4I79A

Crystal structure of human nup43
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
377
structure length
316
Chain Sequence
b'IYAKFVSQKISKTRWRPLPPGSLQTAETFATGSWDNEENYISLWSIEGDHQLLCDIRHHGDVMDLQFFDQERIVAASSTGCVTVFLHHPNNQTLSVNQQWTTAHYHTSSAPCTGVVCNNPEIVTVGEDGRINLFRADHKEAVRTIDNADSSTLHAVTFLRTPEILTVNSIGQLKIWDFRQQGNEPSQILSLTGDRVPLHCVDRHPNQQHVVATGGQDGMLSIWDVRQGTMPVSLLKAHEAEMWEVHFHPSNPEHLFTCSEDGSLWHWDASSWLSRIEITSLLPSRSLSVNTLDVLGPCLVCGTDAEAIYVTRHLFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoporin Nup43
publication title Crystal structure of human nuclear pore complex component NUP43.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 88
structure length 316
sequence length 377
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4i79A00
5HQGA 4FA1D 2HXCA 4GM8A 4J84A 3EI2A 4R7AB 1JMZB 2Q7QA 3SHFA 3MKQA 5THAA 3FM0A 4FWWA 4J87A 1JOFA 1OLZA 3I8EA 4JSXC 3HFQA 3PE7A 4PXWA 5FLXg 3JAMg 4J81A 1SQJA 3U4YA 4CI2A 4A09B 4JSNC 2I3SA 3MMYA 3SXTD 3ZWLB 4ZOYA 3IIWA 3JZGA 5FXYA 4PSXB 1XKSA 1N6DA 4A09A 5I5MA 4CZXA 2H6QA 3I7KA 5IT9g 3IJ0A 4ZOZA 1MDAH 2B5MA 4MK0B 2YBAA 2AGYA 4ZOXA 5TF2A 4X60B 5H17A 3PSLA 4LGNA 3MZLA 3IIYA 3RLMD 3MXXA 1K8KC 3PXTD 2IUVA 3L4MD 3RFGA 4QQEA 3SLED 3A0FA 5CXBB 1A0RB 4GMBA 4GZ8A 2CNXA 3ULEC 4PBYA 3SCYA 4J82A 2UZYB 4J77A 4A08B 5CXBA 4FAND 4U7AA 4ERQA 3VGZA 4GQBB 3I8CA 3JROA 4IMMA 4PSWB 1VYHC 2XU7A 4J8BA 5IC7A 4HDJA 1PI6A 4A08A 2AGZA 3SJLD 5IGQA 4O3TB 1MG2A 3VA6A 3N0EA 3PVWB 4A0AB 2TRCB 3C99A 5SXMA 2H6NA 4O3UB 4JSPC 4LG9A 1SHYB 4A0AA 5EMLB 2OIZA 4PNKB 1N6FA 2H9MA 4X3EA 3AL8B 2W18A 4QL1A 4E54B 2YB8B 4CY3A 3DM0A 2HJBA 1PGUA 2XL3A 3CIKB 3V5WB 3JZHA 5FKRA 4UI9R 2XYIA 2IUPA 4E54A 4X61B 3I7PA 3OTTA 5JWZA 3P4FA 3V9FA 3SBRA 4CZVA 5I5JA 4JSVC 4K3ID 2PM6B 5FKTA 3UVMA 4O45A 3JPXA 3ORVD 3UVOA 2OK4A 2PM7B 4ERZA 4A7JA 5I5IA 3MKSB 1GP2B 4QT8A 4LG8A 2HKRA 3I7NA 2HJ4A 1YFQA 1TBGA 4PBZA 2AGWA 5AJAA 3EU7A 2H68A 3BWSA 3J81g 2H6KA 4Z8LA 2OK6A 5HE1B 2QXVA 1R5MA 3JZNA 4J0WA 5GXIA 2P9LC 3I89A 2G9AA 3UVNA 2UZXB 1GXRA 4BL0A 1QNIA 4K3JB 4J8GA 3IJCA 5FKQA 5EM2B 2HYEA 2YNPA 3DXKC 3JRPA 5GMKn 3OKWA 3E0CA 3AH8B 4FA4D 3SMRA 1XIPA 2H13A 5EM2A 1RI6A 3RFHA 3IKOA 4AEZA 4BUJC 5HYNB 1Q47A 4IA9A 4AOWA 2YMUA 1PEVA 1S4UX 4L3GD 2P9KC 1B9XA 4QRJA 1U4CA 3SWSD 3AL9A 4ZN4A 3EI1B 5IJ8E 2IURA 5K1CC 4J0XA 3K26A 1GG2B 2B5LA 4CI3A 4J86A 2P9UC 3K27A 3OKYB 3DWLC 4GGDA 4EWRA 5IJ7E 3SVWD 2OVQB 3RN0D 4L3HD 4GGAA 5EALA 4XEIC 3OKYA 3B7FA 3FGBA 2AQ5A 3UKUC 4CY1A 5C2WB 4A2MA 5AFU3 3IJ1A 3AFCA 2H14A 2GNQA 5EARA 4D0KA 3AL8A 4A0BB 2O9KA 3EG6A 4CY5A 5HE0B 3L4OD 2Z2OA 4A0BA 3UVLA 2AH1A 2CN3A 3GFCA 3UVKA 3W15A 3PVUB 4GQ1A 2AGLA 3PSCB 3ODTA 3RMZD 3JB9L 2OVRB 3KRXB 4L9OA 2CN2A 3OW8A 4O9DA 5EMJB 2PBIB 5EAPA 4O1QD 4JD2C 2BBKH 3CFVA 1MG3A 3EMHA 4J78A 2J55H 4OZUA 4D6VA 5EMMB 4FA5D 5CYKB 2AH0A 3SBQA 1JMXB 5H1MA 4JT6C 3C75H 2OJYA 5CYKA 4H5IA 4YVDA 1K32A 3RN1D 5K19A 4GGCA 5GXHA 2IUQA 4ES0A 3V7DB 2YNOA 2EBSA 2G99A 4CC9A 3KRWB 3RRMC 2B4EA 4ZOVA 1P22A 3PXWD 2I0RA 3I7HA 3NVNA 2I0TA 4A11B 5HE2B 2HESX 3VH0A 2CE9A 4CI8A 2I0SA 3I2NA 2GC7A 1N6EA 4I79A 1JJUB 3OKTA 4A11A 2MTAH 2H9LA 4KFMB 2YNNA 1ERJA 3EWEA 3N0DA 4J73A 1OMWB 4FA9D 3PXSD 2IWFA 4N14A 3SFZA 3NVQA 1NR0A 5HE3B 5IGOA 1XHMA 4CZYA 2I3TA 2H9NA 2H3XA 4ERYA 3EI4B 3I7OA 1L0QA 1FWXA 2IAAA 4G56B 3C9CA 3F3FA 4TZ4A 5AMSA 3GREA 2PM9B 4ESGA 4GM3A 4X63B 3EI4A 3C5MA 5FQDA 4FAVD 4CI1A 1SQ9A 3EI1A 2PM9A 3SBPA 2CO0A 1U2VC 4J79A 