4IA9A

Crystal structure of human wd repeat domain 5 in complex with 2-chloro-4-fluoro-3-methyl-n-[2-(4-methylpiperazin-1-yl)-5-nitrophenyl]benzamide
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
305
structure length
305
Chain Sequence
PVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords WD repeat-containing protein 5
publication title Synthesis, Optimization, and Evaluation of Novel Small Molecules as Antagonists of WDR5-MLL Interaction.
pubmed doi rcsb
source organism Homo sapiens
total genus 103
structure length 305
sequence length 305
ec nomenclature
pdb deposition date 2012-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4ia9A00
2IAAA 4CZYA 1OMWB 2W18A 4JSPC 3RMZD 1P22A 3CFVA 2H14A 4BH6A 3VH0A 2OIZA 1K8KC 2XL2A 3RFHA 4A2LA 3SWSD 4X60B 5I5MA 3I89A 3UKUC 4E5ZB 1A0RB 3PE7A 2AH1A 4PSWB 4L1QD 4AOWA 2H9LA 3UVMA 3OW8A 4R7AB 5I5IA 3JROA 3FM0A 3KRXB 5GXHA 4JD2C 3MXXA 5SXMA 4GGDA 3FGBA 4J77A 5CYKB 2IUQA 3UKRC 5GSAA 2HYEA 3JPXA 1B9XA 4E54A 5CXCA 5EMLB 5EM2B 4EWRA 5HE2B 3IIYA 1K32A 2HKRA 3UVLA 2Q7QA 2H47A 1U4CA 5IJ8E 2CN2A 5FKRA 2YMUA 4J73A 4QT8A 2O9KA 3HFQA 4QQEA 4FB1D 2XL3A 5FQDA 3MKSB 4PNKB 5EAPA 5IGOA 1TBGA 5CXBA 2GC4A 4J8BA 2HKMA 4J79A 3L4MD 2HXCA 3J80g 3IJCA 4J87A 4CC9A 4Y7RA 3P4FA 2P9NC 2QC5A 4GGAA 5I5JA 5GMKn 4JT5C 4X61B 3ULEC 1QNIA 5H14A 3SBPA 4PXWA 3FRXA 3I7OA 4GM8A 4L9OA 1S4UX 3L4OD 3PVWB 4FHLA 3VA6A 2AQ5A 3NVXA 3VGZA 1JMXB 5TEFA 2AGLA 1PI6A 5EARA 4J86A 2H13A 3F3PA 3UVNA 4J84A 1NR0A 3OL2A 2B5MA 4E54B 5IC7A 2HJ4A 4K3ID 4GM3A 1PGUA 5CXCB 4J78A 1XHMA 1GG2B 3OKWA 4GGCA 3EI3A 5FKSA 4A2MA 3IJ1A 3F3FA 4O3UB 3C99A 3PXWD 4A0AA 4FA1D 4OZUA 2YNOA 1PEVA 4ES0A 3SN6B 3SFZA 2CE9A 3PXTD 4JSXC 2CN3A 4HDJA 3SXTD 2BCJB 4D0KA 5AJAA 4X63B 2BBKH 4A0BA 4U7AA 3RN0D 2H6KA 4YVDA 1GP2B 4FA4D 3MZLA 2AH0A 3EI2B 4ERQA 4LG9A 4A09A 1RI6A 2Z2PA 4CI3A 2P9LC 1PBYB 4GMBA 4GZ8A 4CY5A 1VYHC 3EI1B 4QRJA 4A7JA 4J8GA 3SCYA 1GXRA 3IIWA 5GXIA 3OL2B 5EMKB 3GREA 4GQ1A 4CY3A 2GC7A 3PXSD 4IA9A 5B4WA 4TZ4A 3RFGA 3EI3B 2P9KC 2OK4A 2H9NA 2Z2NA 4A0AB 4K3JB 3JAMg 3SHFA 3SLED 3CIKB 4D6VA 2B5LA 2QXVA 3I7LA 3U4YA 2H9MA 3DSMA 2HESX 2YB8B 3MKQA 4GQBB 3UR4A 3I7KA 5AFU3 3I2NA 4A09B 3V9FA 1GOTB 4ZOYA 4CI1A 4O1QD 2IWFA 2OVPB 4CY2A 4N14A 3RN1D 2B5NA 3J81g 3ZWLB 3N0DA 3MZKA 2CNXA 3KRWB 3AL8A 3EU7A 3I8CA 3OKYA 4XYHA 4Y5RD 3PVUB 2OJYA 3SBQA 3V5WB 2H6QA 4CY1A 5THAA 4U1EI 2XU7A 3DM0A 4LGNA 4CI2A 5K1CC 1ERJA 4JT6C 5FXYA 3SBRA 4O45A 3I7HA 4QL1A 1YFQA 2I0RA 2YNPA 4BL0A 5FKQA 4GM9A 2YBAA 3PSCB 2J55H 1MG3A 1FWXA 3B7FA 3N0EA 4AEZA 3NVNA 2PBIB 4ZN4A 4PBZA 5HYNB 1JMZB 3EI4A 2I0TA 5FA5B 2PM9A 4J0XA 3JB9L 1L0QA 2H68A 3F3GA 1OLZA 4ZOXA 5H17A 3BWSA 3ORVD 1SHYB 5C2WB 1U2VC 5CXBB 3PSLA 2H3XA 4ERZA 4ESGA 3AL8B 4PBYA 3C5MA 3K27A 2G99A 2CO0A 4ZOZA 3EG6A 1N6DA 3MMYA 4XEIC 4A11A 3W15A 5HE3B 3CFSB 3I7PA 3RLMD 5IGQA 4CZVA 2IUVA 3IJ0A 4A08A 4X3EA 1JJUB 5IJ7E 2J57G 1MG2A 1SQ9A 4BUJC 2B4EA 3GFCA 5EMMB 2I0SA 2MTAH 1N6FA 1XIPA 3EI4B 2PM9B 5TF2A 4XYIA 3I8EA 2H9PA 3V7DB 4UI9R 3EMHA 3C75H 4O9DA 3NVQA 4FAND 4A0BB 4MK0B 4Z8LA 3DXKC 4H5JA 2AGZA 4FA9D 5H1MA 3BG1A 2EBSA 3JZHA 1B9YA 4NSXA 2I3TA 1JOFA 2TRCB 3BG0A 2IWKA 4J81A 3K26A 4PC0A 5EALA 1XKSA 4PSXB 4A11B 3SVWD 5HQGA 4J82A 4CI8A 1SQJA 3AH8B 3I7NA 3C9CA 3UVOA 1MDAH 3DWLC 2OK6A 3JRPA 4OWRA 5K19A 2G9AA 5TEEA 3RSEC 2AGYA 4A08B 5FLXg 3AFCA 4ERYA 3JZNA 2CO0C 3RRMC 4FWWA 5EAMA 3SJLD 4G56B 3EWEA 5A2Qg 2H6NA 3JZGA 2GNQA 3A0FA 2P9IC 4IMMA 5FKTA 2AGXA 4J0WA 2PM7B 2J56H 4L3HD 4JXMA 5IT9g 2PM6B 3EI2A 2UZYB 2P9PC 3EI1A 2P9SC 4ZOVA 2Z2OA 4JSVC 3SMRA 3E0CA 2IUPA 3AL9A 4GQ2P 5TDHB 4JSNC 4E5ZA 3OKTA 2OVRB 4H5IA 2IURA 5JWZA 2CE8A 4CZXA 4FA5D 5KDOB 3IKOA 2P9UC 4KFMB 1N6EA 3UVKA 1R5MA 1TYQC 5C9ZB 2OVQB 1Q47A 4O3TB 2XYIA 3DXMC 4LG8A 5HE0B 3OKYB 2UZXB 5HE1B 1NEXB 4L3GD 4FAVD 5CYKA 2HJBA 2YNNA 5AMSA 2AGWA 2I3SA 5EMJB 5EM2A 5C2VB 3ODTA 4I79A 3OTTA
