4QL1A

Crystal structure of human wdr5 in complex with compound oicr-9429
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pharmacological targeting of the Wdr5-MLL interaction in C/EBP alpha N-terminal leukemia.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/inhibitor
molecule keywords WD repeat-containing protein 5
total genus 107
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4ql1A00
2H9LA 2G99A 2J57G 5THAA 4I79A 2H47A 2CN3A 3EI3A 3NVQA 3PXTD 3SBRA 2Z2PA 3EI1A 4JD2C 4MK0B 3N0DA 4BL0A 5EMMB 5H14A 1B9YA 5GMKn 5EM2B 3RN0D 2H13A 4BUJC 1RI6A 4CC9A 3AL9A 5HYNB 3OL2B 4CI2A 4E5ZA 5K19A 4A08A 4FB1D 3SBPA 5IGOA 4AOWA 4O3UB 1N6EA 4J78A 5TDHB 3UVLA 3V9FA 2H3XA 4XYIA 3RFGA 4X60B 4J0WA 4A08B 5FKQA 4D6VA 1JOFA 3RLMD 1PGUA 4JSXC 3IJ1A 4FA1D 4PC0A 3C99A 4A11B 4L3GD 4LG9A 2HXCA 3KRWB 1JMXB 3SVWD 3JZHA 2OK4A 2OVRB 4J73A 2P9NC 4L3HD 2HJ4A 4JT5C 4D0KA 4CI8A 2B5LA 4ERYA 4X63B 5H17A 3J81g 2AH0A 4FAVD 4U1EI 3BG0A 5I5JA 4J8GA 3MXXA 3DXMC 2CN2A 4IA9A 1GP2B 3PE7A 3JB9L 2GC7A 5I5IA 5TEEA 3BG1A 3SHFA 4K3ID 3SCYA 3OL2A 1B9XA 1OLZA 4J87A 5FXYA 3V5WB 3U4YA 5HE2B 4E5ZB 3EMHA 1R5MA 4OWRA 4IMMA 1QNIA 5CXCB 5EM2A 4HDJA 2H6KA 4QL1A 4J77A 2IUPA 3PXSD 4ERZA 4G56B 4GQ2P 4O45A 3EI1B 2H6NA 4PSXB 2H9PA 3L4OD 5FLXg 4PBZA 3KRXB 3JAMg 1MDAH 2AQ5A 3A0FA 2HESX 4A0BB 1OMWB 1GXRA 4O1QD 3SLED 3J80g 4CZXA 2UZYB 3I7NA 3PXWD 3F3PA 5I5MA 2OIZA 2P9PC 1Q47A 1XKSA 4PBYA 3SXTD 4LGNA 3OKWA 1N6FA 3CFSB 3DXKC 3MKQA 2OVQB 2O9KA 3OKYA 2UZXB 4A2LA 3ODTA 4LG8A 3EG6A 2AH1A 5GXHA 3IKOA 4CY5A 1SQ9A 2YB8B 1U2VC 2XYIA 3GREA 5B4WA 4J81A 3DM0A 1NEXB 3EI2B 5KDOB 1P22A 4CY3A 3NVXA 3I7KA 2CNXA 5IJ7E 1MG2A 4CY1A 5EMLB 4GM3A 4A0AB 5HE0B 1S4UX 4TZ4A 1MG3A 4J82A 4PNKB 2CE9A 4A7JA 2H6QA 3SJLD 2Z2OA 5TEFA 5IGQA 2PBIB 5CYKB 2OJYA 3I7LA 4CZVA 3SBQA 4BH6A 3EI4A 2OK6A 3EWEA 4A11A 2HKMA 5AFU3 2P9IC 3K27A 4GGAA 4Z8LA 3UVKA 2I3SA 3RSEC 5JWZA 2XU7A 3N0EA 4GGCA 3C9CA 5AMSA 1FWXA 4QRJA 4Y5RD 2B4EA 2P9LC 5EAPA 4EWRA 1VYHC 4XEIC 4X61B 5H1MA 4PSWB 2PM6B 3PSCB 3F3GA 2TRCB 2YMUA 5C9ZB 4GQBB 3ZWLB 4J8BA 4GQ1A 5EMKB 3BWSA 4CI3A 3IIWA 4E54B 2P9SC 4K3JB 2HYEA 5EMJB 2BBKH 3JRPA 4AEZA 3C75H 2H9MA 2W18A 4GMBA 5SXMA 2I0SA 5EALA 3SMRA 4UI9R 4OZUA 5GXIA 3FM0A 3I7HA 4FWWA 3I7PA 2PM9A 3RMZD 1K32A 3I89A 1XHMA 3AFCA 3VA6A 4A0BA 4ZOYA 3VH0A 1PEVA 2IUQA 2AGXA 3AL8B 3AH8B 4GM8A 3MZKA 4ZOVA 4PXWA 3E0CA 4J84A 2B5MA 3FRXA 4H5IA 4A09B 5K1CC 4A09A 2CO0A 3HFQA 5TF2A 3AL8A 4GM9A 1NR0A 2I0RA 4CY2A 4L9OA 2IWKA 1GG2B 4FA5D 3IIYA 1A0RB 3UVMA 4GZ8A 3DSMA 3EI3B 1GOTB 2HJBA 2IURA 3NVNA 5FQDA 3MKSB 3JPXA 4FA4D 3IJCA 1XIPA 2CE8A 2IUVA 4XYHA 3OTTA 4J79A 3CFVA 4U7AA 4JT6C 3I8EA 3UKUC 1JMZB 1K8KC 3UKRC 3B7FA 1YFQA 4N14A 2EBSA 4E54A 1JJUB 5CYKA 2Z2NA 1TBGA 4JSPC 1ERJA 4JSNC 4FHLA 1PI6A 3V7DB 2XL2A 5EARA 1N6DA 4Y7RA 3I7OA 1SHYB 3K26A 3PVWB 4YVDA 5GSAA 2IAAA 3PSLA 2CO0C 2H68A 4NSXA 3RRMC 4QQEA 4J86A 3EI4B 5A2Qg 4CI1A 2AGZA 5CXBB 3DWLC 4R7AB 3C5MA 3JROA 3JZGA 1L0QA 4GGDA 3JZNA 3OKTA 2YNNA 3MMYA 2B5NA 3VGZA 3IJ0A 1U4CA 4ESGA 3OW8A 4L1QD 2AGWA 4ZOZA 5FKSA 5FA5B 4H5JA 3SFZA 3RFHA 1TYQC 4ES0A 2Q7QA 3EI2A 3W15A 4A2MA 4JXMA 3UR4A 2YNPA 3FGBA 4ERQA 2QC5A 2GC4A 3MZLA 2J56H 1SQJA 4O3TB 2MTAH 5IT9g 3UVNA 4KFMB 3RN1D 3SN6B 2PM7B 2QXVA 4X3EA 3F3FA 5C2VB 5CXBA 4A0AA 4ZN4A 5C2WB 3EU7A 2GNQA 5AJAA 2H14A 5IJ8E 3P4FA 2YBAA 3SWSD 3I2NA 4JSVC 2J55H 5HE1B 4QT8A 5HQGA 2I3TA 4CZYA 4O9DA 4ZOXA 3L4MD 1PBYB 3PVUB 2H9NA 2P9KC 5FKRA 3OKYB 2OVPB 2XL3A 3I8CA 4J0XA 5FKTA 5IC7A 4FAND 3CIKB 3GFCA 2P9UC 2IWFA 3ORVD 2AGYA 5CXCA 3ULEC 2G9AA 2HKRA 2I0TA 5HE3B 3UVOA 5EAMA 4FA9D 2PM9B 2YNOA 2BCJB 2AGLA
