A;  2P9U C;  3RSE C;  3PXT D;  1U8C A;  4L9O A;  1L5G A;  3NVQ A;  4CZV A;  3K6S A;  2P9N C;  3ZDX A;  4BP8 A;  5AJA A;  4CY2 A;  2HU5 A;  5IGO A;  4A11 A;  2HKM A;  2IUQ A;  3W15 A;  1RI6 A;  4I79 A;  4E54 A;  3MZK A;  3HFQ A;  3QHY B;  2CO0 C;  3EI4 A;  1O6F A;  5HE2 B;  2OVP B;  1K32 A;  2VDR A;  2XDW A;  3EQ7 A;  3BG0 A;  4IRZ A;  3CFV A;  3EI2 B;  3I8C A;  3I7L A;  3C99 A;  4ERZ A;  3NIG A;  5CXB A;  4FHL A;  4G1M A;  4X3E A;  3PXW D;  3J80 g;  2J55 H;  2H14 A;  4JSX C;  5HE0 B;  3V9F A;  2IWF A;  3EI3 B;  3RN0 D;  5M5V A;  5B4W A;  2H9P A;  4ERY A;  1TYE A;  3ZE1 A;  3GRE A;  1TYQ C;  2EID A;  3QI0 A;  1BPO A;  1XHM A;  3MKQ A;  4PXW A;  5SXM A;  2AGZ A;  4OZU A;  2CO0 A;  3DXM C;  3J81 g;  5K19 A;  2VZ3 A;  1S4U X;  4QRJ A;  4GM8 A;  5EMM B;  3I89 A;  3EMH A;  3IJE A;  2B5L A;  4N14 A;  4PBZ A;  5FKR A;  5HE3 B;  1K3I A;  4DNV A;  4JHP C;  3CIK B;  1XKS A;  3EQ8 A;  4D0K A;  3JPX A;  4IA9 A;  4QAM A;  1MG3 A;  4ZOZ A;  1PI6 A;  2IAA A;  4GQB B;  3UKR C;  4U1E I;  3SBP A;  1L0Q A;  2I0R A;  5EAR A;  4JSN C;  2H9N A;  4CZY A;  3V4P A;  1SHY B;  4J8G A;  4J78 A;  4G1E A;  4JHN A;  2QC5 A;  4U7A A;  3AL8 A;  5H17 A;  5HQG A;  3OKW A;  1C9I A;  3ZE0 A;  3K27 A;  2G99 A;  2JKX A;  3KRX B;  3OF7 A;  3SFZ A;  4A0B B;  3SLE D;  2IUR A;  5K1C C;  4L1M A;  3A0F A;  3IVM A;  3I7K A;  2P9P C;  3F3G A;  5IJ7 E;  1M1X A;  4GZ8 A;  4O02 A;  4A7J A;  5I5J A;  5JWZ A;  2IWK A;  3SBR A;  2XL3 A;  4DNW A;  5EAP A;  2B5M A;  3SWS D;  4UM9 A;  4J77 A;  3JZN A;  4J81 A;  4E5Z B;  2IUV A;  3O4H A;  5CYK B;  2YBA A;  5FKT A;  3KCI A;  2OVQ B;  4CI8 A;  3UVM A;  1PGU A;  4L3H D;  4O45 A;  3DSM A;  3OW8 A;  5C2V B;  5C92 A;  3NID A;  4O3T B;  2CN2 A;  4CY1 A;  2GC7 A;  4YVD A;  3UR4 A;  1VZ3 A;  5GSA A;  3IUN A;  5TF2 A;  2H6Q A;  4NBM A;  5CXC B;  4A09 B;  3OKT A;  1JOF A;  3N0E A;  4J0W A;  3EG6 A;  4QL1 A;  4GGC A;  1SQ9 A;  2YB8 B;  4FAN D;  3RFH A;  4RE6 A;  2VZ1 A;  5IJ8 E;  1VE7 A;  2XE4 A;  5GXI A;  2J57 G;  1VZ2 A;  3IIW A;  2CNX A;  1PEV A;  2HU8 A;  4BCD A;  3NVX A;  4AOW A;  2P9K C;  4RE5 