4IA9A

Crystal structure of human wd repeat domain 5 in complex with 2-chloro-4-fluoro-3-methyl-n-[2-(4-methylpiperazin-1-yl)-5-nitrophenyl]benzamide
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
305
structure length
305
Chain Sequence
b'PVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
molecule tags Transcription
source organism Homo sapiens
publication title Synthesis, Optimization, and Evaluation of Novel Small Molecules as Antagonists of WDR5-MLL Interaction.
pubmed doi rcsb
total genus 103
structure length 305
sequence length 305
ec nomenclature
pdb deposition date 2012-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4ia9A00
5GXIA 5HYNB 4X61B 3UR4A 3OTTA 3UVOA 3UVKA 2G9AA 5GSAA 3DWLC 3PXTD 4J8BA 5I5IA 3I8CA 4I79A 4BL0A 4J84A 5B4WA 3SBQA 1RI6A 4HDJA 3IIYA 5IGOA 4BH6A 4ZOXA 4JT5C 4PBYA 2I0RA 5FKSA 5H14A 4GM9A 4O1QD 2OVQB 1JOFA 4CI2A 2BBKH 2B5NA 3EI1A 4A0BB 4X60B 3EG6A 3IKOA 3JRPA 2H9LA 1L0QA 4H5JA 2IAAA 3RRMC 3VH0A 2PM7B 3GREA 3L4OD 4Y5RD 2O9KA 4GMBA 3BG1A 3NVXA 2IWFA 2UZYB 3JZHA 2Z2OA 3K27A 4X3EA 4JD2C 2IURA 1MG2A 2AH1A 3PE7A 4E54A 4Z8LA 1JJUB 4A0BA 3PVUB 3IJ1A 3EU7A 2PM9A 5TF2A 2IUQA 4K3ID 2P9LC 2UZXB 4CI1A 3DXMC 3IJ0A 4QQEA 4QT8A 5CYKB 3I2NA 2OVPB 3HFQA 4O3TB 3N0EA 2J57G 2H6KA 2Z2NA 3SCYA 3PXWD 4J79A 2TRCB 2W18A 2IWKA 3FRXA 5H1MA 4A09A 3I7KA 3GFCA 3AL8B 2H68A 3OW8A 3F3FA 4A09B 2YNNA 2B5MA 3RLMD 1PBYB 4OWRA 3I7HA 2BCJB 5CXBA 3OKYA 3KRWB 3SJLD 2EBSA 1U2VC 2H9PA 3RFGA 4J87A 5EAPA 4FB1D 5FLXg 5GXHA 3IJCA 1K32A 2IUPA 1SQ9A 3SLED 2I3SA 5CYKA 4QRJA 3MXXA 3JB9L 5EMLB 1JMXB 3JPXA 1PI6A 4BUJC 3PSLA 3B7FA 4K3JB 5HE2B 4PXWA 2PM6B 3I7PA 3JZGA 5THAA 4CY2A 5IT9g 4FA5D 2HXCA 5EMMB 4GM8A 4CC9A 3V7DB 3J80g 4O45A 4J73A 3VA6A 4R7AB 5HE0B 1R5MA 5FA5B 3JROA 4JSPC 3UKUC 2P9UC 3JAMg 4XYIA 5K19A 3I7NA 1N6FA 2AGWA 1TBGA 2HKMA 5IC7A 3ULEC 5FXYA 3ORVD 4GGDA 2I3TA 2H3XA 5FKRA 3F3GA 3SXTD 3SFZA 5C9ZB 2AGLA 4NSXA 5FQDA 4A0AA 1GG2B 4GGAA 4AOWA 1MG3A 5EAMA 4ERQA 2B5LA 5TEEA 4ZOZA 3I7LA 2CN2A 2GC4A 1SHYB 2Z2PA 4AEZA 4A7JA 4E54B 4KFMB 2QC5A 3N0DA 4A2LA 3CFSB 3AL9A 3KRXB 3MMYA 2H9NA 3UKRC 2PM9B 2YNPA 4FA4D 2H14A 2PBIB 1TYQC 3SMRA 4E5ZA 2AGZA 3ZWLB 4G56B 4JSXC 5AJAA 4LG9A 2H6QA 2MTAH 4XYHA 4CY5A 1GOTB 5IGQA 3EWEA 4JT6C 2P9IC 2P9KC 1PGUA 3EI3B 4A2MA 3CFVA 4L3GD 4ESGA 4LG8A 4CI3A 4GQBB 4PBZA 2J55H 4CY3A 1GXRA 4GM3A 1JMZB 2QXVA 3C5MA 1OLZA 5SXMA 4J81A 4GQ2P 3OL2B 4CZVA 5IJ7E 2OJYA 4PC0A 3E0CA 4JXMA 5GMKn 5EMKB 4ZOVA 3MZKA 3K26A 2Q7QA 3UVNA 3ODTA 5HE1B 1B9YA 5EMJB 3EI3A 4FAVD 1QNIA 5EM2A 3JZNA 3RMZD 4FHLA 2CE8A 4FA9D 5C2VB 5JWZA 1GP2B 2OK6A 3MZLA 1OMWB 5I5JA 5EARA 4TZ4A 4CZXA 3AFCA 1MDAH 4YVDA 3SVWD 2H9MA 3EMHA 2OK4A 4GZ8A 4LGNA 3SWSD 4CZYA 2YNOA 4A11B 1K8KC 4QL1A 4A0AB 3L4MD 2HKRA 4ZN4A 1S4UX 3SBPA 4J0XA 4XEIC 2YB8B 4O3UB 1A0RB 2I0SA 2CO0A 3I8EA 3OKYB 3RFHA 1N6DA 1VYHC 2CN3A 3UVLA 3EI1B 5TEFA 3BWSA 5TDHB 5CXBB 2CNXA 2HYEA 4FA1D 1U4CA 2CE9A 5IJ8E 4FWWA 4A08B 4E5ZB 2XL3A 4J77A 3AL8A 4MK0B 4L9OA 5EM2B 5CXCB 3VGZA 5HE3B 3DXKC 3CIKB 4UI9R 3DM0A 3SBRA 3MKSB 2HESX 4X63B 5H17A 4U7AA 4A08A 4L3HD 4PSWB 4FAND 4ERYA 4U1EI 3FM0A 5AFU3 1PEVA 5C2WB 2XU7A 4N14A 2J56H 4J0WA 3P4FA 3EI2A 4A11A 4IMMA 5EALA 4PSXB 3AH8B 2GNQA 2AGXA 4IA9A 5HQGA 5I5MA 3DSMA 3SN6B 3EI2B 3EI4A 4ZOYA 3FGBA 1B9XA 4L1QD 3OKTA 2I0TA 3BG0A 5K1CC 2XL2A 4ERZA 2IUVA 4CI8A 3RSEC 3NVQA 3W15A 3EI4B 3NVNA 3PSCB 4GGCA 1XKSA 2B4EA 4CY1A 4ES0A 3SHFA 3PXSD 2AH0A 5CXCA 1XIPA 4OZUA 2YMUA 4JSNC 4D0KA 1ERJA 5A2Qg 3F3PA 4J86A 4GQ1A 2XYIA 2AGYA 4D6VA 4EWRA 2G99A 4PNKB 4J82A 4J78A 3MKQA 5FKQA 5FKTA 3C9CA 2OIZA 2CO0C 3RN0D 3A0FA 3RN1D 2HJ4A 3V5WB 3C75H 4JSVC 1Q47A 1XHMA 2AQ5A 2HJBA 2P9NC 3I7OA 2H13A 1NEXB 3PVWB 4O9DA 5AMSA 4Y7RA 2H47A 3C99A 2H6NA 2P9PC 3U4YA 1P22A 3I89A 2OVRB 3V9FA 3J81g 3UVMA 2P9SC 1YFQA 4J8GA 1FWXA 1N6EA 4H5IA 1NR0A 2GC7A 2YBAA 3OKWA 3OL2A 1SQJA 5KDOB 3IIWA