chains in the Genus database with same CATH superfamily
4AMYA 3VI4A 2H9LA 2G99A 2J57G 5THAA 4I79A 2H47A 3T3PA 2CN3A 3EI3A 3NVQA 1UTCA 2VZ1A 3PXTD 3SBRA 1QFMA 2Z2PA 4O02A 3FCUA 3QHYB 3EI1A 3O4HA 3IVMA 3MVDK 4JD2C 4MK0B 3N0DA 4BL0A 5EMMB 5H14A 1B9YA 5GMKn 5EM2B 3RN0D 2H13A 4BUJC 1RI6A 4CC9A 5E6SA 3AL9A 5HYNB 1E8MA 3OL2B 4CI2A 4E5ZA 5K19A 4A08A 1E5TA 4FB1D 3SBPA 5IGOA 3FCSA 4AOWA 4G1EA 4O3UB 5FFOA 1N6EA 4J78A 5TDHB 3UVLA 3V9FA 2H3XA 4XYIA 3O4IA 3RFGA 4X60B 4J0WA 4A08B 5FKQA 4D6VA 1JOFA 3RLMD 1PGUA 4JSXC 5C92A 4AMZA 5M5VA 3IJ1A 4FA1D 4PC0A 3C99A 4A11B 4L3GD 4LG9A 2HXCA 3KRWB 1JMXB 4RE5A 3SVWD 3JZHA 1JTDB 2OK4A 4G55A 2OVRB 5HDBA 4J73A 2P9NC 4L3HD 2HJ4A 4JT5C 4D0KA 4CI8A 2B5LA 4ERYA 4X63B 5H17A 3J81g 2AH0A 4G1MA 4FAVD 4U1EI 3BG0A 5I5JA 2BKLA 4J8GA 3MXXA 3DXMC 2CN2A 4IA9A 1GP2B 3GC3B 3PE7A 3JB9L 2GC7A 5I5IA 5TEEA 1A12A 3BG1A 3DDUA 3SHFA 4DNWA 4K3ID 1O6GA 3SCYA 3OL2A 1B9XA 1OLZA 4J87A 5FXYA 3V5WB 3U4YA 5HE2B 4E5ZB 3EMHA 1R5MA 2EIDA 5C86A 4OWRA 4IMMA 1QNIA 5CXCB 5EM2A 4HDJA 2H6KA 4QL1A 4J77A 2IUPA 2VZ3A 3PXSD 3ZDZA 1I2MB 4ERZA 4G56B 4GQ2P 4O45A 3EI1B 2H6NA 4PSXB 3O4GA 3KCIA 2H9PA 3L4OD 5FLXg 4PBZA 3KRXB 4AN0A 4Z7QA 3JAMg 1MDAH 2AQ5A 3A0FA 2HESX 4A0BB 3EQ7A 3MUNA 1OMWB 1GXRA 4O1QD 3SLED 3J80g 4CZXA 2VDNA 2UZYB 3I7NA 3PXWD 3F3PA 5I5MA 2OIZA 2P9PC 1Q47A 1XKSA 4PBYA 3SXTD 4LGNA 3OKWA 1O6FA 5FFGA 4DNVA 1N6FA 3CFSB 2JKXA 3DXKC 3MKQA 2O9KA 1H2WA 2OVQB 3OKYA 2UZXB 4A2LA 3ODTA 4LG8A 3EG6A 2AH1A 5GXHA 3IKOA 4CY5A 1SQ9A 2YB8B 1U2VC 4Z7OA 2XYIA 3GREA 5B4WA 4Z7NA 4JHNA 1C9IA 4J81A 3DM0A 3ZDYA 1NEXB 3EI2B 3IJEA 5KDOB 1P22A 4CY3A 3NVXA 3I7KA 2CNXA 2VDPA 2VDOA 3GD1I 5IJ7E 1MG2A 4CY1A 2QR5A 5EMLB 4GM3A 4A0AB 5HE0B 1H2YA 1S4UX 4TZ4A 1MG3A 4J82A 5E6RA 4PNKB 2QZPA 2CE9A 4A7JA 1E8NA 1H2XA 2H6QA 3SJLD 3K6SA 2Z2OA 3IUNA 3NIDA 5TEFA 3V4PA 5IGQA 2PBIB 5CYKB 2OJYA 3I7LA 4CZVA 3SBQA 1M1XA 2XDWA 4BH6A 3EI4A 2OK6A 3EWEA 4A11A 2HKMA 5AFU3 2P9IC 3K27A 4GGAA 1BPOA 4Z8LA 3UVKA 2I3SA 3RSEC 5JWZA 2XU7A 1UOPA 4MMZA 3N0EA 4GGCA 3C9CA 3K71A 5AMSA 2VDMA 1FWXA 4QRJA 2B4EA 4Y5RD 2P9LC 5EAPA 4EWRA 1VYHC 4XEIC 2VDKA 4X61B 5H1MA 4PSWB 2PM6B 4UM9A 2EIEA 4WK4A 3PSCB 3F3GA 2TRCB 2YMUA 5C9ZB 1VE7A 4GQBB 3ZWLB 4O2WA 4J8BA 2WQ8A 4GQ1A 5EMKB 3BWSA 4CI3A 3IIWA 4E54B 2P9SC 2VC2A 4K3JB 2HYEA 5EMJB 2BBKH 3JRPA 4AEZA 3C75H 2H9MA 2W18A 4GMBA 5SXMA 2I0SA 5EALA 1JV2A 3SMRA 4UI9R 3VI3A 4OZUA 5GXIA 4IRZA 3FM0A 3I7HA 3IUMA 4FWWA 3I7PA 2PM9A 3RMZD 1GOHA 3OF7A 1K32A 3I89A 1XHMA 3AFCA 3VA6A 4BCDA 4A0BA 4ZOYA 3VH0A 1PEVA 2HU7A 2IUQA 2VDQA 2AGXA 3AL8B 3AH8B 4GM8A 3MZKA 4ZOVA 4PXWA 3E0CA 4J84A 2B5MA 3FRXA 4H5IA 4A09B 5K1CC 1YR2A 4A09A 2CO0A 3HFQA 5TF2A 3AL8A 4GM9A 1NR0A 2I0RA 4CY2A 1GOFA 1GG2B 2IWKA 4L9OA 4FA5D 5M5SA 3IIYA 1A0RB 3UVMA 4GZ8A 3ZE2A 3DSMA 3EI3B 4BCCA 5M61A 1GOTB 2HJBA 2IURA 3NVNA 4NAAA 1H2ZA 5FQDA 3MKSB 3JPXA 4FA4D 3IJCA 1XIPA 2CE8A 2IUVA 4XYHA 3OTTA 4J79A 3CFVA 4U7AA 4JT6C 3I8EA 3UKUC 1JMZB 1K8KC 2HU5A 3UKRC 3B7FA 1YFQA 4N14A 2EBSA 4E54A 1JJUB 5CYKA 4DNUA 1UOQA 1K3IA 2EIBA 2Z2NA 1TBGA 4JSPC 1ERJA 1QFSA 4JSNC 5E6UA 1C9LA 4AX4A 4FHLA 1PI6A 3NIFA 3V7DB 4D9SA 2XL2A 2EICA 1N6DA 4Y7RA 5EARA 3I7OA 4WK2A 3PVWB 1SHYB 3K26A 3ZDXA 