4QL1A

Crystal structure of human wdr5 in complex with compound oicr-9429
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title Pharmacological targeting of the Wdr5-MLL interaction in C/EBP alpha N-terminal leukemia.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/inhibitor
total genus 107
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4ql1A00
4GM3A 1GOTB 3I2NA 4CZXA 3VA6A 2Q7QA 3C9CA 3RSEC 2H9PA 3MMYA 5KDOB 2H68A 2J56H 3JRPA 2UZYB 5AFU3 4J87A 4FWWA 4FA1D 3AL9A 4PSXB 5GXHA 3PVUB 5A2Qg 4FHLA 2P9LC 2PM9A 3V5WB 4GM9A 4JSXC 3JZGA 4AOWA 3EI4A 3UR4A 3EWEA 2OIZA 3N0EA 4J84A 3JZNA 3RFHA 1JJUB 4A11A 4ZOVA 3OKYA 1JMXB 2YB8B 3IKOA 4JSNC 4GMBA 4A0AA 4IMMA 4PBZA 2I0TA 5FXYA 5AMSA 4XYIA 2HXCA 2MTAH 4FAVD 1U2VC 2PBIB 2IAAA 3KRWB 3MXXA 5GSAA 5TF2A 3CFVA 2AGLA 3VGZA 2CNXA 2UZXB 2OJYA 5IGOA 1A0RB 2P9NC 3MKSB 5HE3B 5HE0B 4O3TB 1GG2B 2HESX 5GMKn 4ERQA 2I3TA 2XU7A 3FGBA 2QXVA 3I8CA 2I0SA 4PSWB 3I7PA 3C5MA 5EAPA 3AL8A 4CZYA 5IJ8E 3BWSA 3I7LA 3PXSD 3DWLC 1OLZA 3C99A 1RI6A 2P9KC 1NEXB 3SVWD 2TRCB 5C9ZB 5THAA 4Z8LA 1PBYB 5K1CC 2GC4A 3J81g 4J8BA 5FA5B 2J57G 4L3GD 4BH6A 2IWFA 3EI3A 5FKRA 4JSPC 1L0QA 3AFCA 3RN0D 3SLED 2AGYA 3BG1A 1R5MA 4JD2C 4ESGA 1MDAH 1PEVA 4ERYA 5H17A 2AGZA 4LG9A 4L1QD 3DSMA 1PI6A 4TZ4A 2B4EA 2IURA 3EU7A 1B9YA 4XEIC 2YBAA 4A7JA 4X60B 4FA9D 3OTTA 2Z2NA 2CO0C 5HQGA 4O45A 3GFCA 3JPXA 4J86A 4ES0A 5I5MA 4H5IA 3KRXB 3EI1B 5EMMB 4E5ZB 4GM8A 4QQEA 5FLXg 4UI9R 5H1MA 1TYQC 2OVPB 3A0FA 1K8KC 3OL2B 4G56B 3EI2B 4CY1A 2H13A 4O1QD 5GXIA 5FQDA 2CN2A 5I5JA 2AQ5A 3SWSD 4GGDA 3SHFA 2CN3A 3UVLA 4CI3A 2IUQA 4QRJA 5HE1B 5CXCA 4FAND 1JMZB 1B9XA 4JSVC 2PM7B 1MG2A 5HYNB 4A2MA 2H47A 4IA9A 1QNIA 2B5NA 4J73A 1ERJA 4EWRA 1OMWB 3U4YA 4N14A 4CC9A 1XIPA 4K3ID 1SQJA 2P9IC 4XYHA 4LG8A 3AH8B 4FA5D 4U7AA 2BBKH 3PXTD 5TEFA 3ULEC 4YVDA 1GXRA 4GQ2P 2IUPA 4GGAA 2XYIA 2CE8A 5EAMA 2HKMA 2GC7A 5EARA 4X63B 1VYHC 5CXBB 3SBRA 5CYKB 5IT9g 3UVOA 2HJ4A 4QT8A 5EMLB 1JOFA 3RRMC 4Y5RD 1XKSA 3SJLD 4FA4D 4PBYA 1MG3A 4PXWA 3RN1D 2IWKA 5EM2B 3MZKA 2HYEA 3P4FA 3L4MD 3IJCA 4E54A 4X61B 2Z2OA 4FB1D 5B4WA 4H5JA 3W15A 3E0CA 3I7HA 2W18A 3JZHA 4A0BA 4A11B 4CY3A 5SXMA 3I7OA 3OKYB 3L4OD 5IJ7E 3OKWA 3VH0A 2G99A 2AH1A 3RLMD 3OW8A 4JT5C 1N6FA 4GZ8A 1GP2B 3UKRC 3I89A 3SN6B 1PGUA 3ZWLB 4A08B 4OZUA 1N6EA 5I5IA 2YNOA 3MKQA 2H9MA 2G9AA 4J82A 3EMHA 5IGQA 3SFZA 2Z2PA 3EI1A 4X3EA 3CIKB 4A09B 3CFSB 2QC5A 3EG6A 3RMZD 2J55H 3PE7A 3UVKA 2H6QA 3UVNA 5EMKB 2HJBA 5FKTA 3SMRA 3IIYA 3C75H 2I0RA 5K19A 2O9KA 5JWZA 2H9LA 2OK6A 3EI3B 4CI8A 4NSXA 3UVMA 5FKSA 4R7AB 2B5MA 3SBPA 4PC0A 1NR0A 3ORVD 5FKQA 1YFQA 2XL3A 3F3GA 1P22A 2P9SC 3IIWA 2AGWA 3I7KA 3OKTA 1XHMA 4L9OA 3DM0A 2H9NA 5C2VB 2EBSA 3ODTA 5CXBA 4O3UB 3FM0A 5CYKA 3SXTD 2CO0A 2H6KA 5TDHB 2YNPA 4CZVA 3JROA 3NVQA 4CI1A 4J8GA 3NVXA 2BCJB 3I7NA 3K27A 2P9PC 5EM2A 3SCYA 4BUJC 3GREA 3JB9L 4CY5A 5IC7A 3PSLA 3I8EA 3B7FA 3PVWB 2CE9A 4MK0B 4CY2A 2OVQB 1N6DA 3JAMg 4J0XA 4HDJA 3IJ1A 1U4CA 4JT6C 4JXMA 2PM9B 2I3SA 5AJAA 4CI2A 2AGXA 4J78A 3RFGA 4I79A 3FRXA 3EI4B 3V7DB 4J81A 4ERZA 3K26A 2XL2A 1K32A 4QL1A 3J80g 1SQ9A 4ZOYA 4A08A 5H14A 5C2WB 5CXCB 3DXMC 2GNQA 1TBGA 3DXKC 2OK4A 3PXWD 2YNNA 3F3PA 4A09A 4ZOZA 4GGCA 4A0AB 2AH0A 3IJ0A 4Y7RA 2IUVA 4OWRA 4ZN4A 1FWXA 4LGNA 4GQ1A 2YMUA 2H3XA 4D0KA 4GQBB 3N0DA 4J77A 2HKRA 5EMJB 4K3JB 4L3HD 3UKUC 2H14A 3BG0A 4ZOXA 4E5ZA 4D6VA 3MZLA 4KFMB 5HE2B 4U1EI 3SBQA 4E54B 2P9UC 3NVNA 2B5LA 5TEEA 4J0WA 4A2LA 4BL0A 1Q47A 5EALA 3OL2A 3F3FA 3EI2A 3AL8B 4A0BB 4PNKB 4O9DA 1S4UX 1SHYB 3PSCB 4AEZA 3HFQA 2PM6B 2H6NA 4J79A 2OVRB 3V9FA
