4QL1A

Crystal structure of human wdr5 in complex with compound oicr-9429
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
304
structure length
304
Chain Sequence
b'VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title Pharmacological targeting of the Wdr5-MLL interaction in C/EBP alpha N-terminal leukemia.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/inhibitor
total genus 107
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4ql1A00
4MK0B 3RLMD 1K8KC 3IKOA 4QL1A 5FLXg 4GM3A 3UVOA 2J57G 4I79A 2B5NA 2GC4A 3U4YA 4CY3A 5K1CC 3UVNA 1L0QA 2UZYB 3GFCA 3V9FA 3UVKA 4CI3A 5EAPA 2I0RA 2AGXA 2PM9A 4CI2A 2BCJB 2Q7QA 4LG9A 5B4WA 2OJYA 4J78A 2OVPB 1U4CA 4U1EI 4KFMB 4FAVD 2TRCB 4A08B 5I5IA 5GSAA 2H13A 3ODTA 2CO0A 4OWRA 4X63B 1S4UX 4FA9D 4A11A 2AH0A 3EG6A 4BUJC 2OK4A 2UZXB 4JSNC 2HESX 2P9LC 2HKMA 4GQBB 3SHFA 3SWSD 4L3HD 3EI3B 1GP2B 2P9KC 3IJ0A 4J0WA 4PSWB 3V5WB 5CXCB 4JSPC 3RFGA 4AEZA 3OL2A 5FXYA 4Z8LA 3OKWA 4E5ZA 3JZGA 5H17A 3KRWB 5SXMA 4O1QD 4A0BA 4JT5C 4EWRA 1XKSA 3AL9A 2P9UC 4GM9A 2AH1A 2QXVA 3JZHA 4FA1D 2YMUA 2PM7B 3PXWD 4ZN4A 3BG0A 4X60B 3OKTA 1GG2B 3SXTD 4JSXC 2IUQA 1XIPA 4IMMA 4CZVA 2YNOA 5KDOB 5IJ7E 2H9NA 4H5JA 1SHYB 2YNPA 4HDJA 3GREA 3SBRA 5EMLB 4YVDA 2CO0C 3IJCA 5K19A 2CN2A 1GXRA 4NSXA 3I7LA 1JJUB 3OW8A 2G9AA 1ERJA 2I3SA 4K3ID 3EU7A 1R5MA 4GZ8A 4FB1D 4XEIC 4ZOZA 3JZNA 3MKSB 5HYNB 3C99A 3RRMC 1SQJA 3KRXB 2MTAH 5I5JA 3CFSB 3RN1D 4FA4D 3SBQA 5H1MA 2H6KA 4E54A 3ZWLB 1SQ9A 4A09B 5HE2B 1MDAH 3OKYB 5TEEA 3K26A 3MMYA 1TBGA 4FAND 2P9IC 3I2NA 3V7DB 2XL2A 3CFVA 2IAAA 1FWXA 5TF2A 1K32A 1TYQC 4XYHA 5GXHA 1B9YA 5EARA 4LG8A 5AMSA 2XL3A 3VA6A 3J80g 2IWFA 4A0AA 3PE7A 4XYIA 5EALA 3DSMA 3MXXA 4A2MA 4CY1A 1QNIA 2CNXA 4ERYA 4X61B 4J87A 2CN3A 1RI6A 3DM0A 2H9PA 2P9SC 3AFCA 3AL8A 4A11B 4CI8A 1A0RB 3MKQA 4J77A 3EI3A 5AJAA 3PSLA 2XYIA 4N14A 1JOFA 3I7PA 4QT8A 4ERZA 3F3PA 4J79A 3OL2B 4E5ZB 2AGLA 2G99A 4A0BB 5CXBA 2W18A 3PXTD 5HQGA 1U2VC 4D6VA 3EI1A 3SBPA 2OK6A 4JSVC 5EAMA 4JT6C 2H9LA 3MZKA 3RSEC 2AGZA 3EI4A 4O9DA 3RN0D 4H5IA 1JMXB 3F3FA 4OZUA 2GNQA 4PBZA 1OLZA 2B4EA 3C75H 2Z2NA 2HJ4A 3N0EA 4LGNA 4PC0A 3FRXA 1VYHC 5EMMB 2CE9A 1OMWB 1MG3A 5CYKA 4ZOXA 4J86A 5I5MA 2BBKH 2GC7A 3IIWA 3UVLA 4CZYA 3EWEA 4J73A 3FGBA 2HYEA 4GQ2P 5FKSA 3RMZD 5JWZA 2AGYA 2H68A 3P4FA 4FWWA 5EMJB 3DWLC 5FA5B 3SN6B 3B7FA 4FA5D 5FKTA 3EI2A 5THAA 3RFHA 4QQEA 5EM2A 3SFZA 3VH0A 4GM8A 4ZOYA 2XU7A 3CIKB 4QRJA 4J84A 4PXWA 2B5LA 4L3GD 4J8BA 3A0FA 4E54B 4L9OA 2Z2OA 3OTTA 4O45A 4FHLA 3MZLA 1PBYB 4G56B 3BWSA 2IWKA 4IA9A 3I8CA 4J0XA 4TZ4A 3ORVD 2P9NC 5C2VB 3UR4A 3BG1A 3I89A 4O3UB 3EMHA 2YB8B 2PM9B 5EMKB 1N6FA 2IUVA 3HFQA 3ULEC 3DXMC 3PVWB 3SJLD 4K3JB 2PBIB 4Y5RD 1PEVA 3JRPA 2H3XA 4A08A 3I8EA 3K27A 2I0SA 3PXSD 4BL0A 3NVNA 3SMRA 4R7AB 2YNNA 4A0AB 4AOWA 2H9MA 4ESGA 1GOTB 3L4MD 4ZOVA 3VGZA 2EBSA 1B9XA 5GMKn 2Z2PA 4J81A 5C9ZB 4GMBA 4L1QD 2OIZA 3JROA 2IUPA 5IJ8E 1Q47A 5CXCA 4CY5A 5GXIA 4GQ1A 2HKRA 4D0KA 3AL8B 4A2LA 3UVMA 4O3TB 2OVRB 3C9CA 3JAMg 5HE3B 4JD2C 3L4OD 5AFU3 2HXCA 3I7KA 3J81g 2QC5A 4PBYA 2CE8A 4GGCA 4A7JA 3PSCB 5IGOA 5C2WB 4CZXA 2AGWA 3I7NA 3UKUC 2I3TA 2HJBA 2J56H 4CC9A 4CY2A 5CXBB 3I7HA 2H14A 5HE1B 2I0TA 1N6EA 1PGUA 3EI1B 3FM0A 3NVQA 5FKQA 1YFQA 5A2Qg 1XHMA 3SLED 3EI4B 5HE0B 3I7OA 4BH6A 3AH8B 3IIYA 3DXKC 4PSXB 4UI9R 5IC7A 4PNKB 2IURA 2AQ5A 3SCYA 3UKRC 4JXMA 5H14A 4GGDA 5TEFA 4Y7RA 1PI6A 2O9KA 4J8GA 5FQDA 1JMZB 2OVQB 5CYKB 4X3EA 1NEXB 4GGAA 1NR0A 4J82A 2H47A 3JB9L 2H6NA 4CI1A 5IT9g 5IGQA 3E0CA 2P9PC 3N0DA 2PM6B 4ES0A 1P22A 4A09A 2B5MA 3F3GA 5TDHB 2H6QA 3W15A 3JPXA 5FKRA 3EI2B 3C5MA 4ERQA 2YBAA 2J55H 3IJ1A 4U7AA 3NVXA 1N6DA 5EM2B 3OKYA 3SVWD 3PVUB 1MG2A