4YVDA 5GSAA 2IAAA 3PSLA 2CO0C 2H68A 4NSXA 3RRMC 4QQEA 4J86A 3EI4B 5A2Qg 4MMXA 3T3MA 4CI1A 2AGZA 5CXBB 3DWLC 4R7AB 3C5MA 3JROA 3JZGA 3K72A 1L0QA 4GGDA 2HU8A 3JZNA 3ZE0A 1VZ3A 3OKTA 2YNNA 3MMYA 2B5NA 3VGZA 3IJ0A 1U4CA 4ESGA 3OW8A 4L1QD 2AGWA 4ZOZA 2VDLA 3NIGA 5FKSA 5FA5B 4H5JA 3SFZA 5M5RA 3RFHA 5M5TA 1TYQC 4ES0A 2Q7QA 3EI2A 3W15A 4JHPC 4A2MA 4JXMA 3UR4A 2YNPA 4L1MA 3FGBA 2XE4A 4ERQA 2QC5A 2GC4A 3MZLA 2J56H 1SQJA 3EQ9A 3IUJA 3QI0A 4BP9A 4O3TB 2MTAH 5IT9g 1TYEA 4RE6A 3UVNA 4KFMB 3RN1D 3SN6B 2PM7B 2QXVA 4X3EA 3F3FA 5C2VB 5CXBA 4A0AA 4ZN4A 3V4VA 4WJKA 5C2WB 1GOGA 3EU7A 2GNQA 5AJAA 2H14A 5IJ8E 3P4FA 2YBAA 4UM8A 3SWSD 3I2NA 4JSVC 2J55H 5HE1B 4QT8A 4NENA 4BCBA 5HQGA 1U8CA 2I3TA 4CZYA 4O9DA 4ZOXA 4WK0A 1VZ2A 3L4MD 3MUOA 1L5GA 3EQ8A 1PBYB 3PVUB 2H9NA 2P9KC 4MMYA 5FKRA 2XZGA 3IURA 1VE6A 5M5UA 3OKYB 2OVPB 4BP8A 2XL3A 3I8CA 4J0XA 5FKTA 5IC7A 4FAND 3CIKB 3GFCA 3IUQA 1UOOA 4AN1A 2P9UC 2IWFA 2VDRA 3ORVD 2AGYA 5CXCA 3ULEC 2G9AA 1T2XA 2HKRA 2I0TA 4QAMA 3ZE1A 3IULA 5HE3B 3O4JA 3UVOA 5EAMA 4FA9D 4NBMA 2PM9B 2YNOA 2BCJB 4NC4A 2AGLA
chains in the Genus database with same CATH topology
2H9LA 2G99A 2J57G 5THAA 4I79A 2H47A 2CN3A 3EI3A 3NVQA 3PXTD 3SBRA 2Z2PA 3EI1A 4JD2C 4MK0B 3N0DA 4BL0A 5EMMB 5H14A 1B9YA 5GMKn 5EM2B 3RN0D 2H13A 4BUJC 1RI6A 4CC9A 3AL9A 5HYNB 3OL2B 4CI2A 4E5ZA 5K19A 4A08A 4FB1D 3SBPA 5IGOA 4AOWA 4O3UB 1N6EA 4J78A 5TDHB 3UVLA 3V9FA 2H3XA 4XYIA 3RFGA 4X60B 4J0WA 4A08B 5FKQA 4D6VA 1JOFA 3RLMD 1PGUA 4JSXC 3IJ1A 4FA1D 4PC0A 3C99A 4A11B 4L3GD 4LG9A 2HXCA 3KRWB 1JMXB 3SVWD 3JZHA 2OK4A 2OVRB 4J73A 2P9NC 4L3HD 2HJ4A 4JT5C 4D0KA 4CI8A 2B5LA 4ERYA 4X63B 5H17A 3J81g 2AH0A 4FAVD 4U1EI 3BG0A 5I5JA 4J8GA 3MXXA 3DXMC 2CN2A 4IA9A 1GP2B 3PE7A 3JB9L 2GC7A 5I5IA 5TEEA 3BG1A 3SHFA 4K3ID 3SCYA 3OL2A 1B9XA 1OLZA 4J87A 5FXYA 3V5WB 3U4YA 5HE2B 4E5ZB 3EMHA 1R5MA 4OWRA 4IMMA 1QNIA 5CXCB 5EM2A 4HDJA 2H6KA 4QL1A 4J77A 2IUPA 3PXSD 4ERZA 4G56B 4GQ2P 4O45A 3EI1B 2H6NA 4PSXB 2H9PA 3L4OD 5FLXg 4PBZA 3KRXB 3JAMg 1MDAH 2AQ5A 3A0FA 2HESX 4A0BB 1OMWB 1GXRA 4O1QD 3SLED 3J80g 4CZXA 2UZYB 3I7NA 3PXWD 3F3PA 5I5MA 2OIZA 2P9PC 1Q47A 1XKSA 4PBYA 3SXTD 4LGNA 3OKWA 1N6FA 3CFSB 3DXKC 3MKQA 2OVQB 2O9KA 3OKYA 2UZXB 4A2LA 3ODTA 4LG8A 3EG6A 2AH1A 5GXHA 3IKOA 4CY5A 1SQ9A 2YB8B 1U2VC 2XYIA 3GREA 5B4WA 4J81A 3DM0A 1NEXB 3EI2B 5KDOB 1P22A 4CY3A 3NVXA 3I7KA 2CNXA 5IJ7E 1MG2A 4CY1A 5EMLB 4GM3A 4A0AB 5HE0B 1S4UX 4TZ4A 1MG3A 4J82A 4PNKB 2CE9A 4A7JA 2H6QA 3SJLD 2Z2OA 5TEFA 5IGQA 2PBIB 5CYKB 2OJYA 3I7LA 4CZVA 3SBQA 4BH6A 3EI4A 2OK6A 3EWEA 4A11A 2HKMA 5AFU3 2P9IC 3K27A 4GGAA 4Z8LA 3UVKA 2I3SA 3RSEC 5JWZA 2XU7A 3N0EA 4GGCA 3C9CA 5AMSA 1FWXA 4QRJA 4Y5RD 2B4EA 2P9LC 5EAPA 4EWRA 1VYHC 4XEIC 4X61B 5H1MA 4PSWB 2PM6B 3PSCB 3F3GA 2TRCB 2YMUA 5C9ZB 4GQBB 3ZWLB 4J8BA 4GQ1A 5EMKB 3BWSA 4CI3A 3IIWA 4E54B 2P9SC 4K3JB 2HYEA 5EMJB 2BBKH 3JRPA 4AEZA 3C75H 2H9MA 2W18A 4GMBA 5SXMA 2I0SA 5EALA 3SMRA 4UI9R 4OZUA 5GXIA 3FM0A 3I7HA 4FWWA 3I7PA 2PM9A 3RMZD 1K32A 3I89A 1XHMA 3AFCA 3VA6A 4A0BA 4ZOYA 3VH0A 1PEVA 2IUQA 2AGXA 3AL8B 3AH8B 4GM8A 3MZKA 4ZOVA 4PXWA 3E0CA 4J84A 2B5MA 3FRXA 4H5IA 4A09B 5K1CC 4A09A 2CO0A 3HFQA 5TF2A 3AL8A 4GM9A 1NR0A 2I0RA 4CY2A 4L9OA 2IWKA 1GG2B 4FA5D 3IIYA 1A0RB 3UVMA 4GZ8A 3DSMA 3EI3B 1GOTB 2HJBA 2IURA 3NVNA 5FQDA 3MKSB 3JPXA 4FA4D 3IJCA 1XIPA 2CE8A 2IUVA 4XYHA 3OTTA 4J79A 3CFVA 4U7AA 4JT6C 3I8EA 3UKUC 1JMZB 1K8KC 3UKRC 3B7FA 