4I79A

Crystal structure of human nup43
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
377
structure length
316
Chain Sequence
IYAKFVSQKISKTRWRPLPPGSLQTAETFATGSWDNEENYISLWSIEGDHQLLCDIRHHGDVMDLQFFDQERIVAASSTGCVTVFLHHPNNQTLSVNQQWTTAHYHTSSAPCTGVVCNNPEIVTVGEDGRINLFRADHKEAVRTIDNADSSTLHAVTFLRTPEILTVNSIGQLKIWDFRQQGNEPSQILSLTGDRVPLHCVDRHPNQQHVVATGGQDGMLSIWDVRQGTMPVSLLKAHEAEMWEVHFHPSNPEHLFTCSEDGSLWHWDASSWLSRIEITSLLPSRSLSVNTLDVLGPCLVCGTDAEAIYVTRHLFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Nucleoporin Nup43
publication title Crystal structure of human nuclear pore complex component NUP43.
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 316
sequence length 377
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4i79A00
2Z2PA 4H5JA 3I7KA 2W18A 4PSXB 2YNOA 2IURA 4A08A 2IUVA 1RI6A 3BG1A 3IJCA 4CY3A 3OKYB 3RSEC 3PXTD 4J87A 3PVUB 3VGZA 3GREA 4ERQA 2OJYA 5HE1B 1SQ9A 3IIYA 3PVWB 3J80g 4D0KA 3ODTA 2YNPA 2IWFA 3SLED 4FA1D 4E54B 2P9PC 3DWLC 3KRXB 2B5NA 5CYKA 3W15A 2B5MA 3MXXA 5HE0B 2PM9A 4A0AB 2HESX 3HFQA 4J82A 4Z8LA 4LGNA 3CFSB 4JSPC 4D6VA 3GFCA 2XL2A 3UVMA 2PM7B 4JXMA 4X60B 5FXYA 3I7PA 2YBAA 4H5IA 1QNIA 3ORVD 3EI2A 3EI1A 2CNXA 3OTTA 2GNQA 1PBYB 1A0RB 1GXRA 3A0FA 3SCYA 3PSLA 2IUPA 4Y5RD 2XU7A 2CE9A 3PE7A 4CY5A 3IKOA 5FKRA 4A08B 3V5WB 4JSXC 1YFQA 1MG3A 2P9SC 1JMXB 4A2LA 1TYQC 2H13A 4N14A 1K32A 3AL8A 4J77A 5FLXg 3I7HA 1Q47A 3JZGA 4E5ZA 2H9LA 3ZWLB 4PNKB 3JZNA 4FB1D 3UVOA 2H9PA 2AGZA 1ERJA 3MZLA 4ZOZA 3DM0A 2GC4A 2I3SA 3RLMD 4O3TB 3U4YA 2I0TA 3KRWB 4ES0A 5CYKB 3C75H 4AOWA 3I7LA 4JD2C 2QC5A 5EM2B 4LG8A 2PM9B 3FRXA 1N6EA 5EMMB 3EMHA 4X61B 4GMBA 3EI4A 2P9LC 4J81A 5SXMA 1MG2A 2AQ5A 5IC7A 4GQ1A 3UVLA 1JOFA 4L1QD 4OZUA 3K26A 3NVNA 3SFZA 4CC9A 3K27A 3EI2B 3EI1B 5C2VB 3L4OD 1N6FA 4CI2A 3JZHA 1NR0A 5HQGA 2HJBA 5HE2B 4J8GA 5B4WA 3ULEC 4IA9A 4J78A 4A11B 5GXHA 4GQ2P 4GM3A 4J8BA 4PBYA 1VYHC 4PSWB 2YB8B 2YMUA 5TDHB 2I0SA 4L3GD 3F3FA 4BUJC 3AH8B 4ZN4A 3AL8B 4BH6A 2J56H 4X3EA 2H9NA 1PI6A 4J73A 3RMZD 4FA9D 4J0XA 3FM0A 2H47A 4E5ZB 3BG0A 5C9ZB 3EI3A 3RN0D 5EM2A 3I7OA 4QRJA 4CY1A 4K3ID 3OKTA 5IT9g 2TRCB 4CZXA 3SBQA 3L4MD 4J0WA 2AGYA 5EMJB 4ZOVA 3SN6B 2P9NC 1XKSA 3IIWA 4ERZA 2H68A 2IAAA 4FAVD 2AGWA 4L9OA 3MKSB 4GQBB 2OIZA 2G9AA 3EI4B 4FHLA 3VA6A 2HXCA 4KFMB 4CZYA 2H14A 3CFVA 4A11A 3C9CA 3SMRA 3OKWA 5K1CC 3SXTD 4XYIA 5EAMA 5EARA 5IJ7E 4TZ4A 3CIKB 5TEEA 4GM9A 4O1QD 3BWSA 5HYNB 5H14A 2I0RA 4FWWA 3PXSD 2P9IC 1MDAH 1OLZA 