chains in the Genus database with same CATH superfamily
4MK0B 3O4GA 3RLMD 5E6RA 4NAAA 1K8KC 3IKOA 2QR5A 4QL1A 3VI4A 5FLXg 4GM3A 3UVOA 2J57G 4I79A 2B5NA 2GC4A 3U4YA 4CY3A 5K1CC 3UVNA 1L0QA 4G1MA 3K72A 2UZYB 3GFCA 3V9FA 3UVKA 4CI3A 5EAPA 2I0RA 2AGXA 2PM9A 4CI2A 2BCJB 2Q7QA 4LG9A 3EQ9A 5B4WA 2OJYA 4J78A 5M5UA 2OVPB 1U4CA 1VZ3A 4KFMB 4U1EI 3IURA 4FAVD 2TRCB 4A08B 4WK2A 5I5IA 2HU7A 5GSAA 4L1MA 2H13A 2XDWA 3ODTA 2CO0A 4OWRA 4MMYA 4X63B 1S4UX 1L5GA 1E8NA 5HDBA 4FA9D 4A11A 2AH0A 3EG6A 4BUJC 2OK4A 2UZXB 4G55A 4JSNC 3IULA 1I2MB 2HESX 2P9LC 2HKMA 4GQBB 3FCSA 3SHFA 3SWSD 4D9SA 1K3IA 3EI3B 1GP2B 2P9KC 3IJ0A 4J0WA 4L3HD 4PSWB 5CXCB 4JSPC 3V5WB 3RFGA 4AEZA 3OL2A 5FXYA 4Z8LA 3OKWA 4E5ZA 3JZGA 5H17A 3ZDZA 1UOOA 1GOHA 3KRWB 5SXMA 4O1QD 4A0BA 4JT5C 4EWRA 3VI3A 2BKLA 1XKSA 3AL9A 2P9UC 4GM9A 4NENA 3GD1I 2AH1A 2QXVA 3JZHA 4FA1D 2YMUA 2PM7B 3PXWD 4ZN4A 3BG0A 4X60B 3OKTA 2EIBA 4AN1A 1GG2B 3SXTD 4JSXC 2IUQA 1XIPA 4IMMA 4CZVA 5C92A 2YNOA 5KDOB 5IJ7E 2H9NA 4H5JA 3IUMA 1SHYB 3O4HA 2YNPA 4HDJA 2WQ8A 1E5TA 3GREA 3SBRA 5EMLB 4YVDA 2CO0C 3IJCA 5K19A 2CN2A 1GXRA 4AMYA 4NSXA 3I7LA 1JJUB 3OW8A 4UM9A 2G9AA 1ERJA 2I3SA 4K3ID 3EU7A 1R5MA 3IUQA 4GZ8A 4O2WA 4FB1D 4XEIC 4ZOZA 3JZNA 2EICA 3ZDXA 3MKSB 5HYNB 3C99A 3RRMC 1SQJA 3KRXB 2MTAH 1A12A 5I5JA 3O4IA 3CFSB 5M5VA 3RN1D 4FA4D 2VDQA 3SBQA 5H1MA 2H6KA 3ZE0A 4E54A 3ZWLB 1SQ9A 1GOFA 4A09B 5HE2B 4Z7NA 2XE4A 1MDAH 5E6UA 3OKYB 5TEEA 3K26A 3MMYA 1TBGA 4FAND 2EIDA 2P9IC 3I2NA 4MMZA 3IUJA 2VZ3A 3V7DB 2XL2A 3CFVA 4Z7OA 2IAAA 1FWXA 5TF2A 1K32A 1TYQC 3ZE2A 4XYHA 5GXHA 2VDMA 1B9YA 5EARA 4LG8A 5AMSA 2XL3A 2VZ1A 4AN0A 1UOQA 4DNUA 3VA6A 3J80g 2IWFA 2HU8A 4A0AA 3PE7A 4JHPC 1H2YA 4XYIA 5EALA 4DNVA 3DSMA 3K71A 3MXXA 4NBMA 4A2MA 3K6SA 1C9LA 4CY1A 1QNIA 2CNXA 4ERYA 2VC2A 3EQ8A 4DNWA 4X61B 4J87A 4AMZA 2CN3A 3T3MA 1RI6A 3DM0A 3NIDA 3MVDK 2H9PA 2P9SC 2XZGA 3AFCA 3AL8A 3QHYB 4A11B 4CI8A 1A0RB 4IRZA 3EQ7A 3MKQA 4J77A 3EI3A 5AJAA 3PSLA 2XYIA 4N14A 1JOFA 1UTCA 3I7PA 4BCDA 4WK4A 4QT8A 4ERZA 3F3PA 1T2XA 4G1EA 3OL2B 4J79A 4E5ZB 2AGLA 3V4VA 2G99A 4UM8A 4A0BB 5CXBA 2W18A 3PXTD 4MMXA 5HQGA 3ZDYA 1U2VC 2VDNA 4D6VA 3EI1A 3SBPA 2OK6A 4JSVC 5EAMA 4JT6C 4BP8A 1BPOA 2H9LA 3MZKA 1O6GA 3RSEC 2AGZA 5C86A 3EI4A 4O9DA 3RN0D 4H5IA 1JMXB 3F3FA 4RE6A 1QFMA 1GOGA 4OZUA 2GNQA 4PBZA 1OLZA 3NIFA 2B4EA 3C75H 2Z2NA 2HJ4A 4JHNA 3N0EA 4LGNA 5M5TA 4PC0A 3FRXA 1QFSA 1VYHC 5EMMB 2CE9A 1TYEA 4BCBA 1OMWB 1MG3A 5CYKA 4ZOXA 4J86A 5I5MA 2BBKH 2GC7A 1VE7A 2QZPA 3IIWA 3UVLA 4CZYA 3EWEA 4J73A 3FGBA 2HYEA 4GQ2P 5FKSA 3RMZD 4NC4A 5JWZA 2AGYA 2H68A 3MUOA 3P4FA 4FWWA 5EMJB 3DWLC 5FA5B 3SN6B 3B7FA 4FA5D 1VZ2A 5E6SA 5FKTA 3EI2A 5THAA 3RFHA 4QQEA 5EM2A 3SFZA 3VH0A 4GM8A 4ZOYA 2XU7A 3CIKB 2VDKA 4QRJA 4J84A 4PXWA 2B5LA 4L3GD 4J8BA 3A0FA 1YR2A 4E54B 3FCUA 3T3PA 4L9OA 2Z2OA 3OTTA 4O45A 4FHLA 5FFGA 3MZLA 1PBYB 4G56B 3BWSA 2IWKA 3KCIA 4IA9A 3I8CA 4J0XA 4TZ4A 5M61A 3ORVD 1U8CA 2P9NC 3QI0A 4BCCA 3UR4A 5C2VB 3BG1A 4BP9A 3GC3B 3I89A 4O3UB 3EMHA 2YB8B 2PM9B 5EMKB 1N6FA 2IUVA 3HFQA 2VDPA 1JTDB 3ULEC 3DXMC 3PVWB 3SJLD 4K3JB 2PBIB 4Y5RD 1PEVA 3JRPA 2H3XA 3V4PA 3ZE1A 4A08A 3I8EA 3K27A 2I0SA 1C9IA 3PXSD 