4QL1A

Crystal structure of human wdr5 in complex with compound oicr-9429
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/inhibitor
molecule keywords WD repeat-containing protein 5
publication title Pharmacological targeting of the Wdr5-MLL interaction in C/EBP alpha N-terminal leukemia.
pubmed doi rcsb
source organism Homo sapiens
total genus 107
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4ql1A00
5KDOB 2HKRA 3B7FA 2AGXA 3I7NA 3SBPA 4UI9R 3AL8A 2PM6B 4A08A 4BUJC 5EMJB 1B9YA 5HE2B 2H6QA 3C9CA 3SFZA 1RI6A 3ZWLB 5EMMB 4A11B 3L4MD 4CY5A 4N14A 4LG8A 5C2WB 2B4EA 2P9UC 5CXBA 4J78A 3SJLD 3EI1A 3N0DA 4U7AA 3SMRA 2Z2NA 5IT9g 2UZXB 1XHMA 2YNNA 5IGQA 5FKQA 2MTAH 2HESX 4GMBA 3JROA 3DM0A 1NEXB 3FM0A 3UVOA 2G99A 4ERQA 3ULEC 2H9PA 3UVNA 1U4CA 3SXTD 2AGWA 4U1EI 4L1QD 2CN3A 2CE9A 3L4OD 3EI4A 5GMKn 3EMHA 5CXCB 3VGZA 4L9OA 4A0AA 5AJAA 4D0KA 3PSCB 5EM2A 3IJCA 1YFQA 3MXXA 4X60B 4Y5RD 3BWSA 3BG1A 2HKMA 4AOWA 4J87A 3RLMD 1N6EA 4FWWA 4I79A 5IGOA 2PBIB 5AMSA 2PM9B 4NSXA 1SQJA 4FAVD 4FA1D 2H6KA 3GFCA 3I7PA 3JZHA 3SCYA 3C75H 4IA9A 4A0BA 1S4UX 3A0FA 5EARA 3AL8B 3N0EA 4QRJA 2H9MA 4ERZA 4X61B 5EMKB 3OL2A 4A08B 2AGYA 2OK6A 4JSXC 1VYHC 2XU7A 4JSVC 4J81A 5FXYA 4H5IA 3UVMA 5CXBB 3V7DB 1U2VC 2Q7QA 4GQBB 2YNOA 2BBKH 3SVWD 3E0CA 4CY2A 3I8CA 1N6FA 4J86A 5I5IA 4Y7RA 3VH0A 3W15A 3PSLA 4G56B 5GXIA 4L3HD 1MG2A 3I8EA 3UVLA 4BH6A 4QQEA 4KFMB 4J8BA 3UR4A 4HDJA 1L0QA 3MKSB 3I7KA 4ZOVA 3V5WB 5EMLB 4FHLA 3EI4B 4PNKB 1Q47A 2P9IC 1ERJA 3FGBA 4Z8LA 2XL3A 4A7JA 5TEFA 4MK0B 2I0TA 3JRPA 2IUPA 4ESGA 1PBYB 4CZYA 5HE0B 3J80g 2HYEA 5THAA 2P9PC 1GP2B 4J73A 5C2VB 3C5MA 4A09A 5A2Qg 4D6VA 5EALA 1GG2B 3DXKC 4JT6C 4XYIA 3IJ1A 4R7AB 2B5LA 3UKRC 5TDHB 4FA5D 4ES0A 4PSXB 1GOTB 2HXCA 2AH1A 3MKQA 2J56H 3F3PA 3V9FA 2EBSA 3EI3A 4JD2C 2XL2A 4FAND 4JSPC 2GC7A 4GQ2P 2J55H 2I3TA 3ODTA 2AH0A 3KRXB 3I2NA 3RN1D 4PSWB 4X3EA 3OKYB 4LGNA 1A0RB 5HE3B 4BL0A 3EI2B 5H1MA 2CN2A 4O3UB 4J8GA 3K27A 3UVKA 5GSAA 2OK4A 4E5ZA 3GREA 1TBGA 4A2LA 2CE8A 4FA4D 3NVNA 2Z2OA 3F3FA 4EWRA 2OVRB 1R5MA 1P22A 2W18A 3JAMg 1PGUA 3HFQA 2CNXA 4CZVA 4ZOXA 2H3XA 4QL1A 1OMWB 3KRWB 1GXRA 5FKTA 4J0WA 3IIWA 1FWXA 3MZLA 3PXSD 3JB9L 2XYIA 2IURA 5SXMA 2IAAA 1K8KC 2G9AA 2OVPB 3AFCA 1MDAH 4X63B 1N6DA 4ZOZA 3UKUC 2IWFA 4A11A 3PVUB 2H6NA 4GGAA 3DXMC 5C9ZB 1QNIA 2H68A 4GGDA 5FKRA 3F3GA 3EI1B 4J0XA 4JXMA 4CY3A 2CO0A 3CIKB 3OW8A 4E54A 3RRMC 3EI3B 4OZUA 3I7OA 2H9NA 3JPXA 3ORVD 3FRXA 2AGZA 4J84A 5TF2A 1K32A 1SQ9A 4XYHA 3DWLC 3K26A 1JMXB 4YVDA 3IIYA 3CFSB 5I5JA 1XKSA 2GC4A 5H17A 2I3SA 3MZKA 4A0AB 2BCJB 4PBZA 3PXWD 3NVXA 5EM2B 3U4YA 2Z2PA 5I5MA 3MMYA 3RMZD 5HYNB 3EG6A 2PM9A 4O1QD 1JJUB 5CYKA 4CI2A 2YBAA 3DSMA 3RSEC 3OKWA 3NVQA 3SWSD 2O9KA 4H5JA 3P4FA 4JT5C 4A0BB 4IMMA 5FLXg 4GM9A 2P9KC 3OL2B 2YB8B 2I0SA 5H14A 2IWKA 2AQ5A 2HJ4A 3PXTD 3OTTA 4FA9D 2I0RA 3AL9A 2P9NC 4ERYA 4J79A 1SHYB 1B9XA 2OIZA 4CI1A 5AFU3 3AH8B 5B4WA 5K19A 4O45A 1OLZA 4E54B 4JSNC 4CI8A 3RFHA 4CZXA 4L3GD 4PBYA 4AEZA 2GNQA 5EAMA 3JZGA 3SN6B 1XIPA 2YMUA 3PE7A 2QC5A 3I89A 3EWEA 1PEVA 5TEEA 4QT8A 5IC7A 3I7LA 4CY1A 4LG9A 5FA5B 3PVWB 2AGLA 4CI3A 2P9SC 4A2MA 4ZOYA 2QXVA 4OWRA 1NR0A 2UZYB 3C99A 5CYKB 4K3JB 3SHFA 4A09B 4K3ID 3J81g 4TZ4A 4PC0A 4O9DA 5IJ7E 2YNPA 3IJ0A 5HE1B 5JWZA 3CFVA 1TYQC 1JMZB 2OJYA 2OVQB 2CO0C 4J82A 4GZ8A 4J77A 3OKTA 2PM7B 2IUQA 1PI6A 3OKYA 4XEIC 5FQDA 3EI2A 2B5NA 4GGCA 2P9LC 2H9LA 5CXCA 3RN0D 4FB1D 5IJ8E 4ZN4A 3EU7A 3I7HA 1MG3A 3JZNA 2J57G 2B5MA 3SBQA 1JOFA 4E5ZB 3IKOA 2TRCB 3SLED 5K1CC 3VA6A 2H14A 5FKSA 3SBRA 2H13A 4GM3A 5GXHA 4O3TB 4GM8A 4PXWA 5EAPA 4GQ1A 3RFGA 4CC9A 2HJBA 2IUVA 2H47A 3BG0A 5HQGA
