4I79A

Crystal structure of human nup43
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
377
structure length
316
Chain Sequence
IYAKFVSQKISKTRWRPLPPGSLQTAETFATGSWDNEENYISLWSIEGDHQLLCDIRHHGDVMDLQFFDQERIVAASSTGCVTVFLHHPNNQTLSVNQQWTTAHYHTSSAPCTGVVCNNPEIVTVGEDGRINLFRADHKEAVRTIDNADSSTLHAVTFLRTPEILTVNSIGQLKIWDFRQQGNEPSQILSLTGDRVPLHCVDRHPNQQHVVATGGQDGMLSIWDVRQGTMPVSLLKAHEAEMWEVHFHPSNPEHLFTCSEDGSLWHWDASSWLSRIEITSLLPSRSLSVNTLDVLGPCLVCGTDAEAIYVTRHLFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoporin Nup43
publication title Crystal structure of human nuclear pore complex component NUP43.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 88
structure length 316
sequence length 377
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4i79A00
2P9NC 4O3UB 2MTAH 3C75H 4J87A 2OK6A 5EM2A 3I2NA 3EMHA 4LG8A 3I8CA 3UKUC 3I7NA 4IMMA 2H68A 3UR4A 5GSAA 4E5ZA 3OTTA 2PM7B 4PBYA 2H9NA 5C9ZB 4GZ8A 3AL8B 3RN1D 2CNXA 5FQDA 4PC0A 1GG2B 2AQ5A 3VGZA 5EMJB 5CXCB 5IJ8E 3I7PA 2I0TA 2XL3A 3MXXA 2I0SA 1MDAH 5TEEA 3NVXA 2OK4A 2CN2A 2GC4A 2PBIB 4XYIA 3AL8A 3SHFA 1A0RB 3PXWD 4D6VA 3L4MD 5C2VB 3EI4A 4O9DA 3J80g 4ESGA 4X61B 3DXMC 3ORVD 4TZ4A 4IA9A 4J8BA 3BG1A 4Z8LA 5CYKB 3EWEA 3OL2B 5C2WB 4Y7RA 2B4EA 4JD2C 4JSVC 4ES0A 3UVOA 4NSXA 2B5LA 2AGZA 3SBRA 3EI3B 3CFVA 1YFQA 3IJ0A 2BCJB 4A2LA 1B9XA 1MG3A 3JZHA 3BWSA 3F3FA 2P9KC 3RMZD 2YNPA 1TYQC 4GQ2P 5CYKA 3OL2A 2HKMA 4A0AA 1MG2A 4JXMA 3VA6A 2OVRB 3EI2B 3EI1B 1OLZA 5H14A 3EI3A 1NR0A 4ERZA 3UVNA 1XIPA 3RRMC 5EAPA 1PGUA 2H6NA 2Z2OA 3JAMg 4FAVD 2AH0A 4PBZA 1GP2B 2UZYB 3NVQA 2IUVA 4E54B 4N14A 2H47A 4A11B 5A2Qg 3PVUB 3V5WB 1PEVA 3IIWA 5I5MA 3OKTA 3DXKC 4AEZA 4A0BB 2GNQA 3DSMA 5KDOB 3BG0A 2G9AA 1OMWB 3PSLA 4BUJC 3CFSB 3OKYB 2XYIA 3N0EA 5IGQA 2G99A 2AGWA 2HXCA 1Q47A 4MK0B 5AJAA 3U4YA 1PI6A 4A0BA 5IC7A 1VYHC 3C99A 3GREA 3SJLD 4K3JB 4ERQA 4A08B 4OZUA 2CE9A 4CC9A 4YVDA 3W15A 3RSEC 4ZN4A 4CY2A 1U4CA 3K27A 4ZOVA 2P9PC 2GC7A 4L1QD 3SXTD 2YB8B 2OJYA 2BBKH 3FM0A 2AGLA 2YNNA 4CY1A 3MKSB 4L3GD 3SWSD 1PBYB 3FRXA 3N0DA 3RFHA 2Z2PA 4ZOZA 3MZLA 3I8EA 2J55H 4J82A 3PVWB 3SCYA 4L3HD 5CXCA 4JT6C 4D0KA 2IAAA 5I5JA 5EMMB 2P9SC 5TDHB 4PSWB 3MKQA 3V7DB 2PM9B 3IKOA 4BL0A 2AGXA 5K19A 1S4UX 3A0FA 4A2MA 3B7FA 5CXBB 2H13A 3ZWLB 3I7LA 2AH1A 5TF2A 5H17A 2IUQA 1GXRA 4J77A 5THAA 5K1CC 4K3ID 2H6QA 2H6KA 5JWZA 4J8GA 3ODTA 4GQ1A 3I7KA 4QQEA 3MMYA 4J81A 4J79A 2PM9A 1ERJA 4GM9A 4A09B 1K32A 5HYNB 1NEXB 1N6DA 4FHLA 3C5MA 2I3TA 2XL2A 1U2VC 2B5MA 1SQJA 4U7AA 2J57G 3EG6A 2EBSA 5H1MA 2UZXB 1JMZB 4J86A 4LGNA 4Y5RD 2QC5A 4PXWA 2CO0A 5I5IA 3SBQA 1JOFA 3EI2A 3V9FA 2HESX 2HJBA 1L0QA 3EI1A 5EARA 5IGOA 4FA4D 3JRPA 2Z2NA 1XKSA 4XYHA 1XHMA 4PSXB 2YNOA 2P9LC 3I7OA 3L4OD 3SMRA 3SLED 4GMBA 3RFGA 1SHYB 2XU7A 4E54A 1GOTB 4A11A 3J81g 3HFQA 2B5NA 2H9MA 3NVNA 3UVLA 2CO0C 3SN6B 2I3SA 4E5ZB 1R5MA 3RN0D 3ULEC 5IT9g 4CY3A 2AGYA 4CI3A 1RI6A 4L9OA 3OW8A 3E0CA 3OKYA 5EMKB 4HDJA 4AOWA 4X60B 3OKWA 5HE3B 3JB9L 3C9CA 2HKRA 5FKRA 5HQGA 4LG9A 2CN3A 3UVKA 4FA9D 4A08A 4R7AB 4O45A 5AFU3 1QNIA 5HE1B 3JROA 3PSCB 3IJ1A 4J0WA 3EU7A 3RLMD 4CI8A 4GGAA 5FLXg 3EI4B 4GGCA 3IJCA 5AMSA 4FA5D 4J0XA 2IURA 2HYEA 3F3GA 5HE0B 1TBGA 3FGBA 3F3PA 4JSNC 1N6EA 2YMUA 3JPXA 3PXSD 2H9LA 4FWWA 4PNKB 5FA5B 3I7HA 2OVQB 3IIYA 4QT8A 4CZVA 4G56B 3AL9A 4O3TB 1N6FA 3JZNA 5SXMA 5HE2B 4EWRA 3UVMA 4BH6A 3I89A 1FWXA 3VH0A 2J56H 2IWFA 5TEFA 2I0RA 4JSXC 3AFCA 3PE7A 5GXIA 1B9YA 5EMLB 2PM6B 3KRXB 4J84A 