1YFQA 4N14A 2EBSA 4E54A 1JJUB 5CYKA 2Z2NA 1TBGA 4JSPC 1ERJA 4JSNC 4FHLA 1PI6A 3V7DB 2XL2A 5EARA 1N6DA 4Y7RA 3I7OA 1SHYB 3K26A 3PVWB 4YVDA 5GSAA 2IAAA 3PSLA 2CO0C 2H68A 4NSXA 3RRMC 4QQEA 4J86A 3EI4B 5A2Qg 4CI1A 2AGZA 5CXBB 3DWLC 4R7AB 3C5MA 3JROA 3JZGA 1L0QA 4GGDA 3JZNA 3OKTA 2YNNA 3MMYA 2B5NA 3VGZA 3IJ0A 1U4CA 4ESGA 3OW8A 4L1QD 2AGWA 4ZOZA 5FKSA 5FA5B 4H5JA 3SFZA 3RFHA 1TYQC 4ES0A 2Q7QA 3EI2A 3W15A 4A2MA 4JXMA 3UR4A 2YNPA 3FGBA 4ERQA 2QC5A 2GC4A 3MZLA 2J56H 1SQJA 4O3TB 2MTAH 5IT9g 3UVNA 4KFMB 3RN1D 3SN6B 2PM7B 2QXVA 4X3EA 3F3FA 5C2VB 5CXBA 4A0AA 4ZN4A 5C2WB 3EU7A 2GNQA 5AJAA 2H14A 5IJ8E 3P4FA 2YBAA 3SWSD 3I2NA 4JSVC 2J55H 5HE1B 4QT8A 5HQGA 2I3TA 4CZYA 4O9DA 4ZOXA 3L4MD 1PBYB 3PVUB 2H9NA 2P9KC 5FKRA 3OKYB 2OVPB 2XL3A 3I8CA 4J0XA 5FKTA 5IC7A 4FAND 3CIKB 3GFCA 2P9UC 2IWFA 3ORVD 2AGYA 5CXCA 3ULEC 2G9AA 2HKRA 2I0TA 5HE3B 3UVOA 5EAMA 4FA9D 2PM9B 2YNOA 2BCJB 2AGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H9L A;  2G99 A;  2J57 G;  5THA A;  4I79 A;  2H47 A;  2CN3 A;  3EI3 A;  3NVQ A;  3PXT D;  3SBR A;  2Z2P A;  3EI1 A;  4JD2 C;  4MK0 B;  3N0D A;  4BL0 A;  5EMM B;  5H14 A;  1B9Y A;  5GMK n;  5EM2 B;  3RN0 D;  2H13 A;  4BUJ C;  1RI6 A;  4CC9 A;  3AL9 A;  5HYN B;  3OL2 B;  4CI2 A;  4E5Z A;  5K19 A;  4A08 A;  4FB1 D;  3SBP A;  5IGO A;  4AOW A;  4O3U B;  1N6E A;  4J78 A;  5TDH B;  3UVL A;  3V9F A;  2H3X A;  4XYI A;  3RFG A;  4X60 B;  4J0W A;  4A08 B;  5FKQ A;  4D6V A;  1JOF A;  3RLM D;  1PGU A;  4JSX C;  3IJ1 A;  4FA1 D;  4PC0 A;  3C99 A;  4A11 B;  4L3G D;  4LG9 A;  2HXC A;  3KRW B;  1JMX B;  3SVW D;  3JZH A;  2OK4 A;  2OVR B;  4J73 A;  2P9N C;  4L3H D;  2HJ4 A;  4JT5 C;  4D0K A;  4CI8 A;  2B5L A;  4ERY A;  4X63 B;  5H17 A;  3J81 g;  2AH0 A;  4FAV D;  4U1E I;  3BG0 A;  5I5J A;  4J8G A;  3MXX A;  3DXM C;  2CN2 A;  4IA9 A;  1GP2 B;  3PE7 A;  3JB9 L;  2GC7 A;  5I5I A;  5TEE A;  3BG1 A;  3SHF A;  4K3I D;  3SCY A;  3OL2 A;  1B9X A;  1OLZ A;  4J87 A;  5FXY A;  3V5W B;  3U4Y A;  5HE2 B;  4E5Z B;  3EMH A;  1R5M A;  4OWR A;  4IMM A;  1QNI A;  5CXC B;  5EM2 A;  4HDJ A;  2H6K A;  4QL1 A;  4J77 A;  2IUP A;  3PXS D;  4ERZ A;  4G56 B;  4GQ2 P;  4O45 A;  3EI1 B;  2H6N A;  4PSX B;  2H9P A;  3L4O D;  5FLX g;  4PBZ A;  3KRX B;  3JAM g;  1MDA H;  2AQ5 A;  3A0F A;  2HES X;  4A0B B;  1OMW B;  1GXR A;  4O1Q D;  3SLE D;  3J80 g;  4CZX A;  2UZY B;  3I7N A;  3PXW D;  3F3P A;  5I5M A;  2OIZ A;  2P9P C;  1Q47 A;  1XKS A;  4PBY A;  3SXT D;  4LGN A;  3OKW A;  1N6F A;  3CFS B;  3DXK C;  3MKQ A;  2OVQ B;  2O9K A;  3OKY A;  2UZX B;  4A2L A;  3ODT A;  4LG8 A;  3EG6 A;  2AH1 A;  5GXH A;  3IKO A;  4CY5 A;  1SQ9 A;  2YB8 B;  1U2V C;  2XYI A;  3GRE A;  5B4W A;  4J81 A;  3DM0 A;  1NEX B;  3EI2 B;  5KDO B;  1P22 A;  4CY3 A;  3NVX A;  3I7K A;  2CNX A;  5IJ7 E;  1MG2 A;  4CY1 A;  5EML B;  4GM3 A;  4A0A B;  5HE0 B;  1S4U X;  4TZ4 A;  1MG3 A;  4J82 A;  4PNK B;  2CE9 A;  4A7J A;  2H6Q A;  3SJL D;  2Z2O A;  5TEF A;  5IGQ A;  2PBI B;  5CYK B;  2OJY A;  3I7L A;  4CZV A;  3SBQ A;  4BH6 A;  3EI4 A;  2OK6 A;  3EWE A;  4A11 A;  2HKM A;  5AFU 3;  2P9I C;  3K27 A;  4GGA A;  4Z8L A;  3UVK A;  2I3S A;  3RSE C;  5JWZ A;  2XU7 A;  3N0E A;  4GGC A;  3C9C A;  5AMS A;  1FWX A;  4QRJ A;  4Y5R D;  2B4E A;  2P9L C;  5EAP A;  4EWR A;  1VYH C;  4XEI C;  4X61 B;  5H1M A;  4PSW B;  2PM6 B;  3PSC B;  3F3G A;  2TRC B;  2YMU A;  