chains in the Genus database with same CATH superfamily
2IAAA 1H2WA 4CZYA 2HU5A 1JTDB 1OMWB 2W18A 3GD1I 4JSPC 3RMZD 3V4VA 1P22A 4WK0A 3CFVA 2H14A 4BH6A 5M5SA 3VH0A 2OIZA 1K8KC 2XL2A 5E6RA 4BP9A 3RFHA 1E5TA 4A2LA 3SWSD 4X60B 3NIGA 5I5MA 3I89A 3UKUC 4E5ZB 1A0RB 3PE7A 2AH1A 4PSWB 4L1QD 4AOWA 2H9LA 3UVMA 3OW8A 4R7AB 5I5IA 3JROA 3K71A 3FM0A 1UOPA 3KRXB 5GXHA 4JD2C 3MXXA 5SXMA 4GGDA 3FGBA 1E8NA 4J77A 4DNUA 5CYKB 4MMZA 3IURA 2IUQA 3UKRC 5GSAA 3MVDK 4BCDA 1H2ZA 4BCBA 3JPXA 2HYEA 1B9XA 4E54A 5CXCA 5EMLB 5EM2B 4EWRA 5HE2B 3IIYA 1K32A 2HKRA 3UVLA 2Q7QA 2H47A 1U4CA 4IRZA 5IJ8E 2CN2A 5FKRA 2YMUA 3NIFA 4J73A 1M1XA 4QT8A 2O9KA 3HFQA 3FCUA 4QQEA 4FB1D 2XL3A 5FQDA 3MKSB 4PNKB 1E8MA 5EAPA 5IGOA 2JKXA 1TBGA 4AMZA 5CXBA 2GC4A 4J8BA 5M5TA 2HKMA 4BCCA 4J79A 3L4MD 2HXCA 3J80g 3IJCA 4J87A 4CC9A 4Y7RA 3P4FA 4DNVA 2P9NC 2QC5A 4GGAA 5I5JA 1VZ2A 5GMKn 4JT5C 4X61B 3ULEC 1QNIA 4UM9A 5H14A 3SBPA 4PXWA 3FRXA 3I7OA 4GM8A 4L9OA 1S4UX 3L4OD 3PVWB 4FHLA 3VA6A 2AQ5A 3NVXA 3O4HA 3VGZA 1JMXB 3MUOA 5TEFA 2AGLA 1PI6A 5EARA 4J86A 2H13A 3F3PA 3UVNA 1NR0A 4J84A 3OL2A 2B5MA 4E54B 5IC7A 2HJ4A 4K3ID 4GM3A 1PGUA 2EICA 5CXCB 4J78A 1XHMA 1GG2B 3OKWA 4GGCA 3EI3A 5FKSA 4NBMA 2VDOA 4A2MA 3IJ1A 3F3FA 4O3UB 3C99A 3PXWD 4A0AA 4FA1D 4OZUA 2VDLA 2VDMA 2YNOA 1PEVA 4ES0A 3SN6B 3SFZA 2CE9A 3PXTD 2VDNA 4JSXC 2CN3A 4HDJA 3SXTD 3IUMA 2BCJB 4D0KA 5AJAA 4X63B 2BBKH 4A0BA 3IUJA 4U7AA 3RN0D 2H6KA 2VZ3A 3IUNA 4YVDA 3ZE1A 1GP2B 1BPOA 2HU7A 2VDKA 4FA4D 3MZLA 2AH0A 1UOOA 4ERQA 3EI2B 3T3PA 4LG9A 4A09A 1RI6A 2Z2PA 4CI3A 2P9LC 3EQ9A 1H2XA 1PBYB 2VC2A 4GMBA 4NAAA 1I2MB 4GZ8A 4CY5A 1VYHC 3EI1B 4QRJA 4A7JA 4J8GA 4MMYA 3SCYA 1GXRA 3IIWA 3VI3A 1GOHA 1A12A 3DDUA 5GXIA 3OL2B 5EMKB 3GREA 4GQ1A 4CY3A 2GC7A 3PXSD 4IA9A 5B4WA 1C9LA 4TZ4A 3RFGA 3EI3B 2P9KC 2OK4A 2H9NA 2Z2NA 4A0AB 4K3JB 3JAMg 3SHFA 1TYEA 3SLED 3CIKB 4RE6A 4D6VA 2B5LA 2QXVA 3I7LA 4Z7QA 3U4YA 2H9MA 3DSMA 3IJEA 2HESX 2YB8B 3MKQA 4BP8A 1VE6A 4GQBB 3UR4A 2HU8A 3I7KA 5AFU3 3I2NA 2XDWA 4A09B 3MUNA 3V9FA 4Z7NA 1GOTB 4ZOYA 4CI1A 4O1QD 2IWFA 2OVPB 4CY2A 4N14A 3RN1D 3ODTA 2B5NA 3J81g 3ZWLB 1L5GA 4UM8A 5C92A 3N0DA 3MZKA 2CNXA 3KRWB 4O2WA 3AL8A 3EU7A 3I8CA 3OKYA 4DNWA 4XYHA 4Y5RD 5C86A 3K72A 3PVUB 1JV2A 2OJYA 3SBQA 3V5WB 2H6QA 4CY1A 5THAA 4U1EI 2XU7A 3DM0A 4LGNA 4CI2A 5K1CC 4L1MA 1ERJA 4JT6C 5FXYA 1QFMA 4O45A 3SBRA 3I7HA 4QL1A 1UTCA 1YFQA 2I0RA 2YNPA 2VDPA 4BL0A 5FKQA 4GM9A 2YBAA 3O4JA 3PSCB 2J55H 1MG3A 1FWXA 2WQ8A 3B7FA 3N0EA 4AEZA 3NVNA 4AN0A 2PBIB 5M5UA 4ZN4A 3OF7A 4PBZA 2VDQA 3T3MA 2VDRA 1O6GA 5HYNB 1JMZB 3EI4A 2I0TA 5FA5B 2PM9A 4J0XA 3JB9L 1K3IA 1L0QA 2H68A 3F3GA 1OLZA 4ZOXA 5H17A 5E6SA 3ZDZA 3BWSA 1QFSA 3ORVD 1SHYB 5C2WB 2EIDA 1U2VC 1GOGA 5CXBB 3PSLA 2H3XA 4AX4A 4ERZA 4G1MA 5FFOA 4ESGA 3AL8B 4PBYA 3C5MA 1U8CA 3K27A 2G99A 2CO0A 4ZOZA 3ZE0A 3QHYB 3EG6A 1VE7A 1N6DA 3MMYA 3IUQA 4XEIC 3EQ7A 4A11A 4AMYA 3W15A 4WK4A 5HE3B 3CFSB 4NC4A 2QZPA 3I7PA 3RLMD 5IGQA 4CZVA 2IUVA 3IJ0A 4A08A 4X3EA 1JJUB 5IJ7E 2J57G 