2HKMA 2H47A 2XL2A 2CO0C 2GC4A 4FB1D 3DXMC 2CE8A 5CXCB 5H14A 3FRXA 5TDHB 3J80g 2B5NA 1NEXB 3RSEC 5TEFA 1GOTB 3BG0A 3CFSB 4FHLA 5EAMA 4L1QD 5CXCA 4GM9A 2Z2NA 5C2VB 4E5ZB 3UKRC 5GSAA 3DSMA 2Z2PA 3OL2B 4Y7RA 5FA5B 3UR4A 4CY2A 2BCJB 3BG1A 2AGXA 3F3PA 4E5ZA 2P9IC 5A2Qg 3OL2A 4OWRA 2QC5A 2J56H 2J57G 3MZKA 4U1EI 5FKSA 1B9YA 2P9SC 4BH6A 2H9PA 3SN6B 2OVPB 4GQ2P 4XYIA 5EMKB 3EI3B 3I7LA 4NSXA 4PC0A 5KDOB 3NVXA 4A2LA 2P9NC 4XYHA 3EI3A 3F3GA 2P9PC 5TEEA 5C9ZB 4JXMA 3EI2B 1PBYB 5B4WA 1TYQC 4Y5RD 2IWKA 4JT5C 4H5JA
chains in the Genus database with same CATH superfamily
5HQGA 4FA1D 2HXCA 4GM8A 4J84A 3EI2A 4R7AB 1JMZB 2Q7QA 3SHFA 3MKQA 5THAA 3FM0A 4FWWA 4J87A 1JOFA 1OLZA 3I8EA 4JSXC 3HFQA 3PE7A 4PXWA 5FLXg 3JAMg 5HDBA 4J81A 1H2XA 1QFSA 5FFOA 1SQJA 3U4YA 4CI2A 4A09B 3NIFA 4JSNC 2I3SA 3MMYA 3SXTD 1JV2A 3ZWLB 3IIWA 3JZGA 4ZOYA 5FXYA 5M5UA 4PSXB 1N6DA 1XKSA 3GD1I 4A09A 5I5MA 4CZXA 3K71A 4O2WA 2H6QA 3I7KA 5IT9g 1H2YA 3IJ0A 4ZOZA 4JHPC 1MDAH 2B5MA 4MK0B 2YBAA 2AGYA 4ZOXA 5TF2A 3DDUA 4X60B 5H17A 4Z7QA 3PSLA 4LGNA 1VE6A 3IIYA 3MZLA 4L1MA 3MXXA 3RLMD 1K8KC 3PXTD 2IUVA 2EIEA 3L4MD 3RFGA 4QQEA 3SLED 3A0FA 5CXBB 5M5SA 1A0RB 4GMBA 2XZGA 4GZ8A 1TYEA 2CNXA 4D9SA 3ULEC 4PBYA 3SCYA 4J82A 2UZYB 4J77A 4A08B 5CXBA 4FAND 4BCDA 4U7AA 4ERQA 3MVDK 1YR2A 3VGZA 3MUNA 4WK2A 4GQBB 3I8CA 4AX4A 3JROA 4IMMA 4PSWB 1VYHC 2XU7A 4J8BA 5IC7A 4HDJA 1PI6A 4A08A 2AGZA 3VI3A 3SJLD 5IGQA 4O3TB 1MG2A 3VA6A 3N0EA 3PVWB 4A0AB 2TRCB 3C99A 5SXMA 1E8NA 3EQ7A 1VZ3A 2EIBA 2H6NA 4O3UB 4JSPC 4LG9A 1SHYB 4A0AA 5EMLB 2QR5A 1H2ZA 2OIZA 4PNKB 1N6FA 1A12A 2H9MA 4X3EA 3K72A 3AL8B 2W18A 4QL1A 4E54B 2YB8B 3T3MA 3DM0A 4CY3A 2HJBA 1PGUA 2XL3A 3CIKB 3V5WB 3JZHA 5FKRA 3KCIA 3IURA 4UI9R 2XYIA 2IUPA 2XE4A 1I2MB 4O02A 3I7PA 3OTTA 2VDOA 3P4FA 4X61B 5JWZA 1K3IA 3V9FA 3SBRA 4CZVA 3IUMA 5I5JA 1O6FA 4BCCA 4JSVC 4K3ID 2PM6B 5FKTA 5M5VA 3UVMA 4O45A 3JPXA 3ORVD 3UVOA 4G1EA 3GC3B 2OK4A 2PM7B 1C9IA 4ERZA 3IUNA 4A7JA 5I5IA 2VDPA 3MKSB 2VDRA 1GP2B 4QT8A 4LG8A 2HKRA 3I7NA 2HJ4A 3IULA 1YFQA 3V4VA 1TBGA 3O4GA 3ZE0A 4PBZA 2AGWA 1JTDB 4AN0A 5AJAA 5FFGA 3EU7A 1L5GA 4BP9A 2H68A 3BWSA 3J81g 2H6KA 2VC2A 5C92A 3ZDXA 4Z8LA 2OK6A 5HE1B 1E8MA 2QXVA 5C86A 1R5MA 3JZNA 4J0WA 5GXIA 2JKXA 2P9LC 3I89A 1UTCA 5E6RA 2G9AA 3O4IA 3UVNA 2VDNA 2UZXB 1GXRA 4BL0A 1QNIA 4K3JB 4J8GA 3IJCA 2VDMA 3VI4A 5FKQA 5EM2B 2HYEA 2YNPA 3DXKC 4IRZA 1GOFA 3JRPA 5GMKn 3OKWA 3E0CA 3AH8B 4FA4D 2VDLA 1XIPA 2H13A 3SMRA 5EM2A 1RI6A 3RFHA 3IKOA 4AEZA 4BUJC 5HYNB 1Q47A 4IA9A 4AOWA 2YMUA 1PEVA 1S4UX 4UM9A 4L3GD 4WJKA 2P9KC 1B9XA 4QRJA 1U4CA 3SWSD 2HU5A 3AL9A 4ZN4A 3EI1B 3QHYB 3O4JA 2IURA 5IJ8E 5K1CC 4J0XA 3K26A 1GG2B 2B5LA 4BCBA 4NAAA 4CI3A 4J86A 2P9UC 3K27A 3OKYB 3DWLC 4GGDA 4EWRA 5IJ7E 3SVWD 2OVQB 2XDWA 3RN0D 4L3HD 4GGAA 1GOHA 5EALA 4G1MA 4XEIC 3OKYA 4WK4A 3B7FA 3FGBA 4BP8A 3K6SA 4DNVA 2AQ5A 3UKUC 4CY1A 2WQ8A 5C2WB 4A2MA 2VZ3A 5AFU3 3IJ1A 3AFCA 2H14A 2GNQA 5EARA 4D0KA 3AL8A 4A0BB 2O9KA 3EG6A 4CY5A 1UOQA 3L4OD 5HE0B 2Z2OA 4Z7OA 4A0BA 3UVLA 1T2XA 2AH1A 2CN3A 3GFCA 3UVKA 3W15A 3PVUB 4GQ1A 5M5RA 2AGLA 3PSCB 3ODTA 3RMZD 3JB9L 2OVRB 1QFMA 3KRXB 4L9OA 2CN2A 3OW8A 4O9DA 5EMJB 1O6GA 2PBIB 5EAPA 5M61A 3ZDZA 3IJEA 4O1QD 3FCUA 4RE5A 4JD2C 2BBKH 3CFVA 1MG3A 3EMHA 3V4PA 2VDQA 4J78A 2J55H 1BPOA 4OZUA 4D6VA 5E6SA 4FA5D 4UM8A 5CYKB 5EMMB 2AH0A 3SBQA 1JMXB 5H1MA 4JT6C 1UOOA 3C75H 2OJYA 1H2WA 4NC4A 5CYKA 4H5IA 4YVDA 1K32A 3RN1D 5K19A 4GGCA 5GXHA 2IUQA 4MMXA 