chains in the Genus database with same CATH superfamily
3IULA 4GM3A 1GOTB 3I2NA 4CZXA 5M61A 1VE6A 3VA6A 1E5TA 2Q7QA 3V4VA 3C9CA 3RSEC 2H9PA 3MMYA 5KDOB 2H68A 1YR2A 2J56H 3JRPA 2UZYB 5AFU3 4JHPC 1QFSA 3ZE0A 4J87A 4FWWA 4FA1D 3AL9A 2VDMA 4PSXB 3EQ9A 5GXHA 2WQ8A 3PVUB 5A2Qg 4FHLA 2P9LC 4BCDA 2PM9A 3V5WB 4GM9A 4JSXC 3JZGA 4AOWA 3EI4A 3UR4A 3EWEA 2OIZA 1U8CA 3N0EA 2VZ1A 3O4GA 4J84A 1A12A 4G1EA 3JZNA 3RFHA 1JJUB 4A11A 3NIDA 4ZOVA 3IUMA 4G1MA 3OKYA 1JMXB 2YB8B 3IKOA 4MMXA 4JSNC 2VDQA 4GMBA 3EQ8A 4A0AA 4IMMA 4PBZA 2I0TA 4AMYA 5FXYA 5AMSA 4XYIA 5FFOA 3K71A 2HXCA 2MTAH 4FAVD 1C9LA 1U2VC 2EIBA 2PBIB 2IAAA 1JV2A 3KRWB 3MXXA 4G55A 3GC3B 5TF2A 3CFVA 5GSAA 2AGLA 3VGZA 2JKXA 2CNXA 2UZXB 4Z7QA 2OJYA 5IGOA 1A0RB 2P9NC 3MKSB 5HE3B 4RE6A 2VDLA 5HE0B 4O3TB 1GG2B 2HESX 5GMKn 4ERQA 2I3TA 2XU7A 1L5GA 4AX4A 3FGBA 2QXVA 3I8CA 4AMZA 4NAAA 2I0SA 4PSWB 3I7PA 3C5MA 5EAPA 3AL8A 4CZYA 5IJ8E 3BWSA 3I7LA 4BP9A 3PXSD 3DWLC 1OLZA 3C99A 1RI6A 2P9KC 1NEXB 3SVWD 4RE5A 2TRCB 5C9ZB 5THAA 4O02A 4Z8LA 1PBYB 2EICA 2GC4A 5K1CC 3J81g 4J8BA 5FA5B 2J57G 4L3GD 4BH6A 2IWFA 3EI3A 3K6SA 5FKRA 4JSPC 1L0QA 3AFCA 3QHYB 3RN0D 3SLED 2AGYA 3BG1A 1R5MA 4JD2C 4ESGA 1MDAH 1PEVA 4ERYA 5H17A 2AGZA 4LG9A 1H2XA 1GOHA 4L1QD 4D9SA 3DSMA 1PI6A 3NIFA 4TZ4A 2VZ3A 1QFMA 2B4EA 2IURA 2BKLA 3EU7A 1B9YA 4XEIC 4QAMA 2XDWA 2YBAA 2XZGA 4A7JA 4MMZA 4X60B 3T3MA 4FA9D 3OTTA 2Z2NA 2CO0C 5HQGA 4O45A 3GFCA 3JPXA 4J86A 5HDBA 4DNVA 3IUJA 4ES0A 4NBMA 5I5MA 4H5IA 3KRXB 3EI1B 5EMMB 1VZ3A 4E5ZB 3IUQA 4GM8A 4QQEA 4BP8A 5FLXg 4UI9R 5H1MA 1TYQC 2OVPB 4WK2A 3A0FA 1K8KC 1O6FA 2VC2A 3OL2B 4G56B 3EI2B 4CY1A 2H13A 4O1QD 5GXIA 1UOQA 2CN2A 5FQDA 5I5JA 2AQ5A 3SWSD 4GGDA 3SHFA 2CN3A 3UVLA 4CI3A 2IUQA 3GD1I 4QRJA 5HE1B 1H2ZA 5CXCA 4FAND 1JMZB 1B9XA 2PM7B 2HU5A 1MG2A 4JSVC 5HYNB 3O4IA 4A2MA 2H47A 4IA9A 1QNIA 4BCCA 2B5NA 4J73A 1ERJA 4EWRA 1OMWB 3U4YA 4N14A 4CC9A 1H2YA 1XIPA 3O4HA 4K3ID 5M5TA 1SQJA 2P9IC 4WJKA 4XYHA 4Z7OA 4LG8A 3VI3A 3AH8B 4FA5D 4U7AA 2BBKH 3PXTD 4DNUA 5TEFA 3ULEC 4YVDA 1GXRA 4GQ2P 2IUPA 4GGAA 2XYIA 2CE8A 5EAMA 5M5SA 2HKMA 2GC7A 4MMYA 4NENA 5EARA 4L1MA 4X63B 2HU7A 1VYHC 3OF7A 5CXBB 3SBRA 5CYKB 5IT9g 3UVOA 2HJ4A 4QT8A 5EMLB 1JOFA 3RRMC 3K72A 4Y5RD 1XKSA 3SJLD 4FA4D 4PBYA 1MG3A 4PXWA 3RN1D 2IWKA 5EM2B 3MZKA 2HYEA 3P4FA 3L4MD 3NIGA 3IJCA 4WK0A 4E54A 4X61B 2Z2OA 4FB1D 5B4WA 4H5JA 3W15A 3E0CA 3I7HA 2W18A 3JZHA 4A0BA 4A11B 4CY3A 5SXMA 3I7OA 3O4JA 3OKYB 1K3IA 1E8MA 3L4OD 5IJ7E 3OKWA 3IUNA 3VH0A 1O6GA 4Z7NA 2G99A 3MUOA 2AH1A 3RLMD 3OW8A 2EIEA 1N6FA 4JT5C 4GZ8A 1GP2B 3UKRC 3I89A 3SN6B 1PGUA 3ZWLB 4A08B 4OZUA 1N6EA 5I5IA 3FCUA 2YNOA 3MKQA 2H9MA 3V4PA 3KCIA 1GOGA 2G9AA 4WK4A 4J82A 3EMHA 5IGQA 3SFZA 2Z2PA 3EI1A 4X3EA 3CIKB 4A09B 4O2WA 3CFSB 2QC5A 3EG6A 3RMZD 1TYEA 2J55H 3PE7A 3MUNA 3UVKA 2H6QA 1UOPA 3UVNA 2VDKA 2VDOA 2HJBA 5EMKB 5FKTA 3SMRA 3IIYA 3IVMA 3C75H 2I0RA 1GOFA 5K19A 2O9KA 2QR5A 5E6SA 5JWZA 2H9LA 2OK6A 3EI3B 4CI8A 4NSXA 3UVMA 5FKSA 4R7AB 4UM9A 2B5MA 3SBPA 2VDNA 4PC0A 1NR0A 3ORVD 3ZE1A 1VE7A 5FKQA 1BPOA 4IRZA 1YFQA 2XL3A 5C86A 1I2MB 3F3GA 1P22A 5M5UA 2P9SC 5M5RA 3ZDYA 3IIWA 2AGWA 3I7KA 3OKTA 1XHMA 4L9OA 3DM0A 2H9NA 1C9IA 5C2VB 2EBSA 3ODTA 5CXBA 4O3UB 3FM0A 5CYKA 3SXTD 2CO0A 2H6KA 5TDHB 