1MG2A 1SQ9A 3IULA 4BUJC 2B4EA 3GFCA 5EMMB 2I0SA 2MTAH 1N6FA 3K6SA 1XIPA 3EI4B 2PM9B 5TF2A 3ZE2A 3VI4A 4QAMA 4WJKA 3ZDXA 4XYIA 3I8EA 1VZ3A 2H9PA 1GOFA 3V7DB 1O6FA 4UI9R 2VZ1A 1YR2A 3EMHA 3NIDA 3C75H 4O9DA 3NVQA 5FFGA 3O4IA 4FAND 4A0BB 3KCIA 4MK0B 4Z8LA 3DXKC 4G55A 2AGZA 4H5JA 4Z7OA 4FA9D 5H1MA 3BG1A 2EBSA 3JZHA 1B9YA 1UOQA 4NSXA 2I3TA 1JOFA 2TRCB 3BG0A 2IWKA 4J81A 3K26A 4PC0A 4RE5A 5EALA 1XKSA 4PSXB 4A11B 3SVWD 5HQGA 3IVMA 4J82A 4CI8A 1SQJA 3AH8B 3I7NA 3C9CA 3UVOA 1MDAH 3DWLC 2OK6A 4NENA 3JRPA 4OWRA 5K19A 2G9AA 5TEEA 3RSEC 2AGYA 4A08B 5FLXg 3AFCA 4O02A 4ERYA 4AN1A 3JZNA 2CO0C 3RRMC 4FWWA 4G1EA 5EAMA 3SJLD 1C9IA 4WK2A 4G56B 3EWEA 5A2Qg 2H6NA 3JZGA 3V4PA 2GNQA 3A0FA 2P9IC 4IMMA 5FKTA 5M5RA 5M5VA 2AGXA 4J0WA 5E6UA 3ZDYA 2PM7B 1T2XA 2J56H 4L3HD 4JXMA 5IT9g 2PM6B 3EI2A 3FCSA 3QI0A 2UZYB 2P9PC 3EI1A 2P9SC 4JHPC 2EIBA 2Z2OA 4JSVC 4ZOVA 3SMRA 3E0CA 2IUPA 3AL9A 4GQ2P 5TDHB 4JSNC 4E5ZA 3OKTA 2OVRB 4H5IA 2QR5A 2IURA 5JWZA 2CE8A 4CZXA 4FA5D 5KDOB 3IKOA 2P9UC 4KFMB 1N6EA 3UVKA 1R5MA 1TYQC 3GC3B 5C9ZB 4D9SA 2OVQB 1Q47A 4O3TB 2XYIA 3DXMC 4LG8A 5HE0B 3OKYB 2UZXB 5HE1B 1NEXB 4L3GD 4FAVD 2EIEA 5HDBA 3O4GA 5CYKA 2HJBA 2YNNA 5AMSA 4JHNA 2BKLA 1H2YA 2XZGA 2AGWA 3EQ8A 2I3SA 4MMXA 5EMJB 5M61A 5EM2A 5C2VB 2XE4A 4I79A 3OTTA
chains in the Genus database with same CATH topology
2IAAA 4CZYA 1OMWB 2W18A 4JSPC 3RMZD 1P22A 3CFVA 2H14A 4BH6A 3VH0A 2OIZA 1K8KC 2XL2A 3RFHA 4A2LA 3SWSD 4X60B 5I5MA 3I89A 3UKUC 4E5ZB 1A0RB 3PE7A 2AH1A 4PSWB 4L1QD 4AOWA 2H9LA 3UVMA 3OW8A 4R7AB 5I5IA 3JROA 3FM0A 3KRXB 5GXHA 4JD2C 3MXXA 5SXMA 4GGDA 3FGBA 4J77A 5CYKB 2IUQA 3UKRC 5GSAA 2HYEA 3JPXA 1B9XA 4E54A 5CXCA 5EMLB 5EM2B 4EWRA 5HE2B 3IIYA 1K32A 2HKRA 3UVLA 2Q7QA 2H47A 1U4CA 5IJ8E 2CN2A 5FKRA 2YMUA 4J73A 4QT8A 2O9KA 3HFQA 4QQEA 4FB1D 2XL3A 5FQDA 3MKSB 4PNKB 5EAPA 5IGOA 1TBGA 5CXBA 2GC4A 4J8BA 2HKMA 4J79A 3L4MD 2HXCA 3J80g 3IJCA 4J87A 4CC9A 4Y7RA 3P4FA 2P9NC 2QC5A 4GGAA 5I5JA 5GMKn 4JT5C 4X61B 3ULEC 1QNIA 5H14A 3SBPA 4PXWA 3FRXA 3I7OA 4GM8A 4L9OA 1S4UX 3L4OD 3PVWB 4FHLA 3VA6A 2AQ5A 3NVXA 3VGZA 1JMXB 5TEFA 2AGLA 1PI6A 5EARA 4J86A 2H13A 3F3PA 3UVNA 4J84A 1NR0A 3OL2A 2B5MA 4E54B 5IC7A 2HJ4A 4K3ID 4GM3A 1PGUA 5CXCB 4J78A 1XHMA 1GG2B 3OKWA 4GGCA 3EI3A 5FKSA 4A2MA 3IJ1A 3F3FA 4O3UB 3C99A 3PXWD 4A0AA 4FA1D 4OZUA 2YNOA 1PEVA 4ES0A 3SN6B 3SFZA 2CE9A 3PXTD 4JSXC 2CN3A 4HDJA 3SXTD 2BCJB 4D0KA 5AJAA 4X63B 2BBKH 4A0BA 4U7AA 3RN0D 2H6KA 4YVDA 1GP2B 4FA4D 3MZLA 2AH0A 3EI2B 4ERQA 4LG9A 4A09A 1RI6A 2Z2PA 4CI3A 2P9LC 1PBYB 4GMBA 4GZ8A 4CY5A 1VYHC 3EI1B 4QRJA 4A7JA 4J8GA 3SCYA 1GXRA 3IIWA 5GXIA 3OL2B 5EMKB 3GREA 4GQ1A 4CY3A 2GC7A 3PXSD 4IA9A 5B4WA 4TZ4A 3RFGA 3EI3B 2P9KC 2OK4A 2H9NA 2Z2NA 4A0AB 4K3JB 3JAMg 3SHFA 3SLED 3CIKB 4D6VA 2B5LA 2QXVA 3I7LA 3U4YA 2H9MA 3DSMA 2HESX 2YB8B 3MKQA 4GQBB 3UR4A 3I7KA 5AFU3 3I2NA 4A09B 3V9FA 1GOTB 4ZOYA 4CI1A 4O1QD 2IWFA 2OVPB 4CY2A 4N14A 3RN1D 2B5NA 3J81g 3ZWLB 3N0DA 3MZKA 2CNXA 3KRWB 3AL8A 3EU7A 3I8CA 3OKYA 4XYHA 4Y5RD 3PVUB 2OJYA 3SBQA 3V5WB 2H6QA 4CY1A 5THAA 4U1EI 2XU7A 3DM0A 4LGNA 4CI2A 5K1CC 1ERJA 4JT6C 5FXYA 3SBRA 4O45A 3I7HA 4QL1A 1YFQA 2I0RA 2YNPA 4BL0A 5FKQA 4GM9A 2YBAA 3PSCB 2J55H 1MG3A 1FWXA 3B7FA 3N0EA 4AEZA 3NVNA 2PBIB 4ZN4A 4PBZA 5HYNB 1JMZB 3EI4A 2I0TA 5FA5B 2PM9A 4J0XA 3JB9L 1L0QA 2H68A 3F3GA 1OLZA 4ZOXA 5H17A 3BWSA 3ORVD 1SHYB 5C2WB 1U2VC 5CXBB 3PSLA 2H3XA 4ERZA 4ESGA 3AL8B 4PBYA 3C5MA 3K27A 2G99A 2CO0A 4ZOZA 3EG6A 