chains in the Genus database with same CATH superfamily
5KDOB 2HKRA 3B7FA 2AGXA 3I7NA 5FFGA 3SBPA 4UI9R 2VZ1A 3AL8A 2PM6B 4A08A 4BUJC 5EMJB 1B9YA 5HE2B 2H6QA 3C9CA 3SFZA 1RI6A 3ZWLB 4AMZA 4WJKA 3O4HA 5EMMB 4A11B 3L4MD 4CY5A 4N14A 4LG8A 5C2WB 3NIDA 4DNWA 2B4EA 2P9UC 5CXBA 2QZPA 4J78A 3SJLD 3EI1A 3N0DA 4U7AA 3SMRA 2Z2NA 5IT9g 2UZXB 1I2MB 1XHMA 2YNNA 5IGQA 5FKQA 2HU5A 2EICA 2MTAH 2HESX 4GMBA 4NAAA 1TYEA 3JROA 3DM0A 1NEXB 3FM0A 1U8CA 4AX4A 3UVOA 3ZDYA 2XZGA 2G99A 1UTCA 4ERQA 3ULEC 2H9PA 3UVNA 1U4CA 3SXTD 2AGWA 4U1EI 4L1QD 2CN3A 2CE9A 3L4OD 2VDLA 3EI4A 5GMKn 3EMHA 5CXCB 3VGZA 2XE4A 4L9OA 3IUQA 4A0AA 3GC3B 1H2YA 5AJAA 4D0KA 3PSCB 5EM2A 3IJCA 1YFQA 3MXXA 4X60B 4Y5RD 4BCCA 3BWSA 3BG1A 2HKMA 4IRZA 4J87A 3RLMD 4AOWA 1N6EA 4FWWA 4I79A 5IGOA 2PBIB 5AMSA 2PM9B 4NSXA 4QAMA 1JV2A 4MMYA 1SQJA 4FAVD 4FA1D 2H6KA 3GFCA 3I7PA 3JZHA 3SCYA 3C75H 4IA9A 4A0BA 1S4UX 3A0FA 5EARA 3AL8B 3N0EA 4QRJA 2H9MA 4ERZA 4X61B 5EMKB 3OL2A 4A08B 2AGYA 1H2ZA 2OK6A 3T3PA 4JSXC 1VYHC 2XU7A 4JSVC 4J81A 5FXYA 1VE6A 4MMXA 4H5IA 3UVMA 5CXBB 3V7DB 1U2VC 2Q7QA 4GQBB 2YNOA 2BBKH 5M5UA 3SVWD 3E0CA 1E8NA 4CY2A 3I8CA 1N6FA 4J86A 5I5IA 3QI0A 4Y7RA 3VH0A 4Z7NA 3W15A 3PSLA 4G56B 5GXIA 4L3HD 1MG2A 4UM8A 3I8EA 3UVLA 4BH6A 4QQEA 4KFMB 4J8BA 3UR4A 4HDJA 3ZE0A 3EQ9A 1L0QA 3K71A 1K3IA 3MKSB 3I7KA 4ZOVA 3V5WB 5EMLB 4FHLA 3VI3A 3EI4B 4PNKB 1Q47A 2P9IC 4DNVA 1ERJA 3IURA 3FGBA 4Z8LA 2XL3A 4Z7QA 4A7JA 5TEFA 4MK0B 2I0TA 2BKLA 2IUPA 3JRPA 4ESGA 1PBYB 4CZYA 5HE0B 3J80g 5M5TA 3FCUA 2HYEA 5THAA 4Z7OA 2P9PC 1GP2B 5FFOA 4J73A 5C2VB 1A12A 3IULA 3C5MA 4A09A 1H2XA 5A2Qg 4D6VA 2VZ3A 5EALA 1GG2B 3DXKC 4JT6C 5E6UA 4XYIA 2VDKA 2HU8A 3IJ1A 4R7AB 3ZDZA 2B5LA 5M5SA 3UKRC 5TDHB 4FA5D 4ES0A 4PSXB 1GOTB 3IJEA 2HXCA 1UOQA 2AH1A 3MKQA 2J56H 3F3PA 3NIGA 3V9FA 2EBSA 3EI3A 4JD2C 2XL2A 4FAND 4JSPC 2GC7A 1GOFA 4GQ2P 2J55H 2I3TA 1VE7A 3EQ8A 2EIBA 3IUJA 3ODTA 4G55A 3QHYB 3MUOA 5C92A 2AH0A 3KRXB 3I2NA 3RN1D 4PSWB 4X3EA 3OKYB 2WQ8A 4LGNA 1A0RB 5HE3B 4BL0A 3EI2B 1M1XA 5H1MA 2CN2A 4O3UB 5HDBA 4J8GA 5E6SA 3K27A 3UVKA 5GSAA 3K6SA 2OK4A 4AN0A 4E5ZA 4L1MA 3GREA 1TBGA 3O4IA 4A2LA 2CE8A 4FA4D 4BP8A 3NVNA 2Z2OA 3F3FA 4EWRA 2OVRB 1R5MA 1P22A 2W18A 3ZE2A 3GD1I 2EIDA 3JAMg 1PGUA 3HFQA 1GOGA 2CNXA 4CZVA 4ZOXA 4D9SA 2H3XA 4QL1A 1OMWB 3KRWB 1GXRA 5FKTA 4J0WA 3IIWA 1FWXA 2QR5A 3MZLA 3PXSD 3JB9L 2XYIA 2IURA 5SXMA 2VC2A 2IAAA 1K8KC 2G9AA 2OVPB 3AFCA 1MDAH 4X63B 1N6DA 4ZOZA 2VDQA 3UKUC 2IWFA 4A11A 3PVUB 2H6NA 4GGAA 3DXMC 5C9ZB 1QNIA 2H68A 1O6FA 4GGDA 5FKRA 1T2XA 3EQ7A 4WK4A 3F3GA 4WK2A 2XDWA 3EI1B 4J0XA 4JXMA 4CY3A 2CO0A 3CIKB 3OW8A 5M61A 4E54A 3RRMC 1E8MA 5M5RA 3EI3B 4AMYA 4OZUA 3K72A 3I7OA 2H9NA 3JPXA 3ORVD 3FRXA 3ZDXA 2AGZA 4J84A 5TF2A 1K32A 1SQ9A 4XYHA 3DWLC 1QFSA 3K26A 4NENA 1JMXB 3V4VA 4YVDA 3IIYA 3VI4A 3CFSB 5I5JA 1XKSA 2GC4A 5H17A 2I3SA 3O4JA 3MZKA 4A0AB 3MVDK 4BCDA 2BCJB 4PBZA 3PXWD 4JHNA 1C9IA 3NVXA 5EM2B 3U4YA 2Z2PA 5I5MA 3MMYA 3RMZD 5HYNB 3EG6A 2PM9A 4O1QD 1JJUB 5CYKA 1E5TA 3IUMA 4CI2A 2YBAA 3DSMA 3RSEC 4BP9A 3OKWA 4RE6A 3NVQA 1VZ2A 3SWSD 2VDMA 2O9KA 4NBMA 4H5JA 1UOPA 2EIEA 3P4FA 4JT5C 4A0BB 4IMMA 5FLXg 1VZ3A 4GM9A 2P9KC 5M5VA 1BPOA 3OL2B 1O6GA 2YB8B 2I0SA 