4BL0A 2VDOA 3NVNA 4Z7QA 3SMRA 4R7AB 2YNNA 2VDLA 4A0AB 5M5RA 4AOWA 2H9MA 4ESGA 1GOTB 3L4MD 4ZOVA 3VGZA 2EBSA 1B9XA 5GMKn 2Z2PA 4J81A 5C9ZB 3O4JA 4GMBA 4L1QD 2OIZA 3JROA 2IUPA 5IJ8E 1Q47A 5CXCA 4CY5A 5GXIA 4GQ1A 1H2ZA 2HKRA 4D0KA 3AL8B 4A2LA 3UVMA 2JKXA 3MUNA 4O3TB 2OVRB 3C9CA 3JAMg 1E8MA 1UOPA 5HE3B 4JD2C 3L4OD 5AFU3 2HXCA 4RE5A 3I7KA 4WJKA 3J81g 2QC5A 4PBYA 2CE8A 4GGCA 4A7JA 3PSCB 5IGOA 3IUNA 5C2WB 3DDUA 4CZXA 1VE6A 2AGWA 3I7NA 3UKUC 2I3TA 2HJBA 2J56H 4CC9A 4CY2A 5CXBB 3I7HA 4WK0A 2HU5A 2H14A 5HE1B 2I0TA 1N6EA 1PGUA 4O02A 4AX4A 3EI1B 1H2WA 3FM0A 3NVQA 5FKQA 1YFQA 5A2Qg 1XHMA 3SLED 3EI4B 5HE0B 3I7OA 4BH6A 3AH8B 3IIYA 3IVMA 3DXKC 4PSXB 4UI9R 5IC7A 4PNKB 2IURA 2AQ5A 3SCYA 3UKRC 4JXMA 5H14A 1M1XA 4GGDA 5TEFA 4Y7RA 1PI6A 1JV2A 2O9KA 4J8GA 5FQDA 1JMZB 5FFOA 3NIGA 2OVQB 5CYKB 4X3EA 1NEXB 4GGAA 4QAMA 5M5SA 1NR0A 4J82A 2EIEA 2H47A 3JB9L 2H6NA 4CI1A 5IT9g 5IGQA 3E0CA 2P9PC 3N0DA 2PM6B 4ES0A 1P22A 3OF7A 2VDRA 4A09A 2B5MA 1H2XA 3F3GA 5TDHB 2H6QA 3W15A 3JPXA 5FKRA 3EI2B 3C5MA 4ERQA 2YBAA 2J55H 3IJ1A 3IJEA 4U7AA 1O6FA 1N6DA 3NVXA 5EM2B 3OKYA 3SVWD 3PVUB 1MG2A
chains in the Genus database with same CATH topology
4MK0B 3RLMD 1K8KC 3IKOA 4QL1A 5FLXg 4GM3A 3UVOA 2J57G 4I79A 2B5NA 2GC4A 3U4YA 4CY3A 5K1CC 3UVNA 1L0QA 2UZYB 3GFCA 3V9FA 3UVKA 4CI3A 5EAPA 2I0RA 2AGXA 2PM9A 4CI2A 2BCJB 2Q7QA 4LG9A 5B4WA 2OJYA 4J78A 2OVPB 1U4CA 4U1EI 4KFMB 4FAVD 2TRCB 4A08B 5I5IA 5GSAA 2H13A 3ODTA 2CO0A 4OWRA 4X63B 1S4UX 4FA9D 4A11A 2AH0A 3EG6A 4BUJC 2OK4A 2UZXB 4JSNC 2HESX 2P9LC 2HKMA 4GQBB 3SHFA 3SWSD 4L3HD 3EI3B 1GP2B 2P9KC 3IJ0A 4J0WA 4PSWB 3V5WB 5CXCB 4JSPC 3RFGA 4AEZA 3OL2A 5FXYA 4Z8LA 3OKWA 4E5ZA 3JZGA 5H17A 3KRWB 5SXMA 4O1QD 4A0BA 4JT5C 4EWRA 1XKSA 3AL9A 2P9UC 4GM9A 2AH1A 2QXVA 3JZHA 4FA1D 2YMUA 2PM7B 3PXWD 4ZN4A 3BG0A 4X60B 3OKTA 1GG2B 3SXTD 4JSXC 2IUQA 1XIPA 4IMMA 4CZVA 2YNOA 5KDOB 5IJ7E 2H9NA 4H5JA 1SHYB 2YNPA 4HDJA 3GREA 3SBRA 5EMLB 4YVDA 2CO0C 3IJCA 5K19A 2CN2A 1GXRA 4NSXA 3I7LA 1JJUB 3OW8A 2G9AA 1ERJA 2I3SA 4K3ID 3EU7A 1R5MA 4GZ8A 4FB1D 4XEIC 4ZOZA 3JZNA 3MKSB 5HYNB 3C99A 3RRMC 1SQJA 3KRXB 2MTAH 5I5JA 3CFSB 3RN1D 4FA4D 3SBQA 5H1MA 2H6KA 4E54A 3ZWLB 1SQ9A 4A09B 5HE2B 1MDAH 3OKYB 5TEEA 3K26A 3MMYA 1TBGA 4FAND 2P9IC 3I2NA 3V7DB 2XL2A 3CFVA 2IAAA 1FWXA 5TF2A 1K32A 1TYQC 4XYHA 5GXHA 1B9YA 5EARA 4LG8A 5AMSA 2XL3A 3VA6A 3J80g 2IWFA 4A0AA 3PE7A 4XYIA 5EALA 3DSMA 3MXXA 4A2MA 4CY1A 1QNIA 2CNXA 4ERYA 4X61B 4J87A 2CN3A 1RI6A 3DM0A 2H9PA 2P9SC 3AFCA 3AL8A 4A11B 4CI8A 1A0RB 3MKQA 4J77A 3EI3A 5AJAA 3PSLA 2XYIA 4N14A 1JOFA 3I7PA 4QT8A 4ERZA 3F3PA 4J79A 3OL2B 4E5ZB 2AGLA 2G99A 4A0BB 5CXBA 2W18A 3PXTD 5HQGA 1U2VC 4D6VA 3EI1A 3SBPA 2OK6A 4JSVC 5EAMA 4JT6C 2H9LA 3MZKA 3RSEC 2AGZA 3EI4A 4O9DA 3RN0D 4H5IA 1JMXB 3F3FA 4OZUA 2GNQA 4PBZA 1OLZA 2B4EA 3C75H 2Z2NA 2HJ4A 3N0EA 4LGNA 4PC0A 3FRXA 1VYHC 5EMMB 2CE9A 1OMWB 1MG3A 5CYKA 4ZOXA 4J86A 5I5MA 2BBKH 2GC7A 3IIWA 3UVLA 4CZYA 3EWEA 4J73A 3FGBA 2HYEA 4GQ2P 5FKSA 3RMZD 5JWZA 2AGYA 2H68A 3P4FA 4FWWA 5EMJB 3DWLC 5FA5B 3SN6B 3B7FA 4FA5D 5FKTA 3EI2A 5THAA 3RFHA 4QQEA 5EM2A 3SFZA 3VH0A 4GM8A 4ZOYA 2XU7A 3CIKB 4QRJA 4J84A 4PXWA 2B5LA 4L3GD 4J8BA 3A0FA 4E54B 4L9OA 2Z2OA 3OTTA 4O45A 4FHLA 3MZLA 1PBYB 4G56B 3BWSA 2IWKA 4IA9A 3I8CA 4J0XA 4TZ4A 3ORVD 2P9NC 5C2VB 3UR4A 3BG1A 3I89A 4O3UB 3EMHA 2YB8B 2PM9B 5EMKB 1N6FA 2IUVA 3HFQA 3ULEC 3DXMC 3PVWB 3SJLD 4K3JB 2PBIB 4Y5RD 1PEVA 3JRPA 