4A0AB 2P9UC 3SFZA 4A7JA 4J78A 4OWRA 5CXBA 4UI9R 4JSPC 4CZXA 4O1QD 3UKRC 2H14A 4U1EI 3JZGA 5B4WA 4GM3A 4ZOYA 2CE8A 3MZKA 3PXTD 4CI1A 1SQ9A 2TRCB 4I79A 2Q7QA 4X63B 4XEIC 5GMKn 3SVWD 2IUPA 4X3EA 4JT5C 4QRJA 4GM8A 2OVPB 2H9PA 2OIZA 4FA1D 4A09A 2W18A 5FKQA 3DM0A 5FKTA 4KFMB 4ZOXA 4FAND 4H5IA 5EAMA 2HJ4A 4H5JA 4CI2A 4ERYA 5EALA 2YBAA 3DWLC 4FB1D 1K8KC 4GQBB 2IWKA 2P9IC 5EM2B 2H3XA 4J73A 3GFCA 1JJUB 2QXVA 5FXYA 4CZYA 3AH8B 3SBPA 4CY5A 2O9KA 3KRWB 1JMXB 3K26A 3P4FA 4QL1A 5FKSA 5IJ7E 3CIKB 5GXHA 1P22A 4GGDA
chains in the Genus database with same CATH superfamily
2P9NC 4O3UB 2MTAH 1TYEA 3C75H 4J87A 1M1XA 2OK6A 5EM2A 3I2NA 3EMHA 4LG8A 3I8CA 3UKUC 3I7NA 4AMZA 4IMMA 2H68A 3UR4A 5GSAA 4E5ZA 3OTTA 2PM7B 4PBYA 2H9NA 3T3PA 5C9ZB 4GZ8A 3AL8B 1O6GA 1H2XA 3RN1D 2CNXA 5FQDA 4PC0A 1GG2B 2AQ5A 3VGZA 5EMJB 5CXCB 2QZPA 5IJ8E 2JKXA 3I7PA 3ZDYA 2I0TA 2XL3A 5E6UA 3MXXA 2I0SA 4JHPC 1MDAH 5TEEA 5FFOA 3NVXA 3QHYB 2OK4A 4UM8A 2CN2A 2GC4A 2PBIB 4XYIA 3AL8A 3SHFA 1A0RB 3PXWD 4D6VA 3L4MD 5C2VB 3EI4A 4O9DA 3J80g 4ESGA 4X61B 3DXMC 3ORVD 4TZ4A 4IA9A 4AX4A 4J8BA 3BG1A 4Z8LA 5CYKB 3EWEA 3OL2B 5C2WB 4Y7RA 2VDMA 2B4EA 4JD2C 4JSVC 4ES0A 2EIBA 3UVOA 4NSXA 2B5LA 2AGZA 3SBRA 3EI3B 3CFVA 1YFQA 3NIFA 3IJ0A 1YR2A 2BCJB 4A2LA 1B9XA 1UTCA 1VZ3A 3V4PA 1A12A 1MG3A 3JZHA 3BWSA 3F3FA 3K71A 2P9KC 3RMZD 2YNPA 1JV2A 1TYQC 4GQ2P 5CYKA 3FCSA 4DNWA 3OL2A 2HKMA 4A0AA 2VZ1A 1MG2A 4JXMA 3VA6A 2OVRB 2BKLA 3EI2B 3GD1I 3DDUA 5FFGA 1OLZA 5H14A 3EI3A 3EI1B 3V4VA 1NR0A 5HDBA 4ERZA 2VDOA 3UVNA 4D9SA 1BPOA 1XIPA 3RRMC 5EAPA 1PGUA 2H6NA 2Z2OA 3JAMg 4G1EA 4FAVD 2AH0A 4PBZA 1GP2B 3MUOA 2EIDA 2UZYB 3NVQA 2IUVA 4RE5A 4N14A 2EICA 4E54B 2H47A 4A11B 5A2Qg 3PVUB 3V5WB 4Z7NA 1PEVA 3IIWA 5I5MA 3KCIA 4QAMA 2XZGA 1GOHA 3OKTA 3DXKC 4AEZA 4A0BB 2GNQA 3DSMA 1QFSA 1VZ2A 5KDOB 3BG0A 2G9AA 1OMWB 1C9IA 3PSLA 4BUJC 3CFSB 3O4GA 3OKYB 4O02A 2XYIA 1H2WA 3N0EA 5IGQA 2G99A 2AGWA 2HXCA 1Q47A 5C92A 4MK0B 5AJAA 3U4YA 1PI6A 4A0BA 5IC7A 1VYHC 3C99A 3GREA 3SJLD 4K3JB 4ERQA 4A08B 2VC2A 4OZUA 2CE9A 3ZDZA 4CC9A 2EIEA 4YVDA 3W15A 3RSEC 4ZN4A 4G1MA 3IVMA 2QR5A 5M5RA 4CY2A 1U4CA 3K27A 4ZOVA 2P9PC 2GC7A 4L1QD 3SXTD 3ZE2A 1QFMA 2YB8B 2OJYA 2BBKH 3FM0A 2AGLA 2YNNA 4CY1A 2HU8A 3MKSB 4L3GD 5E6RA 5M5VA 4MMZA 4NC4A 3SWSD 1PBYB 3IUJA 4JHNA 4Z7OA 1H2ZA 3IJEA 3FRXA 3N0DA 3RFHA 2Z2PA 4ZOZA 3MZLA 1UOQA 3I8EA 2HU5A 2J55H 1VE7A 4J82A 3PVWB 3SCYA 4L3HD 5CXCA 4JT6C 4DNVA 4D0KA 2IAAA 5I5JA 5EMMB 3IUMA 2P9SC 5TDHB 4PSWB 3MKQA 3V7DB 2PM9B 3IKOA 4BL0A 2AGXA 5K19A 1S4UX 2WQ8A 3A0FA 4DNUA 4A2MA 3B7FA 5CXBB 2H13A 3ZWLB 3I7LA 2AH1A 5TF2A 3FCUA 4MMYA 5H17A 2IUQA 1GXRA 4J77A 4BP8A 5THAA 5K1CC 4K3ID 4AN0A 2H6QA 2H6KA 1E8MA 5JWZA 4J8GA 4WK4A 3ODTA 4GQ1A 3I7KA 4QQEA 3MMYA 4J81A 4J79A 2PM9A 1ERJA 4GM9A 3OF7A 4A09B 1K32A 5HYNB 1K3IA 1NEXB 1N6DA 4FHLA 3C5MA 2I3TA 4BCCA 2XL2A 1U2VC 2B5MA 1SQJA 4U7AA 2J57G 3EG6A 2EBSA 1GOGA 3NIGA 5H1MA 2UZXB 1JMZB 4J86A 4MMXA 4LGNA 4Y5RD 2QC5A 4PXWA 2CO0A 5I5IA 3SBQA 4IRZA 1JOFA 3EI2A 1I2MB 2HESX 2HJBA 3V9FA 1L0QA 3VI3A 3EI1A 5EARA 5IGOA 4FA4D 4UM9A 3JRPA 4Z7QA 2Z2NA 1XKSA 4XYHA 1XHMA 4PSXB 2YNOA 2P9LC 3I7OA 3L4OD 3SMRA 3SLED 2VDPA 4GMBA 4NBMA 4WK0A 3RFGA 1SHYB 2XU7A 3MVDK 2VZ3A 4E54A 1GOTB 3ZE1A 5M5TA 3GC3B 4A11A 3J81g 3HFQA 3IUQA 3O4JA 2B5NA 2H9MA 3IURA 3NVNA 1E5TA 3UVLA 2CO0C 3VI4A 3SN6B 4RE6A 2I3SA 4E5ZB 1R5MA 3RN0D 3ULEC 1GOFA 5IT9g 4CY3A 2AGYA 4CI3A 1RI6A 4L9OA 4AMYA 3OW8A 3E0CA 3OKYA 4WK2A 5EMKB 4HDJA 