5H14A 2IWKA 2AQ5A 3IVMA 3FCSA 2HJ4A 3PXTD 3OTTA 4FA9D 2I0RA 3AL9A 2P9NC 4ERYA 4J79A 2VDNA 3KCIA 1SHYB 4DNUA 3T3MA 1B9XA 2OIZA 4CI1A 2VDOA 4NC4A 5AFU3 3AH8B 5B4WA 5K19A 4O45A 1OLZA 1H2WA 4E54B 4JSNC 4CI8A 3V4PA 3RFHA 4CZXA 4L3GD 1UOOA 4PBYA 4AEZA 5C86A 2GNQA 5EAMA 3JZGA 3SN6B 1XIPA 2JKXA 2YMUA 4MMZA 3PE7A 2QC5A 4AN1A 3I89A 3EWEA 1PEVA 5TEEA 4QT8A 5IC7A 4RE5A 3I7LA 3NIFA 4O02A 1L5GA 4CY1A 4LG9A 5FA5B 3PVWB 2AGLA 4CI3A 2P9SC 4A2MA 4ZOYA 1GOHA 2QXVA 4OWRA 1NR0A 2UZYB 3C99A 5CYKB 4G1EA 3ZE1A 4K3JB 3SHFA 4A09B 3IUNA 2VDRA 4K3ID 3J81g 4TZ4A 4PC0A 4O9DA 5IJ7E 2YNPA 3IJ0A 5HE1B 5JWZA 5E6RA 4BCBA 4O2WA 3CFVA 4G1MA 1TYQC 1JMZB 2OJYA 2OVQB 2CO0C 3DDUA 4J82A 3OF7A 4GZ8A 4J77A 3OKTA 1QFMA 2PM7B 2IUQA 2VDPA 1PI6A 3OKYA 4XEIC 5FQDA 3MUNA 2HU7A 3EI2A 2B5NA 4GGCA 2P9LC 2H9LA 5CXCA 3RN0D 4WK0A 4FB1D 5IJ8E 4JHPC 4ZN4A 3EU7A 3I7HA 1MG3A 3JZNA 2J57G 2B5MA 3SBQA 1JOFA 1YR2A 4E5ZB 3IKOA 1JTDB 2TRCB 3SLED 5K1CC 3VA6A 2H14A 5FKSA 3SBRA 2H13A 4GM3A 5GXHA 1C9LA 4O3TB 4GM8A 4PXWA 5EAPA 4GQ1A 3RFGA 4UM9A 4CC9A 2HJBA 2IUVA 2H47A 3O4GA 3BG0A 5HQGA
chains in the Genus database with same CATH topology
5KDOB 2HKRA 3B7FA 2AGXA 3I7NA 3SBPA 4UI9R 3AL8A 2PM6B 4A08A 4BUJC 5EMJB 1B9YA 5HE2B 2H6QA 3C9CA 3SFZA 1RI6A 3ZWLB 5EMMB 4A11B 3L4MD 4CY5A 4N14A 4LG8A 5C2WB 2B4EA 2P9UC 5CXBA 4J78A 3SJLD 3EI1A 3N0DA 4U7AA 3SMRA 2Z2NA 5IT9g 2UZXB 1XHMA 2YNNA 5IGQA 5FKQA 2MTAH 2HESX 4GMBA 3JROA 3DM0A 1NEXB 3FM0A 3UVOA 2G99A 4ERQA 3ULEC 2H9PA 3UVNA 1U4CA 3SXTD 2AGWA 4U1EI 4L1QD 2CN3A 2CE9A 3L4OD 3EI4A 5GMKn 3EMHA 5CXCB 3VGZA 4L9OA 4A0AA 5AJAA 4D0KA 3PSCB 5EM2A 3IJCA 1YFQA 3MXXA 4X60B 4Y5RD 3BWSA 3BG1A 2HKMA 4AOWA 4J87A 3RLMD 1N6EA 4FWWA 4I79A 5IGOA 2PBIB 5AMSA 2PM9B 4NSXA 1SQJA 4FAVD 4FA1D 2H6KA 3GFCA 3I7PA 3JZHA 3SCYA 3C75H 4IA9A 4A0BA 1S4UX 3A0FA 5EARA 3AL8B 3N0EA 4QRJA 2H9MA 4ERZA 4X61B 5EMKB 3OL2A 4A08B 2AGYA 2OK6A 4JSXC 1VYHC 2XU7A 4JSVC 4J81A 5FXYA 4H5IA 3UVMA 5CXBB 3V7DB 1U2VC 2Q7QA 4GQBB 2YNOA 2BBKH 3SVWD 3E0CA 4CY2A 3I8CA 1N6FA 4J86A 5I5IA 4Y7RA 3VH0A 3W15A 3PSLA 4G56B 5GXIA 4L3HD 1MG2A 3I8EA 3UVLA 4BH6A 4QQEA 4KFMB 4J8BA 3UR4A 4HDJA 1L0QA 3MKSB 3I7KA 4ZOVA 3V5WB 5EMLB 4FHLA 3EI4B 4PNKB 1Q47A 2P9IC 1ERJA 3FGBA 4Z8LA 2XL3A 4A7JA 5TEFA 4MK0B 2I0TA 3JRPA 2IUPA 4ESGA 1PBYB 4CZYA 5HE0B 3J80g 2HYEA 5THAA 2P9PC 1GP2B 4J73A 5C2VB 3C5MA 4A09A 5A2Qg 4D6VA 5EALA 1GG2B 3DXKC 4JT6C 4XYIA 3IJ1A 4R7AB 2B5LA 3UKRC 5TDHB 4FA5D 4ES0A 4PSXB 1GOTB 2HXCA 2AH1A 3MKQA 2J56H 3F3PA 3V9FA 2EBSA 3EI3A 4JD2C 2XL2A 4FAND 4JSPC 2GC7A 4GQ2P 2J55H 2I3TA 3ODTA 2AH0A 3KRXB 3I2NA 3RN1D 4PSWB 4X3EA 3OKYB 4LGNA 1A0RB 5HE3B 4BL0A 3EI2B 5H1MA 2CN2A 4O3UB 4J8GA 3K27A 3UVKA 5GSAA 2OK4A 4E5ZA 3GREA 1TBGA 4A2LA 2CE8A 4FA4D 3NVNA 2Z2OA 3F3FA 4EWRA 2OVRB 1R5MA 1P22A 2W18A 3JAMg 1PGUA 3HFQA 2CNXA 4CZVA 4ZOXA 2H3XA 4QL1A 1OMWB 3KRWB 1GXRA 5FKTA 4J0WA 3IIWA 1FWXA 3MZLA 3PXSD 3JB9L 2XYIA 2IURA 5SXMA 2IAAA 1K8KC 2G9AA 2OVPB 3AFCA 1MDAH 4X63B 1N6DA 4ZOZA 3UKUC 2IWFA 4A11A 3PVUB 2H6NA 4GGAA 3DXMC 5C9ZB 1QNIA 2H68A 4GGDA 5FKRA 3F3GA 3EI1B 4J0XA 4JXMA 4CY3A 2CO0A 3CIKB 3OW8A 4E54A 3RRMC 3EI3B 4OZUA 3I7OA 2H9NA 3JPXA 3ORVD 3FRXA 2AGZA 4J84A 5TF2A 1K32A 1SQ9A 4XYHA 3DWLC 3K26A 1JMXB 4YVDA 3IIYA 3CFSB 5I5JA 1XKSA 2GC4A 5H17A 2I3SA 3MZKA 4A0AB 2BCJB 4PBZA 3PXWD 3NVXA 5EM2B 3U4YA 2Z2PA 5I5MA 3MMYA 3RMZD 5HYNB 3EG6A 2PM9A 4O1QD 1JJUB 5CYKA 4CI2A 2YBAA 3DSMA 3RSEC 