2UZXB 2AGLA 3RFHA 2B4EA 4PBZA 5EALA 5KDOB 3I8CA 5H17A 4L3HD 1L0QA 4X63B 3B7FA 4GGCA 1JJUB 1R5MA 5K19A 4EWRA 2PBIB 2G99A 2CO0C 3F3PA 2YNNA 5FKTA 2B5LA 4QT8A 2IUQA 3EI3B 4MK0B 3UVNA 3NVQA 4BL0A 3IJ0A 2MTAH 2P9UC 4AEZA 5AMSA 4PXWA 4GM8A 4A0BA 4QQEA 2OVQB 3VH0A 4IMMA 5FKSA 4GGAA 2I3TA 4LG9A 3I7NA 4JSVC 1FWXA 3UKUC 4A7JA 4G56B 1GOTB 3SBRA 3EWEA 3P4FA 3I8EA 1B9XA 1PGUA 4HDJA 1P22A 5CXCA 1NEXB 4JSNC 4Y7RA 3MZKA 2H6NA 4I79A 5EAPA 1K8KC 3JAMg 4GGDA 2XL3A 3RRMC 3AL9A 2Z2NA 4CZVA 5THAA 3DXKC 2OVPB 2Q7QA 5AFU3 3JROA 3UVKA 3F3GA 5I5MA 2CO0A 2HKRA 4FA4D 5IJ8E 2CE8A 2AGXA 1GP2B 2BCJB 3IJ1A 2J55H 2EBSA 4A09A 2P9KC 5I5JA 2CN3A 3JRPA 3JB9L 2OK6A 3PXWD 5EMLB 2BBKH 4JT6C 3FGBA 2H9MA 1U4CA 5CXBA 2AH0A 3MKQA 4U1EI 5JWZA 4J86A 4NSXA 5GXIA 4A2MA 2H6KA 3AFCA 4ZOYA 3J81g 3OL2A 3SWSD 3V9FA 1N6DA 4A0BB 3SJLD 3RFGA 3EG6A 4QL1A 2AH1A 5GMKn 4J79A 2OK4A 2Z2OA 2XYIA 4ERYA 4O9DA 3C99A 4ESGA 3N0DA 5FQDA 5TEFA 5C2WB 3DSMA 3E0CA 4U7AA 3EU7A 5IGQA 4OWRA 2HJ4A 1U2VC 4PC0A 3OKYA 5TF2A 1XIPA 5CXCB 4FAND 4JT5C 2H6QA 3UR4A 3OW8A 4CI8A 2J57G 4UI9R 3I89A 4XYHA 3I2NA 1OMWB 2OVRB 1XHMA 4E54A 3DXMC 4YVDA 4GZ8A 2CN2A 3SVWD 3MMYA 4O45A 4CI1A 2IWKA 3UKRC 4O3UB 3SBPA 5HE3B 2UZYB 2HKMA 4FA5D 1GG2B 1SHYB 3V7DB 5A2Qg 4A09B 1PEVA 1SQJA 2GC7A 5AJAA 5FA5B 4CI3A 5H1MA 4XEIC 2HYEA 1B9YA 4CY2A 4A0AA 3NVXA 2QXVA 2PM6B 1TBGA 5CXBB 5EMKB 3SHFA 3C5MA 3JPXA 5FKQA 2O9KA 5GSAA 1S4UX 3OL2B 5I5IA 4K3JB 3RN1D 1JMZB 3N0EA 4ZOXA 3PSCB 4R7AB 2H3XA 5IGOA 4J84A
chains in the Genus database with same CATH superfamily
2Z2PA 4H5JA 3I7KA 2W18A 4PSXB 2YNOA 2IURA 4A08A 2IUVA 1K3IA 1RI6A 3NIFA 2VDQA 3V4PA 3BG1A 3MVDK 3IJCA 4CY3A 3OKYB 3RSEC 3IUMA 3PXTD 4J87A 3PVUB 3VGZA 3GREA 4ERQA 2OJYA 3NIGA 5HE1B 1SQ9A 3IIYA 3MUOA 3PVWB 3J80g 4D0KA 3ODTA 2YNPA 2IWFA 1U8CA 3SLED 4FA1D 4E54B 2P9PC 3DWLC 4NENA 3KRXB 2B5NA 2VDLA 5CYKA 3W15A 4AN0A 3O4GA 2B5MA 3MXXA 5HE0B 2PM9A 4A0AB 2HESX 3HFQA 3GD1I 4J82A 4Z8LA 4LGNA 3CFSB 4JSPC 4D6VA 3GFCA 2XL2A 3UVMA 2PM7B 4JXMA 1UOOA 4X60B 5FXYA 3I7PA 2YBAA 4H5IA 1QNIA 3ORVD 3EI2A 3EI1A 4G1MA 2CNXA 3OTTA 4JHNA 2GNQA 1PBYB 1A0RB 1GXRA 4G1EA 3A0FA 3SCYA 1L5GA 3PSLA 2IUPA 4Y5RD 3ZE0A 2XU7A 2CE9A 3PE7A 3V4VA 4CY5A 3IUQA 3IKOA 5FKRA 4A08B 3V5WB 2BKLA 3FCSA 1E8NA 4NAAA 1YFQA 1MG3A 4JSXC 2P9SC 1JMXB 4A2LA 1TYQC 1UOQA 2H13A 5M61A 4N14A 1K32A 1H2WA 4L1MA 3AL8A 4J77A 5C86A 3VI3A 5FLXg 3I7HA 2HU5A 1Q47A 3JZGA 1T2XA 4IRZA 4E5ZA 2H9LA 4NC4A 3ZWLB 4PNKB 3JZNA 4FB1D 3UVOA 