5C9Z B;  4GQB B;  3ZWL B;  4J8B A;  4GQ1 A;  5EMK B;  3BWS A;  4CI3 A;  3IIW A;  4E54 B;  2P9S C;  4K3J B;  2HYE A;  5EMJ B;  2BBK H;  3JRP A;  4AEZ A;  3C75 H;  2H9M A;  2W18 A;  4GMB A;  5SXM A;  2I0S A;  5EAL A;  3SMR A;  4UI9 R;  4OZU A;  5GXI A;  3FM0 A;  3I7H A;  4FWW A;  3I7P A;  2PM9 A;  3RMZ D;  1K32 A;  3I89 A;  1XHM A;  3AFC A;  3VA6 A;  4A0B A;  4ZOY A;  3VH0 A;  1PEV A;  2IUQ A;  2AGX A;  3AL8 B;  3AH8 B;  4GM8 A;  3MZK A;  4ZOV A;  4PXW A;  3E0C A;  4J84 A;  2B5M A;  3FRX A;  4H5I A;  4A09 B;  5K1C C;  4A09 A;  2CO0 A;  3HFQ A;  5TF2 A;  3AL8 A;  4GM9 A;  1NR0 A;  2I0R A;  4CY2 A;  4L9O A;  2IWK A;  1GG2 B;  4FA5 D;  3IIY A;  1A0R B;  3UVM A;  4GZ8 A;  3DSM A;  3EI3 B;  1GOT B;  2HJB A;  2IUR A;  3NVN A;  5FQD A;  3MKS B;  3JPX A;  4FA4 D;  3IJC A;  1XIP A;  2CE8 A;  2IUV A;  4XYH A;  3OTT A;  4J79 A;  3CFV A;  4U7A A;  4JT6 C;  3I8E A;  3UKU C;  1JMZ B;  1K8K C;  3UKR C;  3B7F A;  1YFQ A;  4N14 A;  2EBS A;  4E54 A;  1JJU B;  5CYK A;  2Z2N A;  1TBG A;  4JSP C;  1ERJ A;  4JSN C;  4FHL A;  1PI6 A;  3V7D B;  2XL2 A;  5EAR A;  1N6D A;  4Y7R A;  3I7O A;  1SHY B;  3K26 A;  3PVW B;  4YVD A;  5GSA A;  2IAA A;  3PSL A;  2CO0 C;  2H68 A;  4NSX A;  3RRM C;  4QQE A;  4J86 A;  3EI4 B;  5A2Q g;  4CI1 A;  2AGZ A;  5CXB B;  3DWL C;  4R7A B;  3C5M A;  3JRO A;  3JZG A;  1L0Q A;  4GGD A;  3JZN A;  3OKT A;  2YNN A;  3MMY A;  2B5N A;  3VGZ A;  3IJ0 A;  1U4C A;  4ESG A;  3OW8 A;  4L1Q D;  2AGW A;  4ZOZ A;  5FKS A;  5FA5 B;  4H5J A;  3SFZ A;  3RFH A;  1TYQ C;  4ES0 A;  2Q7Q A;  3EI2 A;  3W15 A;  4A2M A;  4JXM A;  3UR4 A;  2YNP A;  3FGB A;  4ERQ A;  2QC5 A;  2GC4 A;  3MZL A;  2J56 H;  1SQJ A;  4O3T B;  2MTA H;  5IT9 g;  3UVN A;  4KFM B;  3RN1 D;  3SN6 B;  2PM7 B;  2QXV A;  4X3E A;  3F3F A;  5C2V B;  5CXB A;  4A0A A;  4ZN4 A;  5C2W B;  3EU7 A;  2GNQ A;  5AJA A;  2H14 A;  5IJ8 E;  3P4F A;  2YBA A;  3SWS D;  3I2N A;  4JSV C;  2J55 H;  5HE1 B;  4QT8 A;  5HQG A;  2I3T A;  4CZY A;  4O9D A;  4ZOX A;  3L4M D;  1PBY B;  3PVU B;  2H9N A;  2P9K C;  5FKR A;  3OKY B;  2OVP B;  2XL3 A;  3I8C A;  4J0X A;  5FKT A;  5IC7 A;  4FAN D;  3CIK B;  3GFC A;  2P9U C;  2IWF A;  3ORV D;  2AGY A;  5CXC A;  3ULE C;  2G9A A;  2HKR A;  2I0T A;  5HE3 B;  3UVO A;  5EAM A;  4FA9 D;  2PM9 B;  2YNO A;  2BCJ B;  2AGL A; 
#chains in the Genus database with same CATH topology
 4AMY A;  3VI4 A;  2H9L A;  2G99 A;  2J57 G;  5THA A;  4I79 A;  2H47 A;  3T3P A;  2CN3 A;  3EI3 A;  3NVQ A;  1UTC A;  2VZ1 A;  3PXT D;  3SBR A;  1QFM A;  2Z2P A;  4O02 A;  3FCU A;  3QHY B;  3EI1 A;  3O4H A;  3IVM A;  3MVD K;  4JD2 C;  4MK0 B;  3N0D A;  4BL0 A;  5EMM B;  5H14 A;  1B9Y A;  5GMK n;  5EM2 B;  3RN0 D;  2H13 A;  4BUJ C;  1RI6 A;  4CC9 A;  5E6S A;  3AL9 A;  5HYN B;  1E8M A;  3OL2 B;  4CI2 A;  4E5Z A;  5K19 A;  4A08 A;  1E5T A;  4FB1 D;  3SBP A;  5IGO A;  3FCS A;  4AOW A;  4G1E A;  4O3U B;  5FFO A;  1N6E A;  4J78 A;  5TDH B;  3UVL A;  3V9F A;  2H3X A;  4XYI A;  3O4I A;  3RFG A;  4X60 B;  4J0W A;  4A08 B;  5FKQ A;  4D6V A;  1JOF A;  3RLM D;  1PGU A;  4JSX C;  5C92 A;  4AMZ A;  5M5V A;  3IJ1 A;  4FA1 D;  4PC0 A;  3C99 A;  4A11 B;  4L3G D;  4LG9 A;  2HXC A;  3KRW B;  1JMX B;  4RE5 A;  3SVW D;  3JZH A;  1JTD B;  2OK4 A;  4G55 A;  2OVR B;  5HDB A;  4J73 A;  2P9N C;  4L3H D;  2HJ4 A;  4JT5 C;  4D0K A;  4CI8 A;  2B5L A;  4ERY A;  