3OKWA 3NVQA 3SWSD 2O9KA 4H5JA 3P4FA 4JT5C 4A0BB 4IMMA 5FLXg 4GM9A 2P9KC 3OL2B 2YB8B 2I0SA 5H14A 2IWKA 2AQ5A 2HJ4A 3PXTD 3OTTA 4FA9D 2I0RA 3AL9A 2P9NC 4ERYA 4J79A 1SHYB 1B9XA 2OIZA 4CI1A 5AFU3 3AH8B 5B4WA 5K19A 4O45A 1OLZA 4E54B 4JSNC 4CI8A 3RFHA 4CZXA 4L3GD 4PBYA 4AEZA 2GNQA 5EAMA 3JZGA 3SN6B 1XIPA 2YMUA 3PE7A 2QC5A 3I89A 3EWEA 1PEVA 5TEEA 4QT8A 5IC7A 3I7LA 4CY1A 4LG9A 5FA5B 3PVWB 2AGLA 4CI3A 2P9SC 4A2MA 4ZOYA 2QXVA 4OWRA 1NR0A 2UZYB 3C99A 5CYKB 4K3JB 3SHFA 4A09B 4K3ID 3J81g 4TZ4A 4PC0A 4O9DA 5IJ7E 2YNPA 3IJ0A 5HE1B 5JWZA 3CFVA 1TYQC 1JMZB 2OJYA 2OVQB 2CO0C 4J82A 4GZ8A 4J77A 3OKTA 2PM7B 2IUQA 1PI6A 3OKYA 4XEIC 5FQDA 3EI2A 2B5NA 4GGCA 2P9LC 2H9LA 5CXCA 3RN0D 4FB1D 5IJ8E 4ZN4A 3EU7A 3I7HA 1MG3A 3JZNA 2J57G 2B5MA 3SBQA 1JOFA 4E5ZB 3IKOA 2TRCB 3SLED 5K1CC 3VA6A 2H14A 5FKSA 3SBRA 2H13A 4GM3A 5GXHA 4O3TB 4GM8A 4PXWA 5EAPA 4GQ1A 3RFGA 4CC9A 2HJBA 2IUVA 2H47A 3BG0A 5HQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KDO B;  2HKR A;  3B7F A;  2AGX A;  3I7N A;  3SBP A;  4UI9 R;  3AL8 A;  2PM6 B;  4A08 A;  4BUJ C;  5EMJ B;  1B9Y A;  5HE2 B;  2H6Q A;  3C9C A;  3SFZ A;  1RI6 A;  3ZWL B;  5EMM B;  4A11 B;  3L4M D;  4CY5 A;  4N14 A;  4LG8 A;  5C2W B;  2B4E A;  2P9U C;  5CXB A;  4J78 A;  3SJL D;  3EI1 A;  3N0D A;  4U7A A;  3SMR A;  2Z2N A;  5IT9 g;  2UZX B;  1XHM A;  2YNN A;  5IGQ A;  5FKQ A;  2MTA H;  2HES X;  4GMB A;  3JRO A;  3DM0 A;  1NEX B;  3FM0 A;  3UVO A;  2G99 A;  4ERQ A;  3ULE C;  2H9P A;  3UVN A;  1U4C A;  3SXT D;  2AGW A;  4U1E I;  4L1Q D;  2CN3 A;  2CE9 A;  3L4O D;  3EI4 A;  5GMK n;  3EMH A;  5CXC B;  3VGZ A;  4L9O A;  4A0A A;  5AJA A;  4D0K A;  3PSC B;  5EM2 A;  3IJC A;  1YFQ A;  3MXX A;  4X60 B;  4Y5R D;  3BWS A;  3BG1 A;  2HKM A;  4AOW A;  4J87 A;  3RLM D;  1N6E A;  4FWW A;  4I79 A;  5IGO A;  2PBI B;  5AMS A;  2PM9 B;  4NSX A;  1SQJ A;  4FAV D;  4FA1 D;  2H6K A;  3GFC A;  3I7P A;  3JZH A;  3SCY A;  3C75 H;  4IA9 A;  4A0B A;  1S4U X;  3A0F A;  5EAR A;  3AL8 B;  3N0E A;  4QRJ A;  2H9M A;  4ERZ A;  4X61 B;  5EMK B;  3OL2 A;  4A08 B;  2AGY A;  2OK6 A;  4JSX C;  1VYH C;  2XU7 A;  4JSV C;  4J81 A;  5FXY A;  4H5I A;  3UVM A;  5CXB B;  3V7D B;  1U2V C;  2Q7Q A;  4GQB B;  2YNO A;  2BBK H;  3SVW D;  3E0C A;  4CY2 A;  3I8C A;  1N6F A;  4J86 A;  5I5I A;  4Y7R A;  3VH0 A;  3W15 A;  3PSL A;  4G56 B;  5GXI A;  4L3H D;  1MG2 A;  3I8E A;  3UVL A;  4BH6 A;  4QQE A;  4KFM B;  4J8B A;  3UR4 A;  4HDJ A;  1L0Q A;  3MKS B;  3I7K A;  4ZOV A;  3V5W B;  5EML B;  4FHL A;  3EI4 B;  4PNK B;  1Q47 A;  2P9I C;  1ERJ A;  3FGB A;  4Z8L A;  2XL3 A;  4A7J A;  5TEF A;  4MK0 B;  2I0T A;  3JRP A;  2IUP A;  4ESG A;  1PBY B;  4CZY A;  5HE0 B;  3J80 g;  2HYE A;  5THA A;  2P9P C;  1GP2 B;  4J73 A;  5C2V B;  3C5M A;  4A09 A;  5A2Q g;  4D6V A;  5EAL A;  1GG2 B;  3DXK C;  4JT6 C;  4XYI A;  3IJ1 A;  4R7A B;  2B5L A;  3UKR C;  5TDH B;  4FA5 D;  4ES0 A;  4PSX B;  1GOT B;  2HXC A;  2AH1 A;  3MKQ A;  2J56 H;  3F3P A;  3V9F A;  2EBS A;  3EI3 A;  4JD2 C;  2XL2 A;  4FAN D;  4JSP C;  2GC7 A;  4GQ2 P;  2J55 H;  2I3T A;  3ODT A;  2AH0 A;  3KRX B;  3I2N A;  3RN1 D;  4PSW B;  4X3E A;  3OKY B;  4LGN A;  1A0R B;  5HE3 B;  4BL0 A;  3EI2 B;  5H1M A;  2CN2 A;  4O3U B;  4J8G A;  3K27 A;  3UVK A;  5GSA A;  2OK4 A;  4E5Z A;  3GRE A;  1TBG A;  4A2L A;  2CE8 A;  4FA4 D;  3NVN A;  2Z2O A;  3F3F A;  4EWR A;  2OVR B;  1R5M