2H9PA 2AGZA 1ERJA 3MZLA 4G55A 4ZOZA 3DM0A 3VI4A 2GC4A 2EIDA 2I3SA 3ZE2A 3RLMD 4O3TB 3U4YA 2I0TA 1YR2A 3KRWB 4ES0A 5CYKB 3C75H 4MMZA 1M1XA 4AX4A 4AOWA 3I7LA 4JD2C 2QC5A 5EM2B 4LG8A 2PM9B 3FRXA 1N6EA 5EMMB 3EMHA 4X61B 3QHYB 1QFSA 4GMBA 3EI4A 4AMYA 2P9LC 4J81A 5SXMA 1MG2A 5HDBA 4D9SA 2AQ5A 3K72A 5IC7A 4GQ1A 3UVLA 1JOFA 4L1QD 4OZUA 3K26A 4WK2A 3NVNA 3SFZA 1GOHA 4CC9A 3K27A 3EI2B 3EI1B 5C2VB 1UTCA 3L4OD 1N6FA 4CI2A 3JZHA 3QI0A 4JHPC 1NR0A 5HQGA 2HJBA 4DNVA 5HE2B 4MMXA 4J8GA 5B4WA 3ZDYA 3ULEC 4IA9A 5FFGA 4J78A 4A11B 5GXHA 4GQ2P 4GM3A 3MUNA 4J8BA 4PBYA 1VYHC 2VDPA 4PSWB 1O6GA 2YB8B 2YMUA 5TDHB 2I0SA 4L3GD 3F3FA 4BUJC 3AH8B 5M5TA 4ZN4A 3IJEA 3AL8B 4BH6A 2J56H 4X3EA 2H9NA 1PI6A 4J73A 3RMZD 4FA9D 4J0XA 3FM0A 2H47A 4E5ZB 3BG0A 5C9ZB 3EI3A 4RE5A 3RN0D 5EM2A 3I7OA 4QRJA 4CY1A 4K3ID 3OKTA 5IT9g 2TRCB 4CZXA 3SBQA 3L4MD 1VZ2A 4J0WA 2AGYA 5E6RA 3EQ7A 4ZOVA 2P9NC 5EMJB 3SN6B 1XKSA 3IIWA 4ERZA 2H68A 2IAAA 4FAVD 2AGWA 4L9OA 4UM9A 2WQ8A 3MKSB 4GQBB 2OIZA 3IURA 2G9AA 3EI4B 4FHLA 3VA6A 2HXCA 4KFMB 4CZYA 2H14A 3CFVA 4A11A 2XDWA 3C9CA 3SMRA 3OKWA 5K1CC 3SXTD 4XYIA 5EAMA 5EARA 5IJ7E 4TZ4A 3CIKB 3NIDA 5TEEA 4GM9A 4O1QD 3BWSA 5HYNB 5H14A 2I0RA 4FWWA 3PXSD 2P9IC 1MDAH 1OLZA 2UZXB 1QFMA 1H2YA 2AGLA 3RFHA 2B4EA 4PBZA 5EALA 4BCBA 3K6SA 5KDOB 3I8CA 5M5VA 5H17A 4L3HD 1L0QA 4X63B 3B7FA 2QR5A 4GGCA 1JV2A 3T3PA 1JJUB 1BPOA 1R5MA 5K19A 4EWRA 2PBIB 2EICA 4BP8A 2G99A 2CO0C 3F3PA 2YNNA 5FKTA 4O02A 2B5LA 4QT8A 3OF7A 1TYEA 2IUQA 3EI3B 4MK0B 3UVNA 4Z7OA 3NVQA 4BL0A 3IJ0A 2MTAH 1GOGA 2P9UC 4AEZA 4BCCA 5AMSA 4PXWA 4GM8A 2XZGA 1JTDB 3IUJA 4A0BA 4QQEA 2OVQB 3K71A 3VH0A 4IMMA 5FKSA 4GGAA 2I3TA 4LG9A 3I7NA 4JSVC 5M5RA 4BP9A 1FWXA 3UKUC 4A7JA 4G56B 1C9LA 1GOTB 3SBRA 3EWEA 3P4FA 3EQ8A 3I8EA 1B9XA 3O4IA 3DDUA 1PGUA 3ZE1A 4HDJA 5C92A 1P22A 5CXCA 1NEXB 4DNWA 3KCIA 4JSNC 4Y7RA 3MZKA 2H6NA 4I79A 1VE7A 5EAPA 1K8KC 3JAMg 4GGDA 2XL3A 3RRMC 2VDOA 3AL9A 2Z2NA 3O4JA 4CZVA 5THAA 3DXKC 2OVPB 2Q7QA 5AFU3 3JROA 2VDNA 3F3GA 3UVKA 4AN1A 5I5MA 2CO0A 2VZ1A 3GC3B 2HKRA 1A12A 2JKXA 4FA4D 5IJ8E 2CE8A 2AGXA 1GP2B 1O6FA 3IVMA 2BCJB 3IJ1A 2J55H 2EBSA 1H2ZA 1GOFA 4A09A 2P9KC 5E6SA 5I5JA 2CN3A 3JRPA 1E5TA 2XE4A 3EQ9A 3JB9L 2OK6A 3PXWD 5EMLB 2BBKH 4JT6C 5FFOA 3FGBA 2VDRA 2H9MA 1U4CA 5CXBA 2AH0A 3MKQA 4U1EI 3ZDXA 5M5SA 5JWZA 2VDKA 2HU7A 1E8MA 4J86A 4NSXA 5GXIA 4A2MA 2H6KA 3AFCA 4ZOYA 3J81g 3OL2A 3SWSD 3V9FA 1N6DA 4A0BB 3SJLD 3RFGA 3EG6A 4BCDA 1I2MB 4QL1A 2AH1A 5GMKn 4J79A 2OK4A 