chains in the Genus database with same CATH superfamily
5GXIA 3QI0A 5HYNB 4X61B 3IUNA 3UR4A 3OTTA 3IULA 4G1MA 3UVOA 3UVKA 2G9AA 4BCCA 5GSAA 3DWLC 3PXTD 4J8BA 5I5IA 3I8CA 4I79A 4WK2A 3K6SA 4BL0A 4J84A 5B4WA 3SBQA 1RI6A 4HDJA 3IIYA 5IGOA 3EQ8A 4BH6A 4ZOXA 5M5VA 4JT5C 2VDMA 4PBYA 3ZDYA 2I0RA 5FKSA 1UTCA 4DNWA 5H14A 4GM9A 1T2XA 4O1QD 2OVQB 1JOFA 2HU8A 4CI2A 3MVDK 2VDNA 1K3IA 3FCSA 2BBKH 2B5NA 3EI1A 4A0BB 4X60B 3EG6A 3IKOA 3JRPA 2H9LA 1L0QA 2VC2A 4H5JA 2IAAA 3NIDA 3RRMC 5M5SA 3VH0A 2PM7B 3GREA 1YR2A 3IUJA 3L4OD 4Y5RD 2O9KA 4GMBA 3BG1A 3NVXA 2IWFA 3KCIA 2UZYB 3JZHA 2Z2OA 3K27A 4X3EA 3IUQA 4JD2C 2IURA 1MG2A 1VZ3A 2AH1A 5E6UA 3PE7A 4E54A 3O4GA 3IURA 1JJUB 4Z8LA 4A0BA 3PVUB 3IJ1A 3EU7A 4Z7NA 2VZ3A 1H2YA 2PM9A 5TF2A 3VI3A 2IUQA 2XZGA 4K3ID 1L5GA 1O6GA 2EIEA 2P9LC 2UZXB 4CI1A 3DXMC 3IJ0A 4QQEA 4QT8A 5CYKB 1VE6A 3I2NA 2OVPB 3HFQA 4O3TB 4D9SA 3N0EA 1E8MA 2J57G 2H6KA 2Z2NA 3SCYA 3PXWD 4J79A 2TRCB 2W18A 2IWKA 3FRXA 5H1MA 4A09A 3I7KA 3GFCA 5C92A 3AL8B 5M5RA 2H68A 3OW8A 3ZE0A 3F3FA 2JKXA 4A09B 3ZE2A 2VDPA 2XDWA 4RE5A 4AX4A 2YNNA 1VE7A 2B5MA 3RLMD 1PBYB 4OWRA 3I7HA 2BCJB 5CXBA 3OKYA 3KRWB 3SJLD 2EBSA 1U2VC 2H9PA 3RFGA 4J87A 5EAPA 4FB1D 5FLXg 1U8CA 5GXHA 3IJCA 1K32A 2IUPA 1SQ9A 3SLED 2I3SA 5CYKA 4QRJA 3MXXA 3JB9L 5EMLB 1JMXB 3JPXA 1PI6A 4BUJC 3PSLA 3DDUA 3B7FA 4K3JB 5HE2B 4PXWA 2PM6B 4AMYA 4UM9A 3I7PA 3MUOA 1QFMA 3JZGA 1GOFA 5THAA 4CY2A 5IT9g 4FA5D 2HXCA 1VZ2A 5EMMB 4GM8A 3EQ9A 4CC9A 3V7DB 3J80g 4O45A 3V4PA 4J73A 3VA6A 4R7AB 5HE0B 1R5MA 5FA5B 4MMZA 3JROA 4QAMA 1H2WA 4JSPC 3UKUC 2P9UC 3JAMg 4XYIA 5K19A 2EIDA 3I7NA 1N6FA 2AGWA 1TBGA 2HKMA 5IC7A 3ULEC 5FXYA 3ORVD 4GGDA 4WK4A 2I3TA 2H3XA 3NIFA 5FKRA 1E8NA 3F3GA 3SXTD 3SFZA 5C9ZB 2AGLA 4NSXA 2QR5A 5FQDA 4A0AA 1GG2B 4GGAA 4AOWA 1MG3A 4UM8A 5EAMA 3NIGA 4ERQA 2B5LA 5TEEA 4ZOZA 3K71A 4BP8A 3I7LA 2CN2A 2GC4A 1SHYB 2Z2PA 4AEZA 3T3PA 4A7JA 4E54B 4KFMB 2QC5A 2HU5A 3N0DA 4A2LA 3CFSB 3AL9A 4IRZA 3KRXB 3MMYA 2H9NA 3UKRC 2PM9B 2YNPA 4FA4D 4AN0A 2H14A 2PBIB 1TYQC 3SMRA 4E5ZA 2AGZA 3ZWLB 4G56B 3K72A 4JSXC 5AJAA 4LG9A 2H6QA 2MTAH 4Z7OA 4XYHA 4CY5A 1GOTB 2QZPA 5IGQA 3EQ7A 3EWEA 1GOHA 4JT6C 1C9IA 3ZDZA 2P9IC 2P9KC 1PGUA 1JV2A 1H2ZA 3EI3B 4A2MA 3CFVA 4L3GD 4ESGA 4NBMA 4LG8A 4CI3A 1JTDB 4GQBB 4PBZA 2J55H 2EICA 4CY3A 2WQ8A 2BKLA 1GXRA 4GM3A 1JMZB 2QXVA 3C5MA 1OLZA 5SXMA 4J81A 4GQ2P 3OL2B 4CZVA 5IJ7E 2OJYA 4PC0A 3E0CA 4JXMA 5C86A 5GMKn 5EMKB 2HU7A 4ZOVA 3MZKA 3K26A 2Q7QA 3UVNA 3ODTA 5HE1B 1B9YA 4JHPC 5EMJB 3EI3A 4FAVD 1QNIA 5EM2A 3JZNA 3RMZD 4FHLA 2CE8A 4FA9D 2VDQA 5C2VB 5JWZA 1GP2B 2OK6A 3MZLA 1OMWB 5I5JA 5EARA 4TZ4A 4CZXA 3AFCA 1UOOA 4WJKA 1MDAH 4YVDA 2VZ1A 3SVWD 2H9MA 3EMHA 2OK4A 4BP9A 4GZ8A 4LGNA 3SWSD 4CZYA 2YNOA 4A11B 3IVMA 1K8KC 4QL1A 4A0AB 3L4MD 2HKRA 1QFSA 4ZN4A 1S4UX 4MMXA 3SBPA 4NC4A 4J0XA 4XEIC 2YB8B 4O3UB 3GC3B 3I8EA 3OKYB 1A0RB 1UOPA 2CO0A 2I0SA 3RFHA 2VDOA 1N6DA 1VYHC 2CN3A 3UVLA 4O2WA 2VDLA 3EI1B 5TEFA 4NAAA 5M5TA 3BWSA 5TDHB 5CXBB 2CNXA 3VI4A 2HYEA 3O4IA 4FA1D 4JHNA 1U4CA 2CE9A 5IJ8E 3IUMA 3T3MA 4FWWA 4A08B 3IJEA 4E5ZB 2XL3A 4J77A 4Z7QA 3AL8A 4MK0B 4NENA 4L9OA 5EM2B 5CXCB 3VGZA 5HE3B 3DXKC 3CIKB 4UI9R 3DM0A 3SBRA 4WK0A 3ZDXA 1E5TA 3MKSB 2HESX 4X63B 5H17A 4U7AA 2VDRA 4A08A 4L3HD 4PSWB 4FAND 4ERYA 4U1EI 3FM0A 5AFU3 1PEVA 5C2WB 2XU7A 4N14A 2J56H 4J0WA 3P4FA 5E6RA 1I2MB 4AMZA 2XE4A 3EI2A 4A11A 1UOQA 4IMMA 2EIBA 5EALA 4PSXB 4RE6A 3AH8B 2GNQA 2VDKA 2AGXA 3GD1I 4IA9A 5HQGA 5I5MA 3DSMA 3SN6B 4BCDA 3EI4A 3EI2B 4ZOYA 3FGBA 1B9XA 4L1QD 3OKTA 2I0TA 3BG0A 5K1CC 2XL2A 4ERZA 2IUVA 4CI8A 3RSEC 3NVQA 4BCBA 3W15A 3EI4B 3MUNA 3NVNA 3PSCB 4GGCA 1XKSA 2B4EA 4CY1A 4ES0A 3SHFA 3PXSD 2AH0A 1A12A 5CXCA 3O4HA 3V4VA 1XIPA 4OZUA 1H2XA 2YMUA 4JSNC 4D0KA 1ERJA 5A2Qg 3F3PA 4G55A 4J86A 4GQ1A 1GOGA 2AGYA 2XYIA 4D6VA 4DNVA 4EWRA 2G99A 4PNKB 1O6FA 4J82A 4J78A 3MKQA 5FKQA 5FKTA 4DNUA 4MMYA 3C9CA 2OIZA 2CO0C 1BPOA 3RN0D 5M5UA 3A0FA 3RN1D 3ZE1A 5M61A 3O4JA 2HJ4A 3V5WB 4AN1A 3C75H 4JSVC 1Q47A 4O02A 1XHMA 2AQ5A 2HJBA 2P9NC 3QHYB 3I7OA 2H13A 1NEXB 3PVWB 4O9DA 3FCUA 4Y7RA 5AMSA 2H47A 3C99A 2H6NA 2P9PC 1M1XA 3U4YA 1P22A 4G1EA 4L1MA 3I89A 1C9LA 2OVRB 3V9FA 3J81g 5E6SA 3UVMA 1TYEA 2P9SC 1YFQA 4J8GA 5FFOA 1FWXA 1N6EA 4H5IA 1NR0A 3OF7A 2GC7A 2YBAA 3OKWA 3OL2A 1SQJA 5KDOB 3IIWA 5FFGA 5HDBA
chains in the Genus database with same CATH topology
5GXIA 5HYNB 4X61B 3UR4A 3OTTA 3UVOA 3UVKA 2G9AA 5GSAA 3DWLC 3PXTD 4J8BA 5I5IA 3I8CA 4I79A 4BL0A 4J84A 5B4WA 3SBQA 1RI6A 4HDJA 3IIYA 5IGOA 4BH6A 4ZOXA 4JT5C 4PBYA 2I0RA 5FKSA 5H14A 4GM9A 4O1QD 2OVQB 1JOFA 4CI2A 2BBKH 2B5NA 3EI1A 4A0BB 4X60B 3EG6A 3IKOA 3JRPA 2H9LA 1L0QA 4H5JA 2IAAA 3RRMC 3VH0A 2PM7B 3GREA 3L4OD 4Y5RD 2O9KA 4GMBA 3BG1A 3NVXA 2IWFA 2UZYB 3JZHA 2Z2OA 3K27A 4X3EA 4JD2C 2IURA 1MG2A 2AH1A 3PE7A 4E54A 4Z8LA 1JJUB 4A0BA 3PVUB 3IJ1A 3EU7A 2PM9A 5TF2A 2IUQA 4K3ID 2P9LC 2UZXB 4CI1A 3DXMC 3IJ0A 4QQEA 4QT8A 5CYKB 3I2NA 2OVPB 3HFQA 4O3TB 3N0EA 2J57G 2H6KA 2Z2NA 3SCYA 3PXWD 4J79A 2TRCB 2W18A 2IWKA 3FRXA 5H1MA 4A09A 3I7KA 3GFCA 3AL8B 2H68A 3OW8A 3F3FA 4A09B 2YNNA 2B5MA 3RLMD 1PBYB 4OWRA 3I7HA 2BCJB 5CXBA 3OKYA 3KRWB 3SJLD 2EBSA 1U2VC 2H9PA 3RFGA 4J87A 5EAPA 4FB1D 5FLXg 5GXHA 3IJCA 1K32A 2IUPA 1SQ9A 3SLED 2I3SA 5CYKA 4QRJA 3MXXA 3JB9L 5EMLB 1JMXB 3JPXA 1PI6A 4BUJC 3PSLA 3B7FA 4K3JB 5HE2B 4PXWA 2PM6B 3I7PA 3JZGA 5THAA 4CY2A 5IT9g 4FA5D 2HXCA 5EMMB 4GM8A 4CC9A 3V7DB 3J80g 4O45A 4J73A 3VA6A 4R7AB 5HE0B 1R5MA 5FA5B 3JROA 4JSPC 3UKUC 2P9UC 3JAMg 4XYIA 5K19A 3I7NA 1N6FA 2AGWA 1TBGA 2HKMA 5IC7A 3ULEC 5FXYA 3ORVD 4GGDA 2I3TA 2H3XA 5FKRA 3F3GA 3SXTD 3SFZA 5C9ZB 2AGLA 4NSXA 5FQDA 4A0AA 1GG2B 4GGAA 4AOWA 1MG3A 5EAMA 4ERQA 2B5LA 5TEEA 4ZOZA 3I7LA 2CN2A 2GC4A 1SHYB 2Z2PA 4AEZA 4A7JA 4E54B 4KFMB 2QC5A 3N0DA 4A2LA 3CFSB 3AL9A 3KRXB 3MMYA 2H9NA 3UKRC 2PM9B 2YNPA 4FA4D 2H14A 2PBIB 1TYQC 3SMRA 4E5ZA 2AGZA 3ZWLB 4G56B 4JSXC 5AJAA 4LG9A 2H6QA 2MTAH 4XYHA 4CY5A 1GOTB 5IGQA 3EWEA 4JT6C 2P9IC 2P9KC 1PGUA 3EI3B 4A2MA 3CFVA 4L3GD 4ESGA 4LG8A 4CI3A 4GQBB 4PBZA 2J55H 4CY3A 1GXRA 4GM3A 1JMZB 2QXVA 3C5MA 1OLZA 5SXMA 4J81A 4GQ2P 3OL2B 4CZVA 5IJ7E 2OJYA 4PC0A 3E0CA 4JXMA 5GMKn 5EMKB 4ZOVA 3MZKA 3K26A 2Q7QA 3UVNA 3ODTA 5HE1B 1B9YA 5EMJB 3EI3A 4FAVD 1QNIA 5EM2A 3JZNA 3RMZD 4FHLA 2CE8A 4FA9D 5C2VB 5JWZA 1GP2B 2OK6A 3MZLA 1OMWB 5I5JA 5EARA 4TZ4A 4CZXA 3AFCA 1MDAH 4YVDA 3SVWD 2H9MA 3EMHA 2OK4A 4GZ8A 4LGNA 3SWSD 4CZYA 2YNOA 4A11B 1K8KC 4QL1A 4A0AB 3L4MD 2HKRA 4ZN4A 1S4UX 3SBPA 4J0XA 