A;  1P22 A;  2W18 A;  3JAM g;  1PGU A;  3HFQ A;  2CNX A;  4CZV A;  4ZOX A;  2H3X A;  4QL1 A;  1OMW B;  3KRW B;  1GXR A;  5FKT A;  4J0W A;  3IIW A;  1FWX A;  3MZL A;  3PXS D;  3JB9 L;  2XYI A;  2IUR A;  5SXM A;  2IAA A;  1K8K C;  2G9A A;  2OVP B;  3AFC A;  1MDA H;  4X63 B;  1N6D A;  4ZOZ A;  3UKU C;  2IWF A;  4A11 A;  3PVU B;  2H6N A;  4GGA A;  3DXM C;  5C9Z B;  1QNI A;  2H68 A;  4GGD A;  5FKR A;  3F3G A;  3EI1 B;  4J0X A;  4JXM A;  4CY3 A;  2CO0 A;  3CIK B;  3OW8 A;  4E54 A;  3RRM C;  3EI3 B;  4OZU A;  3I7O A;  2H9N A;  3JPX A;  3ORV D;  3FRX A;  2AGZ A;  4J84 A;  5TF2 A;  1K32 A;  1SQ9 A;  4XYH A;  3DWL C;  3K26 A;  1JMX B;  4YVD A;  3IIY A;  3CFS B;  5I5J A;  1XKS A;  2GC4 A;  5H17 A;  2I3S A;  3MZK A;  4A0A B;  2BCJ B;  4PBZ A;  3PXW D;  3NVX A;  5EM2 B;  3U4Y A;  2Z2P A;  5I5M A;  3MMY A;  3RMZ D;  5HYN B;  3EG6 A;  2PM9 A;  4O1Q D;  1JJU B;  5CYK A;  4CI2 A;  2YBA A;  3DSM A;  3RSE C;  3OKW A;  3NVQ A;  3SWS D;  2O9K A;  4H5J A;  3P4F A;  4JT5 C;  4A0B B;  4IMM A;  5FLX g;  4GM9 A;  2P9K C;  3OL2 B;  2YB8 B;  2I0S A;  5H14 A;  2IWK A;  2AQ5 A;  2HJ4 A;  3PXT D;  3OTT A;  4FA9 D;  2I0R A;  3AL9 A;  2P9N C;  4ERY A;  4J79 A;  1SHY B;  1B9X A;  2OIZ A;  4CI1 A;  5AFU 3;  3AH8 B;  5B4W A;  5K19 A;  4O45 A;  1OLZ A;  4E54 B;  4JSN C;  4CI8 A;  3RFH A;  4CZX A;  4L3G D;  4PBY A;  4AEZ A;  2GNQ A;  5EAM A;  3JZG A;  3SN6 B;  1XIP A;  2YMU A;  3PE7 A;  2QC5 A;  3I89 A;  3EWE A;  1PEV A;  5TEE A;  4QT8 A;  5IC7 A;  3I7L A;  4CY1 A;  4LG9 A;  5FA5 B;  3PVW B;  2AGL A;  4CI3 A;  2P9S C;  4A2M A;  4ZOY A;  2QXV A;  4OWR A;  1NR0 A;  2UZY B;  3C99 A;  5CYK B;  4K3J B;  3SHF A;  4A09 B;  4K3I D;  3J81 g;  4TZ4 A;  4PC0 A;  4O9D A;  5IJ7 E;  2YNP A;  3IJ0 A;  5HE1 B;  5JWZ A;  3CFV A;  1TYQ C;  1JMZ B;  2OJY A;  2OVQ B;  2CO0 C;  4J82 A;  4GZ8 A;  4J77 A;  3OKT A;  2PM7 B;  2IUQ A;  1PI6 A;  3OKY A;  4XEI C;  5FQD A;  3EI2 A;  2B5N A;  4GGC A;  2P9L C;  2H9L A;  5CXC A;  3RN0 D;  4FB1 D;  5IJ8 E;  4ZN4 A;  3EU7 A;  3I7H A;  1MG3 A;  3JZN A;  2J57 G;  2B5M A;  3SBQ A;  1JOF A;  4E5Z B;  3IKO A;  2TRC B;  3SLE D;  5K1C C;  3VA6 A;  2H14 A;  5FKS A;  3SBR A;  2H13 A;  4GM3 A;  5GXH A;  4O3T B;  4GM8 A;  4PXW A;  5EAP A;  4GQ1 A;  3RFG A;  4CC9 A;  2HJB A;  2IUV A;  2H47 A;  3BG0 A;  5HQG A; 
#chains in the Genus database with same CATH topology
 5KDO B;  2HKR A;  3B7F A;  2AGX A;  3I7N A;  5FFG A;  3SBP A;  4UI9 R;  2VZ1 A;  3AL8 A;  2PM6 B;  4A08 A;  4BUJ C;  5EMJ B;  1B9Y A;  5HE2 B;  2H6Q A;  3C9C A;  3SFZ A;  1RI6 A;  3ZWL B;  4AMZ A;  4WJK A;  3O4H A;  5EMM B;  4A11 B;  3L4M D;  4CY5 A;  4N14 A;  4LG8 A;  5C2W B;  3NID A;  4DNW A;  2B4E A;  2P9U C;  5CXB A;  2QZP A;  4J78 A;  3SJL D;  3EI1 A;  3N0D A;  4U7A A;  3SMR A;  2Z2N A;  5IT9 g;  2UZX B;  1I2M B;  1XHM A;  2YNN A;  5IGQ A;  5FKQ A;  2HU5 A;  2EIC A;  2MTA H;  2HES X;  4GMB A;  4NAA A;  1TYE A;  3JRO A;  3DM0 A;  1NEX B;  3FM0 A;  1U8C A;  4AX4 A;  3UVO A;  3ZDY A;  2XZG A;  2G99 A;  1UTC A;  4ERQ A;  3ULE C;  2H9P A;  3UVN A;  1U4C A;  3SXT D;  2AGW A;  4U1E I;  4L1Q D;  2CN3 A;  2CE9 A;  3L4O D;  2VDL A;  3EI4 A;  5GMK n;  3EMH A;  5CXC B;  3VGZ A;  2XE4 A;  4L9O A;  3IUQ A;  4A0A A;  3GC3 B;  1H2Y A;  5AJA A;  4D0K A;  3PSC B;  5EM2 A;  3IJC A;  1YFQ A;  3MXX A;  4X60 B;  4Y5R D;  4BCC A;  3BWS A;  3BG1 A;  