1VE6A 2Z2OA 2XYIA 4ERYA 4O9DA 3C99A 3ZDZA 4DNUA 4ESGA 3N0DA 5FQDA 2HU8A 5TEFA 5C2WB 3DSMA 3E0CA 4U7AA 1C9IA 2VZ3A 3EU7A 5IGQA 4OWRA 2HJ4A 2VDMA 1U2VC 4MMYA 4PC0A 4UM8A 3OKYA 5TF2A 2VC2A 3FCUA 4WK4A 1XIPA 5CXCB 4FAND 4JT5C 3T3MA 2H6QA 3IULA 3UR4A 3OW8A 4Z7QA 4NBMA 4CI8A 2J57G 4UI9R 3IUNA 3I89A 4XYHA 5M5UA 3I2NA 1OMWB 2OVRB 1XHMA 4E54A 3DXMC 4YVDA 1UOPA 2CN2A 4GZ8A 3SVWD 3MMYA 4O45A 4CI1A 2IWKA 3UKRC 2QZPA 4O3UB 3SBPA 5HE3B 2UZYB 2EIBA 2HKMA 4FA5D 1GG2B 1SHYB 3V7DB 4WJKA 5A2Qg 4A09B 1PEVA 1SQJA 2GC7A 1H2XA 5AJAA 5FA5B 4CI3A 5H1MA 4XEIC 2HYEA 1B9YA 4CY2A 4A0AA 5E6UA 3NVXA 4WK0A 2QXVA 2PM6B 4AMZA 1TBGA 5CXBB 4RE6A 5EMKB 3SHFA 2EIEA 3C5MA 3JPXA 1VZ3A 4QAMA 5FKQA 2O9KA 3O4HA 5GSAA 1S4UX 3OL2B 5I5IA 4K3JB 4O2WA 4Z7NA 3RN1D 1JMZB 3N0EA 4ZOXA 3PSCB 4R7AB 2H3XA 5IGOA 4J84A
chains in the Genus database with same CATH topology
2Z2PA 4H5JA 3I7KA 2W18A 4PSXB 2YNOA 2IURA 4A08A 2IUVA 1RI6A 3BG1A 3IJCA 4CY3A 3OKYB 3RSEC 3PXTD 4J87A 3PVUB 3VGZA 3GREA 4ERQA 2OJYA 5HE1B 1SQ9A 3IIYA 3PVWB 3J80g 4D0KA 3ODTA 2YNPA 2IWFA 3SLED 4FA1D 4E54B 2P9PC 3DWLC 3KRXB 2B5NA 5CYKA 3W15A 2B5MA 3MXXA 5HE0B 2PM9A 4A0AB 2HESX 3HFQA 4J82A 4Z8LA 4LGNA 3CFSB 4JSPC 4D6VA 3GFCA 2XL2A 3UVMA 2PM7B 4JXMA 4X60B 5FXYA 3I7PA 2YBAA 4H5IA 1QNIA 3ORVD 3EI2A 3EI1A 2CNXA 3OTTA 2GNQA 1PBYB 1A0RB 1GXRA 3A0FA 3SCYA 3PSLA 2IUPA 4Y5RD 2XU7A 2CE9A 3PE7A 4CY5A 3IKOA 5FKRA 4A08B 3V5WB 4JSXC 1YFQA 1MG3A 2P9SC 1JMXB 4A2LA 1TYQC 2H13A 4N14A 1K32A 3AL8A 4J77A 5FLXg 3I7HA 1Q47A 3JZGA 4E5ZA 2H9LA 3ZWLB 4PNKB 3JZNA 4FB1D 3UVOA 2H9PA 2AGZA 1ERJA 3MZLA 4ZOZA 3DM0A 2GC4A 2I3SA 3RLMD 4O3TB 3U4YA 2I0TA 3KRWB 4ES0A 5CYKB 3C75H 4AOWA 3I7LA 4JD2C 2QC5A 5EM2B 4LG8A 2PM9B 3FRXA 1N6EA 5EMMB 3EMHA 4X61B 4GMBA 3EI4A 2P9LC 4J81A 5SXMA 1MG2A 2AQ5A 5IC7A 4GQ1A 3UVLA 1JOFA 4L1QD 4OZUA 3K26A 3NVNA 3SFZA 4CC9A 3K27A 3EI2B 3EI1B 5C2VB 3L4OD 1N6FA 4CI2A 3JZHA 1NR0A 5HQGA 2HJBA 5HE2B 4J8GA 5B4WA 3ULEC 4IA9A 4J78A 4A11B 5GXHA 4GQ2P 4GM3A 4J8BA 4PBYA 1VYHC 4PSWB 2YB8B 2YMUA 5TDHB 2I0SA 4L3GD 3F3FA 4BUJC 3AH8B 4ZN4A 3AL8B 4BH6A 2J56H 4X3EA 2H9NA 1PI6A 4J73A 3RMZD 4FA9D 4J0XA 3FM0A 2H47A 4E5ZB 3BG0A 5C9ZB 3EI3A 3RN0D 5EM2A 3I7OA 4QRJA 4CY1A 4K3ID 3OKTA 5IT9g 2TRCB 4CZXA 3SBQA 3L4MD 4J0WA 2AGYA 5EMJB 4ZOVA 3SN6B 2P9NC 1XKSA 3IIWA 4ERZA 2H68A 2IAAA 4FAVD 2AGWA 4L9OA 3MKSB 4GQBB 2OIZA 2G9AA 3EI4B 4FHLA 3VA6A 2HXCA 4KFMB 4CZYA 2H14A 3CFVA 4A11A 3C9CA 3SMRA 3OKWA 5K1CC 3SXTD 4XYIA 5EAMA 5EARA 5IJ7E 