4QL1A

Crystal structure of human wdr5 in complex with compound oicr-9429
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title Pharmacological targeting of the Wdr5-MLL interaction in C/EBP alpha N-terminal leukemia.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/inhibitor
total genus 107
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4ql1A00
3L4OD 5JWZA 2YMUA 3I7OA 4QT8A 4IMMA 5I5MA 2AGLA 1XKSA 4A0AB 4JT5C 2HKMA 2PM7B 2H9LA 5FKRA 5I5IA 5B4WA 4E54B 1NEXB 2HKRA 4QQEA 3C9CA 3PXSD 3SN6B 2P9IC 3N0EA 3I2NA 3DSMA 3ULEC 3GFCA 2CN3A 4N14A 3FRXA 3OTTA 4CI8A 3UVMA 3JAMg 1MG3A 3SLED 5H17A 5HYNB 3JRPA 1RI6A 4JD2C 4E5ZA 1K8KC 5CXBB 5EALA 2I3TA 4FA1D 4BL0A 3K26A 2Q7QA 3JZGA 1NR0A 3SWSD 3IJ1A 1GG2B 3NVQA 4J78A 3CIKB 4CY3A 3N0DA 3RSEC 4L9OA 1ERJA 2P9NC 4A0AA 4A7JA 3AH8B 2IWFA 3I7HA 2YBAA 4E54A 4K3ID 1SHYB 2P9PC 4ZN4A 2XL2A 3I7LA 2XYIA 4NSXA 4JXMA 4UI9R 4LGNA 2YNNA 5IC7A 3UVKA 2HJBA 3VH0A 4CZYA 4R7AB 4PBZA 3EI1B 2XL3A 3OW8A 4GM8A 3MZLA 3PVUB 5EMMB 1U4CA 4GGCA 4H5JA 2P9LC 3DXKC 5K19A 4A09B 2AH1A 3DXMC 1XHMA 5FKSA 3MKSB 3SMRA 4A08B 2H13A 1JMXB 5FQDA 5CYKB 1N6FA 3BG0A 2PBIB 4L3HD 4L1QD 3DWLC 2QXVA 1TYQC 2CE9A 5C2VB 4ZOXA 3C5MA 4J86A 5H1MA 1A0RB 1Q47A 3OKYB 4GGDA 2Z2OA 3I7KA 5GSAA 4ES0A 4QRJA 4FHLA 2I0RA 4JT6C 2QC5A 2AGZA 4GQBB 3PSCB 5IGQA 2H6KA 2IUQA 4YVDA 5AJAA 3SJLD 2GC4A 4GZ8A 3SBRA 4A09A 2CE8A 1P22A 2OK6A 4CI1A 2OVRB 2PM9B 3AL8B 4A08A 2YB8B 3JZNA 3ZWLB 2P9KC 4J81A 1XIPA 3B7FA 4O45A 3JB9L 4FB1D 4CI2A 4FAVD 2H3XA 3FM0A 4XEIC 5CYKA 3K27A 4J87A 1PEVA 5EAMA 3F3FA 2YNOA 3EI2A 4I79A 4JSNC 1B9XA 4IA9A 3UVNA 3A0FA 4TZ4A 3EI3B 1N6EA 3F3PA 5GXHA 3RN1D 1GXRA 4GQ1A 5H14A 2IWKA 4U7AA 3IKOA 4PNKB 2AGWA 4AOWA 3HFQA 5EM2B 3SBQA 3SVWD 2IURA 3FGBA 2CO0A 3VA6A 4CI3A 4FWWA 3RMZD 4XYHA 5CXCB 4ERZA 3UKUC 3RRMC 2TRCB 5I5JA 3SBPA 4CZXA 4GGAA 3SFZA 4JSPC 3KRWB 5TF2A 2G9AA 2GC7A 3AL8A 4ERYA 4O1QD 2B4EA 2OVPB 4X61B 4GQ2P 3CFVA 4O9DA 2IAAA 2H68A 2I0SA 3PXWD 3BG1A 5HE1B 4H5IA 1L0QA 1S4UX 4AEZA 2H9PA 4PXWA 3UR4A 5C2WB 3OL2B 1GP2B 3EI3A 1YFQA 2I0TA 3IIYA 5TEEA 4BH6A 2H47A 5IJ7E 2IUVA 2YNPA 3I89A 4PC0A 3KRXB 1MDAH 4O3UB 2OK4A 1B9YA 2CN2A 2EBSA 5CXBA 2OJYA 3E0CA 5TEFA 2O9KA 4X60B 3CFSB 2BCJB 1N6DA 4A11B 5FLXg 4X3EA 2G99A 3I8EA 4BUJC 4O3TB 1GOTB 5EMLB 1JOFA 3IJCA 2HESX 3NVNA 4CY5A 3JPXA 4J0XA 4LG8A 3RLMD 3OKWA 3AL9A 4CZVA 4D0KA 4D6VA 3EI4B 3MXXA 3U4YA 5EARA 1FWXA 3F3GA 5FXYA 2P9UC 4XYIA 4GM3A 3DM0A 1R5MA 3EI1A 3RN0D 3PVWB 4A0BB 2XU7A 4J73A 3I7NA 4ZOZA 4A2LA 3PSLA 1SQ9A 2AGYA 3C75H 4CY2A 2MTAH 2B5NA 5IJ8E 3AFCA 3I7PA 4A11A 2HXCA 3V9FA 2CNXA 3SCYA 3ORVD 4J8BA 4QL1A 3SXTD 5AMSA 3MKQA 4K3JB 4E5ZB 2IUPA 4EWRA 1PBYB 2B5LA 4JSXC 2OVQB 5GXIA 3EU7A 4GM9A 1QNIA 2H6NA 3ODTA 3EI4A 5GMKn 4J84A 1PI6A 4A2MA 3J80g 3L4MD 1MG2A 5EMJB 3IJ0A 4HDJA 3OKYA 5FA5B 5HQGA 2Z2PA 3EMHA 5FKTA 2P9SC 3BWSA 4ZOYA 4GMBA 4A0BA 4CY1A 3MZKA 5FKQA 3RFGA 4ESGA 1U2VC 4J8GA 5AFU3 5C9ZB 2PM9A 3PXTD 4FA5D 3EWEA 5KDOB 2PM6B 2J57G 3V5WB 2AH0A 4JSVC 5EMKB 5TDHB 3UKRC 4L3GD 5THAA 5HE3B 4U1EI 5EAPA 4X63B 2OIZA 3SHFA 2H6QA 3UVLA 2J56H 3UVOA 3VGZA 4J0WA 4Y7RA 3V7DB 2W18A 5EM2A 2B5MA 4J77A 1JJUB 3C99A 2J55H 3P4FA 4CC9A 5A2Qg 3NVXA 3RFHA 2CO0C 4FA4D 5CXCA 2I3SA 5IT9g 2AGXA 3I8CA 4OWRA 3PE7A 2HYEA 3GREA 5SXMA 3MMYA 3EG6A 4KFMB 3JROA 1PGUA 4J82A 3JZHA 2HJ4A 4FAND 2UZYB 3IIWA 5IGOA 3J81g 3OL2A 2H9NA 5HE2B 4PBYA 4PSXB 4Z8LA 4Y5RD 2BBKH 1SQJA 4MK0B 2GNQA 1VYHC 2H14A 1K32A 4LG9A 3W15A 3EI2B 2H9MA 4ERQA 2Z2NA 2UZXB 4J79A 4G56B 4PSWB 1OMWB 4ZOVA 3OKTA 1OLZA 4FA9D 1TBGA 4OZUA 2AQ5A 1JMZB 5K1CC 5HE0B