4ES0A 3V7DB 2YNOA 4Z7NA 2EBSA 4NENA 2G99A 4AN1A 4CC9A 1U8CA 4JHNA 3KRWB 3FCSA 3RRMC 2B4EA 4ZOVA 1E5TA 1P22A 5M5TA 4WK0A 5E6UA 3PXWD 2I0RA 3I7HA 4RE6A 4DNUA 3NVNA 2I0TA 4AMYA 4A11B 5HE2B 2HESX 3VH0A 2CE9A 3OF7A 4CI8A 2I0SA 3I2NA 2GC7A 1N6EA 4I79A 1JJUB 3OKTA 4A11A 2MTAH 2H9LA 2YNNA 1ERJA 4KFMB 3EWEA 3N0DA 4J73A 1GOGA 1OMWB 4FA9D 3PXSD 4MMYA 2IWFA 4N14A 4MMZA 3SFZA 3NVQA 2VDKA 1NR0A 5HE3B 5IGOA 1XHMA 4DNWA 4CZYA 2I3TA 2H9NA 2H3XA 4ERYA 3EI4B 3I7OA 1L0QA 1FWXA 2IAAA 4G56B 3C9CA 3F3FA 4TZ4A 3IUJA 5AMSA 2HU8A 3GREA 2PM9B 4ESGA 4GM3A 4X63B 3EI4A 3C5MA 2HU7A 5FQDA 3ZE2A 4FAVD 4CI1A 1SQ9A 3EI1A 2PM9A 3NIGA 3SBPA 2CO0A 1U2VC 4J79A 2HKMA 2H47A 2XL2A 3EQ9A 2CO0C 2GC4A 4FB1D 3DXMC 2CE8A 5CXCB 5H14A 3FRXA 5TDHB 3J80g 2B5NA 1NEXB 3RSEC 5TEFA 1UOPA 1GOTB 3BG0A 3CFSB 2EICA 4FHLA 5EAMA 1VE7A 4L1QD 5CXCA 4GM9A 2Z2NA 3O4HA 5C2VB 4E5ZB 3UKRC 5GSAA 3DSMA 2Z2PA 3OL2B 4Y7RA 3ZDYA 4E54A 5FA5B 3UR4A 4CY2A 2BCJB 3BG1A 2BKLA 2AGXA 3F3PA 4E5ZA 2P9IC 3EQ8A 5A2Qg 3OL2A 4OWRA 2QC5A 2J56H 1VZ2A 4NBMA 2J57G 3IVMA 3MZKA 4U1EI 2EIDA 2VZ1A 5FKSA 1B9YA 2P9SC 2QZPA 4BH6A 2H9PA 3SN6B 2OVPB 4GQ2P 1C9LA 4G55A 4XYIA 5EMKB 3IUQA 3EI3B 3I7LA 3NIDA 4NSXA 3QI0A 4PC0A 5KDOB 3MUOA 3NVXA 4A2LA 3T3PA 4AMZA 2P9NC 4XYHA 3EI3A 3F3GA 3ZE1A 2P9PC 5TEEA 4QAMA 5C9ZB 4JXMA 3EI2B 1PBYB 5B4WA 1TYQC 4Y5RD 2IWKA 1M1XA 4JT5C 4H5JA
chains in the Genus database with same CATH topology
5HQGA 4FA1D 2HXCA 4GM8A 4J84A 3EI2A 4R7AB 1JMZB 2Q7QA 3SHFA 3MKQA 5THAA 3FM0A 4FWWA 4J87A 1JOFA 1OLZA 3I8EA 4JSXC 3HFQA 3PE7A 4PXWA 5FLXg 3JAMg 4J81A 1SQJA 3U4YA 4CI2A 4A09B 4JSNC 2I3SA 3MMYA 3SXTD 3ZWLB 4ZOYA 3IIWA 3JZGA 5FXYA 4PSXB 1XKSA 1N6DA 4A09A 5I5MA 4CZXA 2H6QA 3I7KA 5IT9g 3IJ0A 4ZOZA 1MDAH 2B5MA 4MK0B 2YBAA 2AGYA 4ZOXA 5TF2A 4X60B 5H17A 3PSLA 4LGNA 3MZLA 3IIYA 3RLMD 3MXXA 1K8KC 3PXTD 2IUVA 3L4MD 3RFGA 4QQEA 3SLED 3A0FA 5CXBB 1A0RB 4GMBA 4GZ8A 2CNXA 3ULEC 4PBYA 3SCYA 4J82A 2UZYB 4J77A 4A08B 5CXBA 4FAND 4U7AA 4ERQA 3VGZA 4GQBB 3I8CA 3JROA 4IMMA 4PSWB 1VYHC 2XU7A 4J8BA 5IC7A 4HDJA 1PI6A 4A08A 2AGZA 3SJLD 5IGQA 4O3TB 1MG2A 3VA6A 3N0EA 3PVWB 4A0AB 2TRCB 3C99A 5SXMA 2H6NA 4O3UB 4JSPC 4LG9A 1SHYB 4A0AA 5EMLB 2OIZA 4PNKB 1N6FA 2H9MA 4X3EA 3AL8B 2W18A 4QL1A 4E54B 2YB8B 4CY3A 3DM0A 2HJBA 1PGUA 2XL3A 3CIKB 3V5WB 3JZHA 5FKRA 4UI9R 2XYIA 2IUPA 4E54A 4X61B 3I7PA 3OTTA 5JWZA 3P4FA 3V9FA 3SBRA 4CZVA 5I5JA 4JSVC 4K3ID 2PM6B 5FKTA 3UVMA 4O45A 3JPXA 3ORVD 3UVOA 2OK4A 2PM7B 4ERZA 4A7JA 5I5IA 3MKSB 1GP2B 4QT8A 4LG8A 2HKRA 3I7NA 2HJ4A 1YFQA 1TBGA 4PBZA 2AGWA 5AJAA 3EU7A 2H68A 3BWSA 3J81g 2H6KA 4Z8LA 2OK6A 5HE1B 2QXVA 1R5MA 3JZNA 4J0WA 5GXIA 2P9LC 3I89A 2G9AA 3UVNA 2UZXB 1GXRA 4BL0A 1QNIA 4K3JB 4J8GA 3IJCA 5FKQA 5EM2B 2HYEA 2YNPA 3DXKC 3JRPA 5GMKn 3OKWA 3E0CA 3AH8B 4FA4D 3SMRA 1XIPA 2H13A 5EM2A 1RI6A 3RFHA 3IKOA 4AEZA 4BUJC 5HYNB 1Q47A 4IA9A 4AOWA 2YMUA 1PEVA 1S4UX 4L3GD 2P9KC 1B9XA 4QRJA 1U4CA 3SWSD 3AL9A 4ZN4A 3EI1B 5IJ8E 2IURA 5K1CC 4J0XA 3K26A 1GG2B 2B5LA 4CI3A 4J86A 2P9UC 3K27A 3OKYB 3DWLC 4GGDA 4EWRA 5IJ7E 3SVWD 2OVQB 3RN0D 4L3HD 4GGAA 5EALA 4XEIC 3OKYA 3B7FA 3FGBA 2AQ5A 3UKUC 4CY1A 5C2WB 4A2MA 5AFU3 3IJ1A 3AFCA 2H14A 2GNQA 5EARA 4D0KA 3AL8A 4A0BB 2O9KA 3EG6A 4CY5A 5HE0B 3L4OD 2Z2OA 4A0BA 3UVLA 2AH1A 2CN3A 3GFCA 3UVKA 3W15A 3PVUB 4GQ1A 2AGLA 3PSCB 3ODTA 3RMZD 3JB9L 2OVRB 3KRXB 4L9OA 2CN2A 3OW8A 4O9DA 5EMJB 2PBIB 5EAPA 4O1QD 4JD2C 2BBKH 3CFVA 1MG3A 3EMHA 4J78A 2J55H 4OZUA 4D6VA 5EMMB 4FA5D 5CYKB 