2YNPA 3ZDZA 4AN1A 4CZVA 3JROA 3NVQA 3VI4A 4CI1A 4J8GA 3NVXA 2BCJB 5M5VA 4BCBA 3I7NA 3K27A 2P9PC 5EM2A 3T3PA 2QZPA 3SCYA 4BUJC 3GREA 3JB9L 5E6RA 4CY5A 5IC7A 3PSLA 3I8EA 2XE4A 3B7FA 3IURA 3PVWB 2CE9A 4MK0B 4CY2A 2OVQB 1N6DA 3JAMg 4J0XA 3DDUA 4HDJA 4JHNA 3IJ1A 1U4CA 4JT6C 4JXMA 2PM9B 2I3SA 5AJAA 4CI2A 2AGXA 1T2XA 4J78A 3RFGA 4I79A 3FRXA 3EI4B 3V7DB 4J81A 4ERZA 3K26A 2XL2A 1K32A 4QL1A 5FFGA 3J80g 1SQ9A 1JTDB 4ZOYA 4A08A 5H14A 5C2WB 5CXCB 3DXMC 2GNQA 1TBGA 2HU8A 3DXKC 3ZE2A 3QI0A 2OK4A 3PXWD 4DNWA 5E6UA 2YNNA 3F3PA 1UOOA 4A09A 3EQ7A 4ZOZA 4GGCA 4A0AB 2AH0A 3IJ0A 4Y7RA 1E8NA 2IUVA 4OWRA 4ZN4A 4AN0A 5C92A 1FWXA 4LGNA 3FCSA 4GQ1A 1H2WA 2YMUA 2H3XA 4D0KA 2VDRA 4GQBB 3N0DA 4J77A 2HKRA 5EMJB 4K3JB 4L3HD 3UKUC 2H14A 3BG0A 1M1XA 1VZ2A 4ZOXA 4E5ZA 4D6VA 3ZDXA 3MZLA 4KFMB 5HE2B 4U1EI 3SBQA 4E54B 2P9UC 3NVNA 2B5LA 3IJEA 5TEEA 4UM8A 3MVDK 2EIDA 1UTCA 4J0WA 4A2LA 2VDPA 1Q47A 4BL0A 5EALA 3OL2A 4NC4A 3F3FA 3EI2A 3AL8B 4A0BB 4PNKB 4O9DA 1S4UX 1SHYB 3PSCB 4AEZA 3HFQA 2PM6B 2H6NA 4J79A 2OVRB 3V9FA
chains in the Genus database with same CATH topology
4GM3A 1GOTB 3I2NA 4CZXA 3VA6A 2Q7QA 3C9CA 3RSEC 2H9PA 3MMYA 5KDOB 2H68A 2J56H 3JRPA 2UZYB 5AFU3 4J87A 4FWWA 4FA1D 3AL9A 4PSXB 5GXHA 3PVUB 5A2Qg 4FHLA 2P9LC 2PM9A 3V5WB 4GM9A 4JSXC 3JZGA 4AOWA 3EI4A 3UR4A 3EWEA 2OIZA 3N0EA 4J84A 3JZNA 3RFHA 1JJUB 4A11A 4ZOVA 3OKYA 1JMXB 2YB8B 3IKOA 4JSNC 4GMBA 4A0AA 4IMMA 4PBZA 2I0TA 5FXYA 5AMSA 4XYIA 2HXCA 2MTAH 4FAVD 1U2VC 2PBIB 2IAAA 3KRWB 3MXXA 5GSAA 5TF2A 3CFVA 2AGLA 3VGZA 2CNXA 2UZXB 2OJYA 5IGOA 1A0RB 2P9NC 3MKSB 5HE3B 5HE0B 4O3TB 1GG2B 2HESX 5GMKn 4ERQA 2I3TA 2XU7A 3FGBA 2QXVA 3I8CA 2I0SA 4PSWB 3I7PA 3C5MA 5EAPA 3AL8A 4CZYA 5IJ8E 3BWSA 3I7LA 3PXSD 3DWLC 1OLZA 3C99A 1RI6A 2P9KC 1NEXB 3SVWD 2TRCB 5C9ZB 5THAA 4Z8LA 1PBYB 5K1CC 2GC4A 3J81g 4J8BA 5FA5B 2J57G 4L3GD 4BH6A 2IWFA 3EI3A 5FKRA 4JSPC 1L0QA 3AFCA 3RN0D 3SLED 2AGYA 3BG1A 1R5MA 4JD2C 4ESGA 1MDAH 1PEVA 4ERYA 5H17A 2AGZA 4LG9A 4L1QD 3DSMA 1PI6A 4TZ4A 2B4EA 2IURA 3EU7A 1B9YA 4XEIC 2YBAA 4A7JA 4X60B 4FA9D 3OTTA 2Z2NA 2CO0C 5HQGA 4O45A 3GFCA 3JPXA 4J86A 4ES0A 5I5MA 4H5IA 3KRXB 3EI1B 5EMMB 4E5ZB 4GM8A 4QQEA 5FLXg 4UI9R 5H1MA 1TYQC 2OVPB 3A0FA 1K8KC 3OL2B 4G56B 3EI2B 4CY1A 2H13A 4O1QD 5GXIA 5FQDA 2CN2A 5I5JA 2AQ5A 3SWSD 4GGDA 3SHFA 2CN3A 3UVLA 4CI3A 2IUQA 4QRJA 5HE1B 5CXCA 4FAND 1JMZB 1B9XA 4JSVC 2PM7B 1MG2A 5HYNB 4A2MA 2H47A 4IA9A 1QNIA 2B5NA 4J73A 1ERJA 4EWRA 1OMWB 3U4YA 4N14A 4CC9A 1XIPA 4K3ID 1SQJA 2P9IC 4XYHA 4LG8A 3AH8B 4FA5D 4U7AA 2BBKH 3PXTD 5TEFA 3ULEC 4YVDA 1GXRA 4GQ2P 2IUPA 4GGAA 2XYIA 2CE8A 5EAMA 2HKMA 2GC7A 5EARA 4X63B 1VYHC 5CXBB 3SBRA 5CYKB 5IT9g 3UVOA 2HJ4A 4QT8A 5EMLB 1JOFA 3RRMC 4Y5RD 1XKSA 3SJLD 4FA4D 4PBYA 1MG3A 4PXWA 3RN1D 2IWKA 5EM2B 3MZKA 2HYEA 3P4FA 3L4MD 3IJCA 4E54A 4X61B 2Z2OA 4FB1D 5B4WA 4H5JA 3W15A 3E0CA 3I7HA 2W18A 3JZHA 4A0BA 4A11B 4CY3A 5SXMA 3I7OA 3OKYB 3L4OD 5IJ7E 3OKWA 3VH0A 2G99A 2AH1A 3RLMD 3OW8A 4JT5C 1N6FA 4GZ8A 1GP2B 3UKRC 3I89A 3SN6B 1PGUA 3ZWLB 4A08B 4OZUA 1N6EA 5I5IA 2YNOA 3MKQA 2H9MA 2G9AA 4J82A 3EMHA 5IGQA 3SFZA 2Z2PA 3EI1A 4X3EA 3CIKB 4A09B 3CFSB 2QC5A 3EG6A 3RMZD 2J55H 3PE7A 3UVKA 2H6QA 3UVNA 5EMKB 2HJBA 5FKTA 3SMRA 3IIYA 3C75H 2I0RA 5K19A 2O9KA 5JWZA 2H9LA 2OK6A 3EI3B 4CI8A 4NSXA 3UVMA 5FKSA 4R7AB 2B5MA 3SBPA 4PC0A 1NR0A 3ORVD 5FKQA 1YFQA 2XL3A 3F3GA 1P22A 2P9SC 3IIWA 2AGWA 3I7KA 3OKTA 1XHMA 4L9OA 