A;  3L4O D;  5I5I A;  2YNN A;  2B5N A;  2BCJ B;  5M5R A;  3C5M A;  1JMZ B;  3GFC A;  2TRC B;  5FLX g;  3MVD K;  4G56 B;  2OVR B;  4Z7Q A;  3OTT A;  5GMK n;  2EIE A;  4FWW A;  4BP9 A;  3ZDY A;  5EML B;  1TBG A;  2HES X;  3FCU A;  3P4F A;  3IUQ A;  2I3S A;  3IJ1 A;  5EAM A;  5M5S A;  2H47 A;  4QT8 A;  4TZ4 A;  3E0C A;  2AGW A;  4PSX B;  1P22 A;  1A0R B;  3UKU C;  2YMU A;  4JT6 C;  4OWR A;  5E6U A;  4ERQ A;  1YFQ A;  2AGX A;  3IJ0 A;  3PVU B;  2AGY A;  2VDL A;  4LGN A;  4UM8 A;  2HU7 A;  3EWE A;  4CI2 A;  3NVN A;  3F3F A;  2OK4 A;  1NEX B;  4JT5 C;  3MUN A;  4X63 B;  3SJL D;  4MMY A;  3PSL A;  2H68 A;  2VDM A;  3B7F A;  3RMZ D;  3V7D B;  2PM9 A;  3CFS B;  3UVK A;  1JMX B;  5C9Z B;  4WJK A;  3U4Y A;  5AMS A;  4FA1 D;  4ZOY A;  4A08 B;  4A0A B;  4MK0 B;  3IUJ A;  4GM9 A;  2CN3 A;  3IKO A;  5HDB A;  1UOO A;  3F3P A;  4J87 A;  3ZE2 A;  5M5T A;  3OKY A;  1U2V C;  4L3G D;  4K3I D;  2B4E A;  5FQD A;  5TEF A;  3IUR A;  3UVO A;  4NEN A;  3JAM g;  2AQ5 A;  4J82 A;  2EIB A;  3I7H A;  5FFO A;  3BG1 A;  1GG2 B;  1QFM A;  1UTC A;  2P9L C;  2GNQ A;  3EI1 B;  2YNO A;  2HXC A;  5C86 A;  1B9Y A;  4J0X A;  4BL0 A;  3DDU A;  3MZL A;  4XYI A;  5M5U A;  1GOH A;  4J86 A;  5EMJ B;  2AH0 A;  4AEZ A;  3JRO A;  2XL2 A;  4MMX A;  3EI2 A;  4CI3 A;  2UZX B;  5EM2 B;  3OL2 B;  4AN1 A;  1UOP A;  4JSP C;  3AL9 A;  2UZY B;  1QFS A;  3IJC A;  3EI3 A;  5THA A;  1GOF A;  1JTD B;  2HJ4 A;  4FA9 D;  4A11 B;  5FFG A;  4GQ2 P;  4E54 B;  1H2Y A;  2Z2O A; 
#chains in the Genus database with same CATH homology
 4FA5 D;  3AH8 B;  3EI4 B;  3ZWL B;  1PBY B;  3PVW B;  3VH0 A;  3I8E A;  4ESG A;  4Y7R A;  5IC7 A;  5CXB B;  3JZH A;  1N6E A;  4ZOV A;  1MG2 A;  4LG8 A;  5A2Q g;  4O1Q D;  1OLZ A;  2GC4 A;  3EU7 A;  2PM6 B;  4BUJ C;  2Z2N A;  5GXH A;  4X61 B;  4GQ1 A;  1GOT B;  2QXV A;  3N0D A;  4FB1 D;  3DWL C;  1VYH C;  3FRX A;  2J56 H;  4FA4 D;  2P9S C;  3RFG A;  2CE8 A;  3DXK C;  3I7P A;  3BWS A;  1N6F A;  4ZOX A;  5C2V B;  3RLM D;  4NSX A;  3SHF A;  2I0S A;  4GMB A;  4HDJ A;  4XEI C;  4A2M A;  2H9M A;  5EAL A;  4IMM A;  3ODT A;  3PSC