2HKM A;  4IRZ A;  4J87 A;  3RLM D;  4AOW A;  1N6E A;  4FWW A;  4I79 A;  5IGO A;  2PBI B;  5AMS A;  2PM9 B;  4NSX A;  4QAM A;  1JV2 A;  4MMY A;  1SQJ A;  4FAV D;  4FA1 D;  2H6K A;  3GFC A;  3I7P A;  3JZH A;  3SCY A;  3C75 H;  4IA9 A;  4A0B A;  1S4U X;  3A0F A;  5EAR A;  3AL8 B;  3N0E A;  4QRJ A;  2H9M A;  4ERZ A;  4X61 B;  5EMK B;  3OL2 A;  4A08 B;  2AGY A;  1H2Z A;  2OK6 A;  3T3P A;  4JSX C;  1VYH C;  2XU7 A;  4JSV C;  4J81 A;  5FXY A;  1VE6 A;  4MMX A;  4H5I A;  3UVM A;  5CXB B;  3V7D B;  1U2V C;  2Q7Q A;  4GQB B;  2YNO A;  2BBK H;  5M5U A;  3SVW D;  3E0C A;  1E8N A;  4CY2 A;  3I8C A;  1N6F A;  4J86 A;  5I5I A;  3QI0 A;  4Y7R A;  3VH0 A;  4Z7N A;  3W15 A;  3PSL A;  4G56 B;  5GXI A;  4L3H D;  1MG2 A;  4UM8 A;  3I8E A;  3UVL A;  4BH6 A;  4QQE A;  4KFM B;  4J8B A;  3UR4 A;  4HDJ A;  3ZE0 A;  3EQ9 A;  1L0Q A;  3K71 A;  1K3I A;  3MKS B;  3I7K A;  4ZOV A;  3V5W B;  5EML B;  4FHL A;  3VI3 A;  3EI4 B;  4PNK B;  1Q47 A;  2P9I C;  4DNV A;  1ERJ A;  3IUR A;  3FGB A;  4Z8L A;  2XL3 A;  4Z7Q A;  4A7J A;  5TEF A;  4MK0 B;  2I0T A;  2BKL A;  2IUP A;  3JRP A;  4ESG A;  1PBY B;  4CZY A;  5HE0 B;  3J80 g;  5M5T A;  3FCU A;  2HYE A;  5THA A;  4Z7O A;  2P9P C;  1GP2 B;  5FFO A;  4J73 A;  5C2V B;  1A12 A;  3IUL A;  3C5M A;  4A09 A;  1H2X A;  5A2Q g;  4D6V A;  2VZ3 A;  5EAL A;  1GG2 B;  3DXK C;  4JT6 C;  5E6U A;  4XYI A;  2VDK A;  2HU8 A;  3IJ1 A;  4R7A B;  3ZDZ A;  2B5L A;  5M5S A;  3UKR C;  5TDH B;  4FA5 D;  4ES0 A;  4PSX B;  1GOT B;  3IJE A;  2HXC A;  1UOQ A;  2AH1 A;  3MKQ A;  2J56 H;  3F3P A;  3NIG A;  3V9F A;  2EBS A;  3EI3 A;  4JD2 C;  2XL2 A;  4FAN D;  4JSP C;  2GC7 A;  1GOF A;  4GQ2 P;  2J55 H;  2I3T A;  1VE7 A;  3EQ8 A;  2EIB A;  3IUJ A;  3ODT A;  4G55 A;  3QHY B;  3MUO A;  5C92 A;  2AH0 A;  3KRX B;  3I2N A;  3RN1 D;  4PSW B;  4X3E A;  3OKY B;  2WQ8 A;  4LGN A;  1A0R B;  5HE3 B;  4BL0 A;  3EI2 B;  1M1X A;  5H1M A;  2CN2 A;  4O3U B;  5HDB A;  4J8G A;  5E6S A;  3K27 A;  3UVK A;  5GSA A;  3K6S A;  2OK4 A;  4AN0 A;  4E5Z A;  4L1M A;  3GRE A;  1TBG A;  3O4I A;  4A2L A;  2CE8 A;  4FA4 D;  4BP8 A;  3NVN A;  2Z2O A;  3F3F A;  4EWR A;  2OVR B;  1R5M A;  1P22 A;  2W18 A;  3ZE2 A;  3GD1 I;  2EID A;  3JAM g;  1PGU A;  3HFQ A;  1GOG A;  2CNX A;  4CZV A;  4ZOX A;  4D9S A;  2H3X A;  4QL1 A;  1OMW B;  3KRW B;  1GXR A;  5FKT A;  4J0W A;  3IIW A;  1FWX A;  2QR5 A;  3MZL A;  3PXS D;  3JB9 L;  2XYI A;  2IUR A;  5SXM A;  2VC2 A;  2IAA A;  1K8K C;  2G9A A;  2OVP B;  3AFC A;  1MDA H;  4X63 B;  1N6D A;  4ZOZ A;  2VDQ A;  3UKU C;  2IWF A;  4A11 A;  3PVU B;  2H6N A;  4GGA A;  3DXM C;  5C9Z B;  1QNI A;  2H68 A;  1O6F A;  4GGD A;  5FKR A;  1T2X A;  3EQ7 A;  4WK4 A;  3F3G A;  4WK2 A;  2XDW A;  3EI1 B;  4J0X A;  4JXM A;  4CY3 A;  2CO0 A;  3CIK B;  3OW8 A;  5M61 A;  4E54 A;  3RRM C;  1E8M A;  5M5R A;  3EI3 B;  4AMY A;  4OZU A;  3K72 A;  3I7O A;  2H9N A;  3JPX A;  3ORV D;  3FRX A;  3ZDX A;  2AGZ A;  4J84 A;  5TF2 A;  1K32 A;  1SQ9 A;  4XYH A;  3DWL C;  1QFS A;  3K26 A;  4NEN A;  1JMX B;  3V4V A;  4YVD A;  3IIY A;  3VI4 A;  3CFS B;  5I5J A;  1XKS A;  2GC4 A;  5H17 A;  2I3S A;  3O4J A;  3MZK A;  4A0A B;  3MVD K;  4BCD A;  2BCJ B;  4PBZ A;  3PXW D;  4JHN A;  1C9I A;  3NVX A;  5EM2 B;  3U4Y A;  2Z2P A;  5I5M A;  3MMY A;  3RMZ D;  5HYN B;  3EG6 A;  2PM9 A;  4O1Q D;  1JJU B;  5CYK A;  1E5T A;  3IUM A;  