3DM0A 2H9NA 5C2VB 2EBSA 3ODTA 5CXBA 4O3UB 3FM0A 5CYKA 3SXTD 2CO0A 2H6KA 5TDHB 2YNPA 4CZVA 3JROA 3NVQA 4CI1A 4J8GA 3NVXA 2BCJB 3I7NA 3K27A 2P9PC 5EM2A 3SCYA 4BUJC 3GREA 3JB9L 4CY5A 5IC7A 3PSLA 3I8EA 3B7FA 3PVWB 2CE9A 4MK0B 4CY2A 2OVQB 1N6DA 3JAMg 4J0XA 4HDJA 3IJ1A 1U4CA 4JT6C 4JXMA 2PM9B 2I3SA 5AJAA 4CI2A 2AGXA 4J78A 3RFGA 4I79A 3FRXA 3EI4B 3V7DB 4J81A 4ERZA 3K26A 2XL2A 1K32A 4QL1A 3J80g 1SQ9A 4ZOYA 4A08A 5H14A 5C2WB 5CXCB 3DXMC 2GNQA 1TBGA 3DXKC 2OK4A 3PXWD 2YNNA 3F3PA 4A09A 4ZOZA 4GGCA 4A0AB 2AH0A 3IJ0A 4Y7RA 2IUVA 4OWRA 4ZN4A 1FWXA 4LGNA 4GQ1A 2YMUA 2H3XA 4D0KA 4GQBB 3N0DA 4J77A 2HKRA 5EMJB 4K3JB 4L3HD 3UKUC 2H14A 3BG0A 4ZOXA 4E5ZA 4D6VA 3MZLA 4KFMB 5HE2B 4U1EI 3SBQA 4E54B 2P9UC 3NVNA 2B5LA 5TEEA 4J0WA 4A2LA 4BL0A 1Q47A 5EALA 3OL2A 3F3FA 3EI2A 3AL8B 4A0BB 4PNKB 4O9DA 1S4UX 1SHYB 3PSCB 4AEZA 3HFQA 2PM6B 2H6NA 4J79A 2OVRB 3V9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GM3 A;  1GOT B;  3I2N A;  4CZX A;  3VA6 A;  2Q7Q A;  3C9C A;  3RSE C;  2H9P A;  3MMY A;  5KDO B;  2H68 A;  2J56 H;  3JRP A;  2UZY B;  5AFU 3;  4J87 A;  4FWW A;  4FA1 D;  3AL9 A;  4PSX B;  5GXH A;  3PVU B;  5A2Q g;  4FHL A;  2P9L C;  2PM9 A;  3V5W B;  4GM9 A;  4JSX C;  3JZG A;  4AOW A;  3EI4 A;  3UR4 A;  3EWE A;  2OIZ A;  3N0E A;  4J84 A;  3JZN A;  3RFH A;  1JJU B;  4A11 A;  4ZOV A;  3OKY A;  1JMX B;  2YB8 B;  3IKO A;  4JSN C;  4GMB A;  4A0A A;  4IMM A;  4PBZ A;  2I0T A;  5FXY A;  5AMS A;  4XYI A;  2HXC A;  2MTA H;  4FAV D;  1U2V C;  2PBI B;  2IAA A;  3KRW B;  3MXX A;  5GSA A;  5TF2 A;  3CFV A;  2AGL A;  3VGZ A;  2CNX A;  2UZX B;  2OJY A;  5IGO A;  1A0R B;  2P9N C;  3MKS B;  5HE3 B;  5HE0 B;  4O3T B;  1GG2 B;  2HES X;  5GMK n;  4ERQ A;  2I3T A;  2XU7 A;  3FGB A;  2QXV A;  3I8C A;  2I0S A;  4PSW B;  3I7P A;  3C5M A;  5EAP A;  3AL8 A;  4CZY A;  5IJ8 E;  3BWS A;  3I7L A;  3PXS D;  3DWL C;  1OLZ A;  3C99 A;  1RI6 A;  2P9K C;  1NEX B;  3SVW D;  2TRC B;  5C9Z B;  5THA A;  4Z8L A;  1PBY B;  5K1C C;  2GC4 A;  3J81 g;  4J8B A;  5FA5 B;  2J57 G;  4L3G D;  4BH6 A;  2IWF A;  3EI3 A;  5FKR A;  4JSP C;  1L0Q A;  3AFC A;  3RN0 D;  3SLE D;  2AGY A;  3BG1 A;  1R5M A;  4JD2 C;  4ESG A;  1MDA H;  1PEV A;  4ERY A;  5H17 A;  2AGZ A;  4LG9 A;  4L1Q D;  3DSM A;  1PI6 A;  4TZ4 A;  2B4E A;  2IUR A;  3EU7 A;  1B9Y A;  4XEI C;  2YBA A;  4A7J A;  4X60 B;  4FA9 D;  3OTT A;  2Z2N A;  2CO0 C;  5HQG A;  4O45 A;  3GFC A;  3JPX A;  4J86 A;  4ES0 A;  5I5M A;  4H5I A;  3KRX B;  3EI1 B;  5EMM B;  4E5Z B;  4GM8 A;  4QQE A;  5FLX g;  4UI9 R;  5H1M A;  1TYQ C;  2OVP B;  3A0F A;  1K8K C;  3OL2 B;  4G56 B;  3EI2 B;  4CY1 A;  2H13 A;  4O1Q D;  5GXI A;  5FQD A;  2CN2 A;  5I5J A;  2AQ5 A;  3SWS D;  4GGD A;  3SHF A;  2CN3 A;  3UVL A;  4CI3 A;  2IUQ A;  4QRJ A;  5HE1 B;  5CXC A;  4FAN D;  1JMZ B;  1B9X A;  4JSV C;  2PM7 B;  1MG2 A;  5HYN B;  4A2M A;  2H47 A;  4IA9 A;  1QNI A;  2B5N A;  4J73 A;  1ERJ A;  4EWR A;  1OMW B;  3U4Y A;  4N14 A;  4CC9 A;  1XIP A;  4K3I D;  1SQJ A;  2P9I C;  4XYH A;  4LG8 A;  3AH8 B;  4FA5 D;  4U7A A;  2BBK H;  3PXT D;  5TEF A;  3ULE C;  4YVD A;  1GXR A;  4GQ2 P;  2IUP A;  4GGA A;  2XYI A;  2CE8 A;  5EAM A;  2HKM A;  2GC7 A;  5EAR A;  4X63 B;  1VYH C;  5CXB B;  3SBR A;  5CYK B;  5IT9 g;  3UVO A;  2HJ4 A;  4QT8 A;  5EML B;  1JOF A;  3RRM C;  4Y5R D;  1XKS A;  3SJL D;  4FA4 D;  4PBY A;  1MG3 A;  4PXW