2AH0A 3SBQA 1JMXB 5H1MA 4JT6C 3C75H 2OJYA 5CYKA 4H5IA 4YVDA 1K32A 3RN1D 5K19A 4GGCA 5GXHA 2IUQA 4ES0A 3V7DB 2YNOA 2EBSA 2G99A 4CC9A 3KRWB 3RRMC 2B4EA 4ZOVA 1P22A 3PXWD 2I0RA 3I7HA 3NVNA 2I0TA 4A11B 5HE2B 2HESX 3VH0A 2CE9A 4CI8A 2I0SA 3I2NA 2GC7A 1N6EA 4I79A 1JJUB 3OKTA 4A11A 2MTAH 2H9LA 4KFMB 2YNNA 1ERJA 3EWEA 3N0DA 4J73A 1OMWB 4FA9D 3PXSD 2IWFA 4N14A 3SFZA 3NVQA 1NR0A 5HE3B 5IGOA 1XHMA 4CZYA 2I3TA 2H9NA 2H3XA 4ERYA 3EI4B 3I7OA 1L0QA 1FWXA 2IAAA 4G56B 3C9CA 3F3FA 4TZ4A 5AMSA 3GREA 2PM9B 4ESGA 4GM3A 4X63B 3EI4A 3C5MA 5FQDA 4FAVD 4CI1A 1SQ9A 3EI1A 2PM9A 3SBPA 2CO0A 1U2VC 4J79A 2HKMA 2H47A 2XL2A 2CO0C 2GC4A 4FB1D 3DXMC 2CE8A 5CXCB 5H14A 3FRXA 5TDHB 3J80g 2B5NA 1NEXB 3RSEC 5TEFA 1GOTB 3BG0A 3CFSB 4FHLA 5EAMA 4L1QD 5CXCA 4GM9A 2Z2NA 5C2VB 4E5ZB 3UKRC 5GSAA 3DSMA 2Z2PA 3OL2B 4Y7RA 5FA5B 3UR4A 4CY2A 2BCJB 3BG1A 2AGXA 3F3PA 4E5ZA 2P9IC 5A2Qg 3OL2A 4OWRA 2QC5A 2J56H 2J57G 3MZKA 4U1EI 5FKSA 1B9YA 2P9SC 4BH6A 2H9PA 3SN6B 2OVPB 4GQ2P 4XYIA 5EMKB 3EI3B 3I7LA 4NSXA 4PC0A 5KDOB 3NVXA 4A2LA 2P9NC 4XYHA 3EI3A 3F3GA 2P9PC 5TEEA 5C9ZB 4JXMA 3EI2B 1PBYB 5B4WA 1TYQC 4Y5RD 2IWKA 4JT5C 4H5JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HQG A;  4FA1 D;  2HXC A;  4GM8 A;  4J84 A;  3EI2 A;  4R7A B;  1JMZ B;  2Q7Q A;  3SHF A;  3MKQ A;  5THA A;  3FM0 A;  4FWW A;  4J87 A;  1JOF A;  1OLZ A;  3I8E A;  4JSX C;  3HFQ A;  3PE7 A;  4PXW A;  5FLX g;  3JAM g;  4J81 A;  1SQJ A;  3U4Y A;  4CI2 A;  4A09 B;  4JSN C;  2I3S A;  3MMY A;  3SXT D;  3ZWL B;  4ZOY A;  3IIW A;  3JZG A;  5FXY A;  4PSX B;  1XKS A;  1N6D A;  4A09 A;  5I5M A;  4CZX A;  2H6Q A;  3I7K A;  5IT9 g;  3IJ0 A;  4ZOZ A;  1MDA H;  2B5M A;  4MK0 B;  2YBA A;  2AGY A;  4ZOX A;  5TF2 A;  4X60 B;  5H17 A;  3PSL A;  4LGN A;  3MZL A;  3IIY A;  3RLM D;  3MXX A;  1K8K C;  3PXT D;  2IUV A;  3L4M D;  3RFG A;  4QQE A;  3SLE D;  3A0F A;  5CXB B;  1A0R B;  4GMB A;  4GZ8 A;  2CNX A;  3ULE C;  4PBY A;  3SCY A;  4J82 A;  2UZY B;  4J77 A;  4A08 B;  5CXB A;  4FAN D;  4U7A A;  4ERQ A;  3VGZ A;  4GQB B;  3I8C A;  3JRO A;  4IMM A;  4PSW B;  1VYH C;  2XU7 A;  4J8B A;  5IC7 A;  4HDJ A;  1PI6 A;  4A08 A;  2AGZ A;  3SJL D;  5IGQ A;  4O3T B;  1MG2 A;  3VA6 A;  3N0E A;  3PVW B;  4A0A B;  2TRC B;  3C99 A;  5SXM A;  2H6N A;  4O3U B;  4JSP C;  4LG9 A;  1SHY B;  4A0A A;  5EML B;  2OIZ A;  4PNK B;  1N6F A;  2H9M A;  4X3E A;  3AL8 B;  2W18 A;  4QL1 A;  4E54 B;  2YB8 B;  4CY3 A;  3DM0 A;  2HJB A;  1PGU A;  2XL3 A;  3CIK B;  3V5W B;  3JZH A;  5FKR A;  4UI9 R;  2XYI A;  2IUP A;  4E54 A;  4X61 B;  3I7P A;  3OTT A;  5JWZ A;  3P4F A;  3V9F A;  3SBR A;  4CZV A;  5I5J A;  4JSV C;  4K3I D;  2PM6 B;  5FKT A;  3UVM A;  4O45 A;  3JPX A;  3ORV D;  3UVO A;  2OK4 A;  2PM7 B;  4ERZ A;  4A7J A;  5I5I A;  3MKS B;  1GP2 B;  4QT8 A;  4LG8 A;  2HKR A;  3I7N A;  2HJ4 A;  1YFQ A;  1TBG A;  4PBZ A;  2AGW A;  5AJA A;  3EU7 A;  2H68 A;  3BWS A;  3J81 g;  2H6K A;  4Z8L A;  2OK6 A;  5HE1 B;  2QXV A;  1R5M A;  3JZN A;  4J0W A;  5GXI A;  2P9L C;  3I89 A;  2G9A A;  3UVN A;  2UZX B;  1GXR A;  4BL0 A;  1QNI A;  4K3J B;  4J8G A;  3IJC A;  5FKQ A;  5EM2 B;  2HYE A;  2YNP A;  3DXK C;  3JRP A;  5GMK n;  3OKW A;  3E0C A;  3AH8 B;  4FA4 D;  3SMR A;  1XIP A;  2H13 A;  5EM2 A;  1RI6 A;  3RFH A;  3IKO A;  4AEZ A;  4BUJ C;  5HYN B;  1Q47 A;  4IA9 A;  4AOW A;  2YMU A;  1PEV A;  1S4U X;  4L3G D;  2P9K C;  1B9X A;  4QRJ A;  1U4C A;  3SWS D;  3AL9 