chains in the Genus database with same CATH superfamily
1UOOA 3L4OD 5JWZA 2YMUA 3I7OA 4QT8A 2XDWA 4IMMA 5I5MA 2AGLA 1I2MB 2VDQA 1U8CA 1XKSA 4A0AB 4JT5C 4UM9A 2VDMA 2HKMA 2PM7B 2H9LA 4JHNA 5FKRA 5B4WA 5I5IA 4E54B 1NEXB 2EIEA 2HKRA 4QQEA 4AN1A 3C9CA 3PXSD 3SN6B 1UTCA 2P9IC 3IJEA 3N0EA 3NIDA 3I2NA 1GOFA 3DSMA 3ULEC 3GFCA 2CN3A 3ZDZA 4N14A 3FRXA 3OTTA 4CI8A 4G1EA 3UVMA 3IUJA 3JAMg 1MG3A 4WK4A 3SLED 5H17A 5HYNB 3JRPA 1RI6A 4JD2C 4E5ZA 1K8KC 2HU7A 5CXBB 5EALA 2I3TA 4FA1D 2EIBA 2EIDA 4BL0A 3K26A 2Q7QA 1JV2A 3JZGA 5FFGA 1NR0A 2VDNA 4BCDA 3SWSD 3V4VA 4D9SA 5C86A 1E5TA 3IJ1A 1GG2B 3NVQA 4J78A 3IUNA 3ZDYA 3CIKB 2VDOA 4CY3A 3N0DA 3RSEC 4L9OA 1ERJA 2P9NC 4A0AA 3O4HA 1VZ2A 4A7JA 3AH8B 2IWFA 1TYEA 4RE5A 3I7HA 2YBAA 4E54A 4K3ID 1SHYB 2P9PC 4ZN4A 2XL2A 5FFOA 3I7LA 2XYIA 4NSXA 2VDLA 4JXMA 4UI9R 4LGNA 2YNNA 4MMZA 5IC7A 3UVKA 2HJBA 3VH0A 2EICA 4WK2A 4CZYA 4R7AB 4PBZA 3EI1B 4Z7OA 2XL3A 3OW8A 4GM8A 3MZLA 3PVUB 5EMMB 5E6UA 1M1XA 1U4CA 4GGCA 4H5JA 2P9LC 3DXKC 5K19A 4A09B 2AH1A 3DXMC 1XHMA 5FKSA 1H2XA 3MKSB 3SMRA 4A08B 2H13A 1JMXB 5FQDA 5CYKB 1N6FA 3BG0A 2PBIB 4JHPC 4L1QD 4L3HD 3DWLC 2XE4A 1E8NA 2QXVA 1TYQC 2CE9A 5C2VB 2JKXA 4ZOXA 1QFSA 3C5MA 4J86A 5H1MA 3QI0A 1A0RB 1Q47A 3OKYB 4GGDA 2VZ3A 2QR5A 2Z2OA 3QHYB 3I7KA 5GSAA 4ES0A 4QRJA 4FHLA 5M5SA 2I0RA 4JT6C 3O4GA 2QC5A 4G1MA 2AGZA 4GQBB 3PSCB 5IGQA 2H6KA 2IUQA 4YVDA 5AJAA 3SJLD 2GC4A 4GZ8A 3SBRA 4A09A 2CE8A 1P22A 2OK6A 4CI1A 2OVRB 2PM9B 4BCBA 3NIFA 3T3MA 3AL8B 4A08A 4AMYA 2YB8B 3JZNA 3ZWLB 2P9KC 4J81A 1XIPA 3B7FA 4O45A 3JB9L 4FB1D 4CI2A 4FAVD 2H3XA 3FM0A 4XEIC 5CYKA 3K27A 4UM8A 3K6SA 4J87A 1O6FA 1PEVA 5EAMA 1BPOA 3F3FA 2YNOA 3EI2A 3EQ9A 4I79A 4JSNC 1B9XA 4IA9A 3UVNA 3A0FA 4TZ4A 2VDKA 3EI3B 1N6EA 3F3PA 5GXHA 4WJKA 3RN1D 1GXRA 4GQ1A 4L1MA 5H14A 2IWKA 4U7AA 3IKOA 4PNKB 2AGWA 4AOWA 3HFQA 5EM2B 1C9IA 3SBQA 3SVWD 1VZ3A 2IURA 3FGBA 2CO0A 3VA6A 4CI3A 4FWWA 5E6RA 3RMZD 4XYHA 5CXCB 4ERZA 4RE6A 5M5VA 3UKUC 3RRMC 3GC3B 2TRCB 5I5JA 3SBPA 4CZXA 3ZE1A 4GGAA 4O2WA 4JSPC 3SFZA 3KRWB 5TF2A 2G9AA 2GC7A 4QAMA 4DNVA 3AL8A 4ERYA 4O1QD 2B4EA 2OVPB 4X61B 4BCCA 4GQ2P 3ZE2A 3CFVA 4O9DA 2IAAA 2H68A 2I0SA 3PXWD 3BG1A 5HE1B 4H5IA 1L0QA 1S4UX 4AEZA 2H9PA 4PXWA 2VC2A 1K3IA 3UR4A 5C2WB 3OL2B 1JTDB 1GP2B 3GD1I 1C9LA 3EI3A 1YFQA 2I0TA 3IIYA 5TEEA 4BH6A 2H47A 5IJ7E 2IUVA 2YNPA 3VI4A 3I89A 4PC0A 3KRXB 1MDAH 4O3UB 2OK4A 1B9YA 2BKLA 2CN2A 4MMYA 1VE7A 2EBSA 2OJYA 3E0CA 5CXBA 5TEFA 2O9KA 4X60B 5M5RA 3CFSB 2BCJB 1N6DA 3EQ7A 4A11B 5FLXg 4X3EA 2G99A 3I8EA 4BUJC 4O3TB 1T2XA 1GOTB 3K71A 5EMLB 1JOFA 3IJCA 2HESX 3NVNA 4CY5A 3JPXA 4J0XA 4LG8A 3RLMD 3OKWA 3AL9A 4CZVA 3O4JA 4D0KA 4D6VA 3EI4B 3MXXA 4Z7QA 3U4YA 5M5UA 5EARA 1FWXA 3F3GA 5FXYA 2P9UC 4XYIA 4GM3A 3IULA 3DM0A 1R5MA 3EI1A 3RN0D 3PVWB 4A0BB 2XU7A 4J73A 3I7NA 4ZOZA 4A2LA 3PSLA 1SQ9A 2AGYA 3C75H 4CY2A 1UOQA 2B5NA 2MTAH 3NIGA 5IJ8E 3AFCA 3I7PA 4A11A 2HXCA 3V9FA 4NENA 4O02A 2CNXA 3SCYA 3ORVD 4J8BA 4QL1A 3SXTD 5AMSA 3MKQA 4K3JB 4E5ZB 2IUPA 4EWRA 5C92A 1PBYB 2B5LA 4JSXC 2OVQB 5GXIA 3EU7A 4GM9A 4DNWA 1QNIA 2H6NA 3ODTA 3EI4A 5GMKn 4J84A 1PI6A 4A2MA 3J80g 3L4MD 1MG2A 5EMJB 3IJ0A 5M5TA 4HDJA 3OKYA 5FA5B 5HQGA 2HU5A 2Z2PA 3EMHA 5E6SA 2XZGA 5FKTA 2P9SC 2QZPA 3BWSA 5HDBA 3FCSA 