4X63 B;  5H17 A;  3J81 g;  2AH0 A;  4G1M A;  4FAV D;  4U1E I;  3BG0 A;  5I5J A;  2BKL A;  4J8G A;  3MXX A;  3DXM C;  2CN2 A;  4IA9 A;  1GP2 B;  3GC3 B;  3PE7 A;  3JB9 L;  2GC7 A;  5I5I A;  5TEE A;  1A12 A;  3BG1 A;  3DDU A;  3SHF A;  4DNW A;  4K3I D;  1O6G A;  3SCY A;  3OL2 A;  1B9X A;  1OLZ A;  4J87 A;  5FXY A;  3V5W B;  3U4Y A;  5HE2 B;  4E5Z B;  3EMH A;  1R5M A;  2EID A;  5C86 A;  4OWR A;  4IMM A;  1QNI A;  5CXC B;  5EM2 A;  4HDJ A;  2H6K A;  4QL1 A;  4J77 A;  2IUP A;  2VZ3 A;  3PXS D;  3ZDZ A;  1I2M B;  4ERZ A;  4G56 B;  4GQ2 P;  4O45 A;  3EI1 B;  2H6N A;  4PSX B;  3O4G A;  3KCI A;  2H9P A;  3L4O D;  5FLX g;  4PBZ A;  3KRX B;  4AN0 A;  4Z7Q A;  3JAM g;  1MDA H;  2AQ5 A;  3A0F A;  2HES X;  4A0B B;  3EQ7 A;  3MUN A;  1OMW B;  1GXR A;  4O1Q D;  3SLE D;  3J80 g;  4CZX A;  2VDN A;  2UZY B;  3I7N A;  3PXW D;  3F3P A;  5I5M A;  2OIZ A;  2P9P C;  1Q47 A;  1XKS A;  4PBY A;  3SXT D;  4LGN A;  3OKW A;  1O6F A;  5FFG A;  4DNV A;  1N6F A;  3CFS B;  2JKX A;  3DXK C;  3MKQ A;  2O9K A;  1H2W A;  2OVQ B;  3OKY A;  2UZX B;  4A2L A;  3ODT A;  4LG8 A;  3EG6 A;  2AH1 A;  5GXH A;  3IKO A;  4CY5 A;  1SQ9 A;  2YB8 B;  1U2V C;  4Z7O A;  2XYI A;  3GRE A;  5B4W A;  4Z7N A;  4JHN A;  1C9I A;  4J81 A;  3DM0 A;  3ZDY A;  1NEX B;  3EI2 B;  3IJE A;  5KDO B;  1P22 A;  4CY3 A;  3NVX A;  3I7K A;  2CNX A;  2VDP A;  2VDO A;  3GD1 I;  5IJ7 E;  1MG2 A;  4CY1 A;  2QR5 A;  5EML B;  4GM3 A;  4A0A B;  5HE0 B;  1H2Y A;  1S4U X;  4TZ4 A;  1MG3 A;  4J82 A;  5E6R A;  4PNK B;  2QZP A;  2CE9 A;  4A7J A;  1E8N A;  1H2X A;  2H6Q A;  3SJL D;  3K6S A;  2Z2O A;  3IUN A;  3NID A;  5TEF A;  3V4P A;  5IGQ A;  2PBI B;  5CYK B;  2OJY A;  3I7L A;  4CZV A;  3SBQ A;  1M1X A;  2XDW A;  4BH6 A;  3EI4 A;  2OK6 A;  3EWE A;  4A11 A;  2HKM A;  5AFU 3;  2P9I C;  3K27 A;  4GGA A;  1BPO A;  4Z8L A;  3UVK A;  2I3S A;  3RSE C;  5JWZ A;  2XU7 A;  1UOP A;  4MMZ A;  3N0E A;  4GGC A;  3C9C A;  3K71 A;  5AMS A;  2VDM A;  1FWX A;  4QRJ A;  2B4E A;  4Y5R D;  2P9L C;  5EAP A;  4EWR A;  1VYH C;  4XEI C;  2VDK A;  4X61 B;  5H1M A;  4PSW B;  2PM6 B;  4UM9 A;  2EIE A;  4WK4 A;  3PSC B;  3F3G A;  2TRC B;  2YMU A;  5C9Z B;  1VE7 A;  4GQB B;  3ZWL B;  4O2W A;  4J8B A;  2WQ8 A;  4GQ1 A;  5EMK B;  3BWS A;  4CI3 A;  3IIW A;  4E54 B;  2P9S C;  2VC2 A;  4K3J B;  2HYE A;  5EMJ B;  2BBK H;  3JRP A;  4AEZ A;  3C75 H;  2H9M A;  2W18 A;  4GMB A;  5SXM A;  2I0S A;  5EAL A;  1JV2 A;  3SMR A;  4UI9 R;  3VI3 A;  4OZU A;  5GXI A;  4IRZ A;  3FM0 A;  3I7H A;  3IUM A;  4FWW A;  3I7P A;  2PM9 A;  3RMZ D;  1GOH A;  3OF7 A;  1K32 A;  3I89 A;  1XHM A;  3AFC A;  3VA6 A;  4BCD A;  4A0B A;  4ZOY A;  3VH0 A;  1PEV A;  2HU7 A;  2IUQ A;  2VDQ A;  2AGX A;  3AL8 B;  3AH8 B;  4GM8 A;  3MZK A;  4ZOV A;  4PXW A;  3E0C A;  4J84 A;  2B5M A;  3FRX A;  4H5I A;  4A09 B;  5K1C C;  1YR2 A;  4A09 A;  2CO0 A;  3HFQ A;  5TF2 A;  3AL8 A;  4GM9 A;  1NR0 A;  2I0R A;  4CY2 A;  1GOF A;  1GG2 B;  2IWK A;  4L9O A;  4FA5 D;  5M5S A;  3IIY A;  1A0R B;  3UVM A;  4GZ8 A;  3ZE2 A;  3DSM A;  3EI3 B;  4BCC A;  5M61 A;  1GOT B;  2HJB A;  2IUR A;  3NVN A;  4NAA A;  1H2Z A;  5FQD A;  3MKS B;  3JPX A;  4FA4 D;  3IJC A;  1XIP A;  2CE8 A;  2IUV A;  4XYH A;  3OTT A;  4J79 A;  3CFV A;  4U7A A;  4JT6 C;  3I8E A;  3UKU C;  1JMZ B;  1K8K C;  2HU5 A;  3UKR C;  3B7F A;  1YFQ A;  4N14 A;  2EBS A;  4E54 A;  1JJU