1N6DA 3MMYA 4XEIC 4A11A 3W15A 5HE3B 3CFSB 3I7PA 3RLMD 5IGQA 4CZVA 2IUVA 3IJ0A 4A08A 4X3EA 1JJUB 5IJ7E 2J57G 1MG2A 1SQ9A 4BUJC 2B4EA 3GFCA 5EMMB 2I0SA 2MTAH 1N6FA 1XIPA 3EI4B 2PM9B 5TF2A 4XYIA 3I8EA 2H9PA 3V7DB 4UI9R 3EMHA 3C75H 4O9DA 3NVQA 4FAND 4A0BB 4MK0B 4Z8LA 3DXKC 4H5JA 2AGZA 4FA9D 5H1MA 3BG1A 2EBSA 3JZHA 1B9YA 4NSXA 2I3TA 1JOFA 2TRCB 3BG0A 2IWKA 4J81A 3K26A 4PC0A 5EALA 1XKSA 4PSXB 4A11B 3SVWD 5HQGA 4J82A 4CI8A 1SQJA 3AH8B 3I7NA 3C9CA 3UVOA 1MDAH 3DWLC 2OK6A 3JRPA 4OWRA 5K19A 2G9AA 5TEEA 3RSEC 2AGYA 4A08B 5FLXg 3AFCA 4ERYA 3JZNA 2CO0C 3RRMC 4FWWA 5EAMA 3SJLD 4G56B 3EWEA 5A2Qg 2H6NA 3JZGA 2GNQA 3A0FA 2P9IC 4IMMA 5FKTA 2AGXA 4J0WA 2PM7B 2J56H 4L3HD 4JXMA 5IT9g 2PM6B 3EI2A 2UZYB 2P9PC 3EI1A 2P9SC 4ZOVA 2Z2OA 4JSVC 3SMRA 3E0CA 2IUPA 3AL9A 4GQ2P 5TDHB 4JSNC 4E5ZA 3OKTA 2OVRB 4H5IA 2IURA 5JWZA 2CE8A 4CZXA 4FA5D 5KDOB 3IKOA 2P9UC 4KFMB 1N6EA 3UVKA 1R5MA 1TYQC 5C9ZB 2OVQB 1Q47A 4O3TB 2XYIA 3DXMC 4LG8A 5HE0B 3OKYB 2UZXB 5HE1B 1NEXB 4L3GD 4FAVD 5CYKA 2HJBA 2YNNA 5AMSA 2AGWA 2I3SA 5EMJB 5EM2A 5C2VB 3ODTA 4I79A 3OTTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IAA A;  4CZY A;  1OMW B;  2W18 A;  4JSP C;  3RMZ D;  1P22 A;  3CFV A;  2H14 A;  4BH6 A;  3VH0 A;  2OIZ A;  1K8K C;  2XL2 A;  3RFH A;  4A2L A;  3SWS D;  4X60 B;  5I5M A;  3I89 A;  3UKU C;  4E5Z B;  1A0R B;  3PE7 A;  2AH1 A;  4PSW B;  4L1Q D;  4AOW A;  2H9L A;  3UVM A;  3OW8 A;  4R7A B;  5I5I A;  3JRO A;  3FM0 A;  3KRX B;  5GXH A;  4JD2 C;  3MXX A;  5SXM A;  4GGD A;  3FGB A;  4J77 A;  5CYK B;  2IUQ A;  3UKR C;  5GSA A;  2HYE A;  3JPX A;  1B9X A;  4E54 A;  5CXC A;  5EML B;  5EM2 B;  4EWR A;  5HE2 B;  3IIY A;  1K32 A;  2HKR A;  3UVL A;  2Q7Q A;  2H47 A;  1U4C A;  5IJ8 E;  2CN2 A;  5FKR A;  2YMU A;  4J73 A;  4QT8 A;  2O9K A;  3HFQ A;  4QQE A;  4FB1 D;  2XL3 A;  5FQD A;  3MKS B;  4PNK B;  5EAP A;  5IGO A;  1TBG A;  5CXB A;  2GC4 A;  4J8B A;  2HKM A;  4J79 A;  3L4M D;  2HXC A;  3J80 g;  3IJC A;  4J87 A;  4CC9 A;  4Y7R A;  3P4F A;  2P9N C;  2QC5 A;  4GGA A;  5I5J A;  5GMK n;  4JT5 C;  4X61 B;  3ULE C;  1QNI A;  5H14 A;  3SBP A;  4PXW A;  3FRX A;  3I7O A;  4GM8 A;  4L9O A;  1S4U X;  3L4O D;  3PVW B;  4FHL A;  3VA6 A;  2AQ5 A;  3NVX A;  3VGZ A;  1JMX B;  5TEF A;  2AGL A;  1PI6 A;  5EAR A;  4J86 A;  2H13 A;  3F3P A;  3UVN A;  4J84 A;  1NR0 A;  3OL2 A;  2B5M A;  4E54 B;  5IC7 A;  2HJ4 A;  4K3I D;  4GM3 A;  1PGU A;  5CXC B;  4J78 A;  1XHM A;  1GG2 B;  3OKW A;  4GGC A;  3EI3 A;  5FKS A;  4A2M A;  3IJ1 A;  3F3F A;  4O3U B;  3C99 A;  3PXW D;  4A0A A;  4FA1 D;  4OZU A;  2YNO A;  1PEV A;  4ES0 A;  3SN6 B;  3SFZ A;  2CE9 A;  3PXT D;  4JSX C;  2CN3 A;  4HDJ A;  3SXT D;  2BCJ B;  4D0K A;  5AJA A;  4X63 B;  2BBK H;  4A0B A;  4U7A A;  3RN0 D;  2H6K A;  4YVD A;  1GP2 B;  4FA4 D;  3MZL A;  2AH0 A;  3EI2 B;  4ERQ A;  4LG9 A;  4A09 A;  1RI6 A;  2Z2P A;  4CI3 A;  2P9L C;  1PBY B;  4GMB A;  4GZ8 A;  4CY5 A;  1VYH C;  3EI1 B;  4QRJ A;  4A7J A;  4J8G A;  3SCY A;  1GXR A;  3IIW A;  5GXI A;  3OL2 B;  5EMK B;  3GRE A;  4GQ1 A;  4CY3 A;  2GC7 A;  3PXS D;  4IA9 A;  5B4W A;  4TZ4 A;  3RFG A;  3EI3 B;  2P9K C;  2OK4 A;  2H9N A;  2Z2N A;  4A0A B;  4K3J B;  3JAM g;  3SHF A;  3SLE D;  3CIK B;  4D6V A;  2B5L A;  2QXV A;  3I7L A;  3U4Y A;  2H9M A;  3DSM A;  2HES X;  2YB8 B;  3MKQ A;  4GQB B;  3UR4 A;  3I7K A;  5AFU 3;  3I2N A;  4A09 B;  3V9F A;  1GOT B;  4ZOY A;  4CI1 A;  