4XEIC 2YB8B 4O3UB 1A0RB 2I0SA 2CO0A 3I8EA 3OKYB 3RFHA 1N6DA 1VYHC 2CN3A 3UVLA 3EI1B 5TEFA 3BWSA 5TDHB 5CXBB 2CNXA 2HYEA 4FA1D 1U4CA 2CE9A 5IJ8E 4FWWA 4A08B 4E5ZB 2XL3A 4J77A 3AL8A 4MK0B 4L9OA 5EM2B 5CXCB 3VGZA 5HE3B 3DXKC 3CIKB 4UI9R 3DM0A 3SBRA 3MKSB 2HESX 4X63B 5H17A 4U7AA 4A08A 4L3HD 4PSWB 4FAND 4ERYA 4U1EI 3FM0A 5AFU3 1PEVA 5C2WB 2XU7A 4N14A 2J56H 4J0WA 3P4FA 3EI2A 4A11A 4IMMA 5EALA 4PSXB 3AH8B 2GNQA 2AGXA 4IA9A 5HQGA 5I5MA 3DSMA 3SN6B 3EI2B 3EI4A 4ZOYA 3FGBA 1B9XA 4L1QD 3OKTA 2I0TA 3BG0A 5K1CC 2XL2A 4ERZA 2IUVA 4CI8A 3RSEC 3NVQA 3W15A 3EI4B 3NVNA 3PSCB 4GGCA 1XKSA 2B4EA 4CY1A 4ES0A 3SHFA 3PXSD 2AH0A 5CXCA 1XIPA 4OZUA 2YMUA 4JSNC 4D0KA 1ERJA 5A2Qg 3F3PA 4J86A 4GQ1A 2XYIA 2AGYA 4D6VA 4EWRA 2G99A 4PNKB 4J82A 4J78A 3MKQA 5FKQA 5FKTA 3C9CA 2OIZA 2CO0C 3RN0D 3A0FA 3RN1D 2HJ4A 3V5WB 3C75H 4JSVC 1Q47A 1XHMA 2AQ5A 2HJBA 2P9NC 3I7OA 2H13A 1NEXB 3PVWB 4O9DA 5AMSA 4Y7RA 2H47A 3C99A 2H6NA 2P9PC 3U4YA 1P22A 3I89A 2OVRB 3V9FA 3J81g 3UVMA 2P9SC 1YFQA 4J8GA 1FWXA 1N6EA 4H5IA 1NR0A 2GC7A 2YBAA 3OKWA 3OL2A 1SQJA 5KDOB 3IIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GXI A;  5HYN B;  4X61 B;  3UR4 A;  3OTT A;  3UVO A;  3UVK A;  2G9A A;  5GSA A;  3DWL C;  3PXT D;  4J8B A;  5I5I A;  3I8C A;  4I79 A;  4BL0 A;  4J84 A;  5B4W A;  3SBQ A;  1RI6 A;  4HDJ A;  3IIY A;  5IGO A;  4BH6 A;  4ZOX A;  4JT5 C;  4PBY A;  2I0R A;  5FKS A;  5H14 A;  4GM9 A;  4O1Q D;  2OVQ B;  1JOF A;  4CI2 A;  2BBK H;  2B5N A;  3EI1 A;  4A0B B;  4X60 B;  3EG6 A;  3IKO A;  3JRP A;  2H9L A;  1L0Q A;  4H5J A;  2IAA A;  3RRM C;  3VH0 A;  2PM7 B;  3GRE A;  3L4O D;  4Y5R D;  2O9K A;  4GMB A;  3BG1 A;  3NVX A;  2IWF A;  2UZY B;  3JZH A;  2Z2O A;  3K27 A;  4X3E A;  4JD2 C;  2IUR A;  1MG2 A;  2AH1 A;  3PE7 A;  4E54 A;  4Z8L A;  1JJU B;  4A0B A;  3PVU B;  3IJ1 A;  3EU7 A;  2PM9 A;  5TF2 A;  2IUQ A;  4K3I D;  2P9L C;  2UZX B;  4CI1 A;  3DXM C;  3IJ0 A;  4QQE A;  4QT8 A;  5CYK B;  3I2N A;  2OVP B;  3HFQ A;  4O3T B;  3N0E A;  2J57 G;  2H6K A;  2Z2N A;  3SCY A;  3PXW D;  4J79 A;  2TRC B;  2W18 A;  2IWK A;  3FRX A;  5H1M A;  4A09 A;  3I7K A;  3GFC A;  3AL8 B;  2H68 A;  3OW8 A;  3F3F A;  4A09 B;  2YNN A;  2B5M A;  3RLM D;  1PBY B;  4OWR A;  3I7H A;  2BCJ B;  5CXB A;  3OKY A;  3KRW B;  3SJL D;  2EBS A;  1U2V C;  2H9P A;  3RFG A;  4J87 A;  5EAP A;  4FB1 D;  5FLX g;  5GXH A;  3IJC A;  1K32 A;  2IUP A;  1SQ9 A;  3SLE D;  2I3S A;  5CYK A;  4QRJ A;  3MXX A;  3JB9 L;  5EML B;  1JMX B;  3JPX A;  1PI6 A;  4BUJ C;  3PSL A;  3B7F A;  4K3J B;  5HE2 B;  4PXW A;  2PM6 B;  3I7P A;  3JZG A;  5THA A;  4CY2 A;  5IT9 g;  4FA5 D;  2HXC A;  5EMM B;  4GM8 A;  4CC9 A;  3V7D B;  3J80 g;  4O45 A;  4J73 A;  3VA6 A;  4R7A B;  5HE0 B;  1R5M A;  5FA5 B;  3JRO A;  4JSP C;  3UKU C;  2P9U C;  3JAM g;  4XYI A;  5K19 A;  3I7N A;  1N6F A;  2AGW A;  1TBG A;  2HKM A;  5IC7 A;  3ULE C;  5FXY A;  3ORV D;  4GGD A;  2I3T A;  2H3X A;  5FKR A;  3F3G A;  3SXT D;  3SFZ A;  5C9Z B;  2AGL A;  4NSX A;  5FQD A;  4A0A A;  1GG2 B;  4GGA A;  4AOW A;  1MG3 A;  5EAM A;  4ERQ A;  2B5L A;  5TEE A;  4ZOZ A;  3I7L A;  2CN2 A;  2GC4 A;  1SHY B;  2Z2P A;  4AEZ A;  4A7J A;  4E54 B;  4KFM B;  2QC5 A;  3N0D A;  4A2L A;  3CFS B;  3AL9 A;  3KRX B;  3MMY A;  2H9N A;  3UKR C;  2PM9 B;  2YNP A;  4FA4 D;  2H14 A;  2PBI B;  1TYQ C;  3SMR A;  4E5Z A;  2AGZ A;  3ZWL B;  4G56 B;  4JSX C;  5AJA A;  4LG9 A;  2H6Q A;  