4AOWA 1VE6A 4X60B 1H2YA 2VDQA 3OKWA 5HE3B 3JB9L 3C9CA 1UOPA 2HKRA 5FKRA 2VDRA 5HQGA 3NIDA 2XDWA 4LG9A 2CN3A 3UVKA 3O4HA 1UOOA 4FA9D 1JTDB 4O45A 4R7AB 5AFU3 4A08A 3IUNA 1QNIA 5HE1B 2HU7A 3JROA 3PSCB 3IJ1A 4J0WA 3EU7A 3RLMD 4CI8A 4GGAA 5FLXg 3EI4B 3EQ8A 3EQ9A 4GGCA 3IJCA 5AMSA 4FA5D 4J0XA 2IURA 2HYEA 3F3GA 3ZE0A 5HE0B 1TBGA 3FGBA 3F3PA 4JSNC 1N6EA 2YMUA 3JPXA 3PXSD 2VDNA 2H9LA 4FWWA 4PNKB 5FA5B 3I7HA 2OVQB 3IIYA 4QT8A 4CZVA 4G56B 3AL9A 3MUNA 1N6FA 3JZNA 4O3TB 5HE2B 5SXMA 4EWRA 1E8NA 3T3MA 3UVMA 4BCDA 4BH6A 5M5UA 3I89A 1FWXA 3VH0A 2J56H 2IWFA 2VDLA 2I0RA 5TEFA 5M61A 2XE4A 4JSXC 3AFCA 3PE7A 5GXIA 1B9YA 5EMLB 2PM6B 3KRXB 4J84A 4A0AB 4NENA 1C9LA 3O4IA 2P9UC 3SFZA 4A7JA 4J78A 4OWRA 1T2XA 5C86A 5CXBA 4UI9R 4JSPC 4CZXA 4O1QD 3UKRC 2H14A 4U1EI 3JZGA 5B4WA 4GM3A 4ZOYA 2CE8A 3MZKA 3PXTD 4CI1A 1SQ9A 4O2WA 2TRCB 4I79A 2Q7QA 4X63B 4XEIC 1O6FA 4BP9A 5GMKn 3SVWD 2IUPA 4WJKA 4X3EA 4JT5C 4QRJA 3QI0A 4GM8A 2OVPB 2H9PA 2OIZA 5M5SA 4FA1D 4A09A 3IULA 4AN1A 4L1MA 2W18A 5FKQA 3DM0A 5FKTA 4KFMB 4ZOXA 4FAND 4H5IA 5EAMA 2HJ4A 4H5JA 4CI2A 4ERYA 5EALA 2VDKA 2YBAA 3K72A 3DWLC 4FB1D 1K8KC 4GQBB 2IWKA 2P9IC 5EM2B 2H3XA 3ZDXA 4J73A 3GFCA 1JJUB 1U8CA 2QXVA 5FXYA 5E6SA 4CZYA 3AH8B 3SBPA 4CY5A 4NAAA 2O9KA 3KRWB 3EQ7A 1JMXB 3K26A 3P4FA 4G55A 3K6SA 1L5GA 4QL1A 5FKSA 5IJ7E 3CIKB 4BCBA 5GXHA 1P22A 4GGDA
chains in the Genus database with same CATH topology
2P9NC 4O3UB 2MTAH 3C75H 4J87A 2OK6A 5EM2A 3I2NA 3EMHA 4LG8A 3I8CA 3UKUC 3I7NA 4IMMA 2H68A 3UR4A 5GSAA 4E5ZA 3OTTA 2PM7B 4PBYA 2H9NA 5C9ZB 4GZ8A 3AL8B 3RN1D 2CNXA 5FQDA 4PC0A 1GG2B 2AQ5A 3VGZA 5EMJB 5CXCB 5IJ8E 3I7PA 2I0TA 2XL3A 3MXXA 2I0SA 1MDAH 5TEEA 3NVXA 2OK4A 2CN2A 2GC4A 2PBIB 4XYIA 3AL8A 3SHFA 1A0RB 3PXWD 4D6VA 3L4MD 5C2VB 3EI4A 4O9DA 3J80g 4ESGA 4X61B 3DXMC 3ORVD 4TZ4A 4IA9A 4J8BA 3BG1A 4Z8LA 5CYKB 3EWEA 3OL2B 5C2WB 4Y7RA 2B4EA 4JD2C 4JSVC 4ES0A 3UVOA 4NSXA 2B5LA 2AGZA 3SBRA 3EI3B 3CFVA 1YFQA 3IJ0A 2BCJB 4A2LA 1B9XA 1MG3A 3JZHA 3BWSA 3F3FA 2P9KC 3RMZD 2YNPA 1TYQC 4GQ2P 5CYKA 3OL2A 2HKMA 4A0AA 1MG2A 4JXMA 3VA6A 2OVRB 3EI2B 3EI1B 1OLZA 5H14A 3EI3A 1NR0A 4ERZA 3UVNA 1XIPA 3RRMC 5EAPA 1PGUA 2H6NA 2Z2OA 3JAMg 4FAVD 2AH0A 4PBZA 1GP2B 2UZYB 3NVQA 2IUVA 4E54B 4N14A 2H47A 4A11B 5A2Qg 3PVUB 3V5WB 1PEVA 3IIWA 5I5MA 3OKTA 3DXKC 4AEZA 4A0BB 2GNQA 3DSMA 5KDOB 3BG0A 2G9AA 1OMWB 3PSLA 4BUJC 3CFSB 3OKYB 2XYIA 3N0EA 5IGQA 2G99A 2AGWA 2HXCA 1Q47A 4MK0B 5AJAA 3U4YA 1PI6A 4A0BA 5IC7A 1VYHC 3C99A 3GREA 3SJLD 4K3JB 4ERQA 4A08B 4OZUA 2CE9A 4CC9A 4YVDA 3W15A 3RSEC 4ZN4A 4CY2A 1U4CA 3K27A 4ZOVA 2P9PC 2GC7A 4L1QD 3SXTD 2YB8B 2OJYA 2BBKH 3FM0A 2AGLA 2YNNA 4CY1A 3MKSB 4L3GD 3SWSD 1PBYB 3FRXA 3N0DA 3RFHA 2Z2PA 4ZOZA 3MZLA 3I8EA 2J55H 4J82A 3PVWB 3SCYA 4L3HD 5CXCA 4JT6C 4D0KA 2IAAA 5I5JA 5EMMB 2P9SC 5TDHB 4PSWB 3MKQA 3V7DB 2PM9B 3IKOA 4BL0A 2AGXA 5K19A 1S4UX 3A0FA 4A2MA 3B7FA 5CXBB 2H13A 3ZWLB 3I7LA 2AH1A 5TF2A 5H17A 2IUQA 1GXRA 4J77A 5THAA 5K1CC 4K3ID 2H6QA 2H6KA 5JWZA 4J8GA 3ODTA 4GQ1A 3I7KA 4QQEA 3MMYA 4J81A 4J79A 2PM9A 1ERJA 4GM9A 4A09B 1K32A 5HYNB 1NEXB 1N6DA 4FHLA 3C5MA 2I3TA 2XL2A 1U2VC 2B5MA 1SQJA 4U7AA 2J57G 3EG6A 2EBSA 5H1MA 2UZXB 1JMZB 4J86A 4LGNA 4Y5RD 2QC5A 4PXWA 2CO0A 5I5IA 3SBQA 1JOFA 3EI2A 3V9FA 2HESX 2HJBA 1L0QA 3EI1A 5EARA 5IGOA 4FA4D 3JRPA 2Z2NA 1XKSA 4XYHA 1XHMA 4PSXB 2YNOA 2P9LC 3I7OA 3L4OD 3SMRA 3SLED 4GMBA 3RFGA 1SHYB 2XU7A 4E54A 1GOTB 4A11A 3J81g 3HFQA 2B5NA 2H9MA 3NVNA 3UVLA 2CO0C 3SN6B 