A;  3RN1 D;  2IWK A;  5EM2 B;  3MZK A;  2HYE A;  3P4F A;  3L4M D;  3IJC A;  4E54 A;  4X61 B;  2Z2O A;  4FB1 D;  5B4W A;  4H5J A;  3W15 A;  3E0C A;  3I7H A;  2W18 A;  3JZH A;  4A0B A;  4A11 B;  4CY3 A;  5SXM A;  3I7O A;  3OKY B;  3L4O D;  5IJ7 E;  3OKW A;  3VH0 A;  2G99 A;  2AH1 A;  3RLM D;  3OW8 A;  4JT5 C;  1N6F A;  4GZ8 A;  1GP2 B;  3UKR C;  3I89 A;  3SN6 B;  1PGU A;  3ZWL B;  4A08 B;  4OZU A;  1N6E A;  5I5I A;  2YNO A;  3MKQ A;  2H9M A;  2G9A A;  4J82 A;  3EMH A;  5IGQ A;  3SFZ A;  2Z2P A;  3EI1 A;  4X3E A;  3CIK B;  4A09 B;  3CFS B;  2QC5 A;  3EG6 A;  3RMZ D;  2J55 H;  3PE7 A;  3UVK A;  2H6Q A;  3UVN A;  5EMK B;  2HJB A;  5FKT A;  3SMR A;  3IIY A;  3C75 H;  2I0R A;  5K19 A;  2O9K A;  5JWZ A;  2H9L A;  2OK6 A;  3EI3 B;  4CI8 A;  4NSX A;  3UVM A;  5FKS A;  4R7A B;  2B5M A;  3SBP A;  4PC0 A;  1NR0 A;  3ORV D;  5FKQ A;  1YFQ A;  2XL3 A;  3F3G A;  1P22 A;  2P9S C;  3IIW A;  2AGW A;  3I7K A;  3OKT A;  1XHM A;  4L9O A;  3DM0 A;  2H9N A;  5C2V B;  2EBS A;  3ODT A;  5CXB A;  4O3U B;  3FM0 A;  5CYK A;  3SXT D;  2CO0 A;  2H6K A;  5TDH B;  2YNP A;  4CZV A;  3JRO A;  3NVQ A;  4CI1 A;  4J8G A;  3NVX A;  2BCJ B;  3I7N A;  3K27 A;  2P9P C;  5EM2 A;  3SCY A;  4BUJ C;  3GRE A;  3JB9 L;  4CY5 A;  5IC7 A;  3PSL A;  3I8E A;  3B7F A;  3PVW B;  2CE9 A;  4MK0 B;  4CY2 A;  2OVQ B;  1N6D A;  3JAM g;  4J0X A;  4HDJ A;  3IJ1 A;  1U4C A;  4JT6 C;  4JXM A;  2PM9 B;  2I3S A;  5AJA A;  4CI2 A;  2AGX A;  4J78 A;  3RFG A;  4I79 A;  3FRX A;  3EI4 B;  3V7D B;  4J81 A;  4ERZ A;  3K26 A;  2XL2 A;  1K32 A;  4QL1 A;  3J80 g;  1SQ9 A;  4ZOY A;  4A08 A;  5H14 A;  5C2W B;  5CXC B;  3DXM C;  2GNQ A;  1TBG A;  3DXK C;  2OK4 A;  3PXW D;  2YNN A;  3F3P A;  4A09 A;  4ZOZ A;  4GGC A;  4A0A B;  2AH0 A;  3IJ0 A;  4Y7R A;  2IUV A;  4OWR A;  4ZN4 A;  1FWX A;  4LGN A;  4GQ1 A;  2YMU A;  2H3X A;  4D0K A;  4GQB B;  3N0D A;  4J77 A;  2HKR A;  5EMJ B;  4K3J B;  4L3H D;  3UKU C;  2H14 A;  3BG0 A;  4ZOX A;  4E5Z A;  4D6V A;  3MZL A;  4KFM B;  5HE2 B;  4U1E I;  3SBQ A;  4E54 B;  2P9U C;  3NVN A;  2B5L A;  5TEE A;  4J0W A;  4A2L A;  4BL0 A;  1Q47 A;  5EAL A;  3OL2 A;  3F3F A;  3EI2 A;  3AL8 B;  4A0B B;  4PNK B;  4O9D A;  1S4U X;  1SHY B;  3PSC B;  4AEZ A;  3HFQ A;  2PM6 B;  2H6N A;  4J79 A;  2OVR B;  3V9F A; 
#chains in the Genus database with same CATH topology
 3IUL A;  4GM3 A;  1GOT B;  3I2N A;  4CZX A;  5M61 A;  1VE6 A;  3VA6 A;  1E5T A;  2Q7Q A;  3V4V A;  3C9C A;  3RSE C;  2H9P A;  3MMY A;  5KDO B;  2H68 A;  1YR2 A;  2J56 H;  3JRP A;  2UZY B;  5AFU 3;  4JHP C;  1QFS A;  3ZE0 A;  4J87 A;  4FWW A;  4FA1 D;  3AL9 A;  2VDM A;  4PSX B;  3EQ9 A;  5GXH A;  2WQ8 A;  3PVU B;  5A2Q g;  4FHL A;  2P9L C;  4BCD A;  2PM9 A;  3V5W B;  4GM9 A;  4JSX C;  3JZG A;  4AOW A;  3EI4 A;  3UR4 A;  3EWE A;  2OIZ A;  1U8C A;  3N0E A;  2VZ1 A;  3O4G A;  4J84 A;  1A12 A;  4G1E A;  3JZN A;  3RFH A;  1JJU B;  4A11 A;  3NID A;  4ZOV A;  3IUM A;  4G1M A;  3OKY A;  1JMX B;  2YB8 B;  3IKO A;  4MMX A;  4JSN C;  2VDQ A;  4GMB A;  3EQ8 A;  4A0A A;  4IMM A;  4PBZ A;  2I0T A;  4AMY A;  5FXY A;  5AMS A;  4XYI A;  5FFO A;  3K71 A;  2HXC A;  2MTA H;  4FAV D;  1C9L A;  1U2V C;  2EIB A;  2PBI B;  2IAA A;  1JV2 A;  3KRW B;  3MXX A;  4G55 A;  3GC3 B;  5TF2 A;  3CFV A;  5GSA A;  2AGL A;  3VGZ A;  2JKX A;  2CNX A;  2UZX B;  4Z7Q A;  2OJY A;  5IGO A;  