2MTA H;  4XYH A;  4CY5 A;  1GOT B;  5IGQ A;  3EWE A;  4JT6 C;  2P9I C;  2P9K C;  1PGU A;  3EI3 B;  4A2M A;  3CFV A;  4L3G D;  4ESG A;  4LG8 A;  4CI3 A;  4GQB B;  4PBZ A;  2J55 H;  4CY3 A;  1GXR A;  4GM3 A;  1JMZ B;  2QXV A;  3C5M A;  1OLZ A;  5SXM A;  4J81 A;  4GQ2 P;  3OL2 B;  4CZV A;  5IJ7 E;  2OJY A;  4PC0 A;  3E0C A;  4JXM A;  5GMK n;  5EMK B;  4ZOV A;  3MZK A;  3K26 A;  2Q7Q A;  3UVN A;  3ODT A;  5HE1 B;  1B9Y A;  5EMJ B;  3EI3 A;  4FAV D;  1QNI A;  5EM2 A;  3JZN A;  3RMZ D;  4FHL A;  2CE8 A;  4FA9 D;  5C2V B;  5JWZ A;  1GP2 B;  2OK6 A;  3MZL A;  1OMW B;  5I5J A;  5EAR A;  4TZ4 A;  4CZX A;  3AFC A;  1MDA H;  4YVD A;  3SVW D;  2H9M A;  3EMH A;  2OK4 A;  4GZ8 A;  4LGN A;  3SWS D;  4CZY A;  2YNO A;  4A11 B;  1K8K C;  4QL1 A;  4A0A B;  3L4M D;  2HKR A;  4ZN4 A;  1S4U X;  3SBP A;  4J0X A;  4XEI C;  2YB8 B;  4O3U B;  1A0R B;  2I0S A;  2CO0 A;  3I8E A;  3OKY B;  3RFH A;  1N6D A;  1VYH C;  2CN3 A;  3UVL A;  3EI1 B;  5TEF A;  3BWS A;  5TDH B;  5CXB B;  2CNX A;  2HYE A;  4FA1 D;  1U4C A;  2CE9 A;  5IJ8 E;  4FWW A;  4A08 B;  4E5Z B;  2XL3 A;  4J77 A;  3AL8 A;  4MK0 B;  4L9O A;  5EM2 B;  5CXC B;  3VGZ A;  5HE3 B;  3DXK C;  3CIK B;  4UI9 R;  3DM0 A;  3SBR A;  3MKS B;  2HES X;  4X63 B;  5H17 A;  4U7A A;  4A08 A;  4L3H D;  4PSW B;  4FAN D;  4ERY A;  4U1E I;  3FM0 A;  5AFU 3;  1PEV A;  5C2W B;  2XU7 A;  4N14 A;  2J56 H;  4J0W A;  3P4F A;  3EI2 A;  4A11 A;  4IMM A;  5EAL A;  4PSX B;  3AH8 B;  2GNQ A;  2AGX A;  4IA9 A;  5HQG A;  5I5M A;  3DSM A;  3SN6 B;  3EI2 B;  3EI4 A;  4ZOY A;  3FGB A;  1B9X A;  4L1Q D;  3OKT A;  2I0T A;  3BG0 A;  5K1C C;  2XL2 A;  4ERZ A;  2IUV A;  4CI8 A;  3RSE C;  3NVQ A;  3W15 A;  3EI4 B;  3NVN A;  3PSC B;  4GGC A;  1XKS A;  2B4E A;  4CY1 A;  4ES0 A;  3SHF A;  3PXS D;  2AH0 A;  5CXC A;  1XIP A;  4OZU A;  2YMU A;  4JSN C;  4D0K A;  1ERJ A;  5A2Q g;  3F3P A;  4J86 A;  4GQ1 A;  2XYI A;  2AGY A;  4D6V A;  4EWR A;  2G99 A;  4PNK B;  4J82 A;  4J78 A;  3MKQ A;  5FKQ A;  5FKT A;  3C9C A;  2OIZ A;  2CO0 C;  3RN0 D;  3A0F A;  3RN1 D;  2HJ4 A;  3V5W B;  3C75 H;  4JSV C;  1Q47 A;  1XHM A;  2AQ5 A;  2HJB A;  2P9N C;  3I7O A;  2H13 A;  1NEX B;  3PVW B;  4O9D A;  5AMS A;  4Y7R A;  2H47 A;  3C99 A;  2H6N A;  2P9P C;  3U4Y A;  1P22 A;  3I89 A;  2OVR B;  3V9F A;  3J81 g;  3UVM A;  2P9S C;  1YFQ A;  4J8G A;  1FWX A;  1N6E A;  4H5I A;  1NR0 A;  2GC7 A;  2YBA A;  3OKW A;  3OL2 A;  1SQJ A;  5KDO B;  3IIW A; 
#chains in the Genus database with same CATH topology
 5GXI A;  3QI0 A;  5HYN B;  4X61 B;  3IUN A;  3UR4 A;  3OTT A;  3IUL A;  4G1M A;  3UVO A;  3UVK A;  2G9A A;  4BCC A;  5GSA A;  3DWL C;  3PXT D;  4J8B A;  5I5I A;  3I8C A;  4I79 A;  4WK2 A;  3K6S A;  4BL0 A;  4J84 A;  5B4W A;  3SBQ A;  1RI6 A;  4HDJ A;  3IIY A;  5IGO A;  3EQ8 A;  4BH6 A;  4ZOX A;  5M5V A;  4JT5 C;  2VDM A;  4PBY A;  3ZDY A;  2I0R A;  5FKS A;  1UTC A;  4DNW A;  5H14 A;  4GM9 A;  1T2X A;  4O1Q D;  2OVQ B;  1JOF A;  2HU8 A;  4CI2 A;  3MVD K;  2VDN A;  1K3I A;  3FCS A;  2BBK H;  2B5N A;  3EI1 A;  4A0B B;  4X60 B;  3EG6 A;  3IKO A;  3JRP A;  2H9L A;  1L0Q A;  2VC2 A;  4H5J A;  2IAA A;  3NID A;  3RRM C;  5M5S A;  3VH0 A;  2PM7 B;  3GRE A;  1YR2 A;  3IUJ A;  3L4O D;  4Y5R D;  2O9K A;  4GMB A;  3BG1 A;  3NVX A;  2IWF A;  3KCI A;  2UZY B;  3JZH A;  2Z2O A;  3K27 A;  4X3E A;  3IUQ A;  4JD2 C;  2IUR A;  1MG2 A;  1VZ3 A;  2AH1 A;  5E6U A;  