2I3SA 4E5ZB 1R5MA 3RN0D 3ULEC 5IT9g 4CY3A 2AGYA 4CI3A 1RI6A 4L9OA 3OW8A 3E0CA 3OKYA 5EMKB 4HDJA 4AOWA 4X60B 3OKWA 5HE3B 3JB9L 3C9CA 2HKRA 5FKRA 5HQGA 4LG9A 2CN3A 3UVKA 4FA9D 4A08A 4R7AB 4O45A 5AFU3 1QNIA 5HE1B 3JROA 3PSCB 3IJ1A 4J0WA 3EU7A 3RLMD 4CI8A 4GGAA 5FLXg 3EI4B 4GGCA 3IJCA 5AMSA 4FA5D 4J0XA 2IURA 2HYEA 3F3GA 5HE0B 1TBGA 3FGBA 3F3PA 4JSNC 1N6EA 2YMUA 3JPXA 3PXSD 2H9LA 4FWWA 4PNKB 5FA5B 3I7HA 2OVQB 3IIYA 4QT8A 4CZVA 4G56B 3AL9A 4O3TB 1N6FA 3JZNA 5SXMA 5HE2B 4EWRA 3UVMA 4BH6A 3I89A 1FWXA 3VH0A 2J56H 2IWFA 5TEFA 2I0RA 4JSXC 3AFCA 3PE7A 5GXIA 1B9YA 5EMLB 2PM6B 3KRXB 4J84A 4A0AB 2P9UC 3SFZA 4A7JA 4J78A 4OWRA 5CXBA 4UI9R 4JSPC 4CZXA 4O1QD 3UKRC 2H14A 4U1EI 3JZGA 5B4WA 4GM3A 4ZOYA 2CE8A 3MZKA 3PXTD 4CI1A 1SQ9A 2TRCB 4I79A 2Q7QA 4X63B 4XEIC 5GMKn 3SVWD 2IUPA 4X3EA 4JT5C 4QRJA 4GM8A 2OVPB 2H9PA 2OIZA 4FA1D 4A09A 2W18A 5FKQA 3DM0A 5FKTA 4KFMB 4ZOXA 4FAND 4H5IA 5EAMA 2HJ4A 4H5JA 4CI2A 4ERYA 5EALA 2YBAA 3DWLC 4FB1D 1K8KC 4GQBB 2IWKA 2P9IC 5EM2B 2H3XA 4J73A 3GFCA 1JJUB 2QXVA 5FXYA 4CZYA 3AH8B 3SBPA 4CY5A 2O9KA 3KRWB 1JMXB 3K26A 3P4FA 4QL1A 5FKSA 5IJ7E 3CIKB 5GXHA 1P22A 4GGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9N C;  4O3U B;  2MTA H;  3C75 H;  4J87 A;  2OK6 A;  5EM2 A;  3I2N A;  3EMH A;  4LG8 A;  3I8C A;  3UKU C;  3I7N A;  4IMM A;  2H68 A;  3UR4 A;  5GSA A;  4E5Z A;  3OTT A;  2PM7 B;  4PBY A;  2H9N A;  5C9Z B;  4GZ8 A;  3AL8 B;  3RN1 D;  2CNX A;  5FQD A;  4PC0 A;  1GG2 B;  2AQ5 A;  3VGZ A;  5EMJ B;  5CXC B;  5IJ8 E;  3I7P A;  2I0T A;  2XL3 A;  3MXX A;  2I0S A;  1MDA H;  5TEE A;  3NVX A;  2OK4 A;  2CN2 A;  2GC4 A;  2PBI B;  4XYI A;  3AL8 A;  3SHF A;  1A0R B;  3PXW D;  4D6V A;  3L4M D;  5C2V B;  3EI4 A;  4O9D A;  3J80 g;  4ESG A;  4X61 B;  3DXM C;  3ORV D;  4TZ4 A;  4IA9 A;  4J8B A;  3BG1 A;  4Z8L A;  5CYK B;  3EWE A;  3OL2 B;  5C2W B;  4Y7R A;  2B4E A;  4JD2 C;  4JSV C;  4ES0 A;  3UVO A;  4NSX A;  2B5L A;  2AGZ A;  3SBR A;  3EI3 B;  3CFV A;  1YFQ A;  3IJ0 A;  2BCJ B;  4A2L A;  1B9X A;  1MG3 A;  3JZH A;  3BWS A;  3F3F A;  2P9K C;  3RMZ D;  2YNP A;  1TYQ C;  4GQ2 P;  5CYK A;  3OL2 A;  2HKM A;  4A0A A;  1MG2 A;  4JXM A;  3VA6 A;  2OVR B;  3EI2 B;  3EI1 B;  1OLZ A;  5H14 A;  3EI3 A;  1NR0 A;  4ERZ A;  3UVN A;  1XIP A;  3RRM C;  5EAP A;  1PGU A;  2H6N A;  2Z2O A;  3JAM g;  4FAV D;  2AH0 A;  4PBZ A;  1GP2 B;  2UZY B;  3NVQ A;  2IUV A;  4E54 B;  4N14 A;  2H47 A;  4A11 B;  5A2Q g;  3PVU B;  3V5W B;  1PEV A;  3IIW A;  5I5M A;  3OKT A;  3DXK C;  4AEZ A;  4A0B B;  2GNQ A;  3DSM A;  5KDO B;  3BG0 A;  2G9A A;  1OMW B;  3PSL A;  4BUJ C;  3CFS B;  3OKY B;  2XYI A;  3N0E A;  5IGQ A;  2G99 A;  2AGW A;  2HXC A;  1Q47 A;  4MK0 B;  5AJA A;  3U4Y A;  1PI6 A;  4A0B A;  5IC7 A;  1VYH C;  3C99 A;  3GRE A;  3SJL D;  4K3J B;  4ERQ A;  4A08 B;  4OZU A;  2CE9 A;  4CC9 A;  4YVD A;  3W15 A;  3RSE C;  4ZN4 A;  4CY2 A;  1U4C A;  3K27 A;  4ZOV A;  2P9P C;  2GC7 A;  4L1Q D;  3SXT D;  2YB8 B;  2OJY A;  2BBK H;  3FM0 A;  2AGL A;  2YNN A;  4CY1 A;  3MKS B;  4L3G D;  3SWS D;  1PBY B;  3FRX A;  3N0D A;  3RFH A;  2Z2P A;  4ZOZ A;  3MZL A;  3I8E A;  2J55 H;  4J82 A;  3PVW B;  3SCY A;  4L3H D;  5CXC A;  4JT6 C;  4D0K A;  2IAA A;  5I5J A;  5EMM B;  2P9S C;  5TDH B;  4PSW B;  3MKQ A;  3V7D B;  2PM9 B;  3IKO A;  4BL0 A;  2AGX A;  5K19 A;  1S4U X;  3A0F A;  4A2M A;  3B7F A;  5CXB B;  2H13 A;  3ZWL B;  3I7L A;  2AH1 A;  5TF2 A;  5H17 A;  