1A0R B;  2P9N C;  3MKS B;  5HE3 B;  4RE6 A;  2VDL A;  5HE0 B;  4O3T B;  1GG2 B;  2HES X;  5GMK n;  4ERQ A;  2I3T A;  2XU7 A;  1L5G A;  4AX4 A;  3FGB A;  2QXV A;  3I8C A;  4AMZ A;  4NAA A;  2I0S A;  4PSW B;  3I7P A;  3C5M A;  5EAP A;  3AL8 A;  4CZY A;  5IJ8 E;  3BWS A;  3I7L A;  4BP9 A;  3PXS D;  3DWL C;  1OLZ A;  3C99 A;  1RI6 A;  2P9K C;  1NEX B;  3SVW D;  4RE5 A;  2TRC B;  5C9Z B;  5THA A;  4O02 A;  4Z8L A;  1PBY B;  2EIC A;  2GC4 A;  5K1C C;  3J81 g;  4J8B A;  5FA5 B;  2J57 G;  4L3G D;  4BH6 A;  2IWF A;  3EI3 A;  3K6S A;  5FKR A;  4JSP C;  1L0Q A;  3AFC A;  3QHY B;  3RN0 D;  3SLE D;  2AGY A;  3BG1 A;  1R5M A;  4JD2 C;  4ESG A;  1MDA H;  1PEV A;  4ERY A;  5H17 A;  2AGZ A;  4LG9 A;  1H2X A;  1GOH A;  4L1Q D;  4D9S A;  3DSM A;  1PI6 A;  3NIF A;  4TZ4 A;  2VZ3 A;  1QFM A;  2B4E A;  2IUR A;  2BKL A;  3EU7 A;  1B9Y A;  4XEI C;  4QAM A;  2XDW A;  2YBA A;  2XZG A;  4A7J A;  4MMZ A;  4X60 B;  3T3M A;  4FA9 D;  3OTT A;  2Z2N A;  2CO0 C;  5HQG A;  4O45 A;  3GFC A;  3JPX A;  4J86 A;  5HDB A;  4DNV A;  3IUJ A;  4ES0 A;  4NBM A;  5I5M A;  4H5I A;  3KRX B;  3EI1 B;  5EMM B;  1VZ3 A;  4E5Z B;  3IUQ A;  4GM8 A;  4QQE A;  4BP8 A;  5FLX g;  4UI9 R;  5H1M A;  1TYQ C;  2OVP B;  4WK2 A;  3A0F A;  1K8K C;  1O6F A;  2VC2 A;  3OL2 B;  4G56 B;  3EI2 B;  4CY1 A;  2H13 A;  4O1Q D;  5GXI A;  1UOQ A;  2CN2 A;  5FQD A;  5I5J A;  2AQ5 A;  3SWS D;  4GGD A;  3SHF A;  2CN3 A;  3UVL A;  4CI3 A;  2IUQ A;  3GD1 I;  4QRJ A;  5HE1 B;  1H2Z A;  5CXC A;  4FAN D;  1JMZ B;  1B9X A;  2PM7 B;  2HU5 A;  1MG2 A;  4JSV C;  5HYN B;  3O4I A;  4A2M A;  2H47 A;  4IA9 A;  1QNI A;  4BCC A;  2B5N A;  4J73 A;  1ERJ A;  4EWR A;  1OMW B;  3U4Y A;  4N14 A;  4CC9 A;  1H2Y A;  1XIP A;  3O4H A;  4K3I D;  5M5T A;  1SQJ A;  2P9I C;  4WJK A;  4XYH A;  4Z7O A;  4LG8 A;  3VI3 A;  3AH8 B;  4FA5 D;  4U7A A;  2BBK H;  3PXT D;  4DNU A;  5TEF A;  3ULE C;  4YVD A;  1GXR A;  4GQ2 P;  2IUP A;  4GGA A;  2XYI A;  2CE8 A;  5EAM A;  5M5S A;  2HKM A;  2GC7 A;  4MMY A;  4NEN A;  5EAR A;  4L1M A;  4X63 B;  2HU7 A;  1VYH C;  3OF7 A;  5CXB B;  3SBR A;  5CYK B;  5IT9 g;  3UVO A;  2HJ4 A;  4QT8 A;  5EML B;  1JOF A;  3RRM C;  3K72 A;  4Y5R D;  1XKS A;  3SJL D;  4FA4 D;  4PBY A;  1MG3 A;  4PXW A;  3RN1 D;  2IWK A;  5EM2 B;  3MZK A;  2HYE A;  3P4F A;  3L4M D;  3NIG A;  3IJC A;  4WK0 A;  4E54 A;  4X61 B;  2Z2O A;  4FB1 D;  5B4W A;  4H5J A;  3W15 A;  3E0C A;  3I7H A;  2W18 A;  3JZH A;  4A0B A;  4A11 B;  4CY3 A;  5SXM A;  3I7O A;  3O4J A;  3OKY B;  1K3I A;  1E8M A;  3L4O D;  5IJ7 E;  3OKW A;  3IUN A;  3VH0 A;  1O6G A;  4Z7N A;  2G99 A;  3MUO A;  2AH1 A;  3RLM D;  3OW8 A;  2EIE A;  1N6F A;  4JT5 C;  4GZ8 A;  1GP2 B;  3UKR C;  3I89 A;  3SN6 B;  1PGU A;  3ZWL B;  4A08 B;  4OZU A;  1N6E A;  5I5I A;  3FCU A;  2YNO A;  3MKQ A;  2H9M A;  3V4P A;  3KCI A;  1GOG A;  2G9A A;  4WK4 A;  4J82 A;  3EMH A;  5IGQ A;  3SFZ A;  2Z2P A;  3EI1 A;  4X3E A;  3CIK B;  4A09 B;  4O2W A;  3CFS B;  2QC5 A;  3EG6 A;  3RMZ D;  1TYE A;  2J55 H;  3PE7 A;  3MUN A;  3UVK A;  2H6Q A;  1UOP A;  3UVN A;  2VDK A;  2VDO A;  2HJB A;  5EMK B;  5FKT A;  3SMR A;  3IIY A;  3IVM A;  3C75 H;  2I0R A;  1GOF A;  5K19 A;  2O9K A;  2QR5 A;  5E6S A;  5JWZ A;  2H9L A;  2OK6 A;  3EI3 B;  4CI8 A;  4NSX A;  3UVM A;  5FKS A;  4R7A B;  4UM9 A;  2B5M A;  3SBP A;  2VDN A;  4PC0 A;  1NR0 A;  3ORV