4ZOYA 4GMBA 3OF7A 4A0BA 4CY1A 4Z7NA 3MZKA 5FKQA 3RFGA 4BP9A 4AN0A 4ESGA 1U2VC 1L5GA 4J8GA 5AFU3 5C9ZB 2PM9A 3PXTD 3IUQA 4AMZA 4FA5D 1YR2A 3EWEA 5KDOB 2PM6B 2J57G 3V5WB 2AH0A 3K72A 1GOGA 3IUMA 1H2ZA 4JSVC 5EMKB 5TDHB 3UKRC 2VDRA 4L3GD 5THAA 5HE3B 3T3PA 4U1EI 5EAPA 4X63B 2OIZA 3SHFA 2H6QA 2VDPA 3UVLA 2J56H 3UVOA 3VGZA 4J0WA 4Y7RA 3V7DB 2W18A 3V4PA 5EM2A 2B5MA 4J77A 1JJUB 2WQ8A 3C99A 3IURA 4BP8A 1O6GA 2J55H 3P4FA 1E8MA 4CC9A 5M61A 5A2Qg 3NVXA 3RFHA 3KCIA 4NBMA 2CO0C 4FA4D 5CXCA 2I3SA 1QFMA 5IT9g 2AGXA 3I8CA 4OWRA 3PE7A 2HYEA 3GREA 5SXMA 3FCUA 2VZ1A 1VE6A 1A12A 3MMYA 4WK0A 3EG6A 4KFMB 3JROA 1PGUA 3ZE0A 4DNUA 4J82A 4AX4A 3JZHA 2HJ4A 1GOHA 3MUNA 3VI3A 4FAND 2UZYB 1UOPA 3IIWA 5IGOA 3J81g 3OL2A 2H9NA 5HE2B 4PBYA 3ZDXA 4PSXB 4Z8LA 4G55A 4NAAA 1H2WA 4Y5RD 2BBKH 1SQJA 4MK0B 2GNQA 1VYHC 2H14A 4IRZA 1K32A 4LG9A 3W15A 3EI2B 2H9MA 4ERQA 4MMXA 2Z2NA 3IVMA 2UZXB 4J79A 4G56B 4PSWB 1OMWB 3MUOA 4ZOVA 3OKTA 1OLZA 4NC4A 4FA9D 1TBGA 3O4IA 1H2YA 4OZUA 3DDUA 2AQ5A 3MVDK 1JMZB 5K1CC 5HE0B 3EQ8A 2HU8A
chains in the Genus database with same CATH topology
3L4OD 5JWZA 2YMUA 3I7OA 4QT8A 4IMMA 5I5MA 2AGLA 1XKSA 4A0AB 4JT5C 2HKMA 2PM7B 2H9LA 5FKRA 5I5IA 5B4WA 4E54B 1NEXB 2HKRA 4QQEA 3C9CA 3PXSD 3SN6B 2P9IC 3N0EA 3I2NA 3DSMA 3ULEC 3GFCA 2CN3A 4N14A 3FRXA 3OTTA 4CI8A 3UVMA 3JAMg 1MG3A 3SLED 5H17A 5HYNB 3JRPA 1RI6A 4JD2C 4E5ZA 1K8KC 5CXBB 5EALA 2I3TA 4FA1D 4BL0A 3K26A 2Q7QA 3JZGA 1NR0A 3SWSD 3IJ1A 1GG2B 3NVQA 4J78A 3CIKB 4CY3A 3N0DA 3RSEC 4L9OA 1ERJA 2P9NC 4A0AA 4A7JA 3AH8B 2IWFA 3I7HA 2YBAA 4E54A 4K3ID 1SHYB 2P9PC 4ZN4A 2XL2A 3I7LA 2XYIA 4NSXA 4JXMA 4UI9R 4LGNA 2YNNA 5IC7A 3UVKA 2HJBA 3VH0A 4CZYA 4R7AB 4PBZA 3EI1B 2XL3A 3OW8A 4GM8A 3MZLA 3PVUB 5EMMB 1U4CA 4GGCA 4H5JA 2P9LC 3DXKC 5K19A 4A09B 2AH1A 3DXMC 1XHMA 5FKSA 3MKSB 3SMRA 4A08B 2H13A 1JMXB 5FQDA 5CYKB 1N6FA 3BG0A 2PBIB 4L3HD 4L1QD 3DWLC 2QXVA 1TYQC 2CE9A 5C2VB 4ZOXA 3C5MA 4J86A 5H1MA 1A0RB 1Q47A 3OKYB 4GGDA 2Z2OA 3I7KA 5GSAA 4ES0A 4QRJA 4FHLA 2I0RA 4JT6C 2QC5A 2AGZA 4GQBB 3PSCB 5IGQA 2H6KA 2IUQA 4YVDA 5AJAA 3SJLD 2GC4A 4GZ8A 3SBRA 4A09A 2CE8A 1P22A 2OK6A 4CI1A 2OVRB 2PM9B 3AL8B 4A08A 2YB8B 3JZNA 3ZWLB 2P9KC 4J81A 1XIPA 3B7FA 4O45A 3JB9L 4FB1D 4CI2A 4FAVD 2H3XA 3FM0A 4XEIC 5CYKA 3K27A 4J87A 1PEVA 5EAMA 3F3FA 2YNOA 3EI2A 4I79A 4JSNC 1B9XA 4IA9A 3UVNA 3A0FA 4TZ4A 3EI3B 1N6EA 3F3PA 5GXHA 3RN1D 1GXRA 4GQ1A 5H14A 2IWKA 4U7AA 3IKOA 4PNKB 2AGWA 4AOWA 3HFQA 5EM2B 3SBQA 3SVWD 2IURA 3FGBA 2CO0A 3VA6A 4CI3A 4FWWA 3RMZD 4XYHA 5CXCB 4ERZA 3UKUC 3RRMC 2TRCB 5I5JA 3SBPA 4CZXA 4GGAA 3SFZA 4JSPC 3KRWB 5TF2A 2G9AA 2GC7A 3AL8A 4ERYA 4O1QD 2B4EA 2OVPB 4X61B 4GQ2P 3CFVA 4O9DA 2IAAA 2H68A 2I0SA 3PXWD 3BG1A 5HE1B 4H5IA 1L0QA 1S4UX 4AEZA 2H9PA 4PXWA 3UR4A 5C2WB 3OL2B 1GP2B 3EI3A 1YFQA 2I0TA 3IIYA 5TEEA 4BH6A 2H47A 5IJ7E 2IUVA 2YNPA 3I89A 4PC0A 3KRXB 1MDAH 4O3UB 2OK4A 1B9YA 2CN2A 2EBSA 5CXBA 2OJYA 3E0CA 5TEFA 2O9KA 4X60B 3CFSB 2BCJB 1N6DA 4A11B 5FLXg 4X3EA 2G99A 3I8EA 4BUJC 4O3TB 1GOTB 5EMLB 1JOFA 3IJCA 2HESX 3NVNA 4CY5A 3JPXA 4J0XA 4LG8A 3RLMD 3OKWA 3AL9A 4CZVA 4D0KA 4D6VA 3EI4B 3MXXA 3U4YA 5EARA 1FWXA 3F3GA 5FXYA 2P9UC 4XYIA 4GM3A 3DM0A 1R5MA 3EI1A 3RN0D 3PVWB 4A0BB 2XU7A 4J73A 3I7NA 4ZOZA 4A2LA 3PSLA 1SQ9A 2AGYA 3C75H 4CY2A 2MTAH 2B5NA 5IJ8E 3AFCA 3I7PA 4A11A 2HXCA 3V9FA 2CNXA 3SCYA 3ORVD 4J8BA 4QL1A 3SXTD 5AMSA 3MKQA 4K3JB 4E5ZB 2IUPA 4EWRA 1PBYB 2B5LA 