4O1Q D;  2IWF A;  2OVP B;  4CY2 A;  4N14 A;  3RN1 D;  2B5N A;  3J81 g;  3ZWL B;  3N0D A;  3MZK A;  2CNX A;  3KRW B;  3AL8 A;  3EU7 A;  3I8C A;  3OKY A;  4XYH A;  4Y5R D;  3PVU B;  2OJY A;  3SBQ A;  3V5W B;  2H6Q A;  4CY1 A;  5THA A;  4U1E I;  2XU7 A;  3DM0 A;  4LGN A;  4CI2 A;  5K1C C;  1ERJ A;  4JT6 C;  5FXY A;  3SBR A;  4O45 A;  3I7H A;  4QL1 A;  1YFQ A;  2I0R A;  2YNP A;  4BL0 A;  5FKQ A;  4GM9 A;  2YBA A;  3PSC B;  2J55 H;  1MG3 A;  1FWX A;  3B7F A;  3N0E A;  4AEZ A;  3NVN A;  2PBI B;  4ZN4 A;  4PBZ A;  5HYN B;  1JMZ B;  3EI4 A;  2I0T A;  5FA5 B;  2PM9 A;  4J0X A;  3JB9 L;  1L0Q A;  2H68 A;  3F3G A;  1OLZ A;  4ZOX A;  5H17 A;  3BWS A;  3ORV D;  1SHY B;  5C2W B;  1U2V C;  5CXB B;  3PSL A;  2H3X A;  4ERZ A;  4ESG A;  3AL8 B;  4PBY A;  3C5M A;  3K27 A;  2G99 A;  2CO0 A;  4ZOZ A;  3EG6 A;  1N6D A;  3MMY A;  4XEI C;  4A11 A;  3W15 A;  5HE3 B;  3CFS B;  3I7P A;  3RLM D;  5IGQ A;  4CZV A;  2IUV A;  3IJ0 A;  4A08 A;  4X3E A;  1JJU B;  5IJ7 E;  2J57 G;  1MG2 A;  1SQ9 A;  4BUJ C;  2B4E A;  3GFC A;  5EMM B;  2I0S A;  2MTA H;  1N6F A;  1XIP A;  3EI4 B;  2PM9 B;  5TF2 A;  4XYI A;  3I8E A;  2H9P A;  3V7D B;  4UI9 R;  3EMH A;  3C75 H;  4O9D A;  3NVQ A;  4FAN D;  4A0B B;  4MK0 B;  4Z8L A;  3DXK C;  4H5J A;  2AGZ A;  4FA9 D;  5H1M A;  3BG1 A;  2EBS A;  3JZH A;  1B9Y A;  4NSX A;  2I3T A;  1JOF A;  2TRC B;  3BG0 A;  2IWK A;  4J81 A;  3K26 A;  4PC0 A;  5EAL A;  1XKS A;  4PSX B;  4A11 B;  3SVW D;  5HQG A;  4J82 A;  4CI8 A;  1SQJ A;  3AH8 B;  3I7N A;  3C9C A;  3UVO A;  1MDA H;  3DWL C;  2OK6 A;  3JRP A;  4OWR A;  5K19 A;  2G9A A;  5TEE A;  3RSE C;  2AGY A;  4A08 B;  5FLX g;  3AFC A;  4ERY A;  3JZN A;  2CO0 C;  3RRM C;  4FWW A;  5EAM A;  3SJL D;  4G56 B;  3EWE A;  5A2Q g;  2H6N A;  3JZG A;  2GNQ A;  3A0F A;  2P9I C;  4IMM A;  5FKT A;  2AGX A;  4J0W A;  2PM7 B;  2J56 H;  4L3H D;  4JXM A;  5IT9 g;  2PM6 B;  3EI2 A;  2UZY B;  2P9P C;  3EI1 A;  2P9S C;  4ZOV A;  2Z2O A;  4JSV C;  3SMR A;  3E0C A;  2IUP A;  3AL9 A;  4GQ2 P;  5TDH B;  4JSN C;  4E5Z A;  3OKT A;  2OVR B;  4H5I A;  2IUR A;  5JWZ A;  2CE8 A;  4CZX A;  4FA5 D;  5KDO B;  3IKO A;  2P9U C;  4KFM B;  1N6E A;  3UVK A;  1R5M A;  1TYQ C;  5C9Z B;  2OVQ B;  1Q47 A;  4O3T B;  2XYI A;  3DXM C;  4LG8 A;  5HE0 B;  3OKY B;  2UZX B;  5HE1 B;  1NEX B;  4L3G D;  4FAV D;  5CYK A;  2HJB A;  2YNN A;  5AMS A;  2AGW A;  2I3S A;  5EMJ B;  5EM2 A;  5C2V B;  3ODT A;  4I79 A;  3OTT A; 
#chains in the Genus database with same CATH topology
 2IAA A;  1H2W A;  4CZY A;  2HU5 A;  1JTD B;  1OMW B;  2W18 A;  3GD1 I;  4JSP C;  3RMZ D;  3V4V A;  1P22 A;  4WK0 A;  3CFV A;  2H14 A;  4BH6 A;  5M5S A;  3VH0 A;  2OIZ A;  1K8K C;  2XL2 A;  5E6R A;  4BP9 A;  3RFH A;  1E5T A;  4A2L A;  3SWS D;  4X60 B;  3NIG A;  5I5M A;  3I89 A;  3UKU C;  4E5Z B;  1A0R B;  3PE7 A;  2AH1 A;  4PSW B;  4L1Q D;  4AOW A;  2H9L A;  3UVM A;  3OW8 A;  4R7A B;  5I5I A;  3JRO A;  3K71 A;  3FM0 A;  1UOP A;  3KRX B;  5GXH A;  4JD2 C;  3MXX A;  5SXM A;  4GGD A;  3FGB A;  1E8N A;  4J77 A;  4DNU A;  5CYK B;  4MMZ A;  3IUR A;  2IUQ A;  3UKR C;  5GSA A;  3MVD K;  4BCD A;  1H2Z A;  4BCB A;  3JPX A;  2HYE A;  1B9X A;  4E54 A;  5CXC A;  5EML B;  5EM2 B;  4EWR A;  5HE2 B;  3IIY A;  1K32 A;  2HKR A;  3UVL A;  2Q7Q A;  2H47 A;  1U4C A;  4IRZ A;  5IJ8 E;  2CN2 A;  5FKR A;  2YMU A;  3NIF A;  4J73 A;  1M1X A;  4QT8 A;  2O9K A;  3HFQ A;  3FCU A;  4QQE A;  4FB1 D;  2XL3 A;  5FQD A;  3MKS B;  4PNK B;  1E8M A;  5EAP A;  5IGO A;  2JKX A;  1TBG A;  4AMZ A;  5CXB A;  2GC4 A;  4J8B A;  5M5T A;  2HKM A;  4BCC A;  4J79 A;  3L4M D;  2HXC A;  3J80 g;  3IJC A;  4J87 A;  4CC9 A;  4Y7R A;  3P4F A;  4DNV A;  2P9N C;  2QC5 A;  4GGA A;  5I5J A;  1VZ2 A;  5GMK n;  4JT5 C;  4X61 B;  3ULE C;  1QNI A;  4UM9 A;  5H14 A;  3SBP A;  4PXW A;  3FRX A;  3I7O A;  4GM8 A;  4L9O A;  1S4U X;  3L4O D;  3PVW B;  4FHL A;  3VA6 A;  2AQ5 A;  3NVX A;  3O4H A;  3VGZ A;  1JMX B;  3MUO A;  5TEF A;  2AGL A;  1PI6 A;  5EAR A;  4J86 A;  2H13 A;  3F3P A;  3UVN A;  1NR0 A;  4J84 A;  3OL2 A;  2B5M A;  4E54 B;  5IC7 A;  2HJ4 A;  4K3I D;  4GM3 A;  1PGU A;  2EIC A;  5CXC B;  4J78 A;  1XHM A;  1GG2 B;  3OKW A;  4GGC A;  3EI3 A;  5FKS A;  4NBM A;  2VDO A;  4A2M A;  3IJ1 A;  3F3F A;  4O3U B;  3C99 A;  3PXW D;  4A0A A;  4FA1 D;  4OZU A;  2VDL A;  2VDM A;  2YNO A;  1PEV A;  4ES0 A;  3SN6 B;  3SFZ A;  2CE9 A;  3PXT D;  2VDN A;  4JSX C;  2CN3 A;  4HDJ A;  3SXT D;  3IUM A;  2BCJ B;  4D0K A;  5AJA A;  4X63 B;  2BBK H;  4A0B A;  3IUJ A;  4U7A A;  3RN0 D;  2H6K A;  2VZ3 A;  3IUN A;  4YVD A;  3ZE1 A;  1GP2 B;  1BPO A;  2HU7 A;  2VDK A;  4FA4 D;  3MZL A;  2AH0 A;  1UOO A;  4ERQ A;  3EI2 B;  3T3P A;  4LG9 A;  4A09 A;  1RI6 A;  2Z2P A;  4CI3 A;  2P9L C;  3EQ9 A;  1H2X A;  1PBY B;  2VC2 A;  4GMB A;  4NAA A;  1I2M B;  4GZ8 A;  4CY5 A;  1VYH C;  3EI1 B;  4QRJ A;  4A7J A;  4J8G A;  4MMY A;  3SCY A;  1GXR A;  3IIW A;  3VI3 A;  1GOH A;  1A12 A;  3DDU A;  5GXI A;  3OL2 B;  5EMK B;  3GRE A;  4GQ1 A;  4CY3 A;  2GC7 A;  3PXS D;  4IA9 A;  5B4W A;  1C9L A;  4TZ4 A;  3RFG A;  3EI3 B;  2P9K C;  2OK4 A;  2H9N A;  2Z2N A;  4A0A B;  4K3J B;  3JAM g;  3SHF A;  1TYE A;  3SLE D;  3CIK B;  4RE6 A;  4D6V A;  2B5L A;  2QXV A;  3I7L A;  4Z7Q A;  3U4Y A;  2H9M A;  3DSM A;  3IJE A;  2HES X;  2YB8 B;  3MKQ A;  4BP8 A;  1VE6 A;  4GQB B;  3UR4 A;  2HU8 A;  3I7K A;  5AFU 3;  3I2N A;  2XDW A;  4A09 B;  3MUN A;  3V9F A;  4Z7N A;  1GOT B;  4ZOY A;  4CI1 A;  4O1Q D;  2IWF A;  2OVP B;  4CY2 A;  4N14 A;  3RN1 D;  3ODT A;  2B5N A;  3J81 g;  3ZWL B;  1L5G A;  4UM8 A;  5C92 A;  3N0D A;  3MZK A;  2CNX A;  3KRW B;  4O2W A;  3AL8 A;  3EU7 A;  3I8C A;  3OKY A;  4DNW A;  4XYH A;  4Y5R D;  5C86 A;  3K72 A;  3PVU B;  1JV2 A;  2OJY A;  3SBQ A;  3V5W B;  2H6Q A;  4CY1 A;  5THA A;  4U1E I;  2XU7 A;  3DM0 A;  4LGN A;  4CI2 A;  5K1C C;  4L1M A;  1ERJ A;  4JT6 C;  5FXY A;  1QFM A;  4O45 A;  3SBR A;  3I7H A;  4QL1 A;  1UTC A;  1YFQ A;  2I0R A;  2YNP A;  2VDP A;  4BL0 A;  5FKQ A;  4GM9 A;  2YBA A;  3O4J A;  3PSC B;  2J55 H;  1MG3 A;  1FWX A;  2WQ8 A;  3B7F A;  3N0E A;  4AEZ A;  3NVN A;  4AN0 A;  2PBI B;  5M5U A;  4ZN4 A;  3OF7 A;  4PBZ A;  2VDQ A;  3T3M A;  2VDR A;  1O6G A;  5HYN B;  1JMZ B;  3EI4 A;  2I0T A;  5FA5 B;  2PM9 A;  4J0X A;  3JB9 L;  1K3I A;  1L0Q A;  2H68 A;  3F3G A;  1OLZ A;  4ZOX A;  5H17 A;  5E6S A;  3ZDZ A;  3BWS A;  1QFS A;  3ORV D;  1SHY B;  5C2W B;  2EID A;  1U2V C;  1GOG A;  5CXB B;  3PSL A;  2H3X A;  4AX4 A;  4ERZ A;  4G1M A;  5FFO A;  4ESG A;  3AL8 B;  4PBY A;  3C5M A;  1U8C A;  3K27 A;  2G99 A;  2CO0 A;  4ZOZ A;  3ZE0 A;  3QHY B;  3EG6 A;  1VE7 A;  1N6D A;  3MMY A;  3IUQ A;  4XEI C;  3EQ7 A;  4A11 A;  4AMY A;  3W15 A;  4WK4 A;  5HE3 B;  3CFS B;  4NC4 A;  2QZP A;  3I7P A;  3RLM D;  5IGQ A;  4CZV A;  2IUV A;  3IJ0 