2H3XA 4A08A 3I8EA 3K27A 2I0SA 3PXSD 4BL0A 3NVNA 3SMRA 4R7AB 2YNNA 4A0AB 4AOWA 2H9MA 4ESGA 1GOTB 3L4MD 4ZOVA 3VGZA 2EBSA 1B9XA 5GMKn 2Z2PA 4J81A 5C9ZB 4GMBA 4L1QD 2OIZA 3JROA 2IUPA 5IJ8E 1Q47A 5CXCA 4CY5A 5GXIA 4GQ1A 2HKRA 4D0KA 3AL8B 4A2LA 3UVMA 4O3TB 2OVRB 3C9CA 3JAMg 5HE3B 4JD2C 3L4OD 5AFU3 2HXCA 3I7KA 3J81g 2QC5A 4PBYA 2CE8A 4GGCA 4A7JA 3PSCB 5IGOA 5C2WB 4CZXA 2AGWA 3I7NA 3UKUC 2I3TA 2HJBA 2J56H 4CC9A 4CY2A 5CXBB 3I7HA 2H14A 5HE1B 2I0TA 1N6EA 1PGUA 3EI1B 3FM0A 3NVQA 5FKQA 1YFQA 5A2Qg 1XHMA 3SLED 3EI4B 5HE0B 3I7OA 4BH6A 3AH8B 3IIYA 3DXKC 4PSXB 4UI9R 5IC7A 4PNKB 2IURA 2AQ5A 3SCYA 3UKRC 4JXMA 5H14A 4GGDA 5TEFA 4Y7RA 1PI6A 2O9KA 4J8GA 5FQDA 1JMZB 2OVQB 5CYKB 4X3EA 1NEXB 4GGAA 1NR0A 4J82A 2H47A 3JB9L 2H6NA 4CI1A 5IT9g 5IGQA 3E0CA 2P9PC 3N0DA 2PM6B 4ES0A 1P22A 4A09A 2B5MA 3F3GA 5TDHB 2H6QA 3W15A 3JPXA 5FKRA 3EI2B 3C5MA 4ERQA 2YBAA 2J55H 3IJ1A 4U7AA 3NVXA 1N6DA 5EM2B 3OKYA 3SVWD 3PVUB 1MG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MK0 B;  3RLM D;  1K8K C;  3IKO A;  4QL1 A;  5FLX g;  4GM3 A;  3UVO A;  2J57 G;  4I79 A;  2B5N A;  2GC4 A;  3U4Y A;  4CY3 A;  5K1C C;  3UVN A;  1L0Q A;  2UZY B;  3GFC A;  3V9F A;  3UVK A;  4CI3 A;  5EAP A;  2I0R A;  2AGX A;  2PM9 A;  4CI2 A;  2BCJ B;  2Q7Q A;  4LG9 A;  5B4W A;  2OJY A;  4J78 A;  2OVP B;  1U4C A;  4U1E I;  4KFM B;  4FAV D;  2TRC B;  4A08 B;  5I5I A;  5GSA A;  2H13 A;  3ODT A;  2CO0 A;  4OWR A;  4X63 B;  1S4U X;  4FA9 D;  4A11 A;  2AH0 A;  3EG6 A;  4BUJ C;  2OK4 A;  2UZX B;  4JSN C;  2HES X;  2P9L C;  2HKM A;  4GQB B;  3SHF A;  3SWS D;  4L3H D;  3EI3 B;  1GP2 B;  2P9K C;  3IJ0 A;  4J0W A;  4PSW B;  3V5W B;  5CXC B;  4JSP C;  3RFG A;  4AEZ A;  3OL2 A;  5FXY A;  4Z8L A;  3OKW A;  4E5Z A;  3JZG A;  5H17 A;  3KRW B;  5SXM A;  4O1Q D;  4A0B A;  4JT5 C;  4EWR A;  1XKS A;  3AL9 A;  2P9U C;  4GM9 A;  2AH1 A;  2QXV A;  3JZH A;  4FA1 D;  2YMU A;  2PM7 B;  3PXW D;  4ZN4 A;  3BG0 A;  4X60 B;  3OKT A;  1GG2 B;  3SXT D;  4JSX C;  2IUQ A;  1XIP A;  4IMM A;  4CZV A;  2YNO A;  5KDO B;  5IJ7 E;  2H9N A;  4H5J A;  1SHY B;  2YNP A;  4HDJ A;  3GRE A;  3SBR A;  5EML B;  4YVD A;  2CO0 C;  3IJC A;  5K19 A;  2CN2 A;  1GXR A;  4NSX A;  3I7L A;  1JJU B;  3OW8 A;  2G9A A;  1ERJ A;  2I3S A;  4K3I D;  3EU7 A;  1R5M A;  4GZ8 A;  4FB1 D;  4XEI C;  4ZOZ A;  3JZN A;  3MKS B;  5HYN B;  3C99 A;  3RRM C;  1SQJ A;  3KRX B;  2MTA H;  5I5J A;  3CFS B;  3RN1 D;  4FA4 D;  3SBQ A;  5H1M A;  2H6K A;  4E54 A;  3ZWL B;  1SQ9 A;  4A09 B;  5HE2 B;  1MDA H;  3OKY B;  5TEE A;  3K26 A;  3MMY A;  1TBG A;  4FAN D;  2P9I C;  3I2N A;  3V7D B;  2XL2 A;  3CFV A;  2IAA A;  1FWX A;  5TF2 A;  1K32 A;  1TYQ C;  4XYH A;  5GXH A;  1B9Y A;  5EAR A;  4LG8 A;  5AMS A;  2XL3 A;  3VA6 A;  3J80 g;  2IWF A;  4A0A A;  3PE7 A;  4XYI A;  5EAL A;  3DSM A;  3MXX A;  4A2M A;  4CY1 A;  1QNI A;  2CNX A;  4ERY A;  4X61 B;  4J87 A;  2CN3 A;  1RI6 A;  3DM0 A;  2H9P A;  2P9S C;  3AFC A;  3AL8 A;  4A11 B;  4CI8 A;  1A0R B;  3MKQ A;  4J77 A;  3EI3 A;  5AJA A;  3PSL A;  2XYI A;  4N14 A;  1JOF A;  3I7P A;  4QT8 A;  4ERZ A;  3F3P A;  4J79 A;  3OL2 B;  4E5Z B;  2AGL A;  2G99 A;  4A0B B;  5CXB A;  2W18 A;  3PXT D;  5HQG A;  1U2V C;  4D6V A;  3EI1 A;  3SBP A;  2OK6 A;  4JSV C;  5EAM A;  4JT6 C;  2H9L A;  3MZK A;  3RSE C;  2AGZ A;  3EI4 A;  4O9D A;  3RN0 D;  4H5I A;  1JMX B;  3F3F A;  4OZU A;  2GNQ A;  