B;  4O9D A;  4A0B A;  2W18 A;  1Q47 A;  1OMW B;  4JD2 C;  5FKS A;  2EBS A;  2I3T A;  2XU7 A;  2HYE A;  2H9L A;  4KFM B;  1QNI A;  4CC9 A;  4UI9 R;  3UVL A;  2XYI A;  3RRM C;  4E5Z A;  4J79 A;  3AL8 B;  4J8B A;  5CYK A;  1GXR A;  5FXY A;  3ORV D;  3JB9 L;  5C2W B;  4JXM A;  2YNP A;  4K3J B;  4PBY A;  3L4M D;  4GGA A;  3UVN A;  5H1M A;  4X60 B;  3MMY A;  4LG9 A;  4QQE A;  3RN1 D;  1SQJ A;  5I5M A;  4ES0 A;  2CE9 A;  2Q7Q A;  5CXC A;  3SVW D;  4A09 A;  3I7N A;  4O3U B;  1N6D A;  4Y5R D;  5TDH B;  4GGD A;  4J73 A;  4XYH A;  4FAV D;  3AFC A;  5EMK B;  4CI1 A;  1U4C A;  2G9A A;  1B9X A;  4ZN4 A;  1FWX A;  2H13 A;  3C75 H;  2H6K A;  2PBI B;  2I0T A;  3FGB A;  5HYN B;  4Z8L A;  3FM0 A;  3SXT D;  2AGL A;  2HKR A;  2MTA H;  3SN6 B;  2PM7 B;  3MKS B;  2OJY A;  3I2N A;  2AH1 A;  2BBK H;  2Z2P A;  4PNK B;  1JJU B;  4PSW B;  1GP2 B;  3JZG A;  4PC0 A;  5IT9 g;  4CY5 A;  1NR0 A;  3JRP A;  4H5I A;  2OK6 A;  1R5M A;  5FA5 B;  4CZX A;  4L1Q D;  2H3X A;  4A2L A;  4GM3 A;  5IGQ A;  3IIY A;  4H5J A;  3C9C A;  3VA6 A;  4A0A A;  4A08 A;  5HE1 B;  2OIZ A;  3SMR A;  4BH6 A;  4J84 A;  4JSV C;  4CY3 A;  4R7A B;  3PXS D;  5AFU 3;  2HJB A;  5KDO B;  2O9K A;  2H6N A;  2IUP A;  5H14 A;  2PM9 B;  2P9I C;  3MXX A;  3PE7 A;  3EI1 A;  3DM0 A;  3I7O A;  1XIP A;  4EWR A;  5FKQ A;  1K8K C;  3SBQ A;  3SCY A;  1ERJ A;  3KRW B;  3OKY B;  3K26 A;  3ULE C;  1MDA H;  5EM2 A;  3VGZ A;  3OL2 A;  5TEE A;  3V5W B;  4D6V A;  2P9U C;  3RSE C;  3PXT D;  4L9O A;  3NVQ A;  4CZV A;  2P9N C;  5AJA A;  4CY2 A;  5IGO A;  4A11 A;  2HKM A;  2IUQ A;  3W15 A;  1RI6 A;  4I79 A;  4E54 A;  3HFQ A;  3MZK A;  5HE2 B;  2CO0 C;  3EI4 A;  2OVP B;  1K32 A;  3BG0 A;  3CFV A;  3EI2 B;  3I8C A;  3I7L A;  3C99 A;  4ERZ A;  5CXB A;  4FHL A;  4X3E A;  3PXW D;  3J80 g;  2J55 H;  2H14 A;  4JSX C;  5HE0 B;  3V9F A;  2IWF A;  3EI3 B;  3RN0 D;  5B4W A;  2H9P A;  4ERY A;  3GRE A;  1TYQ C;  1XHM A;  3MKQ A;  4PXW A;  5SXM A;  2AGZ A;  4OZU A;  2CO0 A;  3DXM C;  3J81 g;  5K19 A;  1S4U X;  4QRJ A;  4GM8 A;  5EMM B;  3I89 A;  3EMH A;  2B5L A;  4N14 A;  4PBZ A;  5FKR