4TZ4A 3CIKB 5TEEA 4GM9A 4O1QD 3BWSA 5HYNB 5H14A 2I0RA 4FWWA 3PXSD 2P9IC 1MDAH 1OLZA 2UZXB 2AGLA 3RFHA 2B4EA 4PBZA 5EALA 5KDOB 3I8CA 5H17A 4L3HD 1L0QA 4X63B 3B7FA 4GGCA 1JJUB 1R5MA 5K19A 4EWRA 2PBIB 2G99A 2CO0C 3F3PA 2YNNA 5FKTA 2B5LA 4QT8A 2IUQA 3EI3B 4MK0B 3UVNA 3NVQA 4BL0A 3IJ0A 2MTAH 2P9UC 4AEZA 5AMSA 4PXWA 4GM8A 4A0BA 4QQEA 2OVQB 3VH0A 4IMMA 5FKSA 4GGAA 2I3TA 4LG9A 3I7NA 4JSVC 1FWXA 3UKUC 4A7JA 4G56B 1GOTB 3SBRA 3EWEA 3P4FA 3I8EA 1B9XA 1PGUA 4HDJA 1P22A 5CXCA 1NEXB 4JSNC 4Y7RA 3MZKA 2H6NA 4I79A 5EAPA 1K8KC 3JAMg 4GGDA 2XL3A 3RRMC 3AL9A 2Z2NA 4CZVA 5THAA 3DXKC 2OVPB 2Q7QA 5AFU3 3JROA 3UVKA 3F3GA 5I5MA 2CO0A 2HKRA 4FA4D 5IJ8E 2CE8A 2AGXA 1GP2B 2BCJB 3IJ1A 2J55H 2EBSA 4A09A 2P9KC 5I5JA 2CN3A 3JRPA 3JB9L 2OK6A 3PXWD 5EMLB 2BBKH 4JT6C 3FGBA 2H9MA 1U4CA 5CXBA 2AH0A 3MKQA 4U1EI 5JWZA 4J86A 4NSXA 5GXIA 4A2MA 2H6KA 3AFCA 4ZOYA 3J81g 3OL2A 3SWSD 3V9FA 1N6DA 4A0BB 3SJLD 3RFGA 3EG6A 4QL1A 2AH1A 5GMKn 4J79A 2OK4A 2Z2OA 2XYIA 4ERYA 4O9DA 3C99A 4ESGA 3N0DA 5FQDA 5TEFA 5C2WB 3DSMA 3E0CA 4U7AA 3EU7A 5IGQA 4OWRA 2HJ4A 1U2VC 4PC0A 3OKYA 5TF2A 1XIPA 5CXCB 4FAND 4JT5C 2H6QA 3UR4A 3OW8A 4CI8A 2J57G 4UI9R 3I89A 4XYHA 3I2NA 1OMWB 2OVRB 1XHMA 4E54A 3DXMC 4YVDA 4GZ8A 2CN2A 3SVWD 3MMYA 4O45A 4CI1A 2IWKA 3UKRC 4O3UB 3SBPA 5HE3B 2UZYB 2HKMA 4FA5D 1GG2B 1SHYB 3V7DB 5A2Qg 4A09B 1PEVA 1SQJA 2GC7A 5AJAA 5FA5B 4CI3A 5H1MA 4XEIC 2HYEA 1B9YA 4CY2A 4A0AA 3NVXA 2QXVA 2PM6B 1TBGA 5CXBB 5EMKB 3SHFA 3C5MA 3JPXA 5FKQA 2O9KA 5GSAA 1S4UX 3OL2B 5I5IA 4K3JB 3RN1D 1JMZB 3N0EA 4ZOXA 3PSCB 4R7AB 2H3XA 5IGOA 4J84A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z2P A;  4H5J A;  3I7K A;  2W18 A;  4PSX B;  2YNO A;  2IUR A;  4A08 A;  2IUV A;  1RI6 A;  3BG1 A;  3IJC A;  4CY3 A;  3OKY B;  3RSE C;  3PXT D;  4J87 A;  3PVU B;  3VGZ A;  3GRE A;  4ERQ A;  2OJY A;  5HE1 B;  1SQ9 A;  3IIY A;  3PVW B;  3J80 g;  4D0K A;  3ODT A;  2YNP A;  2IWF A;  3SLE D;  4FA1 D;  4E54 B;  2P9P C;  3DWL C;  3KRX B;  2B5N A;  5CYK A;  3W15 A;  2B5M A;  3MXX A;  5HE0 B;  2PM9 A;  4A0A B;  2HES X;  3HFQ A;  4J82 A;  4Z8L A;  4LGN A;  3CFS B;  4JSP C;  4D6V A;  3GFC A;  2XL2 A;  3UVM A;  2PM7 B;  4JXM A;  4X60 B;  5FXY A;  3I7P A;  2YBA A;  4H5I A;  1QNI A;  3ORV D;  3EI2 A;  3EI1 A;  2CNX A;  3OTT A;  2GNQ A;  1PBY B;  1A0R B;  1GXR A;  3A0F A;  3SCY A;  3PSL A;  2IUP A;  4Y5R D;  2XU7 A;  2CE9 A;  3PE7 A;  4CY5 A;  3IKO A;  5FKR A;  4A08 B;  3V5W B;  4JSX C;  1YFQ A;  