4JSXC 2OVQB 5GXIA 3EU7A 4GM9A 1QNIA 2H6NA 3ODTA 3EI4A 5GMKn 4J84A 1PI6A 4A2MA 3J80g 3L4MD 1MG2A 5EMJB 3IJ0A 4HDJA 3OKYA 5FA5B 5HQGA 2Z2PA 3EMHA 5FKTA 2P9SC 3BWSA 4ZOYA 4GMBA 4A0BA 4CY1A 3MZKA 5FKQA 3RFGA 4ESGA 1U2VC 4J8GA 5AFU3 5C9ZB 2PM9A 3PXTD 4FA5D 3EWEA 5KDOB 2PM6B 2J57G 3V5WB 2AH0A 4JSVC 5EMKB 5TDHB 3UKRC 4L3GD 5THAA 5HE3B 4U1EI 5EAPA 4X63B 2OIZA 3SHFA 2H6QA 3UVLA 2J56H 3UVOA 3VGZA 4J0WA 4Y7RA 3V7DB 2W18A 5EM2A 2B5MA 4J77A 1JJUB 3C99A 2J55H 3P4FA 4CC9A 5A2Qg 3NVXA 3RFHA 2CO0C 4FA4D 5CXCA 2I3SA 5IT9g 2AGXA 3I8CA 4OWRA 3PE7A 2HYEA 3GREA 5SXMA 3MMYA 3EG6A 4KFMB 3JROA 1PGUA 4J82A 3JZHA 2HJ4A 4FAND 2UZYB 3IIWA 5IGOA 3J81g 3OL2A 2H9NA 5HE2B 4PBYA 4PSXB 4Z8LA 4Y5RD 2BBKH 1SQJA 4MK0B 2GNQA 1VYHC 2H14A 1K32A 4LG9A 3W15A 3EI2B 2H9MA 4ERQA 2Z2NA 2UZXB 4J79A 4G56B 4PSWB 1OMWB 4ZOVA 3OKTA 1OLZA 4FA9D 1TBGA 4OZUA 2AQ5A 1JMZB 5K1CC 5HE0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L4O D;  5JWZ A;  2YMU A;  3I7O A;  4QT8 A;  4IMM A;  5I5M A;  2AGL A;  1XKS A;  4A0A B;  4JT5 C;  2HKM A;  2PM7 B;  2H9L A;  5FKR A;  5I5I A;  5B4W A;  4E54 B;  1NEX B;  2HKR A;  4QQE A;  3C9C A;  3PXS D;  3SN6 B;  2P9I C;  3N0E A;  3I2N A;  3DSM A;  3ULE C;  3GFC A;  2CN3 A;  4N14 A;  3FRX A;  3OTT A;  4CI8 A;  3UVM A;  3JAM g;  1MG3 A;  3SLE D;  5H17 A;  5HYN B;  3JRP A;  1RI6 A;  4JD2 C;  4E5Z A;  1K8K C;  5CXB B;  5EAL A;  2I3T A;  4FA1 D;  4BL0 A;  3K26 A;  2Q7Q A;  3JZG A;  1NR0 A;  3SWS D;  3IJ1 A;  1GG2 B;  3NVQ A;  4J78 A;  3CIK B;  4CY3 A;  3N0D A;  3RSE C;  4L9O A;  1ERJ A;  2P9N C;  4A0A A;  4A7J A;  3AH8 B;  2IWF A;  3I7H A;  2YBA A;  4E54 A;  4K3I D;  1SHY B;  2P9P C;  4ZN4 A;  2XL2 A;  3I7L A;  2XYI A;  4NSX A;  4JXM A;  4UI9 R;  4LGN A;  2YNN A;  5IC7 A;  3UVK A;  2HJB A;  3VH0 A;  4CZY A;  4R7A B;  4PBZ A;  3EI1 B;  2XL3 A;  3OW8 A;  4GM8 A;  3MZL A;  3PVU B;  5EMM B;  1U4C A;  4GGC A;  4H5J A;  2P9L C;  3DXK C;  5K19 A;  4A09 B;  2AH1 A;  3DXM C;  1XHM A;  5FKS A;  3MKS B;  3SMR A;  4A08 B;  2H13 A;  1JMX B;  5FQD A;  5CYK B;  1N6F A;  3BG0 A;  2PBI B;  4L3H D;  4L1Q D;  3DWL C;  2QXV A;  1TYQ C;  2CE9 A;  5C2V B;  4ZOX A;  3C5M A;  4J86 A;  5H1M A;  1A0R B;  1Q47 A;  3OKY B;  4GGD A;  2Z2O A;  3I7K A;  5GSA A;  4ES0 A;  4QRJ A;  4FHL A;  2I0R A;  4JT6 C;  2QC5 A;  2AGZ A;  4GQB B;  3PSC B;  5IGQ A;  2H6K A;  2IUQ A;  4YVD A;  5AJA A;  3SJL D;  2GC4 A;  4GZ8 A;  3SBR A;  4A09 A;  2CE8 A;  1P22 A;  2OK6 A;  4CI1 A;  2OVR B;  2PM9 B;  3AL8 B;  4A08 A;  2YB8 B;  3JZN A;  3ZWL B;  2P9K C;  4J81 A;  1XIP A;  3B7F A;  4O45 A;  3JB9 L;  4FB1 D;  4CI2 A;  4FAV D;  2H3X A;  3FM0 A;  4XEI C;  5CYK A;  3K27 A;  4J87 A;  1PEV A;  5EAM A;  3F3F A;  2YNO A;  3EI2 A;  4I79 A;  4JSN C;  1B9X A;  4IA9 A;  3UVN A;  3A0F A;  4TZ4 A;  3EI3 B;  1N6E A;  3F3P A;  5GXH A;  3RN1 D;  1GXR A;  4GQ1 A;  5H14 A;  2IWK A;  4U7A A;  3IKO A;  4PNK B;  2AGW A;  4AOW A;  3HFQ A;  5EM2 B;  3SBQ A;  3SVW D;  2IUR A;  3FGB A;  2CO0 A;  3VA6 A;  4CI3 A;  4FWW A;  3RMZ D;  4XYH A;  5CXC B;  4ERZ A;  3UKU C;  3RRM C;  2TRC B;  5I5J A;  3SBP A;  4CZX A;  4GGA A;  3SFZ A;  4JSP C;  3KRW B;  5TF2 A;  2G9A A;  2GC7 A;  3AL8 A;  4ERY A;  4O1Q D;  2B4E A;  2OVP B;  4X61 B;  4GQ2 P;  3CFV A;  4O9D A;  2IAA A;  2H68 A;  2I0S A;  3PXW D;  3BG1 A;  5HE1 B;  4H5I A;  1L0Q A;  1S4U X;  4AEZ A;  2H9P A;  4PXW