4PBZ A;  1OLZ A;  2B4E A;  3C75 H;  2Z2N A;  2HJ4 A;  3N0E A;  4LGN A;  4PC0 A;  3FRX A;  1VYH C;  5EMM B;  2CE9 A;  1OMW B;  1MG3 A;  5CYK A;  4ZOX A;  4J86 A;  5I5M A;  2BBK H;  2GC7 A;  3IIW A;  3UVL A;  4CZY A;  3EWE A;  4J73 A;  3FGB A;  2HYE A;  4GQ2 P;  5FKS A;  3RMZ D;  5JWZ A;  2AGY A;  2H68 A;  3P4F A;  4FWW A;  5EMJ B;  3DWL C;  5FA5 B;  3SN6 B;  3B7F A;  4FA5 D;  5FKT A;  3EI2 A;  5THA A;  3RFH A;  4QQE A;  5EM2 A;  3SFZ A;  3VH0 A;  4GM8 A;  4ZOY A;  2XU7 A;  3CIK B;  4QRJ A;  4J84 A;  4PXW A;  2B5L A;  4L3G D;  4J8B A;  3A0F A;  4E54 B;  4L9O A;  2Z2O A;  3OTT A;  4O45 A;  4FHL A;  3MZL A;  1PBY B;  4G56 B;  3BWS A;  2IWK A;  4IA9 A;  3I8C A;  4J0X A;  4TZ4 A;  3ORV D;  2P9N C;  5C2V B;  3UR4 A;  3BG1 A;  3I89 A;  4O3U B;  3EMH A;  2YB8 B;  2PM9 B;  5EMK B;  1N6F A;  2IUV A;  3HFQ A;  3ULE C;  3DXM C;  3PVW B;  3SJL D;  4K3J B;  2PBI B;  4Y5R D;  1PEV A;  3JRP A;  2H3X A;  4A08 A;  3I8E A;  3K27 A;  2I0S A;  3PXS D;  4BL0 A;  3NVN A;  3SMR A;  4R7A B;  2YNN A;  4A0A B;  4AOW A;  2H9M A;  4ESG A;  1GOT B;  3L4M D;  4ZOV A;  3VGZ A;  2EBS A;  1B9X A;  5GMK n;  2Z2P A;  4J81 A;  5C9Z B;  4GMB A;  4L1Q D;  2OIZ A;  3JRO A;  2IUP A;  5IJ8 E;  1Q47 A;  5CXC A;  4CY5 A;  5GXI A;  4GQ1 A;  2HKR A;  4D0K A;  3AL8 B;  4A2L A;  3UVM A;  4O3T B;  2OVR B;  3C9C A;  3JAM g;  5HE3 B;  4JD2 C;  3L4O D;  5AFU 3;  2HXC A;  3I7K A;  3J81 g;  2QC5 A;  4PBY A;  2CE8 A;  4GGC A;  4A7J A;  3PSC B;  5IGO A;  5C2W B;  4CZX A;  2AGW A;  3I7N A;  3UKU C;  2I3T A;  2HJB A;  2J56 H;  4CC9 A;  4CY2 A;  5CXB B;  3I7H A;  2H14 A;  5HE1 B;  2I0T A;  1N6E A;  1PGU A;  3EI1 B;  3FM0 A;  3NVQ A;  5FKQ A;  1YFQ A;  5A2Q g;  1XHM A;  3SLE D;  3EI4 B;  5HE0 B;  3I7O A;  4BH6 A;  3AH8 B;  3IIY A;  3DXK C;  4PSX B;  4UI9 R;  5IC7 A;  4PNK B;  2IUR A;  2AQ5 A;  3SCY A;  3UKR C;  4JXM A;  5H14 A;  4GGD A;  5TEF A;  4Y7R A;  1PI6 A;  2O9K A;  4J8G A;  5FQD A;  1JMZ B;  2OVQ B;  5CYK B;  4X3E A;  1NEX B;  4GGA A;  1NR0 A;  4J82 A;  2H47 A;  3JB9 L;  2H6N A;  4CI1 A;  5IT9 g;  5IGQ A;  3E0C A;  2P9P C;  3N0D A;  2PM6 B;  4ES0 A;  1P22 A;  4A09 A;  2B5M A;  3F3G A;  5TDH B;  2H6Q A;  3W15 A;  3JPX A;  5FKR A;  3EI2 B;  3C5M A;  4ERQ A;  2YBA A;  2J55 H;  3IJ1 A;  4U7A A;  3NVX A;  1N6D A;  5EM2 B;  3OKY A;  3SVW D;  3PVU B;  1MG2 A; 
#chains in the Genus database with same CATH topology
 4MK0 B;  3O4G A;  3RLM D;  5E6R A;  4NAA A;  1K8K C;  3IKO A;  2QR5 A;  4QL1 A;  3VI4 A;  5FLX g;  4GM3 A;  3UVO A;  2J57 G;  4I79 A;  2B5N A;  2GC4 A;  3U4Y A;  4CY3 A;  5K1C C;  3UVN A;  1L0Q A;  4G1M A;  3K72 A;  2UZY B;  3GFC A;  3V9F A;  3UVK A;  4CI3 A;  5EAP A;  2I0R A;  2AGX A;  2PM9 A;  4CI2 A;  2BCJ B;  2Q7Q A;  4LG9 A;  3EQ9 A;  5B4W A;  2OJY A;  4J78 A;  5M5U A;  2OVP B;  1U4C A;  1VZ3 A;  4KFM B;  4U1E I;  3IUR A;  4FAV D;  2TRC B;  4A08 B;  4WK2 A;  5I5I A;  2HU7 A;  5GSA A;  4L1M A;  2H13 A;  2XDW A;  3ODT A;  2CO0 A;  4OWR A;  4MMY A;  4X63 B;  1S4U X;  1L5G A;  1E8N A;  5HDB A;  4FA9 D;  4A11 A;  2AH0 A;  3EG6 A;  4BUJ C;  2OK4 A;  2UZX B;  4G55 A;  4JSN C;  3IUL A;  1I2M B;  2HES X;  2P9L C;  2HKM A;  4GQB B;  3FCS A;  3SHF A;  3SWS D;  4D9S A;  1K3I A;  3EI3 B;  1GP2 B;  2P9K C;  3IJ0 A;  4J0W A;  4L3H D;  4PSW B;  5CXC B;  4JSP C;  3V5W B;  3RFG A;  4AEZ A;  3OL2 A;  5FXY A;  4Z8L A;  3OKW A;  