2IUQ A;  1GXR A;  4J77 A;  5THA A;  5K1C C;  4K3I D;  2H6Q A;  2H6K A;  5JWZ A;  4J8G A;  3ODT A;  4GQ1 A;  3I7K A;  4QQE A;  3MMY A;  4J81 A;  4J79 A;  2PM9 A;  1ERJ A;  4GM9 A;  4A09 B;  1K32 A;  5HYN B;  1NEX B;  1N6D A;  4FHL A;  3C5M A;  2I3T A;  2XL2 A;  1U2V C;  2B5M A;  1SQJ A;  4U7A A;  2J57 G;  3EG6 A;  2EBS A;  5H1M A;  2UZX B;  1JMZ B;  4J86 A;  4LGN A;  4Y5R D;  2QC5 A;  4PXW A;  2CO0 A;  5I5I A;  3SBQ A;  1JOF A;  3EI2 A;  3V9F A;  2HES X;  2HJB A;  1L0Q A;  3EI1 A;  5EAR A;  5IGO A;  4FA4 D;  3JRP A;  2Z2N A;  1XKS A;  4XYH A;  1XHM A;  4PSX B;  2YNO A;  2P9L C;  3I7O A;  3L4O D;  3SMR A;  3SLE D;  4GMB A;  3RFG A;  1SHY B;  2XU7 A;  4E54 A;  1GOT B;  4A11 A;  3J81 g;  3HFQ A;  2B5N A;  2H9M A;  3NVN A;  3UVL A;  2CO0 C;  3SN6 B;  2I3S A;  4E5Z B;  1R5M A;  3RN0 D;  3ULE C;  5IT9 g;  4CY3 A;  2AGY A;  4CI3 A;  1RI6 A;  4L9O A;  3OW8 A;  3E0C A;  3OKY A;  5EMK B;  4HDJ A;  4AOW A;  4X60 B;  3OKW A;  5HE3 B;  3JB9 L;  3C9C A;  2HKR A;  5FKR A;  5HQG A;  4LG9 A;  2CN3 A;  3UVK A;  4FA9 D;  4A08 A;  4R7A B;  4O45 A;  5AFU 3;  1QNI A;  5HE1 B;  3JRO A;  3PSC B;  3IJ1 A;  4J0W A;  3EU7 A;  3RLM D;  4CI8 A;  4GGA A;  5FLX g;  3EI4 B;  4GGC A;  3IJC A;  5AMS A;  4FA5 D;  4J0X A;  2IUR A;  2HYE A;  3F3G A;  5HE0 B;  1TBG A;  3FGB A;  3F3P A;  4JSN C;  1N6E A;  2YMU A;  3JPX A;  3PXS D;  2H9L A;  4FWW A;  4PNK B;  5FA5 B;  3I7H A;  2OVQ B;  3IIY A;  4QT8 A;  4CZV A;  4G56 B;  3AL9 A;  4O3T B;  1N6F A;  3JZN A;  5SXM A;  5HE2 B;  4EWR A;  3UVM A;  4BH6 A;  3I89 A;  1FWX A;  3VH0 A;  2J56 H;  2IWF A;  5TEF A;  2I0R A;  4JSX C;  3AFC A;  3PE7 A;  5GXI A;  1B9Y A;  5EML B;  2PM6 B;  3KRX B;  4J84 A;  4A0A B;  2P9U C;  3SFZ A;  4A7J A;  4J78 A;  4OWR A;  5CXB A;  4UI9 R;  4JSP C;  4CZX A;  4O1Q D;  3UKR C;  2H14 A;  4U1E I;  3JZG A;  5B4W A;  4GM3 A;  4ZOY A;  2CE8 A;  3MZK A;  3PXT D;  4CI1 A;  1SQ9 A;  2TRC B;  4I79 A;  2Q7Q A;  4X63 B;  4XEI C;  5GMK n;  3SVW D;  2IUP A;  4X3E A;  4JT5 C;  4QRJ A;  4GM8 A;  2OVP B;  2H9P A;  2OIZ A;  4FA1 D;  4A09 A;  2W18 A;  5FKQ A;  3DM0 A;  5FKT A;  4KFM B;  4ZOX A;  4FAN D;  4H5I A;  5EAM A;  2HJ4 A;  4H5J A;  4CI2 A;  4ERY A;  5EAL A;  2YBA A;  3DWL C;  4FB1 D;  1K8K C;  4GQB B;  2IWK A;  2P9I C;  5EM2 B;  2H3X A;  4J73 A;  3GFC A;  1JJU B;  2QXV A;  5FXY A;  4CZY A;  3AH8 B;  3SBP A;  4CY5 A;  2O9K A;  3KRW B;  1JMX B;  3K26 A;  3P4F A;  4QL1 A;  5FKS A;  5IJ7 E;  3CIK B;  5GXH A;  1P22 A;  4GGD A; 
#chains in the Genus database with same CATH topology
 2P9N C;  4O3U B;  2MTA H;  1TYE A;  3C75 H;  4J87 A;  1M1X A;  2OK6 A;  5EM2 A;  3I2N A;  3EMH A;  4LG8 A;  3I8C A;  3UKU C;  3I7N A;  4AMZ A;  4IMM A;  2H68 A;  3UR4 A;  5GSA A;  4E5Z A;  3OTT A;  2PM7 B;  4PBY A;  2H9N A;  3T3P A;  5C9Z B;  4GZ8 A;  3AL8 B;  1O6G A;  1H2X A;  3RN1 D;  2CNX A;  5FQD A;  4PC0 A;  1GG2 B;  2AQ5 A;  3VGZ A;  5EMJ B;  5CXC B;  2QZP A;  5IJ8 E;  2JKX A;  3I7P A;  3ZDY A;  2I0T A;  2XL3 A;  5E6U A;  3MXX A;  2I0S A;  4JHP C;  1MDA H;  5TEE A;  5FFO A;  3NVX A;  3QHY B;  2OK4 A;  4UM8 A;  2CN2 A;  2GC4 A;  2PBI B;  4XYI A;  3AL8 A;  3SHF A;  1A0R B;  3PXW D;  4D6V A;  3L4M D;  5C2V B;  3EI4 A;  4O9D A;  3J80 g;  4ESG A;  4X61 B;  3DXM C;  3ORV D;  4TZ4 A;  4IA9 A;  4AX4 A;  4J8B A;  3BG1 A;  4Z8L A;  5CYK B;  3EWE A;  3OL2 B;  5C2W B;  4Y7R A;  2VDM A;  2B4E A;  4JD2 C;  4JSV