A;  4ZN4 A;  3EI1 B;  5IJ8 E;  2IUR A;  5K1C C;  4J0X A;  3K26 A;  1GG2 B;  2B5L A;  4CI3 A;  4J86 A;  2P9U C;  3K27 A;  3OKY B;  3DWL C;  4GGD A;  4EWR A;  5IJ7 E;  3SVW D;  2OVQ B;  3RN0 D;  4L3H D;  4GGA A;  5EAL A;  4XEI C;  3OKY A;  3B7F A;  3FGB A;  2AQ5 A;  3UKU C;  4CY1 A;  5C2W B;  4A2M A;  5AFU 3;  3IJ1 A;  3AFC A;  2H14 A;  2GNQ A;  5EAR A;  4D0K A;  3AL8 A;  4A0B B;  2O9K A;  3EG6 A;  4CY5 A;  5HE0 B;  3L4O D;  2Z2O A;  4A0B A;  3UVL A;  2AH1 A;  2CN3 A;  3GFC A;  3UVK A;  3W15 A;  3PVU B;  4GQ1 A;  2AGL A;  3PSC B;  3ODT A;  3RMZ D;  3JB9 L;  2OVR B;  3KRX B;  4L9O A;  2CN2 A;  3OW8 A;  4O9D A;  5EMJ B;  2PBI B;  5EAP A;  4O1Q D;  4JD2 C;  2BBK H;  3CFV A;  1MG3 A;  3EMH A;  4J78 A;  2J55 H;  4OZU A;  4D6V A;  5EMM B;  4FA5 D;  5CYK B;  2AH0 A;  3SBQ A;  1JMX B;  5H1M A;  4JT6 C;  3C75 H;  2OJY A;  5CYK A;  4H5I A;  4YVD A;  1K32 A;  3RN1 D;  5K19 A;  4GGC A;  5GXH A;  2IUQ A;  4ES0 A;  3V7D B;  2YNO A;  2EBS A;  2G99 A;  4CC9 A;  3KRW B;  3RRM C;  2B4E A;  4ZOV A;  1P22 A;  3PXW D;  2I0R A;  3I7H A;  3NVN A;  2I0T A;  4A11 B;  5HE2 B;  2HES X;  3VH0 A;  2CE9 A;  4CI8 A;  2I0S A;  3I2N A;  2GC7 A;  1N6E A;  4I79 A;  1JJU B;  3OKT A;  4A11 A;  2MTA H;  2H9L A;  4KFM B;  2YNN A;  1ERJ A;  3EWE A;  3N0D A;  4J73 A;  1OMW B;  4FA9 D;  3PXS D;  2IWF A;  4N14 A;  3SFZ A;  3NVQ A;  1NR0 A;  5HE3 B;  5IGO A;  1XHM A;  4CZY A;  2I3T A;  2H9N A;  2H3X A;  4ERY A;  3EI4 B;  3I7O A;  1L0Q A;  1FWX A;  2IAA A;  4G56 B;  3C9C A;  3F3F A;  4TZ4 A;  5AMS A;  3GRE A;  2PM9 B;  4ESG A;  4GM3 A;  4X63 B;  3EI4 A;  3C5M A;  5FQD A;  4FAV D;  4CI1 A;  1SQ9 A;  3EI1 A;  2PM9 A;  3SBP A;  2CO0 A;  1U2V C;  4J79 A;  2HKM A;  2H47 A;  2XL2 A;  2CO0 C;  2GC4 A;  4FB1 D;  3DXM C;  2CE8 A;  5CXC B;  5H14 A;  3FRX A;  5TDH B;  3J80 g;  2B5N A;  1NEX B;  3RSE C;  5TEF A;  1GOT B;  3BG0 A;  3CFS B;  4FHL A;  5EAM A;  4L1Q D;  5CXC A;  4GM9 A;  2Z2N A;  5C2V B;  4E5Z B;  3UKR C;  5GSA A;  3DSM A;  2Z2P A;  3OL2 B;  4Y7R A;  5FA5 B;  3UR4 A;  4CY2 A;  2BCJ B;  3BG1 A;  2AGX A;  3F3P A;  4E5Z A;  2P9I C;  5A2Q g;  3OL2 A;  4OWR A;  2QC5 A;  2J56 H;  2J57 G;  3MZK A;  4U1E I;  5FKS A;  1B9Y A;  2P9S C;  4BH6 A;  2H9P A;  3SN6 B;  2OVP B;  4GQ2 P;  4XYI A;  5EMK B;  3EI3 B;  3I7L A;  4NSX A;  4PC0 A;  5KDO B;  3NVX A;  4A2L A;  2P9N C;  4XYH A;  3EI3 A;  3F3G A;  2P9P C;  5TEE A;  5C9Z B;  4JXM A;  3EI2 B;  1PBY B;  5B4W A;  1TYQ C;  4Y5R D;  2IWK A;  4JT5 C;  4H5J A; 
#chains in the Genus database with same CATH topology
 5HQG A;  4FA1 D;  2HXC A;  4GM8 A;  4J84 A;  3EI2 A;  4R7A B;  1JMZ B;  2Q7Q A;  3SHF A;  3MKQ A;  5THA A;  3FM0 A;  4FWW A;  4J87 A;  1JOF A;  1OLZ A;  3I8E A;  4JSX C;  3HFQ A;  3PE7 A;  4PXW A;  5FLX g;  3JAM g;  5HDB A;  4J81 A;  1H2X A;  1QFS A;  5FFO A;  1SQJ A;  3U4Y A;  4CI2 A;  4A09 B;  3NIF A;  4JSN C;  2I3S A;  3MMY A;  3SXT D;  1JV2 A;  3ZWL B;  3IIW A;  3JZG A;  4ZOY A;  5FXY A;  5M5U A;  4PSX B;  1N6D A;  1XKS A;  3GD1 I;  4A09 A;  5I5M A;  4CZX A;  3K71 A;  4O2W A;  2H6Q A;  3I7K A;  5IT9 g;  1H2Y A;  3IJ0 A;  4ZOZ A;  4JHP C;  1MDA H;  2B5M A;  4MK0 B;  2YBA A;  2AGY A;  4ZOX A;  5TF2 A;  3DDU A;  4X60 B;  5H17 A;  4Z7Q A;  3PSL A;  4LGN A;  1VE6 A;  3IIY A;  3MZL A;  4L1M A;  3MXX A;  3RLM D;  1K8K C;  3PXT D;  2IUV A;  2EIE A;  3L4M D;  3RFG A;  4QQE A;  3SLE D;  3A0F A;  5CXB B;  5M5S