4E5Z A;  3JZG A;  5H17 A;  3ZDZ A;  1UOO A;  1GOH A;  3KRW B;  5SXM A;  4O1Q D;  4A0B A;  4JT5 C;  4EWR A;  3VI3 A;  2BKL A;  1XKS A;  3AL9 A;  2P9U C;  4GM9 A;  4NEN A;  3GD1 I;  2AH1 A;  2QXV A;  3JZH A;  4FA1 D;  2YMU A;  2PM7 B;  3PXW D;  4ZN4 A;  3BG0 A;  4X60 B;  3OKT A;  2EIB A;  4AN1 A;  1GG2 B;  3SXT D;  4JSX C;  2IUQ A;  1XIP A;  4IMM A;  4CZV A;  5C92 A;  2YNO A;  5KDO B;  5IJ7 E;  2H9N A;  4H5J A;  3IUM A;  1SHY B;  3O4H A;  2YNP A;  4HDJ A;  2WQ8 A;  1E5T A;  3GRE A;  3SBR A;  5EML B;  4YVD A;  2CO0 C;  3IJC A;  5K19 A;  2CN2 A;  1GXR A;  4AMY A;  4NSX A;  3I7L A;  1JJU B;  3OW8 A;  4UM9 A;  2G9A A;  1ERJ A;  2I3S A;  4K3I D;  3EU7 A;  1R5M A;  3IUQ A;  4GZ8 A;  4O2W A;  4FB1 D;  4XEI C;  4ZOZ A;  3JZN A;  2EIC A;  3ZDX A;  3MKS B;  5HYN B;  3C99 A;  3RRM C;  1SQJ A;  3KRX B;  2MTA H;  1A12 A;  5I5J A;  3O4I A;  3CFS B;  5M5V A;  3RN1 D;  4FA4 D;  2VDQ A;  3SBQ A;  5H1M A;  2H6K A;  3ZE0 A;  4E54 A;  3ZWL B;  1SQ9 A;  1GOF A;  4A09 B;  5HE2 B;  4Z7N A;  2XE4 A;  1MDA H;  5E6U A;  3OKY B;  5TEE A;  3K26 A;  3MMY A;  1TBG A;  4FAN D;  2EID A;  2P9I C;  3I2N A;  4MMZ A;  3IUJ A;  2VZ3 A;  3V7D B;  2XL2 A;  3CFV A;  4Z7O A;  2IAA A;  1FWX A;  5TF2 A;  1K32 A;  1TYQ C;  3ZE2 A;  4XYH A;  5GXH A;  2VDM A;  1B9Y A;  5EAR A;  4LG8 A;  5AMS A;  2XL3 A;  2VZ1 A;  4AN0 A;  1UOQ A;  4DNU A;  3VA6 A;  3J80 g;  2IWF A;  2HU8 A;  4A0A A;  3PE7 A;  4JHP C;  1H2Y A;  4XYI A;  5EAL A;  4DNV A;  3DSM A;  3K71 A;  3MXX A;  4NBM A;  4A2M A;  3K6S A;  1C9L A;  4CY1 A;  1QNI A;  2CNX A;  4ERY A;  2VC2 A;  3EQ8 A;  4DNW A;  4X61 B;  4J87 A;  4AMZ A;  2CN3 A;  3T3M A;  1RI6 A;  3DM0 A;  3NID A;  3MVD K;  2H9P A;  2P9S C;  2XZG A;  3AFC A;  3AL8 A;  3QHY B;  4A11 B;  4CI8 A;  1A0R B;  4IRZ A;  3EQ7 A;  3MKQ A;  4J77 A;  3EI3 A;  5AJA A;  3PSL A;  2XYI A;  4N14 A;  1JOF A;  1UTC A;  3I7P A;  4BCD A;  4WK4 A;  4QT8 A;  4ERZ A;  3F3P A;  1T2X A;  4G1E A;  3OL2 B;  4J79 A;  4E5Z B;  2AGL A;  3V4V A;  2G99 A;  4UM8 A;  4A0B B;  5CXB A;  2W18 A;  3PXT D;  4MMX A;  5HQG A;  3ZDY A;  1U2V C;  2VDN A;  4D6V A;  3EI1 A;  3SBP A;  2OK6 A;  4JSV C;  5EAM A;  4JT6 C;  4BP8 A;  1BPO A;  2H9L A;  3MZK A;  1O6G A;  3RSE C;  2AGZ A;  5C86 A;  3EI4 A;  4O9D A;  3RN0 D;  4H5I A;  1JMX B;  3F3F A;  4RE6 A;  1QFM A;  1GOG A;  4OZU A;  2GNQ A;  4PBZ A;  1OLZ A;  3NIF A;  2B4E A;  3C75 H;  2Z2N A;  2HJ4 A;  4JHN A;  3N0E A;  4LGN A;  5M5T A;  4PC0 A;  3FRX A;  1QFS A;  1VYH C;  5EMM B;  2CE9 A;  1TYE A;  4BCB A;  1OMW B;  1MG3 A;  5CYK A;  4ZOX A;  4J86 A;  5I5M A;  2BBK H;  2GC7 A;  1VE7 A;  2QZP A;  3IIW A;  3UVL A;  4CZY A;  3EWE A;  4J73 A;  3FGB A;  2HYE A;  4GQ2 P;  5FKS A;  3RMZ D;  4NC4 A;  5JWZ A;  2AGY A;  2H68 A;  3MUO A;  3P4F A;  4FWW A;  5EMJ B;  3DWL C;  5FA5 B;  3SN6 B;  3B7F A;  4FA5 D;  1VZ2 A;  5E6S A;  5FKT A;  3EI2 A;  5THA A;  3RFH A;  4QQE A;  5EM2 A;  3SFZ A;  3VH0 A;  4GM8 A;  4ZOY A;  2XU7 A;  3CIK B;  2VDK A;  4QRJ A;  4J84 A;  4PXW A;  2B5L A;  4L3G D;  4J8B A;  3A0F A;  1YR2 A;  4E54 B;  3FCU A;  3T3P A;  4L9O A;  2Z2O A;  3OTT A;  4O45 A;  4FHL A;  5FFG A;  3MZL A;  1PBY B;  4G56 B;  3BWS A;  2IWK A;  3KCI A;  4IA9 A;  3I8C A;  4J0X A;  4TZ4 A;  5M61 A;  3ORV D;  1U8C A;  2P9N C;  3QI0 A;  4BCC A;  3UR4 A;  5C2V B;  3BG1 A;  4BP9 A;  3GC3 B;  3I89 A;  4O3U B;  3EMH A;  