C;  4ES0 A;  2EIB A;  3UVO A;  4NSX A;  2B5L A;  2AGZ A;  3SBR A;  3EI3 B;  3CFV A;  1YFQ A;  3NIF A;  3IJ0 A;  1YR2 A;  2BCJ B;  4A2L A;  1B9X A;  1UTC A;  1VZ3 A;  3V4P A;  1A12 A;  1MG3 A;  3JZH A;  3BWS A;  3F3F A;  3K71 A;  2P9K C;  3RMZ D;  2YNP A;  1JV2 A;  1TYQ C;  4GQ2 P;  5CYK A;  3FCS A;  4DNW A;  3OL2 A;  2HKM A;  4A0A A;  2VZ1 A;  1MG2 A;  4JXM A;  3VA6 A;  2OVR B;  2BKL A;  3EI2 B;  3GD1 I;  3DDU A;  5FFG A;  1OLZ A;  5H14 A;  3EI3 A;  3EI1 B;  3V4V A;  1NR0 A;  5HDB A;  4ERZ A;  2VDO A;  3UVN A;  4D9S A;  1BPO A;  1XIP A;  3RRM C;  5EAP A;  1PGU A;  2H6N A;  2Z2O A;  3JAM g;  4G1E A;  4FAV D;  2AH0 A;  4PBZ A;  1GP2 B;  3MUO A;  2EID A;  2UZY B;  3NVQ A;  2IUV A;  4RE5 A;  4N14 A;  2EIC A;  4E54 B;  2H47 A;  4A11 B;  5A2Q g;  3PVU B;  3V5W B;  4Z7N A;  1PEV A;  3IIW A;  5I5M A;  3KCI A;  4QAM A;  2XZG A;  1GOH A;  3OKT A;  3DXK C;  4AEZ A;  4A0B B;  2GNQ A;  3DSM A;  1QFS A;  1VZ2 A;  5KDO B;  3BG0 A;  2G9A A;  1OMW B;  1C9I A;  3PSL A;  4BUJ C;  3CFS B;  3O4G A;  3OKY B;  4O02 A;  2XYI A;  1H2W A;  3N0E A;  5IGQ A;  2G99 A;  2AGW A;  2HXC A;  1Q47 A;  5C92 A;  4MK0 B;  5AJA A;  3U4Y A;  1PI6 A;  4A0B A;  5IC7 A;  1VYH C;  3C99 A;  3GRE A;  3SJL D;  4K3J B;  4ERQ A;  4A08 B;  2VC2 A;  4OZU A;  2CE9 A;  3ZDZ A;  4CC9 A;  2EIE A;  4YVD A;  3W15 A;  3RSE C;  4ZN4 A;  4G1M A;  3IVM A;  2QR5 A;  5M5R A;  4CY2 A;  1U4C A;  3K27 A;  4ZOV A;  2P9P C;  2GC7 A;  4L1Q D;  3SXT D;  3ZE2 A;  1QFM A;  2YB8 B;  2OJY A;  2BBK H;  3FM0 A;  2AGL A;  2YNN A;  4CY1 A;  2HU8 A;  3MKS B;  4L3G D;  5E6R A;  5M5V A;  4MMZ A;  4NC4 A;  3SWS D;  1PBY B;  3IUJ A;  4JHN A;  4Z7O A;  1H2Z A;  3IJE A;  3FRX A;  3N0D A;  3RFH A;  2Z2P A;  4ZOZ A;  3MZL A;  1UOQ A;  3I8E A;  2HU5 A;  2J55 H;  1VE7 A;  4J82 A;  3PVW B;  3SCY A;  4L3H D;  5CXC A;  4JT6 C;  4DNV A;  4D0K A;  2IAA A;  5I5J A;  5EMM B;  3IUM A;  2P9S C;  5TDH B;  4PSW B;  3MKQ A;  3V7D B;  2PM9 B;  3IKO A;  4BL0 A;  2AGX A;  5K19 A;  1S4U X;  2WQ8 A;  3A0F A;  4DNU A;  4A2M A;  3B7F A;  5CXB B;  2H13 A;  3ZWL B;  3I7L A;  2AH1 A;  5TF2 A;  3FCU A;  4MMY A;  5H17 A;  2IUQ A;  1GXR A;  4J77 A;  4BP8 A;  5THA A;  5K1C C;  4K3I D;  4AN0 A;  2H6Q A;  2H6K A;  1E8M A;  5JWZ A;  4J8G A;  4WK4 A;  3ODT A;  4GQ1 A;  3I7K A;  4QQE A;  3MMY A;  4J81 A;  4J79 A;  2PM9 A;  1ERJ A;  4GM9 A;  3OF7 A;  4A09 B;  1K32 A;  5HYN B;  1K3I A;  1NEX B;  1N6D A;  4FHL A;  3C5M A;  2I3T A;  4BCC A;  2XL2 A;  1U2V C;  2B5M A;  1SQJ A;  4U7A A;  2J57 G;  3EG6 A;  2EBS A;  1GOG A;  3NIG A;  5H1M A;  2UZX B;  1JMZ B;  4J86 A;  4MMX A;  4LGN A;  4Y5R D;  2QC5 A;  4PXW A;  2CO0 A;  5I5I A;  3SBQ A;  4IRZ A;  1JOF A;  3EI2 A;  1I2M B;  2HES X;  2HJB A;  3V9F A;  1L0Q A;  3VI3 A;  3EI1 A;  5EAR A;  5IGO A;  4FA4 D;  4UM9 A;  3JRP A;  4Z7Q A;  2Z2N A;  1XKS A;  4XYH A;  1XHM A;  4PSX B;  2YNO A;  2P9L C;  3I7O A;  3L4O D;  3SMR A;  3SLE D;  2VDP A;  4GMB A;  4NBM A;  4WK0 A;  3RFG A;  1SHY B;  2XU7 A;  3MVD K;  2VZ3 A;  4E54 A;  1GOT B;  3ZE1 A;  5M5T A;  3GC3 B;  4A11 A;  3J81 g;  3HFQ A;  3IUQ A;  3O4J A;  2B5N A;  2H9M A;  3IUR A;  3NVN A;  1E5T A;  3UVL A;  2CO0 C;  3VI4 A;  3SN6 B;  4RE6 A;  2I3S A;  4E5Z B;  1R5M A;  3RN0 D;  3ULE C;  1GOF A;  5IT9 g;  4CY3 A;  2AGY A;  4CI3 A;  1RI6 A;  4L9O A;  4AMY A;  3OW8 A;  3E0C A;  3OKY A;  4WK2 A;  5EMK B;  4HDJ A;  4AOW A;  1VE6 A;  4X60 