A;  3UR4 A;  5C2W B;  3OL2 B;  1GP2 B;  3EI3 A;  1YFQ A;  2I0T A;  3IIY A;  5TEE A;  4BH6 A;  2H47 A;  5IJ7 E;  2IUV A;  2YNP A;  3I89 A;  4PC0 A;  3KRX B;  1MDA H;  4O3U B;  2OK4 A;  1B9Y A;  2CN2 A;  2EBS A;  5CXB A;  2OJY A;  3E0C A;  5TEF A;  2O9K A;  4X60 B;  3CFS B;  2BCJ B;  1N6D A;  4A11 B;  5FLX g;  4X3E A;  2G99 A;  3I8E A;  4BUJ C;  4O3T B;  1GOT B;  5EML B;  1JOF A;  3IJC A;  2HES X;  3NVN A;  4CY5 A;  3JPX A;  4J0X A;  4LG8 A;  3RLM D;  3OKW A;  3AL9 A;  4CZV A;  4D0K A;  4D6V A;  3EI4 B;  3MXX A;  3U4Y A;  5EAR A;  1FWX A;  3F3G A;  5FXY A;  2P9U C;  4XYI A;  4GM3 A;  3DM0 A;  1R5M A;  3EI1 A;  3RN0 D;  3PVW B;  4A0B B;  2XU7 A;  4J73 A;  3I7N A;  4ZOZ A;  4A2L A;  3PSL A;  1SQ9 A;  2AGY A;  3C75 H;  4CY2 A;  2MTA H;  2B5N A;  5IJ8 E;  3AFC A;  3I7P A;  4A11 A;  2HXC A;  3V9F A;  2CNX A;  3SCY A;  3ORV D;  4J8B A;  4QL1 A;  3SXT D;  5AMS A;  3MKQ A;  4K3J B;  4E5Z B;  2IUP A;  4EWR A;  1PBY B;  2B5L A;  4JSX C;  2OVQ B;  5GXI A;  3EU7 A;  4GM9 A;  1QNI A;  2H6N A;  3ODT A;  3EI4 A;  5GMK n;  4J84 A;  1PI6 A;  4A2M A;  3J80 g;  3L4M D;  1MG2 A;  5EMJ B;  3IJ0 A;  4HDJ A;  3OKY A;  5FA5 B;  5HQG A;  2Z2P A;  3EMH A;  5FKT A;  2P9S C;  3BWS A;  4ZOY A;  4GMB A;  4A0B A;  4CY1 A;  3MZK A;  5FKQ A;  3RFG A;  4ESG A;  1U2V C;  4J8G A;  5AFU 3;  5C9Z B;  2PM9 A;  3PXT D;  4FA5 D;  3EWE A;  5KDO B;  2PM6 B;  2J57 G;  3V5W B;  2AH0 A;  4JSV C;  5EMK B;  5TDH B;  3UKR C;  4L3G D;  5THA A;  5HE3 B;  4U1E I;  5EAP A;  4X63 B;  2OIZ A;  3SHF A;  2H6Q A;  3UVL A;  2J56 H;  3UVO A;  3VGZ A;  4J0W A;  4Y7R A;  3V7D B;  2W18 A;  5EM2 A;  2B5M A;  4J77 A;  1JJU B;  3C99 A;  2J55 H;  3P4F A;  4CC9 A;  5A2Q g;  3NVX A;  3RFH A;  2CO0 C;  4FA4 D;  5CXC A;  2I3S A;  5IT9 g;  2AGX A;  3I8C A;  4OWR A;  3PE7 A;  2HYE A;  3GRE A;  5SXM A;  3MMY A;  3EG6 A;  4KFM B;  3JRO A;  1PGU A;  4J82 A;  3JZH A;  2HJ4 A;  4FAN D;  2UZY B;  3IIW A;  5IGO A;  3J81 g;  3OL2 A;  2H9N A;  5HE2 B;  4PBY A;  4PSX B;  4Z8L A;  4Y5R D;  2BBK H;  1SQJ A;  4MK0 B;  2GNQ A;  1VYH C;  2H14 A;  1K32 A;  4LG9 A;  3W15 A;  3EI2 B;  2H9M A;  4ERQ A;  2Z2N A;  2UZX B;  4J79 A;  4G56 B;  4PSW B;  1OMW B;  4ZOV A;  3OKT A;  1OLZ A;  4FA9 D;  1TBG A;  4OZU A;  2AQ5 A;  1JMZ B;  5K1C C;  5HE0 B; 
#chains in the Genus database with same CATH topology
 1UOO A;  3L4O D;  5JWZ A;  2YMU A;  3I7O A;  4QT8 A;  2XDW A;  4IMM A;  5I5M A;  2AGL A;  1I2M B;  2VDQ A;  1U8C A;  1XKS A;  4A0A B;  4JT5 C;  4UM9 A;  2VDM A;  2HKM A;  2PM7 B;  2H9L A;  4JHN A;  5FKR A;  5B4W A;  5I5I A;  4E54 B;  1NEX B;  2EIE A;  2HKR A;  4QQE A;  4AN1 A;  3C9C A;  3PXS D;  3SN6 B;  1UTC A;  2P9I C;  3IJE A;  3N0E A;  3NID A;  3I2N A;  1GOF A;  3DSM A;  3ULE C;  3GFC A;  2CN3 A;  3ZDZ A;  4N14 A;  3FRX A;  3OTT A;  4CI8 A;  4G1E A;  3UVM A;  3IUJ A;  3JAM g;  1MG3 A;  4WK4 A;  3SLE D;  5H17 A;  5HYN B;  3JRP A;  1RI6 A;  4JD2 C;  4E5Z A;  1K8K C;  2HU7 A;  5CXB B;  5EAL A;  2I3T A;  4FA1 D;  2EIB A;  2EID A;  4BL0 A;  3K26 A;  2Q7Q A;  1JV2 A;  3JZG A;  5FFG A;  1NR0 A;  2VDN A;  4BCD A;  3SWS D;  3V4V A;  4D9S A;  5C86 A;  1E5T A;  3IJ1 A;  1GG2 B;  3NVQ A;  4J78 A;  3IUN A;  3ZDY A;  3CIK B;  2VDO A;  4CY3 A;  3N0D A;  3RSE C;  4L9O A;  1ERJ A;  2P9N C;  4A0A A;  3O4H A;  1VZ2 A;  4A7J A;  3AH8 B;  2IWF A;  1TYE A;  4RE5 A;  