2YB8 B;  2PM9 B;  5EMK B;  1N6F A;  2IUV A;  3HFQ A;  2VDP A;  1JTD B;  3ULE C;  3DXM C;  3PVW B;  3SJL D;  4K3J B;  2PBI B;  4Y5R D;  1PEV A;  3JRP A;  2H3X A;  3V4P A;  3ZE1 A;  4A08 A;  3I8E A;  3K27 A;  2I0S A;  1C9I A;  3PXS D;  4BL0 A;  2VDO A;  3NVN A;  4Z7Q A;  3SMR A;  4R7A B;  2YNN A;  2VDL A;  4A0A B;  5M5R A;  4AOW A;  2H9M A;  4ESG A;  1GOT B;  3L4M D;  4ZOV A;  3VGZ A;  2EBS A;  1B9X A;  5GMK n;  2Z2P A;  4J81 A;  5C9Z B;  3O4J A;  4GMB A;  4L1Q D;  2OIZ A;  3JRO A;  2IUP A;  5IJ8 E;  1Q47 A;  5CXC A;  4CY5 A;  5GXI A;  4GQ1 A;  1H2Z A;  2HKR A;  4D0K A;  3AL8 B;  4A2L A;  3UVM A;  2JKX A;  3MUN A;  4O3T B;  2OVR B;  3C9C A;  3JAM g;  1E8M A;  1UOP A;  5HE3 B;  4JD2 C;  3L4O D;  5AFU 3;  2HXC A;  4RE5 A;  3I7K A;  4WJK A;  3J81 g;  2QC5 A;  4PBY A;  2CE8 A;  4GGC A;  4A7J A;  3PSC B;  5IGO A;  3IUN A;  5C2W B;  3DDU A;  4CZX A;  1VE6 A;  2AGW A;  3I7N A;  3UKU C;  2I3T A;  2HJB A;  2J56 H;  4CC9 A;  4CY2 A;  5CXB B;  3I7H A;  4WK0 A;  2HU5 A;  2H14 A;  5HE1 B;  2I0T A;  1N6E A;  1PGU A;  4O02 A;  4AX4 A;  3EI1 B;  1H2W A;  3FM0 A;  3NVQ A;  5FKQ A;  1YFQ A;  5A2Q g;  1XHM A;  3SLE D;  3EI4 B;  5HE0 B;  3I7O A;  4BH6 A;  3AH8 B;  3IIY A;  3IVM A;  3DXK C;  4PSX B;  4UI9 R;  5IC7 A;  4PNK B;  2IUR A;  2AQ5 A;  3SCY A;  3UKR C;  4JXM A;  5H14 A;  1M1X A;  4GGD A;  5TEF A;  4Y7R A;  1PI6 A;  1JV2 A;  2O9K A;  4J8G A;  5FQD A;  1JMZ B;  5FFO A;  3NIG A;  2OVQ B;  5CYK B;  4X3E A;  1NEX B;  4GGA A;  4QAM A;  5M5S A;  1NR0 A;  4J82 A;  2EIE A;  2H47 A;  3JB9 L;  2H6N A;  4CI1 A;  5IT9 g;  5IGQ A;  3E0C A;  2P9P C;  3N0D A;  2PM6 B;  4ES0 A;  1P22 A;  3OF7 A;  2VDR A;  4A09 A;  2B5M A;  1H2X A;  3F3G A;  5TDH B;  2H6Q A;  3W15 A;  3JPX A;  5FKR A;  3EI2 B;  3C5M A;  4ERQ A;  2YBA A;  2J55 H;  3IJ1 A;  3IJE A;  4U7A A;  1O6F A;  1N6D A;  3NVX A;  5EM2 B;  3OKY A;  3SVW D;  3PVU B;  1MG2 A; 
#chains in the Genus database with same CATH homology
 4MK0 B;  3RLM D;  1K8K C;  3IKO A;  4QL1 A;  5FLX g;  4GM3 A;  3UVO A;  2J57 G;  4I79 A;  2B5N A;  2GC4 A;  3U4Y A;  4CY3 A;  5K1C C;  3UVN A;  1L0Q A;  2UZY B;  3GFC A;  3V9F A;  3UVK A;  4CI3 A;  5EAP A;  2I0R A;  2AGX A;  2PM9 A;  4CI2 A;  2BCJ B;  2Q7Q A;  4LG9 A;  5B4W A;  2OJY A;  4J78 A;  2OVP B;  1U4C A;  4U1E I;  4KFM B;  4FAV D;  2TRC B;  4A08 B;  5I5I A;  5GSA A;  2H13 A;  3ODT A;  2CO0 A;  4OWR A;  4X63 B;  1S4U X;  4FA9 D;  4A11 A;  2AH0 A;  3EG6 A;  4BUJ C;  2OK4 A;  2UZX B;  4JSN C;  2HES X;  2P9L C;  2HKM A;  4GQB B;  3SHF A;  3SWS D;  4L3H D;  3EI3 B;  1GP2 B;  2P9K C;  3IJ0 A;  4J0W A;  4PSW B;  3V5W B;  5CXC B;  4JSP C;  3RFG A;  4AEZ A;  3OL2 A;  5FXY A;  4Z8L A;  3OKW A;  4E5Z A;  3JZG A;  5H17 A;  3KRW B;  5SXM A;  4O1Q D;  4A0B A;  4JT5 C;  4EWR A;  1XKS A;  3AL9 A;  2P9U C;  4GM9 A;  2AH1 A;  2QXV A;  3JZH A;  4FA1 D;  2YMU A;  2PM7 B;  3PXW D;  4ZN4 A;  3BG0 A;  4X60 B;  3OKT A;  1GG2 B;  3SXT D;  4JSX C;  2IUQ A;  1XIP A;  4IMM A;  4CZV A;  2YNO A;  5KDO B;  5IJ7 E;  2H9N A;  4H5J A;  1SHY B;  2YNP A;  4HDJ A;  3GRE A;  3SBR A;  5EML B;  4YVD A;  2CO0 C;  3IJC A;  5K19 A;  2CN2 A;  1GXR A;  4NSX A;  3I7L A;  1JJU B;  3OW8 A;  2G9A A;  1ERJ A;  2I3S A;  4K3I D;  3EU7 A;  1R5M A;  4GZ8 A;  4FB1 D;  4XEI C;  4ZOZ A;  3JZN A;  3MKS B;  5HYN B;  3C99 A;  3RRM C;  1SQJ A;  3KRX B;  2MTA H;  5I5J