A;  1A0R B;  4GMB A;  2XZG A;  4GZ8 A;  1TYE A;  2CNX A;  4D9S A;  3ULE C;  4PBY A;  3SCY A;  4J82 A;  2UZY B;  4J77 A;  4A08 B;  5CXB A;  4FAN D;  4BCD A;  4U7A A;  4ERQ A;  3MVD K;  1YR2 A;  3VGZ A;  3MUN A;  4WK2 A;  4GQB B;  3I8C A;  4AX4 A;  3JRO A;  4IMM A;  4PSW B;  1VYH C;  2XU7 A;  4J8B A;  5IC7 A;  4HDJ A;  1PI6 A;  4A08 A;  2AGZ A;  3VI3 A;  3SJL D;  5IGQ A;  4O3T B;  1MG2 A;  3VA6 A;  3N0E A;  3PVW B;  4A0A B;  2TRC B;  3C99 A;  5SXM A;  1E8N A;  3EQ7 A;  1VZ3 A;  2EIB A;  2H6N A;  4O3U B;  4JSP C;  4LG9 A;  1SHY B;  4A0A A;  5EML B;  2QR5 A;  1H2Z A;  2OIZ A;  4PNK B;  1N6F A;  1A12 A;  2H9M A;  4X3E A;  3K72 A;  3AL8 B;  2W18 A;  4QL1 A;  4E54 B;  2YB8 B;  3T3M A;  3DM0 A;  4CY3 A;  2HJB A;  1PGU A;  2XL3 A;  3CIK B;  3V5W B;  3JZH A;  5FKR A;  3KCI A;  3IUR A;  4UI9 R;  2XYI A;  2IUP A;  2XE4 A;  1I2M B;  4O02 A;  3I7P A;  3OTT A;  2VDO A;  3P4F A;  4X61 B;  5JWZ A;  1K3I A;  3V9F A;  3SBR A;  4CZV A;  3IUM A;  5I5J A;  1O6F A;  4BCC A;  4JSV C;  4K3I D;  2PM6 B;  5FKT A;  5M5V A;  3UVM A;  4O45 A;  3JPX A;  3ORV D;  3UVO A;  4G1E A;  3GC3 B;  2OK4 A;  2PM7 B;  1C9I A;  4ERZ A;  3IUN A;  4A7J A;  5I5I A;  2VDP A;  3MKS B;  2VDR A;  1GP2 B;  4QT8 A;  4LG8 A;  2HKR A;  3I7N A;  2HJ4 A;  3IUL A;  1YFQ A;  3V4V A;  1TBG A;  3O4G A;  3ZE0 A;  4PBZ A;  2AGW A;  1JTD B;  4AN0 A;  5AJA A;  5FFG A;  3EU7 A;  1L5G A;  4BP9 A;  2H68 A;  3BWS A;  3J81 g;  2H6K A;  2VC2 A;  5C92 A;  3ZDX A;  4Z8L A;  2OK6 A;  5HE1 B;  1E8M A;  2QXV A;  5C86 A;  1R5M A;  3JZN A;  4J0W A;  5GXI A;  2JKX A;  2P9L C;  3I89 A;  1UTC A;  5E6R A;  2G9A A;  3O4I A;  3UVN A;  2VDN A;  2UZX B;  1GXR A;  4BL0 A;  1QNI A;  4K3J B;  4J8G A;  3IJC A;  2VDM A;  3VI4 A;  5FKQ A;  5EM2 B;  2HYE A;  2YNP A;  3DXK C;  4IRZ A;  1GOF A;  3JRP A;  5GMK n;  3OKW A;  3E0C A;  3AH8 B;  4FA4 D;  2VDL A;  1XIP A;  2H13 A;  3SMR A;  5EM2 A;  1RI6 A;  3RFH A;  3IKO A;  4AEZ A;  4BUJ C;  5HYN B;  1Q47 A;  4IA9 A;  4AOW A;  2YMU A;  1PEV A;  1S4U X;  4UM9 A;  4L3G D;  4WJK A;  2P9K C;  1B9X A;  4QRJ A;  1U4C A;  3SWS D;  2HU5 A;  3AL9 A;  4ZN4 A;  3EI1 B;  3QHY B;  3O4J A;  2IUR A;  5IJ8 E;  5K1C C;  4J0X A;  3K26 A;  1GG2 B;  2B5L A;  4BCB A;  4NAA A;  4CI3 A;  4J86 A;  2P9U C;  3K27 A;  3OKY B;  3DWL C;  4GGD A;  4EWR A;  5IJ7 E;  3SVW D;  2OVQ B;  2XDW A;  3RN0 D;  4L3H D;  4GGA A;  1GOH A;  5EAL A;  4G1M A;  4XEI C;  3OKY A;  4WK4 A;  3B7F A;  3FGB A;  4BP8 A;  3K6S A;  4DNV A;  2AQ5 A;  3UKU C;  4CY1 A;  2WQ8 A;  5C2W B;  4A2M A;  2VZ3 A;  5AFU 3;  3IJ1 A;  3AFC A;  2H14 A;  2GNQ A;  5EAR A;  4D0K A;  3AL8 A;  4A0B B;  2O9K A;  3EG6 A;  4CY5 A;  1UOQ A;  3L4O D;  5HE0 B;  2Z2O A;  4Z7O A;  4A0B A;  3UVL A;  1T2X A;  2AH1 A;  2CN3 A;  3GFC A;  3UVK A;  3W15 A;  3PVU B;  4GQ1 A;  5M5R A;  2AGL A;  3PSC B;  3ODT A;  3RMZ D;  3JB9 L;  2OVR B;  1QFM A;  3KRX B;  4L9O A;  2CN2 A;  3OW8 A;  4O9D A;  5EMJ B;  1O6G A;  2PBI B;  5EAP A;  5M61 A;  3ZDZ A;  3IJE A;  4O1Q D;  3FCU A;  4RE5 A;  4JD2 C;  2BBK H;  3CFV A;  1MG3 A;  3EMH A;  3V4P A;  2VDQ A;  4J78 A;  2J55 H;  1BPO A;  4OZU A;  4D6V A;  5E6S A;  4FA5 D;  4UM8 A;  5CYK B;  5EMM B;  2AH0 A;  3SBQ A;  1JMX B;  5H1M A;  4JT6 C;  1UOO A;  3C75 H;  2OJY A;  1H2W A;  4NC4 A;  5CYK A;  4H5I A;  4YVD A;  1K32 A;  3RN1 D;  5K19 A;  4GGC A;  5GXH A;  2IUQ A;  4MMX A;  4ES0 A;  3V7D B;  2YNO A;  4Z7N