3I7H A;  2YBA A;  4E54 A;  4K3I D;  1SHY B;  2P9P C;  4ZN4 A;  2XL2 A;  5FFO A;  3I7L A;  2XYI A;  4NSX A;  2VDL A;  4JXM A;  4UI9 R;  4LGN A;  2YNN A;  4MMZ A;  5IC7 A;  3UVK A;  2HJB A;  3VH0 A;  2EIC A;  4WK2 A;  4CZY A;  4R7A B;  4PBZ A;  3EI1 B;  4Z7O A;  2XL3 A;  3OW8 A;  4GM8 A;  3MZL A;  3PVU B;  5EMM B;  5E6U A;  1M1X A;  1U4C A;  4GGC A;  4H5J A;  2P9L C;  3DXK C;  5K19 A;  4A09 B;  2AH1 A;  3DXM C;  1XHM A;  5FKS A;  1H2X A;  3MKS B;  3SMR A;  4A08 B;  2H13 A;  1JMX B;  5FQD A;  5CYK B;  1N6F A;  3BG0 A;  2PBI B;  4JHP C;  4L1Q D;  4L3H D;  3DWL C;  2XE4 A;  1E8N A;  2QXV A;  1TYQ C;  2CE9 A;  5C2V B;  2JKX A;  4ZOX A;  1QFS A;  3C5M A;  4J86 A;  5H1M A;  3QI0 A;  1A0R B;  1Q47 A;  3OKY B;  4GGD A;  2VZ3 A;  2QR5 A;  2Z2O A;  3QHY B;  3I7K A;  5GSA A;  4ES0 A;  4QRJ A;  4FHL A;  5M5S A;  2I0R A;  4JT6 C;  3O4G A;  2QC5 A;  4G1M A;  2AGZ A;  4GQB B;  3PSC B;  5IGQ A;  2H6K A;  2IUQ A;  4YVD A;  5AJA A;  3SJL D;  2GC4 A;  4GZ8 A;  3SBR A;  4A09 A;  2CE8 A;  1P22 A;  2OK6 A;  4CI1 A;  2OVR B;  2PM9 B;  4BCB A;  3NIF A;  3T3M A;  3AL8 B;  4A08 A;  4AMY A;  2YB8 B;  3JZN A;  3ZWL B;  2P9K C;  4J81 A;  1XIP A;  3B7F A;  4O45 A;  3JB9 L;  4FB1 D;  4CI2 A;  4FAV D;  2H3X A;  3FM0 A;  4XEI C;  5CYK A;  3K27 A;  4UM8 A;  3K6S A;  4J87 A;  1O6F A;  1PEV A;  5EAM A;  1BPO A;  3F3F A;  2YNO A;  3EI2 A;  3EQ9 A;  4I79 A;  4JSN C;  1B9X A;  4IA9 A;  3UVN A;  3A0F A;  4TZ4 A;  2VDK A;  3EI3 B;  1N6E A;  3F3P A;  5GXH A;  4WJK A;  3RN1 D;  1GXR A;  4GQ1 A;  4L1M A;  5H14 A;  2IWK A;  4U7A A;  3IKO A;  4PNK B;  2AGW A;  4AOW A;  3HFQ A;  5EM2 B;  1C9I A;  3SBQ A;  3SVW D;  1VZ3 A;  2IUR A;  3FGB A;  2CO0 A;  3VA6 A;  4CI3 A;  4FWW A;  5E6R A;  3RMZ D;  4XYH A;  5CXC B;  4ERZ A;  4RE6 A;  5M5V A;  3UKU C;  3RRM C;  3GC3 B;  2TRC B;  5I5J A;  3SBP A;  4CZX A;  3ZE1 A;  4GGA A;  4O2W A;  4JSP C;  3SFZ A;  3KRW B;  5TF2 A;  2G9A A;  2GC7 A;  4QAM A;  4DNV A;  3AL8 A;  4ERY A;  4O1Q D;  2B4E A;  2OVP B;  4X61 B;  4BCC A;  4GQ2 P;  3ZE2 A;  3CFV A;  4O9D A;  2IAA A;  2H68 A;  2I0S A;  3PXW D;  3BG1 A;  5HE1 B;  4H5I A;  1L0Q A;  1S4U X;  4AEZ A;  2H9P A;  4PXW A;  2VC2 A;  1K3I A;  3UR4 A;  5C2W B;  3OL2 B;  1JTD B;  1GP2 B;  3GD1 I;  1C9L A;  3EI3 A;  1YFQ A;  2I0T A;  3IIY A;  5TEE A;  4BH6 A;  2H47 A;  5IJ7 E;  2IUV A;  2YNP A;  3VI4 A;  3I89 A;  4PC0 A;  3KRX B;  1MDA H;  4O3U B;  2OK4 A;  1B9Y A;  2BKL A;  2CN2 A;  4MMY A;  1VE7 A;  2EBS A;  2OJY A;  3E0C A;  5CXB A;  5TEF A;  2O9K A;  4X60 B;  5M5R A;  3CFS B;  2BCJ B;  1N6D A;  3EQ7 A;  4A11 B;  5FLX g;  4X3E A;  2G99 A;  3I8E A;  4BUJ C;  4O3T B;  1T2X A;  1GOT B;  3K71 A;  5EML B;  1JOF A;  3IJC A;  2HES X;  3NVN A;  4CY5 A;  3JPX A;  4J0X A;  4LG8 A;  3RLM D;  3OKW A;  3AL9 A;  4CZV A;  3O4J A;  4D0K A;  4D6V A;  3EI4 B;  3MXX A;  4Z7Q A;  3U4Y A;  5M5U A;  5EAR A;  1FWX A;  3F3G A;  5FXY A;  2P9U C;  4XYI A;  4GM3 A;  3IUL A;  3DM0 A;  1R5M A;  3EI1 A;  3RN0 D;  3PVW B;  4A0B B;  2XU7 A;  4J73 A;  3I7N A;  4ZOZ A;  4A2L A;  3PSL A;  1SQ9 A;  2AGY A;  3C75 H;  4CY2 A;  1UOQ A;  2B5N A;  2MTA H;  3NIG A;  5IJ8 E;  3AFC A;  3I7P A;  4A11 A;  2HXC A;  3V9F A;  4NEN A;  4O02 A;  2CNX A;  3SCY A;  3ORV D;  4J8B A;  4QL1 A;  3SXT D;  5AMS A;  3MKQ A;  4K3J B;  4E5Z B;  2IUP A;  4EWR A;  5C92 A;  1PBY B;  2B5L