A;  4A08 A;  4X3E A;  1JJU B;  5IJ7 E;  2J57 G;  1MG2 A;  1SQ9 A;  3IUL A;  4BUJ C;  2B4E A;  3GFC A;  5EMM B;  2I0S A;  2MTA H;  1N6F A;  3K6S A;  1XIP A;  3EI4 B;  2PM9 B;  5TF2 A;  3ZE2 A;  3VI4 A;  4QAM A;  4WJK A;  3ZDX A;  4XYI A;  3I8E A;  1VZ3 A;  2H9P A;  1GOF A;  3V7D B;  1O6F A;  4UI9 R;  2VZ1 A;  1YR2 A;  3EMH A;  3NID A;  3C75 H;  4O9D A;  3NVQ A;  5FFG A;  3O4I A;  4FAN D;  4A0B B;  3KCI A;  4MK0 B;  4Z8L A;  3DXK C;  4G55 A;  2AGZ A;  4H5J A;  4Z7O A;  4FA9 D;  5H1M A;  3BG1 A;  2EBS A;  3JZH A;  1B9Y A;  1UOQ A;  4NSX A;  2I3T A;  1JOF A;  2TRC B;  3BG0 A;  2IWK A;  4J81 A;  3K26 A;  4PC0 A;  4RE5 A;  5EAL A;  1XKS A;  4PSX B;  4A11 B;  3SVW D;  5HQG A;  3IVM A;  4J82 A;  4CI8 A;  1SQJ A;  3AH8 B;  3I7N A;  3C9C A;  3UVO A;  1MDA H;  3DWL C;  2OK6 A;  4NEN A;  3JRP A;  4OWR A;  5K19 A;  2G9A A;  5TEE A;  3RSE C;  2AGY A;  4A08 B;  5FLX g;  3AFC A;  4O02 A;  4ERY A;  4AN1 A;  3JZN A;  2CO0 C;  3RRM C;  4FWW A;  4G1E A;  5EAM A;  3SJL D;  1C9I A;  4WK2 A;  4G56 B;  3EWE A;  5A2Q g;  2H6N A;  3JZG A;  3V4P A;  2GNQ A;  3A0F A;  2P9I C;  4IMM A;  5FKT A;  5M5R A;  5M5V A;  2AGX A;  4J0W A;  5E6U A;  3ZDY A;  2PM7 B;  1T2X A;  2J56 H;  4L3H D;  4JXM A;  5IT9 g;  2PM6 B;  3EI2 A;  3FCS A;  3QI0 A;  2UZY B;  2P9P C;  3EI1 A;  2P9S C;  4JHP C;  2EIB A;  2Z2O A;  4JSV C;  4ZOV A;  3SMR A;  3E0C A;  2IUP A;  3AL9 A;  4GQ2 P;  5TDH B;  4JSN C;  4E5Z A;  3OKT A;  2OVR B;  4H5I A;  2QR5 A;  2IUR A;  5JWZ A;  2CE8 A;  4CZX A;  4FA5 D;  5KDO B;  3IKO A;  2P9U C;  4KFM B;  1N6E A;  3UVK A;  1R5M A;  1TYQ C;  3GC3 B;  5C9Z B;  4D9S A;  2OVQ B;  1Q47 A;  4O3T B;  2XYI A;  3DXM C;  4LG8 A;  5HE0 B;  3OKY B;  2UZX B;  5HE1 B;  1NEX B;  4L3G D;  4FAV D;  2EIE A;  5HDB A;  3O4G A;  5CYK A;  2HJB A;  2YNN A;  5AMS A;  4JHN A;  2BKL A;  1H2Y A;  2XZG A;  2AGW A;  3EQ8 A;  2I3S A;  4MMX A;  5EMJ B;  5M61 A;  5EM2 A;  5C2V B;  2XE4 A;  4I79 A;  3OTT A; 
#chains in the Genus database with same CATH homology
 2IAA A;  4CZY A;  1OMW B;  2W18 A;  4JSP C;  3RMZ D;  1P22 A;  3CFV A;  2H14 A;  4BH6 A;  3VH0 A;  2OIZ A;  1K8K C;  2XL2 A;  3RFH A;  4A2L A;  3SWS D;  4X60 B;  5I5M A;  3I89 A;  3UKU C;  4E5Z B;  1A0R B;  3PE7 A;  2AH1 A;  4PSW B;  4L1Q D;  4AOW A;  2H9L A;  3UVM A;  3OW8 A;  4R7A B;  5I5I A;  3JRO A;  3FM0 A;  3KRX B;  5GXH A;  4JD2 C;  3MXX A;  5SXM A;  4GGD A;  3FGB A;  4J77 A;  5CYK B;  2IUQ A;  3UKR C;  5GSA A;  2HYE A;  3JPX A;  1B9X A;  4E54 A;  5CXC A;  5EML B;  5EM2 B;  4EWR A;  5HE2 B;  3IIY A;  1K32 A;  2HKR A;  3UVL A;  2Q7Q A;  2H47 A;  1U4C A;  5IJ8 E;  2CN2 A;  5FKR A;  2YMU A;  4J73 A;  4QT8 A;  2O9K A;  3HFQ A;  4QQE A;  4FB1 D;  2XL3 A;  5FQD A;  3MKS B;  4PNK B;  5EAP A;  5IGO A;  1TBG A;  5CXB A;  2GC4 A;  4J8B A;  2HKM A;  4J79 A;  3L4M D;  2HXC A;  3J80 g;  3IJC A;  4J87 A;  4CC9 A;  4Y7R A;  3P4F A;  2P9N C;  2QC5 A;  4GGA A;  5I5J A;  5GMK n;  4JT5 C;  4X61 B;  3ULE C;  1QNI A;  5H14 A;  3SBP A;  4PXW A;  3FRX A;  3I7O A;  4GM8 A;  4L9O A;  1S4U X;  3L4O D;  3PVW B;  4FHL A;  3VA6 A;  2AQ5 A;  3NVX A;  3VGZ A;  1JMX B;  5TEF A;  2AGL A;  1PI6 A;  5EAR A;  4J86 A;  2H13 A;  3F3P A;  3UVN A;  4J84 A;  1NR0 A;  3OL2 A;  2B5M A;  4E54 B;  5IC7 A;  2HJ4 A;  4K3I D;  4GM3 A;  1PGU A;  5CXC B;  4J78 A;  1XHM A;  1GG2 B;  3OKW A;  4GGC A;  3EI3 A;  5FKS A;  4A2M A;  3IJ1 A;  