D;  3ZE1 A;  1VE7 A;  5FKQ A;  1BPO A;  4IRZ A;  1YFQ A;  2XL3 A;  5C86 A;  1I2M B;  3F3G A;  1P22 A;  5M5U A;  2P9S C;  5M5R A;  3ZDY A;  3IIW A;  2AGW A;  3I7K A;  3OKT A;  1XHM A;  4L9O A;  3DM0 A;  2H9N A;  1C9I A;  5C2V B;  2EBS A;  3ODT A;  5CXB A;  4O3U B;  3FM0 A;  5CYK A;  3SXT D;  2CO0 A;  2H6K A;  5TDH B;  2YNP A;  3ZDZ A;  4AN1 A;  4CZV A;  3JRO A;  3NVQ A;  3VI4 A;  4CI1 A;  4J8G A;  3NVX A;  2BCJ B;  5M5V A;  4BCB A;  3I7N A;  3K27 A;  2P9P C;  5EM2 A;  3T3P A;  2QZP A;  3SCY A;  4BUJ C;  3GRE A;  3JB9 L;  5E6R A;  4CY5 A;  5IC7 A;  3PSL A;  3I8E A;  2XE4 A;  3B7F A;  3IUR A;  3PVW B;  2CE9 A;  4MK0 B;  4CY2 A;  2OVQ B;  1N6D A;  3JAM g;  4J0X A;  3DDU A;  4HDJ A;  4JHN A;  3IJ1 A;  1U4C A;  4JT6 C;  4JXM A;  2PM9 B;  2I3S A;  5AJA A;  4CI2 A;  2AGX A;  1T2X A;  4J78 A;  3RFG A;  4I79 A;  3FRX A;  3EI4 B;  3V7D B;  4J81 A;  4ERZ A;  3K26 A;  2XL2 A;  1K32 A;  4QL1 A;  5FFG A;  3J80 g;  1SQ9 A;  1JTD B;  4ZOY A;  4A08 A;  5H14 A;  5C2W B;  5CXC B;  3DXM C;  2GNQ A;  1TBG A;  2HU8 A;  3DXK C;  3ZE2 A;  3QI0 A;  2OK4 A;  3PXW D;  4DNW A;  5E6U A;  2YNN A;  3F3P A;  1UOO A;  4A09 A;  3EQ7 A;  4ZOZ A;  4GGC A;  4A0A B;  2AH0 A;  3IJ0 A;  4Y7R A;  1E8N A;  2IUV A;  4OWR A;  4ZN4 A;  4AN0 A;  5C92 A;  1FWX A;  4LGN A;  3FCS A;  4GQ1 A;  1H2W A;  2YMU A;  2H3X A;  4D0K A;  2VDR A;  4GQB B;  3N0D A;  4J77 A;  2HKR A;  5EMJ B;  4K3J B;  4L3H D;  3UKU C;  2H14 A;  3BG0 A;  1M1X A;  1VZ2 A;  4ZOX A;  4E5Z A;  4D6V A;  3ZDX A;  3MZL A;  4KFM B;  5HE2 B;  4U1E I;  3SBQ A;  4E54 B;  2P9U C;  3NVN A;  2B5L A;  3IJE A;  5TEE A;  4UM8 A;  3MVD K;  2EID A;  1UTC A;  4J0W A;  4A2L A;  2VDP A;  1Q47 A;  4BL0 A;  5EAL A;  3OL2 A;  4NC4 A;  3F3F A;  3EI2 A;  3AL8 B;  4A0B B;  4PNK B;  4O9D A;  1S4U X;  1SHY B;  3PSC B;  4AEZ A;  3HFQ A;  2PM6 B;  2H6N A;  4J79 A;  2OVR B;  3V9F A; 
#chains in the Genus database with same CATH homology
 4GM3 A;  1GOT B;  3I2N A;  4CZX A;  3VA6 A;  2Q7Q A;  3C9C A;  3RSE C;  2H9P A;  3MMY A;  5KDO B;  2H68 A;  2J56 H;  3JRP A;  2UZY B;  5AFU 3;  4J87 A;  4FWW A;  4FA1 D;  3AL9 A;  4PSX B;  5GXH A;  3PVU B;  5A2Q g;  4FHL A;  2P9L C;  2PM9 A;  3V5W B;  4GM9 A;  4JSX C;  3JZG A;  4AOW A;  3EI4 A;  3UR4 A;  3EWE A;  2OIZ A;  3N0E A;  4J84 A;  3JZN A;  3RFH A;  1JJU B;  4A11 A;  4ZOV A;  3OKY A;  1JMX B;  2YB8 B;  3IKO A;  4JSN C;  4GMB A;  4A0A A;  4IMM A;  4PBZ A;  2I0T A;  5FXY A;  5AMS A;  4XYI A;  2HXC A;  2MTA H;  4FAV D;  1U2V C;  2PBI B;  2IAA A;  3KRW B;  3MXX A;  5GSA A;  5TF2 A;  3CFV A;  2AGL A;  3VGZ A;  2CNX A;  2UZX B;  2OJY A;  5IGO A;  1A0R B;  2P9N C;  3MKS B;  5HE3 B;  5HE0 B;  4O3T B;  1GG2 B;  2HES X;  5GMK n;  4ERQ A;  2I3T A;  2XU7 A;  3FGB A;  2QXV A;  3I8C A;  2I0S A;  4PSW B;  3I7P A;  3C5M A;  5EAP A;  3AL8 A;  4CZY A;  5IJ8 E;  3BWS A;  3I7L A;  3PXS D;  3DWL C;  1OLZ A;  3C99 A;  1RI6 A;  2P9K C;  1NEX B;  3SVW D;  2TRC B;  5C9Z B;  5THA A;  4Z8L A;  1PBY B;  5K1C C;  2GC4 A;  3J81 g;  4J8B A;  5FA5 B;  2J57 G;  4L3G D;  4BH6 A;  2IWF A;  3EI3 A;  5FKR A;  4JSP C;  1L0Q A;  3AFC A;  3RN0 D;  3SLE D;  2AGY A;  3BG1 A;  1R5M A;  4JD2 C;  4ESG A;  1MDA H;  1PEV A;  4ERY A;  5H17 A;  2AGZ A;  4LG9 A;  4L1Q D;  3DSM A;  1PI6 A;  4TZ4 A;  2B4E A;  2IUR A;  3EU7 A;  1B9Y A;  4XEI C;  2YBA A;  4A7J A;  4X60 B;  