B;  1H2Y A;  2VDQ A;  3OKW A;  5HE3 B;  3JB9 L;  3C9C A;  1UOP A;  2HKR A;  5FKR A;  2VDR A;  5HQG A;  3NID A;  2XDW A;  4LG9 A;  2CN3 A;  3UVK A;  3O4H A;  1UOO A;  4FA9 D;  1JTD B;  4O45 A;  4R7A B;  5AFU 3;  4A08 A;  3IUN A;  1QNI A;  5HE1 B;  2HU7 A;  3JRO A;  3PSC B;  3IJ1 A;  4J0W A;  3EU7 A;  3RLM D;  4CI8 A;  4GGA A;  5FLX g;  3EI4 B;  3EQ8 A;  3EQ9 A;  4GGC A;  3IJC A;  5AMS A;  4FA5 D;  4J0X A;  2IUR A;  2HYE A;  3F3G A;  3ZE0 A;  5HE0 B;  1TBG A;  3FGB A;  3F3P A;  4JSN C;  1N6E A;  2YMU A;  3JPX A;  3PXS D;  2VDN A;  2H9L A;  4FWW A;  4PNK B;  5FA5 B;  3I7H A;  2OVQ B;  3IIY A;  4QT8 A;  4CZV A;  4G56 B;  3AL9 A;  3MUN A;  1N6F A;  3JZN A;  4O3T B;  5HE2 B;  5SXM A;  4EWR A;  1E8N A;  3T3M A;  3UVM A;  4BCD A;  4BH6 A;  5M5U A;  3I89 A;  1FWX A;  3VH0 A;  2J56 H;  2IWF A;  2VDL A;  2I0R A;  5TEF A;  5M61 A;  2XE4 A;  4JSX C;  3AFC A;  3PE7 A;  5GXI A;  1B9Y A;  5EML B;  2PM6 B;  3KRX B;  4J84 A;  4A0A B;  4NEN A;  1C9L A;  3O4I A;  2P9U C;  3SFZ A;  4A7J A;  4J78 A;  4OWR A;  1T2X A;  5C86 A;  5CXB A;  4UI9 R;  4JSP C;  4CZX A;  4O1Q D;  3UKR C;  2H14 A;  4U1E I;  3JZG A;  5B4W A;  4GM3 A;  4ZOY A;  2CE8 A;  3MZK A;  3PXT D;  4CI1 A;  1SQ9 A;  4O2W A;  2TRC B;  4I79 A;  2Q7Q A;  4X63 B;  4XEI C;  1O6F A;  4BP9 A;  5GMK n;  3SVW D;  2IUP A;  4WJK A;  4X3E A;  4JT5 C;  4QRJ A;  3QI0 A;  4GM8 A;  2OVP B;  2H9P A;  2OIZ A;  5M5S A;  4FA1 D;  4A09 A;  3IUL A;  4AN1 A;  4L1M A;  2W18 A;  5FKQ A;  3DM0 A;  5FKT A;  4KFM B;  4ZOX A;  4FAN D;  4H5I A;  5EAM A;  2HJ4 A;  4H5J A;  4CI2 A;  4ERY A;  5EAL A;  2VDK A;  2YBA A;  3K72 A;  3DWL C;  4FB1 D;  1K8K C;  4GQB B;  2IWK A;  2P9I C;  5EM2 B;  2H3X A;  3ZDX A;  4J73 A;  3GFC A;  1JJU B;  1U8C A;  2QXV A;  5FXY A;  5E6S A;  4CZY A;  3AH8 B;  3SBP A;  4CY5 A;  4NAA A;  2O9K A;  3KRW B;  3EQ7 A;  1JMX B;  3K26 A;  3P4F A;  4G55 A;  3K6S A;  1L5G A;  4QL1 A;  5FKS A;  5IJ7 E;  3CIK B;  4BCB A;  5GXH A;  1P22 A;  4GGD A; 
#chains in the Genus database with same CATH homology
 2P9N C;  4O3U B;  2MTA H;  3C75 H;  4J87 A;  2OK6 A;  5EM2 A;  3I2N A;  3EMH A;  4LG8 A;  3I8C A;  3UKU C;  3I7N A;  4IMM A;  2H68 A;  3UR4 A;  5GSA A;  4E5Z A;  3OTT A;  2PM7 B;  4PBY A;  2H9N A;  5C9Z B;  4GZ8 A;  3AL8 B;  3RN1 D;  2CNX A;  5FQD A;  4PC0 A;  1GG2 B;  2AQ5 A;  3VGZ A;  5EMJ B;  5CXC B;  5IJ8 E;  3I7P A;  2I0T A;  2XL3 A;  3MXX A;  2I0S A;  1MDA H;  5TEE A;  3NVX A;  2OK4 A;  2CN2 A;  2GC4 A;  2PBI B;  4XYI A;  3AL8 A;  3SHF A;  1A0R B;  3PXW D;  4D6V A;  3L4M D;  5C2V B;  3EI4 A;  4O9D A;  3J80 g;  4ESG A;  4X61 B;  3DXM C;  3ORV D;  4TZ4 A;  4IA9 A;  4J8B A;  3BG1 A;  4Z8L A;  5CYK B;  3EWE A;  3OL2 B;  5C2W B;  4Y7R A;  2B4E A;  4JD2 C;  4JSV C;  4ES0 A;  3UVO A;  4NSX A;  2B5L A;  2AGZ A;  3SBR A;  3EI3 B;  3CFV A;  1YFQ A;  3IJ0 A;  2BCJ B;  4A2L A;  1B9X A;  1MG3 A;  3JZH A;  3BWS A;  3F3F A;  2P9K C;  3RMZ D;  2YNP A;  1TYQ C;  4GQ2 P;  5CYK A;  3OL2 A;  2HKM A;  4A0A A;  1MG2 A;  4JXM A;  3VA6 A;  2OVR B;  3EI2 B;  3EI1 B;  1OLZ A;  5H14 A;  3EI3 A;  1NR0 A;  4ERZ A;  3UVN A;  1XIP A;  3RRM C;  5EAP A;  1PGU A;  2H6N A;  2Z2O A;  3JAM g;  4FAV D;  2AH0 A;  4PBZ A;  1GP2 B;  2UZY B;  3NVQ A;  2IUV A;  4E54 B;  4N14 A;  2H47 A;  4A11 B;  5A2Q g;  3PVU B;  3V5W B;  1PEV A;  3IIW A;  5I5M A;  3OKT A;  3DXK C;  4AEZ A;  4A0B B;  2GNQ A;  3DSM A;  5KDO B;  3BG0 