1MG3 A;  2P9S C;  1JMX B;  4A2L A;  1TYQ C;  2H13 A;  4N14 A;  1K32 A;  3AL8 A;  4J77 A;  5FLX g;  3I7H A;  1Q47 A;  3JZG A;  4E5Z A;  2H9L A;  3ZWL B;  4PNK B;  3JZN A;  4FB1 D;  3UVO A;  2H9P A;  2AGZ A;  1ERJ A;  3MZL A;  4ZOZ A;  3DM0 A;  2GC4 A;  2I3S A;  3RLM D;  4O3T B;  3U4Y A;  2I0T A;  3KRW B;  4ES0 A;  5CYK B;  3C75 H;  4AOW A;  3I7L A;  4JD2 C;  2QC5 A;  5EM2 B;  4LG8 A;  2PM9 B;  3FRX A;  1N6E A;  5EMM B;  3EMH A;  4X61 B;  4GMB A;  3EI4 A;  2P9L C;  4J81 A;  5SXM A;  1MG2 A;  2AQ5 A;  5IC7 A;  4GQ1 A;  3UVL A;  1JOF A;  4L1Q D;  4OZU A;  3K26 A;  3NVN A;  3SFZ A;  4CC9 A;  3K27 A;  3EI2 B;  3EI1 B;  5C2V B;  3L4O D;  1N6F A;  4CI2 A;  3JZH A;  1NR0 A;  5HQG A;  2HJB A;  5HE2 B;  4J8G A;  5B4W A;  3ULE C;  4IA9 A;  4J78 A;  4A11 B;  5GXH A;  4GQ2 P;  4GM3 A;  4J8B A;  4PBY A;  1VYH C;  4PSW B;  2YB8 B;  2YMU A;  5TDH B;  2I0S A;  4L3G D;  3F3F A;  4BUJ C;  3AH8 B;  4ZN4 A;  3AL8 B;  4BH6 A;  2J56 H;  4X3E A;  2H9N A;  1PI6 A;  4J73 A;  3RMZ D;  4FA9 D;  4J0X A;  3FM0 A;  2H47 A;  4E5Z B;  3BG0 A;  5C9Z B;  3EI3 A;  3RN0 D;  5EM2 A;  3I7O A;  4QRJ A;  4CY1 A;  4K3I D;  3OKT A;  5IT9 g;  2TRC B;  4CZX A;  3SBQ A;  3L4M D;  4J0W A;  2AGY A;  5EMJ B;  4ZOV A;  3SN6 B;  2P9N C;  1XKS A;  3IIW A;  4ERZ A;  2H68 A;  2IAA A;  4FAV D;  2AGW A;  4L9O A;  3MKS B;  4GQB B;  2OIZ A;  2G9A A;  3EI4 B;  4FHL A;  3VA6 A;  2HXC A;  4KFM B;  4CZY A;  2H14 A;  3CFV A;  4A11 A;  3C9C A;  3SMR A;  3OKW A;  5K1C C;  3SXT D;  4XYI A;  5EAM A;  5EAR A;  5IJ7 E;  4TZ4 A;  3CIK B;  5TEE A;  4GM9 A;  4O1Q D;  3BWS A;  5HYN B;  5H14 A;  2I0R A;  4FWW A;  3PXS D;  2P9I C;  1MDA H;  1OLZ A;  2UZX B;  2AGL A;  3RFH A;  2B4E A;  4PBZ A;  5EAL A;  5KDO B;  3I8C A;  5H17 A;  4L3H D;  1L0Q A;  4X63 B;  3B7F A;  4GGC A;  1JJU B;  1R5M A;  5K19 A;  4EWR A;  2PBI B;  2G99 A;  2CO0 C;  3F3P A;  2YNN A;  5FKT A;  2B5L A;  4QT8 A;  2IUQ A;  3EI3 B;  4MK0 B;  3UVN A;  3NVQ A;  4BL0 A;  3IJ0 A;  2MTA H;  2P9U C;  4AEZ A;  5AMS A;  4PXW A;  4GM8 A;  4A0B A;  4QQE A;  2OVQ B;  3VH0 A;  4IMM A;  5FKS A;  4GGA A;  2I3T A;  4LG9 A;  3I7N A;  4JSV C;  1FWX A;  3UKU C;  4A7J A;  4G56 B;  1GOT B;  3SBR A;  3EWE A;  3P4F A;  3I8E A;  1B9X A;  1PGU A;  4HDJ A;  1P22 A;  5CXC A;  1NEX B;  4JSN C;  4Y7R A;  3MZK A;  2H6N A;  4I79 A;  5EAP A;  1K8K C;  3JAM g;  4GGD A;  2XL3 A;  3RRM C;  3AL9 A;  2Z2N A;  4CZV A;  5THA A;  3DXK C;  2OVP