A;  4JSX C;  2OVQ B;  5GXI A;  3EU7 A;  4GM9 A;  4DNW A;  1QNI A;  2H6N A;  3ODT A;  3EI4 A;  5GMK n;  4J84 A;  1PI6 A;  4A2M A;  3J80 g;  3L4M D;  1MG2 A;  5EMJ B;  3IJ0 A;  5M5T A;  4HDJ A;  3OKY A;  5FA5 B;  5HQG A;  2HU5 A;  2Z2P A;  3EMH A;  5E6S A;  2XZG A;  5FKT A;  2P9S C;  2QZP A;  3BWS A;  5HDB A;  3FCS A;  4ZOY A;  4GMB A;  3OF7 A;  4A0B A;  4CY1 A;  4Z7N A;  3MZK A;  5FKQ A;  3RFG A;  4BP9 A;  4AN0 A;  4ESG A;  1U2V C;  1L5G A;  4J8G A;  5AFU 3;  5C9Z B;  2PM9 A;  3PXT D;  3IUQ A;  4AMZ A;  4FA5 D;  1YR2 A;  3EWE A;  5KDO B;  2PM6 B;  2J57 G;  3V5W B;  2AH0 A;  3K72 A;  1GOG A;  3IUM A;  1H2Z A;  4JSV C;  5EMK B;  5TDH B;  3UKR C;  2VDR A;  4L3G D;  5THA A;  5HE3 B;  3T3P A;  4U1E I;  5EAP A;  4X63 B;  2OIZ A;  3SHF A;  2H6Q A;  2VDP A;  3UVL A;  2J56 H;  3UVO A;  3VGZ A;  4J0W A;  4Y7R A;  3V7D B;  2W18 A;  3V4P A;  5EM2 A;  2B5M A;  4J77 A;  1JJU B;  2WQ8 A;  3C99 A;  3IUR A;  4BP8 A;  1O6G A;  2J55 H;  3P4F A;  1E8M A;  4CC9 A;  5M61 A;  5A2Q g;  3NVX A;  3RFH A;  3KCI A;  4NBM A;  2CO0 C;  4FA4 D;  5CXC A;  2I3S A;  1QFM A;  5IT9 g;  2AGX A;  3I8C A;  4OWR A;  3PE7 A;  2HYE A;  3GRE A;  5SXM A;  3FCU A;  2VZ1 A;  1VE6 A;  1A12 A;  3MMY A;  4WK0 A;  3EG6 A;  4KFM B;  3JRO A;  1PGU A;  3ZE0 A;  4DNU A;  4J82 A;  4AX4 A;  3JZH A;  2HJ4 A;  1GOH A;  3MUN A;  3VI3 A;  4FAN D;  2UZY B;  1UOP A;  3IIW A;  5IGO A;  3J81 g;  3OL2 A;  2H9N A;  5HE2 B;  4PBY A;  3ZDX A;  4PSX B;  4Z8L A;  4G55 A;  4NAA A;  1H2W A;  4Y5R D;  2BBK H;  1SQJ A;  4MK0 B;  2GNQ A;  1VYH C;  2H14 A;  4IRZ A;  1K32 A;  4LG9 A;  3W15 A;  3EI2 B;  2H9M A;  4ERQ A;  4MMX A;  2Z2N A;  3IVM A;  2UZX B;  4J79 A;  4G56 B;  4PSW B;  1OMW B;  3MUO A;  4ZOV A;  3OKT A;  1OLZ A;  4NC4 A;  4FA9 D;  1TBG A;  3O4I A;  1H2Y A;  4OZU A;  3DDU A;  2AQ5 A;  3MVD K;  1JMZ B;  5K1C C;  5HE0 B;  3EQ8 A;  2HU8 A; 
#chains in the Genus database with same CATH homology
 3L4O D;  5JWZ A;  2YMU A;  3I7O A;  4QT8 A;  4IMM A;  5I5M A;  2AGL A;  1XKS A;  4A0A B;  4JT5 C;  2HKM A;  2PM7 B;  2H9L A;  5FKR A;  5I5I A;  5B4W A;  4E54 B;  1NEX B;  2HKR A;  4QQE A;  3C9C A;  3PXS D;  3SN6 B;  2P9I C;  3N0E A;  3I2N A;  3DSM A;  3ULE C;  3GFC A;  2CN3 A;  4N14 A;  3FRX A;  3OTT A;  4CI8 A;  3UVM A;  3JAM g;  1MG3 A;  3SLE D;  5H17 A;  5HYN B;  3JRP A;  1RI6 A;  4JD2 C;  4E5Z A;  1K8K C;  5CXB B;  5EAL A;  2I3T A;  4FA1 D;  4BL0 A;  3K26 A;  2Q7Q A;  3JZG A;  1NR0 A;  3SWS D;  3IJ1 A;  1GG2 B;  3NVQ A;  4J78 A;  3CIK B;  4CY3 A;  3N0D A;  3RSE C;  4L9O A;  1ERJ A;  2P9N C;  4A0A A;  4A7J A;  3AH8 B;  2IWF A;  3I7H A;  2YBA A;  4E54 A;  4K3I D;  1SHY B;  2P9P C;  4ZN4 A;  2XL2 A;  3I7L A;  2XYI A;  4NSX A;  4JXM A;  4UI9 R;  4LGN A;  2YNN A;  5IC7 A;  3UVK A;  2HJB A;  3VH0 A;  4CZY A;  4R7A B;  4PBZ A;  3EI1 B;  2XL3 A;  3OW8 A;  4GM8 A;  3MZL A;  3PVU B;  5EMM B;  1U4C A;  4GGC A;  4H5J A;  2P9L C;  3DXK C;  5K19 A;  4A09 B;  2AH1 A;  3DXM C;  1XHM A;  5FKS A;  3MKS B;  3SMR A;  4A08 B;  2H13 A;  1JMX B;  5FQD A;  5CYK B;  1N6F A;  3BG0 A;  2PBI B;  4L3H D;  4L1Q D;  3DWL C;  2QXV A;  1TYQ C;  2CE9 A;  5C2V B;  4ZOX A;  3C5M A;  4J86 A;  5H1M A;  1A0R B;  1Q47 A;  3OKY B;  4GGD A;  2Z2O A;  3I7K A;  5GSA A;  4ES0 A;  4QRJ A;  4FHL A;  2I0R A;  4JT6 C;  2QC5 A;  2AGZ A;  4GQB B;  3PSC B;  5IGQ A;  2H6K A;  