3F3F A;  4O3U B;  3C99 A;  3PXW D;  4A0A A;  4FA1 D;  4OZU A;  2YNO A;  1PEV A;  4ES0 A;  3SN6 B;  3SFZ A;  2CE9 A;  3PXT D;  4JSX C;  2CN3 A;  4HDJ A;  3SXT D;  2BCJ B;  4D0K A;  5AJA A;  4X63 B;  2BBK H;  4A0B A;  4U7A A;  3RN0 D;  2H6K A;  4YVD A;  1GP2 B;  4FA4 D;  3MZL A;  2AH0 A;  3EI2 B;  4ERQ A;  4LG9 A;  4A09 A;  1RI6 A;  2Z2P A;  4CI3 A;  2P9L C;  1PBY B;  4GMB A;  4GZ8 A;  4CY5 A;  1VYH C;  3EI1 B;  4QRJ A;  4A7J A;  4J8G A;  3SCY A;  1GXR A;  3IIW A;  5GXI A;  3OL2 B;  5EMK B;  3GRE A;  4GQ1 A;  4CY3 A;  2GC7 A;  3PXS D;  4IA9 A;  5B4W A;  4TZ4 A;  3RFG A;  3EI3 B;  2P9K C;  2OK4 A;  2H9N A;  2Z2N A;  4A0A B;  4K3J B;  3JAM g;  3SHF A;  3SLE D;  3CIK B;  4D6V A;  2B5L A;  2QXV A;  3I7L A;  3U4Y A;  2H9M A;  3DSM A;  2HES X;  2YB8 B;  3MKQ A;  4GQB B;  3UR4 A;  3I7K A;  5AFU 3;  3I2N A;  4A09 B;  3V9F A;  1GOT B;  4ZOY A;  4CI1 A;  4O1Q D;  2IWF A;  2OVP B;  4CY2 A;  4N14 A;  3RN1 D;  2B5N A;  3J81 g;  3ZWL B;  3N0D A;  3MZK A;  2CNX A;  3KRW B;  3AL8 A;  3EU7 A;  3I8C A;  3OKY A;  4XYH A;  4Y5R D;  3PVU B;  2OJY A;  3SBQ A;  3V5W B;  2H6Q A;  4CY1 A;  5THA A;  4U1E I;  2XU7 A;  3DM0 A;  4LGN A;  4CI2 A;  5K1C C;  1ERJ A;  4JT6 C;  5FXY A;  3SBR A;  4O45 A;  3I7H A;  4QL1 A;  1YFQ A;  2I0R A;  2YNP A;  4BL0 A;  5FKQ A;  4GM9 A;  2YBA A;  3PSC B;  2J55 H;  1MG3 A;  1FWX A;  3B7F A;  3N0E A;  4AEZ A;  3NVN A;  2PBI B;  4ZN4 A;  4PBZ A;  5HYN B;  1JMZ B;  3EI4 A;  2I0T A;  5FA5 B;  2PM9 A;  4J0X A;  3JB9 L;  1L0Q A;  2H68 A;  3F3G A;  1OLZ A;  4ZOX A;  5H17 A;  3BWS A;  3ORV D;  1SHY B;  5C2W B;  1U2V C;  5CXB B;  3PSL A;  2H3X A;  4ERZ A;  4ESG A;  3AL8 B;  4PBY A;  3C5M A;  3K27 A;  2G99 A;  2CO0 A;  4ZOZ A;  3EG6 A;  1N6D A;  3MMY A;  4XEI C;  4A11 A;  3W15 A;  5HE3 B;  3CFS B;  3I7P A;  3RLM D;  5IGQ A;  4CZV A;  2IUV A;  3IJ0 A;  4A08 A;  4X3E A;  1JJU B;  5IJ7 E;  2J57 G;  1MG2 A;  1SQ9 A;  4BUJ C;  2B4E A;  3GFC A;  5EMM B;  2I0S A;  2MTA H;  1N6F A;  1XIP A;  3EI4 B;  2PM9 B;  5TF2 A;  4XYI A;  3I8E A;  2H9P A;  3V7D B;  4UI9 R;  3EMH A;  3C75 H;  4O9D A;  3NVQ A;  4FAN D;  4A0B B;  4MK0 B;  4Z8L A;  3DXK C;  4H5J A;  2AGZ A;  4FA9 D;  5H1M A;  3BG1 A;  2EBS A;  3JZH A;  1B9Y A;  4NSX A;  2I3T A;  1JOF A;  2TRC B;  3BG0 A;  2IWK A;  4J81 A;  3K26 A;  4PC0 A;  5EAL A;  1XKS A;  4PSX B;  4A11 B;  3SVW D;  5HQG A;  4J82 A;  4CI8 A;  1SQJ A;  3AH8 B;  3I7N A;  3C9C A;  3UVO A;  1MDA H;  3DWL C;  2OK6 A;  3JRP A;  4OWR A;  5K19 A;  2G9A A;  5TEE A;  3RSE C;  2AGY A;  4A08 B;  5FLX g;  3AFC A;  4ERY A;  3JZN A;  2CO0 C;  3RRM C;  4FWW A;  5EAM A;  3SJL D;  4G56 B;  3EWE A;  5A2Q g;  2H6N A;  3JZG A;  2GNQ A;  3A0F A;  2P9I C;  4IMM A;  5FKT A;  2AGX A;  4J0W A;  2PM7 B;  2J56 H;  4L3H D;  4JXM A;  5IT9 g;  2PM6 B;  3EI2 A;  2UZY B;  2P9P C;  3EI1 A;  2P9S C;  4ZOV A;  2Z2O A;  4JSV C;  3SMR A;  3E0C A;  2IUP A;  3AL9 A;  4GQ2 P;  5TDH B;  4JSN C;  4E5Z A;  3OKT A;  2OVR B;  4H5I A;  2IUR A;  5JWZ A;  2CE8 A;  4CZX A;  4FA5 D;  5KDO B;  3IKO A;  2P9U C;  4KFM B;  1N6E A;  3UVK A;  1R5M A;  1TYQ C;  5C9Z B;  2OVQ B;  1Q47 A;  4O3T B;  2XYI A;  3DXM C;  4LG8 A;  5HE0 B;  3OKY B;  2UZX B;  5HE1 B;  1NEX B;  4L3G D;  4FAV D;  5CYK A;  2HJB A;  2YNN A;  5AMS A;  2AGW A;  2I3S A;  5EMJ B;  5EM2 A;  5C2V B;  3ODT A;  4I79 A;  3OTT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...