B;  2Q7Q A;  5AFU 3;  3JRO A;  3UVK A;  3F3G A;  5I5M A;  2CO0 A;  2HKR A;  4FA4 D;  5IJ8 E;  2CE8 A;  2AGX A;  1GP2 B;  2BCJ B;  3IJ1 A;  2J55 H;  2EBS A;  4A09 A;  2P9K C;  5I5J A;  2CN3 A;  3JRP A;  3JB9 L;  2OK6 A;  3PXW D;  5EML B;  2BBK H;  4JT6 C;  3FGB A;  2H9M A;  1U4C A;  5CXB A;  2AH0 A;  3MKQ A;  4U1E I;  5JWZ A;  4J86 A;  4NSX A;  5GXI A;  4A2M A;  2H6K A;  3AFC A;  4ZOY A;  3J81 g;  3OL2 A;  3SWS D;  3V9F A;  1N6D A;  4A0B B;  3SJL D;  3RFG A;  3EG6 A;  4QL1 A;  2AH1 A;  5GMK n;  4J79 A;  2OK4 A;  2Z2O A;  2XYI A;  4ERY A;  4O9D A;  3C99 A;  4ESG A;  3N0D A;  5FQD A;  5TEF A;  5C2W B;  3DSM A;  3E0C A;  4U7A A;  3EU7 A;  5IGQ A;  4OWR A;  2HJ4 A;  1U2V C;  4PC0 A;  3OKY A;  5TF2 A;  1XIP A;  5CXC B;  4FAN D;  4JT5 C;  2H6Q A;  3UR4 A;  3OW8 A;  4CI8 A;  2J57 G;  4UI9 R;  3I89 A;  4XYH A;  3I2N A;  1OMW B;  2OVR B;  1XHM A;  4E54 A;  3DXM C;  4YVD A;  4GZ8 A;  2CN2 A;  3SVW D;  3MMY A;  4O45 A;  4CI1 A;  2IWK A;  3UKR C;  4O3U B;  3SBP A;  5HE3 B;  2UZY B;  2HKM A;  4FA5 D;  1GG2 B;  1SHY B;  3V7D B;  5A2Q g;  4A09 B;  1PEV A;  1SQJ A;  2GC7 A;  5AJA A;  5FA5 B;  4CI3 A;  5H1M A;  4XEI C;  2HYE A;  1B9Y A;  4CY2 A;  4A0A A;  3NVX A;  2QXV A;  2PM6 B;  1TBG A;  5CXB B;  5EMK B;  3SHF A;  3C5M A;  3JPX A;  5FKQ A;  2O9K A;  5GSA A;  1S4U X;  3OL2 B;  5I5I A;  4K3J B;  3RN1 D;  1JMZ B;  3N0E A;  4ZOX A;  3PSC B;  4R7A B;  2H3X A;  5IGO A;  4J84 A; 
#chains in the Genus database with same CATH topology
 2Z2P A;  4H5J A;  3I7K A;  2W18 A;  4PSX B;  2YNO A;  2IUR A;  4A08 A;  2IUV A;  1K3I A;  1RI6 A;  3NIF A;  2VDQ A;  3V4P A;  3BG1 A;  3MVD K;  3IJC A;  4CY3 A;  3OKY B;  3RSE C;  3IUM A;  3PXT D;  4J87 A;  3PVU B;  3VGZ A;  3GRE A;  4ERQ A;  2OJY A;  3NIG A;  5HE1 B;  1SQ9 A;  3IIY A;  3MUO A;  3PVW B;  3J80 g;  4D0K A;  3ODT A;  2YNP A;  2IWF A;  1U8C A;  3SLE D;  4FA1 D;  4E54 B;  2P9P C;  3DWL C;  4NEN A;  3KRX B;  2B5N A;  2VDL A;  5CYK A;  3W15 A;  4AN0 A;  3O4G A;  2B5M A;  3MXX A;  5HE0 B;  2PM9 A;  4A0A B;  2HES X;  3HFQ A;  3GD1 I;  4J82 A;  4Z8L A;  4LGN A;  3CFS B;  4JSP C;  4D6V A;  3GFC A;  2XL2 A;  3UVM A;  2PM7 B;  4JXM A;  1UOO A;  4X60 B;  5FXY A;  3I7P A;  2YBA A;  4H5I A;  1QNI A;  3ORV D;  3EI2 A;  3EI1 A;  4G1M A;  2CNX A;  3OTT A;  4JHN A;  2GNQ A;  1PBY B;  1A0R B;  1GXR A;  4G1E A;  3A0F A;  3SCY A;  1L5G A;  3PSL A;  2IUP A;  4Y5R D;  3ZE0 A;  2XU7 A;  2CE9 A;  