A;  2EBS A;  4NEN A;  2G99 A;  4AN1 A;  4CC9 A;  1U8C A;  4JHN A;  3KRW B;  3FCS A;  3RRM C;  2B4E A;  4ZOV A;  1E5T A;  1P22 A;  5M5T A;  4WK0 A;  5E6U A;  3PXW D;  2I0R A;  3I7H A;  4RE6 A;  4DNU A;  3NVN A;  2I0T A;  4AMY A;  4A11 B;  5HE2 B;  2HES X;  3VH0 A;  2CE9 A;  3OF7 A;  4CI8 A;  2I0S A;  3I2N A;  2GC7 A;  1N6E A;  4I79 A;  1JJU B;  3OKT A;  4A11 A;  2MTA H;  2H9L A;  2YNN A;  1ERJ A;  4KFM B;  3EWE A;  3N0D A;  4J73 A;  1GOG A;  1OMW B;  4FA9 D;  3PXS D;  4MMY A;  2IWF A;  4N14 A;  4MMZ A;  3SFZ A;  3NVQ A;  2VDK A;  1NR0 A;  5HE3 B;  5IGO A;  1XHM A;  4DNW A;  4CZY A;  2I3T A;  2H9N A;  2H3X A;  4ERY A;  3EI4 B;  3I7O A;  1L0Q A;  1FWX A;  2IAA A;  4G56 B;  3C9C A;  3F3F A;  4TZ4 A;  3IUJ A;  5AMS A;  2HU8 A;  3GRE A;  2PM9 B;  4ESG A;  4GM3 A;  4X63 B;  3EI4 A;  3C5M A;  2HU7 A;  5FQD A;  3ZE2 A;  4FAV D;  4CI1 A;  1SQ9 A;  3EI1 A;  2PM9 A;  3NIG A;  3SBP A;  2CO0 A;  1U2V C;  4J79 A;  2HKM A;  2H47 A;  2XL2 A;  3EQ9 A;  2CO0 C;  2GC4 A;  4FB1 D;  3DXM C;  2CE8 A;  5CXC B;  5H14 A;  3FRX A;  5TDH B;  3J80 g;  2B5N A;  1NEX B;  3RSE C;  5TEF A;  1UOP A;  1GOT B;  3BG0 A;  3CFS B;  2EIC A;  4FHL A;  5EAM A;  1VE7 A;  4L1Q D;  5CXC A;  4GM9 A;  2Z2N A;  3O4H A;  5C2V B;  4E5Z B;  3UKR C;  5GSA A;  3DSM A;  2Z2P A;  3OL2 B;  4Y7R A;  3ZDY A;  4E54 A;  5FA5 B;  3UR4 A;  4CY2 A;  2BCJ B;  3BG1 A;  2BKL A;  2AGX A;  3F3P A;  4E5Z A;  2P9I C;  3EQ8 A;  5A2Q g;  3OL2 A;  4OWR A;  2QC5 A;  2J56 H;  1VZ2 A;  4NBM A;  2J57 G;  3IVM A;  3MZK A;  4U1E I;  2EID A;  2VZ1 A;  5FKS A;  1B9Y A;  2P9S C;  2QZP A;  4BH6 A;  2H9P A;  3SN6 B;  2OVP B;  4GQ2 P;  1C9L A;  4G55 A;  4XYI A;  5EMK B;  3IUQ A;  3EI3 B;  3I7L A;  3NID A;  4NSX A;  3QI0 A;  4PC0 A;  5KDO B;  3MUO A;  3NVX A;  4A2L A;  3T3P A;  4AMZ A;  2P9N C;  4XYH A;  3EI3 A;  3F3G A;  3ZE1 A;  2P9P C;  5TEE A;  4QAM A;  5C9Z B;  4JXM A;  3EI2 B;  1PBY B;  5B4W A;  1TYQ C;  4Y5R D;  2IWK A;  1M1X A;  4JT5 C;  4H5J A; 
#chains in the Genus database with same CATH homology
 5HQG A;  4FA1 D;  2HXC A;  4GM8 A;  4J84 A;  3EI2 A;  4R7A B;  1JMZ B;  2Q7Q A;  3SHF A;  3MKQ A;  5THA A;  3FM0 A;  4FWW A;  4J87 A;  1JOF A;  1OLZ A;  3I8E A;  4JSX C;  3HFQ A;  3PE7 A;  4PXW A;  5FLX g;  3JAM g;  4J81 A;  1SQJ A;  3U4Y A;  4CI2 A;  4A09 B;  4JSN C;  2I3S A;  3MMY A;  3SXT D;  3ZWL B;  4ZOY A;  3IIW A;  3JZG A;  5FXY A;  4PSX B;  1XKS A;  1N6D A;  4A09 A;  5I5M A;  4CZX A;  2H6Q A;  3I7K A;  5IT9 g;  3IJ0 A;  4ZOZ A;  1MDA H;  2B5M A;  4MK0 B;  2YBA A;  2AGY A;  4ZOX A;  5TF2 A;  4X60 B;  5H17 A;  3PSL A;  4LGN A;  3MZL A;  3IIY A;  3RLM D;  3MXX A;  1K8K C;  3PXT D;  2IUV A;  3L4M D;  3RFG A;  4QQE A;  3SLE D;  3A0F A;  5CXB B;  1A0R B;  4GMB A;  4GZ8 A;  2CNX A;  3ULE C;  4PBY A;  3SCY A;  4J82 A;  2UZY B;  4J77 A;  4A08 B;  5CXB A;  4FAN D;  4U7A A;  4ERQ A;  3VGZ A;  4GQB B;  3I8C A;  3JRO A;  4IMM A;  4PSW B;  1VYH C;  2XU7 A;  4J8B A;  5IC7 A;  4HDJ A;  1PI6 A;  4A08 A;  2AGZ A;  3SJL D;  5IGQ A;  4O3T B;  1MG2 A;  3VA6 A;  3N0E A;  3PVW B;  4A0A B;  2TRC B;  3C99 A;  5SXM A;  2H6N A;  4O3U B;  4JSP C;  4LG9 A;  1SHY B;  4A0A A;  5EML B;  2OIZ A;  4PNK B;  1N6F A;  2H9M A;  4X3E A;  3AL8 B;  2W18 A;  4QL1 A;  4E54 B;  2YB8 B;  4CY3 A;  3DM0 A;  2HJB A;  1PGU A;  2XL3 A;  3CIK B;  3V5W B;  3JZH A;  5FKR A;  4UI9 R;  2XYI A;  2IUP A;  4E54 A;  4X61 B;  3I7P