3PE7 A;  4E54 A;  3O4G A;  3IUR A;  1JJU B;  4Z8L A;  4A0B A;  3PVU B;  3IJ1 A;  3EU7 A;  4Z7N A;  2VZ3 A;  1H2Y A;  2PM9 A;  5TF2 A;  3VI3 A;  2IUQ A;  2XZG A;  4K3I D;  1L5G A;  1O6G A;  2EIE A;  2P9L C;  2UZX B;  4CI1 A;  3DXM C;  3IJ0 A;  4QQE A;  4QT8 A;  5CYK B;  1VE6 A;  3I2N A;  2OVP B;  3HFQ A;  4O3T B;  4D9S A;  3N0E A;  1E8M A;  2J57 G;  2H6K A;  2Z2N A;  3SCY A;  3PXW D;  4J79 A;  2TRC B;  2W18 A;  2IWK A;  3FRX A;  5H1M A;  4A09 A;  3I7K A;  3GFC A;  5C92 A;  3AL8 B;  5M5R A;  2H68 A;  3OW8 A;  3ZE0 A;  3F3F A;  2JKX A;  4A09 B;  3ZE2 A;  2VDP A;  2XDW A;  4RE5 A;  4AX4 A;  2YNN A;  1VE7 A;  2B5M A;  3RLM D;  1PBY B;  4OWR A;  3I7H A;  2BCJ B;  5CXB A;  3OKY A;  3KRW B;  3SJL D;  2EBS A;  1U2V C;  2H9P A;  3RFG A;  4J87 A;  5EAP A;  4FB1 D;  5FLX g;  1U8C A;  5GXH A;  3IJC A;  1K32 A;  2IUP A;  1SQ9 A;  3SLE D;  2I3S A;  5CYK A;  4QRJ A;  3MXX A;  3JB9 L;  5EML B;  1JMX B;  3JPX A;  1PI6 A;  4BUJ C;  3PSL A;  3DDU A;  3B7F A;  4K3J B;  5HE2 B;  4PXW A;  2PM6 B;  4AMY A;  4UM9 A;  3I7P A;  3MUO A;  1QFM A;  3JZG A;  1GOF A;  5THA A;  4CY2 A;  5IT9 g;  4FA5 D;  2HXC A;  1VZ2 A;  5EMM B;  4GM8 A;  3EQ9 A;  4CC9 A;  3V7D B;  3J80 g;  4O45 A;  3V4P A;  4J73 A;  3VA6 A;  4R7A B;  5HE0 B;  1R5M A;  5FA5 B;  4MMZ A;  3JRO A;  4QAM A;  1H2W A;  4JSP C;  3UKU C;  2P9U C;  3JAM g;  4XYI A;  5K19 A;  2EID A;  3I7N A;  1N6F A;  2AGW A;  1TBG A;  2HKM A;  5IC7 A;  3ULE C;  5FXY A;  3ORV D;  4GGD A;  4WK4 A;  2I3T A;  2H3X A;  3NIF A;  5FKR A;  1E8N A;  3F3G A;  3SXT D;  3SFZ A;  5C9Z B;  2AGL A;  4NSX A;  2QR5 A;  5FQD A;  4A0A A;  1GG2 B;  4GGA A;  4AOW A;  1MG3 A;  4UM8 A;  5EAM A;  3NIG A;  4ERQ A;  2B5L A;  5TEE A;  4ZOZ A;  3K71 A;  4BP8 A;  3I7L A;  2CN2 A;  2GC4 A;  1SHY B;  2Z2P A;  4AEZ A;  3T3P A;  4A7J A;  4E54 B;  4KFM B;  2QC5 A;  2HU5 A;  3N0D A;  4A2L A;  3CFS B;  3AL9 A;  4IRZ A;  3KRX B;  3MMY A;  2H9N A;  3UKR C;  2PM9 B;  2YNP A;  4FA4 D;  4AN0 A;  2H14 A;  2PBI B;  1TYQ C;  3SMR A;  4E5Z A;  2AGZ A;  3ZWL B;  4G56 B;  3K72 A;  4JSX C;  5AJA A;  4LG9 A;  2H6Q A;  2MTA H;  4Z7O A;  4XYH A;  4CY5 A;  1GOT B;  2QZP A;  5IGQ A;  3EQ7 A;  3EWE A;  1GOH A;  4JT6 C;  1C9I A;  3ZDZ A;  2P9I C;  2P9K C;  1PGU A;  1JV2 A;  1H2Z A;  3EI3 B;  4A2M A;  3CFV A;  4L3G D;  4ESG A;  4NBM A;  4LG8 A;  4CI3 A;  1JTD B;  4GQB B;  4PBZ A;  2J55 H;  2EIC A;  4CY3 A;  2WQ8 A;  2BKL A;  1GXR A;  4GM3 A;  1JMZ B;  2QXV A;  3C5M A;  1OLZ A;  5SXM A;  4J81 A;  4GQ2 P;  3OL2 B;  4CZV A;  5IJ7 E;  2OJY A;  4PC0 A;  3E0C A;  4JXM A;  5C86 A;  5GMK n;  5EMK B;  2HU7 A;  4ZOV A;  3MZK A;  3K26 A;  2Q7Q A;  3UVN A;  3ODT A;  5HE1 B;  1B9Y A;  4JHP C;  5EMJ B;  3EI3 A;  4FAV D;  1QNI A;  5EM2 A;  3JZN A;  3RMZ D;  4FHL A;  2CE8 A;  4FA9 D;  2VDQ A;  5C2V B;  5JWZ A;  1GP2 B;  2OK6 A;  3MZL A;  1OMW B;  5I5J A;  5EAR A;  4TZ4 A;  4CZX A;  3AFC A;  1UOO A;  4WJK A;  1MDA H;  4YVD A;  2VZ1 A;  3SVW D;  2H9M A;  3EMH A;  2OK4 A;  4BP9 A;  4GZ8 A;  4LGN A;  3SWS D;  4CZY A;  2YNO A;  4A11 B;  3IVM A;  1K8K C;  4QL1 A;  4A0A B;  3L4M D;  2HKR A;  1QFS A;  4ZN4 A;  1S4U X;  4MMX A;  3SBP A;  4NC4 A;  4J0X A;  4XEI C;  2YB8 B;  4O3U B;  3GC3 B;  3I8E A;  3OKY B;  1A0R B;  1UOP A;  2CO0 A;  2I0S A;  3RFH A;  2VDO A;  1N6D A;  1VYH C;  2CN3 A;  3UVL A;  4O2W A;  2VDL A;  3EI1 B;  5TEF A;  4NAA A;  5M5T A;  3BWS