4CI2 A;  2YBA A;  3DSM A;  3RSE C;  4BP9 A;  3OKW A;  4RE6 A;  3NVQ A;  1VZ2 A;  3SWS D;  2VDM A;  2O9K A;  4NBM A;  4H5J A;  1UOP A;  2EIE A;  3P4F A;  4JT5 C;  4A0B B;  4IMM A;  5FLX g;  1VZ3 A;  4GM9 A;  2P9K C;  5M5V A;  1BPO A;  3OL2 B;  1O6G A;  2YB8 B;  2I0S A;  5H14 A;  2IWK A;  2AQ5 A;  3IVM A;  3FCS A;  2HJ4 A;  3PXT D;  3OTT A;  4FA9 D;  2I0R A;  3AL9 A;  2P9N C;  4ERY A;  4J79 A;  2VDN A;  3KCI A;  1SHY B;  4DNU A;  3T3M A;  1B9X A;  2OIZ A;  4CI1 A;  2VDO A;  4NC4 A;  5AFU 3;  3AH8 B;  5B4W A;  5K19 A;  4O45 A;  1OLZ A;  1H2W A;  4E54 B;  4JSN C;  4CI8 A;  3V4P A;  3RFH A;  4CZX A;  4L3G D;  1UOO A;  4PBY A;  4AEZ A;  5C86 A;  2GNQ A;  5EAM A;  3JZG A;  3SN6 B;  1XIP A;  2JKX A;  2YMU A;  4MMZ A;  3PE7 A;  2QC5 A;  4AN1 A;  3I89 A;  3EWE A;  1PEV A;  5TEE A;  4QT8 A;  5IC7 A;  4RE5 A;  3I7L A;  3NIF A;  4O02 A;  1L5G A;  4CY1 A;  4LG9 A;  5FA5 B;  3PVW B;  2AGL A;  4CI3 A;  2P9S C;  4A2M A;  4ZOY A;  1GOH A;  2QXV A;  4OWR A;  1NR0 A;  2UZY B;  3C99 A;  5CYK B;  4G1E A;  3ZE1 A;  4K3J B;  3SHF A;  4A09 B;  3IUN A;  2VDR A;  4K3I D;  3J81 g;  4TZ4 A;  4PC0 A;  4O9D A;  5IJ7 E;  2YNP A;  3IJ0 A;  5HE1 B;  5JWZ A;  5E6R A;  4BCB A;  4O2W A;  3CFV A;  4G1M A;  1TYQ C;  1JMZ B;  2OJY A;  2OVQ B;  2CO0 C;  3DDU A;  4J82 A;  3OF7 A;  4GZ8 A;  4J77 A;  3OKT A;  1QFM A;  2PM7 B;  2IUQ A;  2VDP A;  1PI6 A;  3OKY A;  4XEI C;  5FQD A;  3MUN A;  2HU7 A;  3EI2 A;  2B5N A;  4GGC A;  2P9L C;  2H9L A;  5CXC A;  3RN0 D;  4WK0 A;  4FB1 D;  5IJ8 E;  4JHP C;  4ZN4 A;  3EU7 A;  3I7H A;  1MG3 A;  3JZN A;  2J57 G;  2B5M A;  3SBQ A;  1JOF A;  1YR2 A;  4E5Z B;  3IKO A;  1JTD B;  2TRC B;  3SLE D;  5K1C C;  3VA6 A;  2H14 A;  5FKS A;  3SBR A;  2H13 A;  4GM3 A;  5GXH A;  1C9L A;  4O3T B;  4GM8 A;  4PXW A;  5EAP A;  4GQ1 A;  3RFG A;  4UM9 A;  4CC9 A;  2HJB A;  2IUV A;  2H47 A;  3O4G A;  3BG0 A;  5HQG A; 
#chains in the Genus database with same CATH homology
 5KDO B;  2HKR A;  3B7F A;  2AGX A;  3I7N A;  3SBP A;  4UI9 R;  3AL8 A;  2PM6 B;  4A08 A;  4BUJ C;  5EMJ B;  1B9Y A;  5HE2 B;  2H6Q A;  3C9C A;  3SFZ A;  1RI6 A;  3ZWL B;  5EMM B;  4A11 B;  3L4M D;  4CY5 A;  4N14 A;  4LG8 A;  5C2W B;  2B4E A;  2P9U C;  5CXB A;  4J78 A;  3SJL D;  3EI1 A;  3N0D A;  4U7A A;  3SMR A;  2Z2N A;  5IT9 g;  2UZX B;  1XHM A;  2YNN A;  5IGQ A;  5FKQ A;  2MTA H;  2HES X;  4GMB A;  3JRO A;  3DM0 A;  1NEX B;  3FM0 A;  3UVO A;  2G99 A;  4ERQ A;  3ULE C;  2H9P A;  3UVN A;  1U4C A;  3SXT D;  2AGW A;  4U1E I;  4L1Q D;  2CN3 A;  2CE9 A;  3L4O D;  3EI4 A;  5GMK n;  3EMH A;  5CXC B;  3VGZ A;  4L9O A;  4A0A A;  5AJA A;  4D0K A;  3PSC B;  5EM2 A;  3IJC A;  1YFQ A;  3MXX A;  4X60 B;  4Y5R D;  3BWS A;  3BG1 A;  2HKM A;  4AOW A;  4J87 A;  3RLM D;  1N6E A;  4FWW A;  4I79 A;  5IGO A;  2PBI B;  5AMS A;  2PM9 B;  4NSX A;  1SQJ A;  4FAV D;  4FA1 D;  2H6K A;  3GFC A;  3I7P A;  3JZH A;  3SCY A;  3C75 H;  4IA9 A;  4A0B A;  1S4U X;  3A0F A;  5EAR A;  3AL8 B;  3N0E A;  4QRJ A;  2H9M A;  4ERZ A;  4X61 B;  5EMK B;  3OL2 A;  4A08 B;  2AGY A;  2OK6 A;  4JSX C;  1VYH C;  2XU7 A;  4JSV C;  4J81 A;  5FXY A;  4H5I A;  3UVM A;  5CXB B;  3V7D B;  1U2V C;  2Q7Q A;  4GQB B;  2YNO A;  2BBK H;  3SVW D;  3E0C A;  4CY2 A;  3I8C A;  1N6F A;  4J86 A;  5I5I A;  4Y7R A;  3VH0 A;  3W15 A;  3PSL A;  4G56 B;  5GXI A;  4L3H D;  1MG2 A;  3I8E A;  