A;  2G9A A;  1OMW B;  3PSL A;  4BUJ C;  3CFS B;  3OKY B;  2XYI A;  3N0E A;  5IGQ A;  2G99 A;  2AGW A;  2HXC A;  1Q47 A;  4MK0 B;  5AJA A;  3U4Y A;  1PI6 A;  4A0B A;  5IC7 A;  1VYH C;  3C99 A;  3GRE A;  3SJL D;  4K3J B;  4ERQ A;  4A08 B;  4OZU A;  2CE9 A;  4CC9 A;  4YVD A;  3W15 A;  3RSE C;  4ZN4 A;  4CY2 A;  1U4C A;  3K27 A;  4ZOV A;  2P9P C;  2GC7 A;  4L1Q D;  3SXT D;  2YB8 B;  2OJY A;  2BBK H;  3FM0 A;  2AGL A;  2YNN A;  4CY1 A;  3MKS B;  4L3G D;  3SWS D;  1PBY B;  3FRX A;  3N0D A;  3RFH A;  2Z2P A;  4ZOZ A;  3MZL A;  3I8E A;  2J55 H;  4J82 A;  3PVW B;  3SCY A;  4L3H D;  5CXC A;  4JT6 C;  4D0K A;  2IAA A;  5I5J A;  5EMM B;  2P9S C;  5TDH B;  4PSW B;  3MKQ A;  3V7D B;  2PM9 B;  3IKO A;  4BL0 A;  2AGX A;  5K19 A;  1S4U X;  3A0F A;  4A2M A;  3B7F A;  5CXB B;  2H13 A;  3ZWL B;  3I7L A;  2AH1 A;  5TF2 A;  5H17 A;  2IUQ A;  1GXR A;  4J77 A;  5THA A;  5K1C C;  4K3I D;  2H6Q A;  2H6K A;  5JWZ A;  4J8G A;  3ODT A;  4GQ1 A;  3I7K A;  4QQE A;  3MMY A;  4J81 A;  4J79 A;  2PM9 A;  1ERJ A;  4GM9 A;  4A09 B;  1K32 A;  5HYN B;  1NEX B;  1N6D A;  4FHL A;  3C5M A;  2I3T A;  2XL2 A;  1U2V C;  2B5M A;  1SQJ A;  4U7A A;  2J57 G;  3EG6 A;  2EBS A;  5H1M A;  2UZX B;  1JMZ B;  4J86 A;  4LGN A;  4Y5R D;  2QC5 A;  4PXW A;  2CO0 A;  5I5I A;  3SBQ A;  1JOF A;  3EI2 A;  3V9F A;  2HES X;  2HJB A;  1L0Q A;  3EI1 A;  5EAR A;  5IGO A;  4FA4 D;  3JRP A;  2Z2N A;  1XKS A;  4XYH A;  1XHM A;  4PSX B;  2YNO A;  2P9L C;  3I7O A;  3L4O D;  3SMR A;  3SLE D;  4GMB A;  3RFG A;  1SHY B;  2XU7 A;  4E54 A;  1GOT B;  4A11 A;  3J81 g;  3HFQ A;  2B5N A;  2H9M A;  3NVN A;  3UVL A;  2CO0 C;  3SN6 B;  2I3S A;  4E5Z B;  1R5M A;  3RN0 D;  3ULE C;  5IT9 g;  4CY3 A;  2AGY A;  4CI3 A;  1RI6 A;  4L9O A;  3OW8 A;  3E0C A;  3OKY A;  5EMK B;  4HDJ A;  4AOW A;  4X60 B;  3OKW A;  5HE3 B;  3JB9 L;  3C9C A;  2HKR A;  5FKR A;  5HQG A;  4LG9 A;  2CN3 A;  3UVK A;  4FA9 D;  4A08 A;  4R7A B;  4O45 A;  5AFU 3;  1QNI A;  5HE1 B;  3JRO A;  3PSC B;  3IJ1 A;  4J0W A;  3EU7 A;  3RLM D;  4CI8 A;  4GGA A;  5FLX g;  3EI4 B;  4GGC A;  3IJC A;  5AMS A;  4FA5 D;  4J0X A;  2IUR A;  2HYE A;  3F3G A;  5HE0 B;  1TBG A;  3FGB A;  3F3P A;  4JSN C;  1N6E A;  2YMU A;  3JPX A;  3PXS D;  2H9L A;  4FWW A;  4PNK B;  5FA5 B;  3I7H A;  2OVQ B;  3IIY A;  4QT8 A;  4CZV A;  4G56 B;  3AL9 A;  4O3T B;  1N6F A;  3JZN A;  5SXM A;  5HE2 B;  4EWR A;  3UVM A;  4BH6 A;  3I89 A;  1FWX A;  3VH0 A;  2J56 H;  2IWF A;  5TEF A;  2I0R A;  4JSX C;  3AFC A;  3PE7 A;  5GXI A;  1B9Y A;  5EML B;  2PM6 B;  3KRX B;  4J84 A;  4A0A B;  2P9U C;  3SFZ A;  4A7J A;  4J78 A;  4OWR A;  5CXB A;  4UI9 R;  4JSP C;  4CZX A;  4O1Q D;  3UKR C;  2H14 A;  4U1E I;  3JZG A;  5B4W A;  4GM3 A;  4ZOY A;  2CE8 A;  3MZK A;  3PXT D;  4CI1 A;  1SQ9 A;  2TRC B;  4I79 A;  2Q7Q A;  4X63 B;  4XEI C;  5GMK n;  3SVW D;  2IUP A;  4X3E A;  4JT5 C;  4QRJ A;  4GM8 A;  2OVP B;  2H9P A;  2OIZ A;  4FA1 D;  4A09 A;  2W18 A;  5FKQ A;  3DM0 A;  5FKT A;  4KFM B;  4ZOX A;  4FAN D;  4H5I A;  5EAM A;  2HJ4 A;  4H5J A;  4CI2 A;  4ERY A;  5EAL A;  2YBA A;  3DWL C;  4FB1 D;  1K8K C;  4GQB B;  2IWK A;  2P9I C;  5EM2 B;  2H3X A;  4J73 A;  3GFC A;  1JJU B;  2QXV A;  5FXY A;  4CZY A;  3AH8 B;  3SBP A;  4CY5 A;  2O9K A;  3KRW B;  1JMX B;  3K26 A;  3P4F A;  4QL1 A;  5FKS A;  5IJ7 E;  3CIK B;  5GXH A;  1P22 A;  4GGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...