2IUQ A;  4YVD A;  5AJA A;  3SJL D;  2GC4 A;  4GZ8 A;  3SBR A;  4A09 A;  2CE8 A;  1P22 A;  2OK6 A;  4CI1 A;  2OVR B;  2PM9 B;  3AL8 B;  4A08 A;  2YB8 B;  3JZN A;  3ZWL B;  2P9K C;  4J81 A;  1XIP A;  3B7F A;  4O45 A;  3JB9 L;  4FB1 D;  4CI2 A;  4FAV D;  2H3X A;  3FM0 A;  4XEI C;  5CYK A;  3K27 A;  4J87 A;  1PEV A;  5EAM A;  3F3F A;  2YNO A;  3EI2 A;  4I79 A;  4JSN C;  1B9X A;  4IA9 A;  3UVN A;  3A0F A;  4TZ4 A;  3EI3 B;  1N6E A;  3F3P A;  5GXH A;  3RN1 D;  1GXR A;  4GQ1 A;  5H14 A;  2IWK A;  4U7A A;  3IKO A;  4PNK B;  2AGW A;  4AOW A;  3HFQ A;  5EM2 B;  3SBQ A;  3SVW D;  2IUR A;  3FGB A;  2CO0 A;  3VA6 A;  4CI3 A;  4FWW A;  3RMZ D;  4XYH A;  5CXC B;  4ERZ A;  3UKU C;  3RRM C;  2TRC B;  5I5J A;  3SBP A;  4CZX A;  4GGA A;  3SFZ A;  4JSP C;  3KRW B;  5TF2 A;  2G9A A;  2GC7 A;  3AL8 A;  4ERY A;  4O1Q D;  2B4E A;  2OVP B;  4X61 B;  4GQ2 P;  3CFV A;  4O9D A;  2IAA A;  2H68 A;  2I0S A;  3PXW D;  3BG1 A;  5HE1 B;  4H5I A;  1L0Q A;  1S4U X;  4AEZ A;  2H9P A;  4PXW A;  3UR4 A;  5C2W B;  3OL2 B;  1GP2 B;  3EI3 A;  1YFQ A;  2I0T A;  3IIY A;  5TEE A;  4BH6 A;  2H47 A;  5IJ7 E;  2IUV A;  2YNP A;  3I89 A;  4PC0 A;  3KRX B;  1MDA H;  4O3U B;  2OK4 A;  1B9Y A;  2CN2 A;  2EBS A;  5CXB A;  2OJY A;  3E0C A;  5TEF A;  2O9K A;  4X60 B;  3CFS B;  2BCJ B;  1N6D A;  4A11 B;  5FLX g;  4X3E A;  2G99 A;  3I8E A;  4BUJ C;  4O3T B;  1GOT B;  5EML B;  1JOF A;  3IJC A;  2HES X;  3NVN A;  4CY5 A;  3JPX A;  4J0X A;  4LG8 A;  3RLM D;  3OKW A;  3AL9 A;  4CZV A;  4D0K A;  4D6V A;  3EI4 B;  3MXX A;  3U4Y A;  5EAR A;  1FWX A;  3F3G A;  5FXY A;  2P9U C;  4XYI A;  4GM3 A;  3DM0 A;  1R5M A;  3EI1 A;  3RN0 D;  3PVW B;  4A0B B;  2XU7 A;  4J73 A;  3I7N A;  4ZOZ A;  4A2L A;  3PSL A;  1SQ9 A;  2AGY A;  3C75 H;  4CY2 A;  2MTA H;  2B5N A;  5IJ8 E;  3AFC A;  3I7P A;  4A11 A;  2HXC A;  3V9F A;  2CNX A;  3SCY A;  3ORV D;  4J8B A;  4QL1 A;  3SXT D;  5AMS A;  3MKQ A;  4K3J B;  4E5Z B;  2IUP A;  4EWR A;  1PBY B;  2B5L A;  4JSX C;  2OVQ B;  5GXI A;  3EU7 A;  4GM9 A;  1QNI A;  2H6N A;  3ODT A;  3EI4 A;  5GMK n;  4J84 A;  1PI6 A;  4A2M A;  3J80 g;  3L4M D;  1MG2 A;  5EMJ B;  3IJ0 A;  4HDJ A;  3OKY A;  5FA5 B;  5HQG A;  2Z2P A;  3EMH A;  5FKT A;  2P9S C;  3BWS A;  4ZOY A;  4GMB A;  4A0B A;  4CY1 A;  3MZK A;  5FKQ A;  3RFG A;  4ESG A;  1U2V C;  4J8G A;  5AFU 3;  5C9Z B;  2PM9 A;  3PXT D;  4FA5 D;  3EWE A;  5KDO B;  2PM6 B;  2J57 G;  3V5W B;  2AH0 A;  4JSV C;  5EMK B;  5TDH B;  3UKR C;  4L3G D;  5THA A;  5HE3 B;  4U1E I;  5EAP A;  4X63 B;  2OIZ A;  3SHF A;  2H6Q A;  3UVL A;  2J56 H;  3UVO A;  3VGZ A;  4J0W A;  4Y7R A;  3V7D B;  2W18 A;  5EM2 A;  2B5M A;  4J77 A;  1JJU B;  3C99 A;  2J55 H;  3P4F A;  4CC9 A;  5A2Q g;  3NVX A;  3RFH A;  2CO0 C;  4FA4 D;  5CXC A;  2I3S A;  5IT9 g;  2AGX A;  3I8C A;  4OWR A;  3PE7 A;  2HYE A;  3GRE A;  5SXM A;  3MMY A;  3EG6 A;  4KFM B;  3JRO A;  1PGU A;  4J82 A;  3JZH A;  2HJ4 A;  4FAN D;  2UZY B;  3IIW A;  5IGO A;  3J81 g;  3OL2 A;  2H9N A;  5HE2 B;  4PBY A;  4PSX B;  4Z8L A;  4Y5R D;  2BBK H;  1SQJ A;  4MK0 B;  2GNQ A;  1VYH C;  2H14 A;  1K32 A;  4LG9 A;  3W15 A;  3EI2 B;  2H9M A;  4ERQ A;  2Z2N A;  2UZX B;  4J79 A;  4G56 B;  4PSW B;  1OMW B;  4ZOV A;  3OKT A;  1OLZ A;  4FA9 D;  1TBG A;  4OZU A;  2AQ5 A;  1JMZ B;  5K1C C;  5HE0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...