A;  5HE3 B;  3CIK B;  1XKS A;  4D0K A;  3JPX A;  4IA9 A;  1MG3 A;  4ZOZ A;  1PI6 A;  2IAA A;  4GQB B;  3UKR C;  4U1E I;  3SBP A;  1L0Q A;  2I0R A;  5EAR A;  4JSN C;  2H9N A;  4CZY A;  1SHY B;  4J8G A;  4J78 A;  2QC5 A;  4U7A A;  3AL8 A;  5H17 A;  5HQG A;  3OKW A;  3K27 A;  2G99 A;  3KRX B;  3SFZ A;  4A0B B;  3SLE D;  2IUR A;  5K1C C;  3A0F A;  3I7K A;  2P9P C;  3F3G A;  5IJ7 E;  4GZ8 A;  4A7J A;  5I5J A;  5JWZ A;  2IWK A;  3SBR A;  2XL3 A;  5EAP A;  2B5M A;  3SWS D;  4J77 A;  3JZN A;  4J81 A;  4E5Z B;  2IUV A;  5CYK B;  2YBA A;  5FKT A;  2Z2O A;  2OVQ B;  4CI8 A;  3UVM A;  1PGU A;  4L3H D;  4O45 A;  3DSM A;  3OW8 A;  4O3T B;  2CN2 A;  4CY1 A;  2GC7 A;  4YVD A;  3UR4 A;  5GSA A;  5TF2 A;  2H6Q A;  5CXC B;  4A09 B;  3OKT A;  1JOF A;  3N0E A;  4J0W A;  3EG6 A;  4QL1 A;  4GGC A;  1SQ9 A;  2YB8 B;  4FAN D;  3RFH A;  5IJ8 E;  5GXI A;  2J57 G;  3IIW A;  2CNX A;  1PEV A;  3NVX A;  4AOW A;  2P9K C;  3L4O D;  5I5I A;  2YNN A;  2B5N A;  2BCJ B;  3C5M A;  1JMZ B;  3GFC A;  2TRC B;  5FLX g;  4G56 B;  2OVR B;  3OTT A;  5GMK n;  4FWW A;  5EML B;  1TBG A;  2HES X;  3P4F A;  2I3S A;  3IJ1 A;  5EAM A;  2H47 A;  4QT8 A;  4TZ4 A;  3E0C A;  2AGW A;  4PSX B;  1P22 A;  1A0R B;  3UKU C;  2YMU A;  4JT6 C;  4OWR A;  4ERQ A;  1YFQ A;  2AGX A;  3IJ0 A;  3PVU B;  2AGY A;  4LGN A;  3EWE A;  4CI2 A;  3NVN A;  3F3F A;  2OK4 A;  1NEX B;  4JT5 C;  4X63 B;  3SJL D;  2H68 A;  3B7F A;  3RMZ D;  3V7D B;  2PM9 A;  3CFS B;  3UVK A;  1JMX B;  5C9Z B;  3U4Y A;  5AMS A;  4FA1 D;  4ZOY A;  4A08 B;  4A0A B;  4MK0 B;  4GM9 A;  2CN3 A;  3IKO A;  3F3P A;  4J87 A;  3OKY A;  1U2V C;  4L3G D;  4K3I D;  2B4E A;  5FQD A;  5TEF A;  3UVO A;  3JAM g;  2AQ5 A;  4J82 A;  3I7H A;  3BG1 A;  1GG2 B;  2P9L C;  2GNQ A;  3EI1 B;  2YNO A;  2HXC A;  1B9Y A;  4J0X A;  4BL0 A;  3MZL A;  4XYI A;  4J86 A;  5EMJ B;  2AH0 A;  4AEZ A;  3JRO A;  2XL2 A;  3EI2 A;  4CI3 A;  2UZX B;  5EM2 B;  3OL2 B;  4JSP C;  3AL9 A;  2UZY B;  3IJC A;  3EI3 A;  5THA A;  2HJ4 A;  4FA9 D;  4A11 B;  4GQ2 P;  4E54 B;  3PSL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...