A;  5TDH B;  5CXB B;  2CNX A;  3VI4 A;  2HYE A;  3O4I A;  4FA1 D;  4JHN A;  1U4C A;  2CE9 A;  5IJ8 E;  3IUM A;  3T3M A;  4FWW A;  4A08 B;  3IJE A;  4E5Z B;  2XL3 A;  4J77 A;  4Z7Q A;  3AL8 A;  4MK0 B;  4NEN A;  4L9O A;  5EM2 B;  5CXC B;  3VGZ A;  5HE3 B;  3DXK C;  3CIK B;  4UI9 R;  3DM0 A;  3SBR A;  4WK0 A;  3ZDX A;  1E5T A;  3MKS B;  2HES X;  4X63 B;  5H17 A;  4U7A A;  2VDR A;  4A08 A;  4L3H D;  4PSW B;  4FAN D;  4ERY A;  4U1E I;  3FM0 A;  5AFU 3;  1PEV A;  5C2W B;  2XU7 A;  4N14 A;  2J56 H;  4J0W A;  3P4F A;  5E6R A;  1I2M B;  4AMZ A;  2XE4 A;  3EI2 A;  4A11 A;  1UOQ A;  4IMM A;  2EIB A;  5EAL A;  4PSX B;  4RE6 A;  3AH8 B;  2GNQ A;  2VDK A;  2AGX A;  3GD1 I;  4IA9 A;  5HQG A;  5I5M A;  3DSM A;  3SN6 B;  4BCD A;  3EI4 A;  3EI2 B;  4ZOY A;  3FGB A;  1B9X A;  4L1Q D;  3OKT A;  2I0T A;  3BG0 A;  5K1C C;  2XL2 A;  4ERZ A;  2IUV A;  4CI8 A;  3RSE C;  3NVQ A;  4BCB A;  3W15 A;  3EI4 B;  3MUN A;  3NVN A;  3PSC B;  4GGC A;  1XKS A;  2B4E A;  4CY1 A;  4ES0 A;  3SHF A;  3PXS D;  2AH0 A;  1A12 A;  5CXC A;  3O4H A;  3V4V A;  1XIP A;  4OZU A;  1H2X A;  2YMU A;  4JSN C;  4D0K A;  1ERJ A;  5A2Q g;  3F3P A;  4G55 A;  4J86 A;  4GQ1 A;  1GOG A;  2AGY A;  2XYI A;  4D6V A;  4DNV A;  4EWR A;  2G99 A;  4PNK B;  1O6F A;  4J82 A;  4J78 A;  3MKQ A;  5FKQ A;  5FKT A;  4DNU A;  4MMY A;  3C9C A;  2OIZ A;  2CO0 C;  1BPO A;  3RN0 D;  5M5U A;  3A0F A;  3RN1 D;  3ZE1 A;  5M61 A;  3O4J A;  2HJ4 A;  3V5W B;  4AN1 A;  3C75 H;  4JSV C;  1Q47 A;  4O02 A;  1XHM A;  2AQ5 A;  2HJB A;  2P9N C;  3QHY B;  3I7O A;  2H13 A;  1NEX B;  3PVW B;  4O9D A;  3FCU A;  4Y7R A;  5AMS A;  2H47 A;  3C99 A;  2H6N A;  2P9P C;  1M1X A;  3U4Y A;  1P22 A;  4G1E A;  4L1M A;  3I89 A;  1C9L A;  2OVR B;  3V9F A;  3J81 g;  5E6S A;  3UVM A;  1TYE A;  2P9S C;  1YFQ A;  4J8G A;  5FFO A;  1FWX A;  1N6E A;  4H5I A;  1NR0 A;  3OF7 A;  2GC7 A;  2YBA A;  3OKW A;  3OL2 A;  1SQJ A;  5KDO B;  3IIW A;  5FFG A;  5HDB A; 
#chains in the Genus database with same CATH homology
 5GXI A;  5HYN B;  4X61 B;  3UR4 A;  3OTT A;  3UVO A;  3UVK A;  2G9A A;  5GSA A;  3DWL C;  3PXT D;  4J8B A;  5I5I A;  3I8C A;  4I79 A;  4BL0 A;  4J84 A;  5B4W A;  3SBQ A;  1RI6 A;  4HDJ A;  3IIY A;  5IGO A;  4BH6 A;  4ZOX A;  4JT5 C;  4PBY A;  2I0R A;  5FKS A;  5H14 A;  4GM9 A;  4O1Q D;  2OVQ B;  1JOF A;  4CI2 A;  2BBK H;  2B5N A;  3EI1 A;  4A0B B;  4X60 B;  3EG6 A;  3IKO A;  3JRP A;  2H9L A;  1L0Q A;  4H5J A;  2IAA A;  3RRM C;  3VH0 A;  2PM7 B;  3GRE A;  3L4O D;  4Y5R D;  2O9K A;  4GMB A;  3BG1 A;  3NVX A;  2IWF A;  2UZY B;  3JZH A;  2Z2O A;  3K27 A;  4X3E A;  4JD2 C;  2IUR A;  1MG2 A;  2AH1 A;  3PE7 A;  4E54 A;  4Z8L A;  1JJU B;  4A0B A;  3PVU B;  3IJ1 A;  3EU7 A;  2PM9 A;  5TF2 A;  2IUQ A;  4K3I D;  2P9L C;  2UZX B;  4CI1 A;  3DXM C;  3IJ0 A;  4QQE A;  4QT8 A;  5CYK B;  3I2N A;  2OVP B;  3HFQ A;  4O3T B;  3N0E A;  2J57 G;  2H6K A;  2Z2N A;  3SCY A;  3PXW D;  4J79 A;  2TRC B;  2W18 A;  2IWK A;  3FRX A;  5H1M A;  4A09 A;  3I7K A;  3GFC A;  3AL8 B;  2H68 A;  3OW8 A;  3F3F A;  4A09 B;  2YNN A;  2B5M A;  3RLM D;  1PBY B;  4OWR A;  3I7H A;  2BCJ B;  5CXB A;  3OKY A;  3KRW B;  3SJL D;  2EBS A;  1U2V C;  2H9P A;  3RFG A;  4J87 A;  5EAP A;  4FB1 D;  5FLX g;  5GXH A;  3IJC A;  1K32 A;  2IUP A;  1SQ9 A;  3SLE D;  2I3S A;  5CYK A;  4QRJ A;  3MXX A;  3JB9 L;  5EML B;  1JMX B;  3JPX A;  1PI6 A;  4BUJ C;  