A;  3CFS B;  3RN1 D;  4FA4 D;  3SBQ A;  5H1M A;  2H6K A;  4E54 A;  3ZWL B;  1SQ9 A;  4A09 B;  5HE2 B;  1MDA H;  3OKY B;  5TEE A;  3K26 A;  3MMY A;  1TBG A;  4FAN D;  2P9I C;  3I2N A;  3V7D B;  2XL2 A;  3CFV A;  2IAA A;  1FWX A;  5TF2 A;  1K32 A;  1TYQ C;  4XYH A;  5GXH A;  1B9Y A;  5EAR A;  4LG8 A;  5AMS A;  2XL3 A;  3VA6 A;  3J80 g;  2IWF A;  4A0A A;  3PE7 A;  4XYI A;  5EAL A;  3DSM A;  3MXX A;  4A2M A;  4CY1 A;  1QNI A;  2CNX A;  4ERY A;  4X61 B;  4J87 A;  2CN3 A;  1RI6 A;  3DM0 A;  2H9P A;  2P9S C;  3AFC A;  3AL8 A;  4A11 B;  4CI8 A;  1A0R B;  3MKQ A;  4J77 A;  3EI3 A;  5AJA A;  3PSL A;  2XYI A;  4N14 A;  1JOF A;  3I7P A;  4QT8 A;  4ERZ A;  3F3P A;  4J79 A;  3OL2 B;  4E5Z B;  2AGL A;  2G99 A;  4A0B B;  5CXB A;  2W18 A;  3PXT D;  5HQG A;  1U2V C;  4D6V A;  3EI1 A;  3SBP A;  2OK6 A;  4JSV C;  5EAM A;  4JT6 C;  2H9L A;  3MZK A;  3RSE C;  2AGZ A;  3EI4 A;  4O9D A;  3RN0 D;  4H5I A;  1JMX B;  3F3F A;  4OZU A;  2GNQ A;  4PBZ A;  1OLZ A;  2B4E A;  3C75 H;  2Z2N A;  2HJ4 A;  3N0E A;  4LGN A;  4PC0 A;  3FRX A;  1VYH C;  5EMM B;  2CE9 A;  1OMW B;  1MG3 A;  5CYK A;  4ZOX A;  4J86 A;  5I5M A;  2BBK H;  2GC7 A;  3IIW A;  3UVL A;  4CZY A;  3EWE A;  4J73 A;  3FGB A;  2HYE A;  4GQ2 P;  5FKS A;  3RMZ D;  5JWZ A;  2AGY A;  2H68 A;  3P4F A;  4FWW A;  5EMJ B;  3DWL C;  5FA5 B;  3SN6 B;  3B7F A;  4FA5 D;  5FKT A;  3EI2 A;  5THA A;  3RFH A;  4QQE A;  5EM2 A;  3SFZ A;  3VH0 A;  4GM8 A;  4ZOY A;  2XU7 A;  3CIK B;  4QRJ A;  4J84 A;  4PXW A;  2B5L A;  4L3G D;  4J8B A;  3A0F A;  4E54 B;  4L9O A;  2Z2O A;  3OTT A;  4O45 A;  4FHL A;  3MZL A;  1PBY B;  4G56 B;  3BWS A;  2IWK A;  4IA9 A;  3I8C A;  4J0X A;  4TZ4 A;  3ORV D;  2P9N C;  5C2V B;  3UR4 A;  3BG1 A;  3I89 A;  4O3U B;  3EMH A;  2YB8 B;  2PM9 B;  5EMK B;  1N6F A;  2IUV A;  3HFQ A;  3ULE C;  3DXM C;  3PVW B;  3SJL D;  4K3J B;  2PBI B;  4Y5R D;  1PEV A;  3JRP A;  2H3X A;  4A08 A;  3I8E A;  3K27 A;  2I0S A;  3PXS D;  4BL0 A;  3NVN A;  3SMR A;  4R7A B;  2YNN A;  4A0A B;  4AOW A;  2H9M A;  4ESG A;  1GOT B;  3L4M D;  4ZOV A;  3VGZ A;  2EBS A;  1B9X A;  5GMK n;  2Z2P A;  4J81 A;  5C9Z B;  4GMB A;  4L1Q D;  2OIZ A;  3JRO A;  2IUP A;  5IJ8 E;  1Q47 A;  5CXC A;  4CY5 A;  5GXI A;  4GQ1 A;  2HKR A;  4D0K A;  3AL8 B;  4A2L A;  3UVM A;  4O3T B;  2OVR B;  3C9C A;  3JAM g;  5HE3 B;  4JD2 C;  3L4O D;  5AFU 3;  2HXC A;  3I7K A;  3J81 g;  2QC5 A;  4PBY A;  2CE8 A;  4GGC A;  4A7J A;  3PSC B;  5IGO A;  5C2W B;  4CZX A;  2AGW A;  3I7N A;  3UKU C;  2I3T A;  2HJB A;  2J56 H;  4CC9 A;  4CY2 A;  5CXB B;  3I7H A;  2H14 A;  5HE1 B;  2I0T A;  1N6E A;  1PGU A;  3EI1 B;  3FM0 A;  3NVQ A;  5FKQ A;  1YFQ A;  5A2Q g;  1XHM A;  3SLE D;  3EI4 B;  5HE0 B;  3I7O A;  4BH6 A;  3AH8 B;  3IIY A;  3DXK C;  4PSX B;  4UI9 R;  5IC7 A;  4PNK B;  2IUR A;  2AQ5 A;  3SCY A;  3UKR C;  4JXM A;  5H14 A;  4GGD A;  5TEF A;  4Y7R A;  1PI6 A;  2O9K A;  4J8G A;  5FQD A;  1JMZ B;  2OVQ B;  5CYK B;  4X3E A;  1NEX B;  4GGA A;  1NR0 A;  4J82 A;  2H47 A;  3JB9 L;  2H6N A;  4CI1 A;  5IT9 g;  5IGQ A;  3E0C A;  2P9P C;  3N0D A;  2PM6 B;  4ES0 A;  1P22 A;  4A09 A;  2B5M A;  3F3G A;  5TDH B;  2H6Q A;  3W15 A;  3JPX A;  5FKR A;  3EI2 B;  3C5M A;  4ERQ A;  2YBA A;  2J55 H;  3IJ1 A;  4U7A A;  3NVX A;  1N6D A;  5EM2 B;  3OKY A;  3SVW D;  3PVU B;  1MG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...