3UVL A;  4BH6 A;  4QQE A;  4KFM B;  4J8B A;  3UR4 A;  4HDJ A;  1L0Q A;  3MKS B;  3I7K A;  4ZOV A;  3V5W B;  5EML B;  4FHL A;  3EI4 B;  4PNK B;  1Q47 A;  2P9I C;  1ERJ A;  3FGB A;  4Z8L A;  2XL3 A;  4A7J A;  5TEF A;  4MK0 B;  2I0T A;  3JRP A;  2IUP A;  4ESG A;  1PBY B;  4CZY A;  5HE0 B;  3J80 g;  2HYE A;  5THA A;  2P9P C;  1GP2 B;  4J73 A;  5C2V B;  3C5M A;  4A09 A;  5A2Q g;  4D6V A;  5EAL A;  1GG2 B;  3DXK C;  4JT6 C;  4XYI A;  3IJ1 A;  4R7A B;  2B5L A;  3UKR C;  5TDH B;  4FA5 D;  4ES0 A;  4PSX B;  1GOT B;  2HXC A;  2AH1 A;  3MKQ A;  2J56 H;  3F3P A;  3V9F A;  2EBS A;  3EI3 A;  4JD2 C;  2XL2 A;  4FAN D;  4JSP C;  2GC7 A;  4GQ2 P;  2J55 H;  2I3T A;  3ODT A;  2AH0 A;  3KRX B;  3I2N A;  3RN1 D;  4PSW B;  4X3E A;  3OKY B;  4LGN A;  1A0R B;  5HE3 B;  4BL0 A;  3EI2 B;  5H1M A;  2CN2 A;  4O3U B;  4J8G A;  3K27 A;  3UVK A;  5GSA A;  2OK4 A;  4E5Z A;  3GRE A;  1TBG A;  4A2L A;  2CE8 A;  4FA4 D;  3NVN A;  2Z2O A;  3F3F A;  4EWR A;  2OVR B;  1R5M A;  1P22 A;  2W18 A;  3JAM g;  1PGU A;  3HFQ A;  2CNX A;  4CZV A;  4ZOX A;  2H3X A;  4QL1 A;  1OMW B;  3KRW B;  1GXR A;  5FKT A;  4J0W A;  3IIW A;  1FWX A;  3MZL A;  3PXS D;  3JB9 L;  2XYI A;  2IUR A;  5SXM A;  2IAA A;  1K8K C;  2G9A A;  2OVP B;  3AFC A;  1MDA H;  4X63 B;  1N6D A;  4ZOZ A;  3UKU C;  2IWF A;  4A11 A;  3PVU B;  2H6N A;  4GGA A;  3DXM C;  5C9Z B;  1QNI A;  2H68 A;  4GGD A;  5FKR A;  3F3G A;  3EI1 B;  4J0X A;  4JXM A;  4CY3 A;  2CO0 A;  3CIK B;  3OW8 A;  4E54 A;  3RRM C;  3EI3 B;  4OZU A;  3I7O A;  2H9N A;  3JPX A;  3ORV D;  3FRX A;  2AGZ A;  4J84 A;  5TF2 A;  1K32 A;  1SQ9 A;  4XYH A;  3DWL C;  3K26 A;  1JMX B;  4YVD A;  3IIY A;  3CFS B;  5I5J A;  1XKS A;  2GC4 A;  5H17 A;  2I3S A;  3MZK A;  4A0A B;  2BCJ B;  4PBZ A;  3PXW D;  3NVX A;  5EM2 B;  3U4Y A;  2Z2P A;  5I5M A;  3MMY A;  3RMZ D;  5HYN B;  3EG6 A;  2PM9 A;  4O1Q D;  1JJU B;  5CYK A;  4CI2 A;  2YBA A;  3DSM A;  3RSE C;  3OKW A;  3NVQ A;  3SWS D;  2O9K A;  4H5J A;  3P4F A;  4JT5 C;  4A0B B;  4IMM A;  5FLX g;  4GM9 A;  2P9K C;  3OL2 B;  2YB8 B;  2I0S A;  5H14 A;  2IWK A;  2AQ5 A;  2HJ4 A;  3PXT D;  3OTT A;  4FA9 D;  2I0R A;  3AL9 A;  2P9N C;  4ERY A;  4J79 A;  1SHY B;  1B9X A;  2OIZ A;  4CI1 A;  5AFU 3;  3AH8 B;  5B4W A;  5K19 A;  4O45 A;  1OLZ A;  4E54 B;  4JSN C;  4CI8 A;  3RFH A;  4CZX A;  4L3G D;  4PBY A;  4AEZ A;  2GNQ A;  5EAM A;  3JZG A;  3SN6 B;  1XIP A;  2YMU A;  3PE7 A;  2QC5 A;  3I89 A;  3EWE A;  1PEV A;  5TEE A;  4QT8 A;  5IC7 A;  3I7L A;  4CY1 A;  4LG9 A;  5FA5 B;  3PVW B;  2AGL A;  4CI3 A;  2P9S C;  4A2M A;  4ZOY A;  2QXV A;  4OWR A;  1NR0 A;  2UZY B;  3C99 A;  5CYK B;  4K3J B;  3SHF A;  4A09 B;  4K3I D;  3J81 g;  4TZ4 A;  4PC0 A;  4O9D A;  5IJ7 E;  2YNP A;  3IJ0 A;  5HE1 B;  5JWZ A;  3CFV A;  1TYQ C;  1JMZ B;  2OJY A;  2OVQ B;  2CO0 C;  4J82 A;  4GZ8 A;  4J77 A;  3OKT A;  2PM7 B;  2IUQ A;  1PI6 A;  3OKY A;  4XEI C;  5FQD A;  3EI2 A;  2B5N A;  4GGC A;  2P9L C;  2H9L A;  5CXC A;  3RN0 D;  4FB1 D;  5IJ8 E;  4ZN4 A;  3EU7 A;  3I7H A;  1MG3 A;  3JZN A;  2J57 G;  2B5M A;  3SBQ A;  1JOF A;  4E5Z B;  3IKO A;  2TRC B;  3SLE D;  5K1C C;  3VA6 A;  2H14 A;  5FKS A;  3SBR A;  2H13 A;  4GM3 A;  5GXH A;  4O3T B;  4GM8 A;  4PXW A;  5EAP A;  4GQ1 A;  3RFG A;  4CC9 A;  2HJB A;  2IUV A;  2H47 A;  3BG0 A;  5HQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...