4FA9 D;  3OTT A;  2Z2N A;  2CO0 C;  5HQG A;  4O45 A;  3GFC A;  3JPX A;  4J86 A;  4ES0 A;  5I5M A;  4H5I A;  3KRX B;  3EI1 B;  5EMM B;  4E5Z B;  4GM8 A;  4QQE A;  5FLX g;  4UI9 R;  5H1M A;  1TYQ C;  2OVP B;  3A0F A;  1K8K C;  3OL2 B;  4G56 B;  3EI2 B;  4CY1 A;  2H13 A;  4O1Q D;  5GXI A;  5FQD A;  2CN2 A;  5I5J A;  2AQ5 A;  3SWS D;  4GGD A;  3SHF A;  2CN3 A;  3UVL A;  4CI3 A;  2IUQ A;  4QRJ A;  5HE1 B;  5CXC A;  4FAN D;  1JMZ B;  1B9X A;  4JSV C;  2PM7 B;  1MG2 A;  5HYN B;  4A2M A;  2H47 A;  4IA9 A;  1QNI A;  2B5N A;  4J73 A;  1ERJ A;  4EWR A;  1OMW B;  3U4Y A;  4N14 A;  4CC9 A;  1XIP A;  4K3I D;  1SQJ A;  2P9I C;  4XYH A;  4LG8 A;  3AH8 B;  4FA5 D;  4U7A A;  2BBK H;  3PXT D;  5TEF A;  3ULE C;  4YVD A;  1GXR A;  4GQ2 P;  2IUP A;  4GGA A;  2XYI A;  2CE8 A;  5EAM A;  2HKM A;  2GC7 A;  5EAR A;  4X63 B;  1VYH C;  5CXB B;  3SBR A;  5CYK B;  5IT9 g;  3UVO A;  2HJ4 A;  4QT8 A;  5EML B;  1JOF A;  3RRM C;  4Y5R D;  1XKS A;  3SJL D;  4FA4 D;  4PBY A;  1MG3 A;  4PXW A;  3RN1 D;  2IWK A;  5EM2 B;  3MZK A;  2HYE A;  3P4F A;  3L4M D;  3IJC A;  4E54 A;  4X61 B;  2Z2O A;  4FB1 D;  5B4W A;  4H5J A;  3W15 A;  3E0C A;  3I7H A;  2W18 A;  3JZH A;  4A0B A;  4A11 B;  4CY3 A;  5SXM A;  3I7O A;  3OKY B;  3L4O D;  5IJ7 E;  3OKW A;  3VH0 A;  2G99 A;  2AH1 A;  3RLM D;  3OW8 A;  4JT5 C;  1N6F A;  4GZ8 A;  1GP2 B;  3UKR C;  3I89 A;  3SN6 B;  1PGU A;  3ZWL B;  4A08 B;  4OZU A;  1N6E A;  5I5I A;  2YNO A;  3MKQ A;  2H9M A;  2G9A A;  4J82 A;  3EMH A;  5IGQ A;  3SFZ A;  2Z2P A;  3EI1 A;  4X3E A;  3CIK B;  4A09 B;  3CFS B;  2QC5 A;  3EG6 A;  3RMZ D;  2J55 H;  3PE7 A;  3UVK A;  2H6Q A;  3UVN A;  5EMK B;  2HJB A;  5FKT A;  3SMR A;  3IIY A;  3C75 H;  2I0R A;  5K19 A;  2O9K A;  5JWZ A;  2H9L A;  2OK6 A;  3EI3 B;  4CI8 A;  4NSX A;  3UVM A;  5FKS A;  4R7A B;  2B5M A;  3SBP A;  4PC0 A;  1NR0 A;  3ORV D;  5FKQ A;  1YFQ A;  2XL3 A;  3F3G A;  1P22 A;  2P9S C;  3IIW A;  2AGW A;  3I7K A;  3OKT A;  1XHM A;  4L9O A;  3DM0 A;  2H9N A;  5C2V B;  2EBS A;  3ODT A;  5CXB A;  4O3U B;  3FM0 A;  5CYK A;  3SXT D;  2CO0 A;  2H6K A;  5TDH B;  2YNP A;  4CZV A;  3JRO A;  3NVQ A;  4CI1 A;  4J8G A;  3NVX A;  2BCJ B;  3I7N A;  3K27 A;  2P9P C;  5EM2 A;  3SCY A;  4BUJ C;  3GRE A;  3JB9 L;  4CY5 A;  5IC7 A;  3PSL A;  3I8E A;  3B7F A;  3PVW B;  2CE9 A;  4MK0 B;  4CY2 A;  2OVQ B;  1N6D A;  3JAM g;  4J0X A;  4HDJ A;  3IJ1 A;  1U4C A;  4JT6 C;  4JXM A;  2PM9 B;  2I3S A;  5AJA A;  4CI2 A;  2AGX A;  4J78 A;  3RFG A;  4I79 A;  3FRX A;  3EI4 B;  3V7D B;  4J81 A;  4ERZ A;  3K26 A;  2XL2 A;  1K32 A;  4QL1 A;  3J80 g;  1SQ9 A;  4ZOY A;  4A08 A;  5H14 A;  5C2W B;  5CXC B;  3DXM C;  2GNQ A;  1TBG A;  3DXK C;  2OK4 A;  3PXW D;  2YNN A;  3F3P A;  4A09 A;  4ZOZ A;  4GGC A;  4A0A B;  2AH0 A;  3IJ0 A;  4Y7R A;  2IUV A;  4OWR A;  4ZN4 A;  1FWX A;  4LGN A;  4GQ1 A;  2YMU A;  2H3X A;  4D0K A;  4GQB B;  3N0D A;  4J77 A;  2HKR A;  5EMJ B;  4K3J B;  4L3H D;  3UKU C;  2H14 A;  3BG0 A;  4ZOX A;  4E5Z A;  4D6V A;  3MZL A;  4KFM B;  5HE2 B;  4U1E I;  3SBQ A;  4E54 B;  2P9U C;  3NVN A;  2B5L A;  5TEE A;  4J0W A;  4A2L A;  4BL0 A;  1Q47 A;  5EAL A;  3OL2 A;  3F3F A;  3EI2 A;  3AL8 B;  4A0B B;  4PNK B;  4O9D A;  1S4U X;  1SHY B;  3PSC B;  4AEZ A;  3HFQ A;  2PM6 B;  2H6N A;  4J79 A;  2OVR B;  3V9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...