B;  5CYK A;  4DNU A;  1UOQ A;  1K3I A;  2EIB A;  2Z2N A;  1TBG A;  4JSP C;  1ERJ A;  1QFS A;  4JSN C;  5E6U A;  1C9L A;  4AX4 A;  4FHL A;  1PI6 A;  3NIF A;  3V7D B;  4D9S A;  2XL2 A;  2EIC A;  1N6D A;  4Y7R A;  5EAR A;  3I7O A;  4WK2 A;  3PVW B;  1SHY B;  3K26 A;  3ZDX A;  4YVD A;  5GSA A;  2IAA A;  3PSL A;  2CO0 C;  2H68 A;  4NSX A;  3RRM C;  4QQE A;  4J86 A;  3EI4 B;  5A2Q g;  4MMX A;  3T3M A;  4CI1 A;  2AGZ A;  5CXB B;  3DWL C;  4R7A B;  3C5M A;  3JRO A;  3JZG A;  3K72 A;  1L0Q A;  4GGD A;  2HU8 A;  3JZN A;  3ZE0 A;  1VZ3 A;  3OKT A;  2YNN A;  3MMY A;  2B5N A;  3VGZ A;  3IJ0 A;  1U4C A;  4ESG A;  3OW8 A;  4L1Q D;  2AGW A;  4ZOZ A;  2VDL A;  3NIG A;  5FKS A;  5FA5 B;  4H5J A;  3SFZ A;  5M5R A;  3RFH A;  5M5T A;  1TYQ C;  4ES0 A;  2Q7Q A;  3EI2 A;  3W15 A;  4JHP C;  4A2M A;  4JXM A;  3UR4 A;  2YNP A;  4L1M A;  3FGB A;  2XE4 A;  4ERQ A;  2QC5 A;  2GC4 A;  3MZL A;  2J56 H;  1SQJ A;  3EQ9 A;  3IUJ A;  3QI0 A;  4BP9 A;  4O3T B;  2MTA H;  5IT9 g;  1TYE A;  4RE6 A;  3UVN A;  4KFM B;  3RN1 D;  3SN6 B;  2PM7 B;  2QXV A;  4X3E A;  3F3F A;  5C2V B;  5CXB A;  4A0A A;  4ZN4 A;  3V4V A;  4WJK A;  5C2W B;  1GOG A;  3EU7 A;  2GNQ A;  5AJA A;  2H14 A;  5IJ8 E;  3P4F A;  2YBA A;  4UM8 A;  3SWS D;  3I2N A;  4JSV C;  2J55 H;  5HE1 B;  4QT8 A;  4NEN A;  4BCB A;  5HQG A;  1U8C A;  2I3T A;  4CZY A;  4O9D A;  4ZOX A;  4WK0 A;  1VZ2 A;  3L4M D;  3MUO A;  1L5G A;  3EQ8 A;  1PBY B;  3PVU B;  2H9N A;  2P9K C;  4MMY A;  5FKR A;  2XZG A;  3IUR A;  1VE6 A;  5M5U A;  3OKY B;  2OVP B;  4BP8 A;  2XL3 A;  3I8C A;  4J0X A;  5FKT A;  5IC7 A;  4FAN D;  3CIK B;  3GFC A;  3IUQ A;  1UOO A;  4AN1 A;  2P9U C;  2IWF A;  2VDR A;  3ORV D;  2AGY A;  5CXC A;  3ULE C;  2G9A A;  1T2X A;  2HKR A;  2I0T A;  4QAM A;  3ZE1 A;  3IUL A;  5HE3 B;  3O4J A;  3UVO A;  5EAM A;  4FA9 D;  4NBM A;  2PM9 B;  2YNO A;  2BCJ B;  4NC4 A;  2AGL A; 
#chains in the Genus database with same CATH homology
 2H9L A;  2G99 A;  2J57 G;  5THA A;  4I79 A;  2H47 A;  2CN3 A;  3EI3 A;  3NVQ A;  3PXT D;  3SBR A;  2Z2P A;  3EI1 A;  4JD2 C;  4MK0 B;  3N0D A;  4BL0 A;  5EMM B;  5H14 A;  1B9Y A;  5GMK n;  5EM2 B;  3RN0 D;  2H13 A;  4BUJ C;  1RI6 A;  4CC9 A;  3AL9 A;  5HYN B;  3OL2 B;  4CI2 A;  4E5Z A;  5K19 A;  4A08 A;  4FB1 D;  3SBP A;  5IGO A;  4AOW A;  4O3U B;  1N6E A;  4J78 A;  5TDH B;  3UVL A;  3V9F A;  2H3X A;  4XYI A;  3RFG A;  4X60 B;  4J0W A;  4A08 B;  5FKQ A;  4D6V A;  1JOF A;  3RLM D;  1PGU A;  4JSX C;  3IJ1 A;  4FA1 D;  4PC0 A;  3C99 A;  4A11 B;  4L3G D;  4LG9 A;  2HXC A;  3KRW B;  1JMX B;  3SVW D;  3JZH A;  2OK4 A;  2OVR B;  4J73 A;  2P9N C;  4L3H D;  2HJ4 A;  4JT5 C;  4D0K A;  4CI8 A;  2B5L A;  4ERY A;  4X63 B;  5H17 A;  3J81 g;  2AH0 A;  4FAV D;  4U1E I;  3BG0 A;  5I5J A;  4J8G A;  3MXX A;  3DXM C;  2CN2 A;  4IA9 A;  1GP2 B;  3PE7 A;  3JB9 L;  2GC7 A;  5I5I A;  5TEE A;  3BG1 A;  3SHF A;  4K3I D;  3SCY A;  3OL2 A;  1B9X A;  1OLZ A;  4J87 A;  5FXY A;  3V5W B;  3U4Y A;  5HE2 B;  4E5Z B;  3EMH A;  1R5M A;  4OWR A;  4IMM A;  1QNI A;  5CXC B;  5EM2 A;  4HDJ A;  2H6K A;  4QL1 A;  4J77 A;  2IUP A;  3PXS D;  4ERZ A;  4G56 B;  4GQ2 P;  4O45 A;  3EI1 B;  2H6N A;  4PSX B;  2H9P A;  3L4O D;  5FLX g;  4PBZ A;  3KRX B;  3JAM g;  1MDA H;  2AQ5 A;  3A0F A;  2HES X;  4A0B B;  1OMW B;  1GXR A;  4O1Q D;  3SLE D;  3J80 g;  4CZX A;  2UZY B;  3I7N