3PSL A;  3B7F A;  4K3J B;  5HE2 B;  4PXW A;  2PM6 B;  3I7P A;  3JZG A;  5THA A;  4CY2 A;  5IT9 g;  4FA5 D;  2HXC A;  5EMM B;  4GM8 A;  4CC9 A;  3V7D B;  3J80 g;  4O45 A;  4J73 A;  3VA6 A;  4R7A B;  5HE0 B;  1R5M A;  5FA5 B;  3JRO A;  4JSP C;  3UKU C;  2P9U C;  3JAM g;  4XYI A;  5K19 A;  3I7N A;  1N6F A;  2AGW A;  1TBG A;  2HKM A;  5IC7 A;  3ULE C;  5FXY A;  3ORV D;  4GGD A;  2I3T A;  2H3X A;  5FKR A;  3F3G A;  3SXT D;  3SFZ A;  5C9Z B;  2AGL A;  4NSX A;  5FQD A;  4A0A A;  1GG2 B;  4GGA A;  4AOW A;  1MG3 A;  5EAM A;  4ERQ A;  2B5L A;  5TEE A;  4ZOZ A;  3I7L A;  2CN2 A;  2GC4 A;  1SHY B;  2Z2P A;  4AEZ A;  4A7J A;  4E54 B;  4KFM B;  2QC5 A;  3N0D A;  4A2L A;  3CFS B;  3AL9 A;  3KRX B;  3MMY A;  2H9N A;  3UKR C;  2PM9 B;  2YNP A;  4FA4 D;  2H14 A;  2PBI B;  1TYQ C;  3SMR A;  4E5Z A;  2AGZ A;  3ZWL B;  4G56 B;  4JSX C;  5AJA A;  4LG9 A;  2H6Q A;  2MTA H;  4XYH A;  4CY5 A;  1GOT B;  5IGQ A;  3EWE A;  4JT6 C;  2P9I C;  2P9K C;  1PGU A;  3EI3 B;  4A2M A;  3CFV A;  4L3G D;  4ESG A;  4LG8 A;  4CI3 A;  4GQB B;  4PBZ A;  2J55 H;  4CY3 A;  1GXR A;  4GM3 A;  1JMZ B;  2QXV A;  3C5M A;  1OLZ A;  5SXM A;  4J81 A;  4GQ2 P;  3OL2 B;  4CZV A;  5IJ7 E;  2OJY A;  4PC0 A;  3E0C A;  4JXM A;  5GMK n;  5EMK B;  4ZOV A;  3MZK A;  3K26 A;  2Q7Q A;  3UVN A;  3ODT A;  5HE1 B;  1B9Y A;  5EMJ B;  3EI3 A;  4FAV D;  1QNI A;  5EM2 A;  3JZN A;  3RMZ D;  4FHL A;  2CE8 A;  4FA9 D;  5C2V B;  5JWZ A;  1GP2 B;  2OK6 A;  3MZL A;  1OMW B;  5I5J A;  5EAR A;  4TZ4 A;  4CZX A;  3AFC A;  1MDA H;  4YVD A;  3SVW D;  2H9M A;  3EMH A;  2OK4 A;  4GZ8 A;  4LGN A;  3SWS D;  4CZY A;  2YNO A;  4A11 B;  1K8K C;  4QL1 A;  4A0A B;  3L4M D;  2HKR A;  4ZN4 A;  1S4U X;  3SBP A;  4J0X A;  4XEI C;  2YB8 B;  4O3U B;  1A0R B;  2I0S A;  2CO0 A;  3I8E A;  3OKY B;  3RFH A;  1N6D A;  1VYH C;  2CN3 A;  3UVL A;  3EI1 B;  5TEF A;  3BWS A;  5TDH B;  5CXB B;  2CNX A;  2HYE A;  4FA1 D;  1U4C A;  2CE9 A;  5IJ8 E;  4FWW A;  4A08 B;  4E5Z B;  2XL3 A;  4J77 A;  3AL8 A;  4MK0 B;  4L9O A;  5EM2 B;  5CXC B;  3VGZ A;  5HE3 B;  3DXK C;  3CIK B;  4UI9 R;  3DM0 A;  3SBR A;  3MKS B;  2HES X;  4X63 B;  5H17 A;  4U7A A;  4A08 A;  4L3H D;  4PSW B;  4FAN D;  4ERY A;  4U1E I;  3FM0 A;  5AFU 3;  1PEV A;  5C2W B;  2XU7 A;  4N14 A;  2J56 H;  4J0W A;  3P4F A;  3EI2 A;  4A11 A;  4IMM A;  5EAL A;  4PSX B;  3AH8 B;  2GNQ A;  2AGX A;  4IA9 A;  5HQG A;  5I5M A;  3DSM A;  3SN6 B;  3EI2 B;  3EI4 A;  4ZOY A;  3FGB A;  1B9X A;  4L1Q D;  3OKT A;  2I0T A;  3BG0 A;  5K1C C;  2XL2 A;  4ERZ A;  2IUV A;  4CI8 A;  3RSE C;  3NVQ A;  3W15 A;  3EI4 B;  3NVN A;  3PSC B;  4GGC A;  1XKS A;  2B4E A;  4CY1 A;  4ES0 A;  3SHF A;  3PXS D;  2AH0 A;  5CXC A;  1XIP A;  4OZU A;  2YMU A;  4JSN C;  4D0K A;  1ERJ A;  5A2Q g;  3F3P A;  4J86 A;  4GQ1 A;  2XYI A;  2AGY A;  4D6V A;  4EWR A;  2G99 A;  4PNK B;  4J82 A;  4J78 A;  3MKQ A;  5FKQ A;  5FKT A;  3C9C A;  2OIZ A;  2CO0 C;  3RN0 D;  3A0F A;  3RN1 D;  2HJ4 A;  3V5W B;  3C75 H;  4JSV C;  1Q47 A;  1XHM A;  2AQ5 A;  2HJB A;  2P9N C;  3I7O A;  2H13 A;  1NEX B;  3PVW B;  4O9D A;  5AMS A;  4Y7R A;  2H47 A;  3C99 A;  2H6N A;  2P9P C;  3U4Y A;  1P22 A;  3I89 A;  2OVR B;  3V9F A;  3J81 g;  3UVM A;  2P9S C;  1YFQ A;  4J8G A;  1FWX A;  1N6E A;  4H5I A;  1NR0 A;  2GC7 A;  2YBA A;  3OKW A;  3OL2 A;  1SQJ A;  5KDO B;  3IIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...