A;  3OTT A;  5JWZ A;  3P4F A;  3V9F A;  3SBR A;  4CZV A;  5I5J A;  4JSV C;  4K3I D;  2PM6 B;  5FKT A;  3UVM A;  4O45 A;  3JPX A;  3ORV D;  3UVO A;  2OK4 A;  2PM7 B;  4ERZ A;  4A7J A;  5I5I A;  3MKS B;  1GP2 B;  4QT8 A;  4LG8 A;  2HKR A;  3I7N A;  2HJ4 A;  1YFQ A;  1TBG A;  4PBZ A;  2AGW A;  5AJA A;  3EU7 A;  2H68 A;  3BWS A;  3J81 g;  2H6K A;  4Z8L A;  2OK6 A;  5HE1 B;  2QXV A;  1R5M A;  3JZN A;  4J0W A;  5GXI A;  2P9L C;  3I89 A;  2G9A A;  3UVN A;  2UZX B;  1GXR A;  4BL0 A;  1QNI A;  4K3J B;  4J8G A;  3IJC A;  5FKQ A;  5EM2 B;  2HYE A;  2YNP A;  3DXK C;  3JRP A;  5GMK n;  3OKW A;  3E0C A;  3AH8 B;  4FA4 D;  3SMR A;  1XIP A;  2H13 A;  5EM2 A;  1RI6 A;  3RFH A;  3IKO A;  4AEZ A;  4BUJ C;  5HYN B;  1Q47 A;  4IA9 A;  4AOW A;  2YMU A;  1PEV A;  1S4U X;  4L3G D;  2P9K C;  1B9X A;  4QRJ A;  1U4C A;  3SWS D;  3AL9 A;  4ZN4 A;  3EI1 B;  5IJ8 E;  2IUR A;  5K1C C;  4J0X A;  3K26 A;  1GG2 B;  2B5L A;  4CI3 A;  4J86 A;  2P9U C;  3K27 A;  3OKY B;  3DWL C;  4GGD A;  4EWR A;  5IJ7 E;  3SVW D;  2OVQ B;  3RN0 D;  4L3H D;  4GGA A;  5EAL A;  4XEI C;  3OKY A;  3B7F A;  3FGB A;  2AQ5 A;  3UKU C;  4CY1 A;  5C2W B;  4A2M A;  5AFU 3;  3IJ1 A;  3AFC A;  2H14 A;  2GNQ A;  5EAR A;  4D0K A;  3AL8 A;  4A0B B;  2O9K A;  3EG6 A;  4CY5 A;  5HE0 B;  3L4O D;  2Z2O A;  4A0B A;  3UVL A;  2AH1 A;  2CN3 A;  3GFC A;  3UVK A;  3W15 A;  3PVU B;  4GQ1 A;  2AGL A;  3PSC B;  3ODT A;  3RMZ D;  3JB9 L;  2OVR B;  3KRX B;  4L9O A;  2CN2 A;  3OW8 A;  4O9D A;  5EMJ B;  2PBI B;  5EAP A;  4O1Q D;  4JD2 C;  2BBK H;  3CFV A;  1MG3 A;  3EMH A;  4J78 A;  2J55 H;  4OZU A;  4D6V A;  5EMM B;  4FA5 D;  5CYK B;  2AH0 A;  3SBQ A;  1JMX B;  5H1M A;  4JT6 C;  3C75 H;  2OJY A;  5CYK A;  4H5I A;  4YVD A;  1K32 A;  3RN1 D;  5K19 A;  4GGC A;  5GXH A;  2IUQ A;  4ES0 A;  3V7D B;  2YNO A;  2EBS A;  2G99 A;  4CC9 A;  3KRW B;  3RRM C;  2B4E A;  4ZOV A;  1P22 A;  3PXW D;  2I0R A;  3I7H A;  3NVN A;  2I0T A;  4A11 B;  5HE2 B;  2HES X;  3VH0 A;  2CE9 A;  4CI8 A;  2I0S A;  3I2N A;  2GC7 A;  1N6E A;  4I79 A;  1JJU B;  3OKT A;  4A11 A;  2MTA H;  2H9L A;  4KFM B;  2YNN A;  1ERJ A;  3EWE A;  3N0D A;  4J73 A;  1OMW B;  4FA9 D;  3PXS D;  2IWF A;  4N14 A;  3SFZ A;  3NVQ A;  1NR0 A;  5HE3 B;  5IGO A;  1XHM A;  4CZY A;  2I3T A;  2H9N A;  2H3X A;  4ERY A;  3EI4 B;  3I7O A;  1L0Q A;  1FWX A;  2IAA A;  4G56 B;  3C9C A;  3F3F A;  4TZ4 A;  5AMS A;  3GRE A;  2PM9 B;  4ESG A;  4GM3 A;  4X63 B;  3EI4 A;  3C5M A;  5FQD A;  4FAV D;  4CI1 A;  1SQ9 A;  3EI1 A;  2PM9 A;  3SBP A;  2CO0 A;  1U2V C;  4J79 A;  2HKM A;  2H47 A;  2XL2 A;  2CO0 C;  2GC4 A;  4FB1 D;  3DXM C;  2CE8 A;  5CXC B;  5H14 A;  3FRX A;  5TDH B;  3J80 g;  2B5N A;  1NEX B;  3RSE C;  5TEF A;  1GOT B;  3BG0 A;  3CFS B;  4FHL A;  5EAM A;  4L1Q D;  5CXC A;  4GM9 A;  2Z2N A;  5C2V B;  4E5Z B;  3UKR C;  5GSA A;  3DSM A;  2Z2P A;  3OL2 B;  4Y7R A;  5FA5 B;  3UR4 A;  4CY2 A;  2BCJ B;  3BG1 A;  2AGX A;  3F3P A;  4E5Z A;  2P9I C;  5A2Q g;  3OL2 A;  4OWR A;  2QC5 A;  2J56 H;  2J57 G;  3MZK A;  4U1E I;  5FKS A;  1B9Y A;  2P9S C;  4BH6 A;  2H9P A;  3SN6 B;  2OVP B;  4GQ2 P;  4XYI A;  5EMK B;  3EI3 B;  3I7L A;  4NSX A;  4PC0 A;  5KDO B;  3NVX A;  4A2L A;  2P9N C;  4XYH A;  3EI3 A;  3F3G A;  2P9P C;  5TEE A;  5C9Z B;  4JXM A;  3EI2 B;  1PBY B;  5B4W A;  1TYQ C;  4Y5R D;  2IWK A;  4JT5 C;  4H5J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...