A;  3PXW D;  3F3P A;  5I5M A;  2OIZ A;  2P9P C;  1Q47 A;  1XKS A;  4PBY A;  3SXT D;  4LGN A;  3OKW A;  1N6F A;  3CFS B;  3DXK C;  3MKQ A;  2OVQ B;  2O9K A;  3OKY A;  2UZX B;  4A2L A;  3ODT A;  4LG8 A;  3EG6 A;  2AH1 A;  5GXH A;  3IKO A;  4CY5 A;  1SQ9 A;  2YB8 B;  1U2V C;  2XYI A;  3GRE A;  5B4W A;  4J81 A;  3DM0 A;  1NEX B;  3EI2 B;  5KDO B;  1P22 A;  4CY3 A;  3NVX A;  3I7K A;  2CNX A;  5IJ7 E;  1MG2 A;  4CY1 A;  5EML B;  4GM3 A;  4A0A B;  5HE0 B;  1S4U X;  4TZ4 A;  1MG3 A;  4J82 A;  4PNK B;  2CE9 A;  4A7J A;  2H6Q A;  3SJL D;  2Z2O A;  5TEF A;  5IGQ A;  2PBI B;  5CYK B;  2OJY A;  3I7L A;  4CZV A;  3SBQ A;  4BH6 A;  3EI4 A;  2OK6 A;  3EWE A;  4A11 A;  2HKM A;  5AFU 3;  2P9I C;  3K27 A;  4GGA A;  4Z8L A;  3UVK A;  2I3S A;  3RSE C;  5JWZ A;  2XU7 A;  3N0E A;  4GGC A;  3C9C A;  5AMS A;  1FWX A;  4QRJ A;  4Y5R D;  2B4E A;  2P9L C;  5EAP A;  4EWR A;  1VYH C;  4XEI C;  4X61 B;  5H1M A;  4PSW B;  2PM6 B;  3PSC B;  3F3G A;  2TRC B;  2YMU A;  5C9Z B;  4GQB B;  3ZWL B;  4J8B A;  4GQ1 A;  5EMK B;  3BWS A;  4CI3 A;  3IIW A;  4E54 B;  2P9S C;  4K3J B;  2HYE A;  5EMJ B;  2BBK H;  3JRP A;  4AEZ A;  3C75 H;  2H9M A;  2W18 A;  4GMB A;  5SXM A;  2I0S A;  5EAL A;  3SMR A;  4UI9 R;  4OZU A;  5GXI A;  3FM0 A;  3I7H A;  4FWW A;  3I7P A;  2PM9 A;  3RMZ D;  1K32 A;  3I89 A;  1XHM A;  3AFC A;  3VA6 A;  4A0B A;  4ZOY A;  3VH0 A;  1PEV A;  2IUQ A;  2AGX A;  3AL8 B;  3AH8 B;  4GM8 A;  3MZK A;  4ZOV A;  4PXW A;  3E0C A;  4J84 A;  2B5M A;  3FRX A;  4H5I A;  4A09 B;  5K1C C;  4A09 A;  2CO0 A;  3HFQ A;  5TF2 A;  3AL8 A;  4GM9 A;  1NR0 A;  2I0R A;  4CY2 A;  4L9O A;  2IWK A;  1GG2 B;  4FA5 D;  3IIY A;  1A0R B;  3UVM A;  4GZ8 A;  3DSM A;  3EI3 B;  1GOT B;  2HJB A;  2IUR A;  3NVN A;  5FQD A;  3MKS B;  3JPX A;  4FA4 D;  3IJC A;  1XIP A;  2CE8 A;  2IUV A;  4XYH A;  3OTT A;  4J79 A;  3CFV A;  4U7A A;  4JT6 C;  3I8E A;  3UKU C;  1JMZ B;  1K8K C;  3UKR C;  3B7F A;  1YFQ A;  4N14 A;  2EBS A;  4E54 A;  1JJU B;  5CYK A;  2Z2N A;  1TBG A;  4JSP C;  1ERJ A;  4JSN C;  4FHL A;  1PI6 A;  3V7D B;  2XL2 A;  5EAR A;  1N6D A;  4Y7R A;  3I7O A;  1SHY B;  3K26 A;  3PVW B;  4YVD A;  5GSA A;  2IAA A;  3PSL A;  2CO0 C;  2H68 A;  4NSX A;  3RRM C;  4QQE A;  4J86 A;  3EI4 B;  5A2Q g;  4CI1 A;  2AGZ A;  5CXB B;  3DWL C;  4R7A B;  3C5M A;  3JRO A;  3JZG A;  1L0Q A;  4GGD A;  3JZN A;  3OKT A;  2YNN A;  3MMY A;  2B5N A;  3VGZ A;  3IJ0 A;  1U4C A;  4ESG A;  3OW8 A;  4L1Q D;  2AGW A;  4ZOZ A;  5FKS A;  5FA5 B;  4H5J A;  3SFZ A;  3RFH A;  1TYQ C;  4ES0 A;  2Q7Q A;  3EI2 A;  3W15 A;  4A2M A;  4JXM A;  3UR4 A;  2YNP A;  3FGB A;  4ERQ A;  2QC5 A;  2GC4 A;  3MZL A;  2J56 H;  1SQJ A;  4O3T B;  2MTA H;  5IT9 g;  3UVN A;  4KFM B;  3RN1 D;  3SN6 B;  2PM7 B;  2QXV A;  4X3E A;  3F3F A;  5C2V B;  5CXB A;  4A0A A;  4ZN4 A;  5C2W B;  3EU7 A;  2GNQ A;  5AJA A;  2H14 A;  5IJ8 E;  3P4F A;  2YBA A;  3SWS D;  3I2N A;  4JSV C;  2J55 H;  5HE1 B;  4QT8 A;  5HQG A;  2I3T A;  4CZY A;  4O9D A;  4ZOX A;  3L4M D;  1PBY B;  3PVU B;  2H9N A;  2P9K C;  5FKR A;  3OKY B;  2OVP B;  2XL3 A;  3I8C A;  4J0X A;  5FKT A;  5IC7 A;  4FAN D;  3CIK B;  3GFC A;  2P9U C;  2IWF A;  3ORV D;  2AGY A;  5CXC A;  3ULE C;  2G9A A;  2HKR A;  2I0T A;  5HE3 B;  3UVO A;  5EAM A;  4FA9 D;  2PM9 B;  2YNO A;  2BCJ B;  2AGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...