3PE7 A;  3V4V A;  4CY5 A;  3IUQ A;  3IKO A;  5FKR A;  4A08 B;  3V5W B;  2BKL A;  3FCS A;  1E8N A;  4NAA A;  1YFQ A;  1MG3 A;  4JSX C;  2P9S C;  1JMX B;  4A2L A;  1TYQ C;  1UOQ A;  2H13 A;  5M61 A;  4N14 A;  1K32 A;  1H2W A;  4L1M A;  3AL8 A;  4J77 A;  5C86 A;  3VI3 A;  5FLX g;  3I7H A;  2HU5 A;  1Q47 A;  3JZG A;  1T2X A;  4IRZ A;  4E5Z A;  2H9L A;  4NC4 A;  3ZWL B;  4PNK B;  3JZN A;  4FB1 D;  3UVO A;  2H9P A;  2AGZ A;  1ERJ A;  3MZL A;  4G55 A;  4ZOZ A;  3DM0 A;  3VI4 A;  2GC4 A;  2EID A;  2I3S A;  3ZE2 A;  3RLM D;  4O3T B;  3U4Y A;  2I0T A;  1YR2 A;  3KRW B;  4ES0 A;  5CYK B;  3C75 H;  4MMZ A;  1M1X A;  4AX4 A;  4AOW A;  3I7L A;  4JD2 C;  2QC5 A;  5EM2 B;  4LG8 A;  2PM9 B;  3FRX A;  1N6E A;  5EMM B;  3EMH A;  4X61 B;  3QHY B;  1QFS A;  4GMB A;  3EI4 A;  4AMY A;  2P9L C;  4J81 A;  5SXM A;  1MG2 A;  5HDB A;  4D9S A;  2AQ5 A;  3K72 A;  5IC7 A;  4GQ1 A;  3UVL A;  1JOF A;  4L1Q D;  4OZU A;  3K26 A;  4WK2 A;  3NVN A;  3SFZ A;  1GOH A;  4CC9 A;  3K27 A;  3EI2 B;  3EI1 B;  5C2V B;  1UTC A;  3L4O D;  1N6F A;  4CI2 A;  3JZH A;  3QI0 A;  4JHP C;  1NR0 A;  5HQG A;  2HJB A;  4DNV A;  5HE2 B;  4MMX A;  4J8G A;  5B4W A;  3ZDY A;  3ULE C;  4IA9 A;  5FFG A;  4J78 A;  4A11 B;  5GXH A;  4GQ2 P;  4GM3 A;  3MUN A;  4J8B A;  4PBY A;  1VYH C;  2VDP A;  4PSW B;  1O6G A;  2YB8 B;  2YMU A;  5TDH B;  2I0S A;  4L3G D;  3F3F A;  4BUJ C;  3AH8 B;  5M5T A;  4ZN4 A;  3IJE A;  3AL8 B;  4BH6 A;  2J56 H;  4X3E A;  2H9N A;  1PI6 A;  4J73 A;  3RMZ D;  4FA9 D;  4J0X A;  3FM0 A;  2H47 A;  4E5Z B;  3BG0 A;  5C9Z B;  3EI3 A;  4RE5 A;  3RN0 D;  5EM2 A;  3I7O A;  4QRJ A;  4CY1 A;  4K3I D;  3OKT A;  5IT9 g;  2TRC B;  4CZX A;  3SBQ A;  3L4M D;  1VZ2 A;  4J0W A;  2AGY A;  5E6R A;  3EQ7 A;  4ZOV A;  2P9N C;  5EMJ B;  3SN6 B;  1XKS A;  3IIW A;  4ERZ A;  2H68 A;  2IAA A;  4FAV D;  2AGW A;  4L9O A;  4UM9 A;  2WQ8 A;  3MKS B;  4GQB B;  2OIZ A;  3IUR A;  2G9A A;  3EI4 B;  4FHL A;  3VA6 A;  2HXC A;  4KFM B;  4CZY A;  2H14 A;  3CFV A;  4A11 A;  2XDW A;  3C9C A;  3SMR A;  3OKW A;  5K1C C;  3SXT D;  4XYI A;  5EAM A;  5EAR A;  5IJ7 E;  4TZ4 A;  3CIK B;  3NID A;  5TEE A;  4GM9 A;  4O1Q D;  3BWS A;  5HYN B;  5H14 A;  2I0R A;  4FWW A;  3PXS D;  2P9I C;  1MDA H;  1OLZ A;  2UZX B;  1QFM A;  1H2Y A;  2AGL A;  3RFH A;  2B4E A;  4PBZ A;  5EAL A;  4BCB A;  3K6S A;  5KDO B;  3I8C A;  5M5V A;  5H17 A;  4L3H D;  1L0Q A;  4X63 B;  3B7F A;  2QR5 A;  4GGC A;  1JV2 A;  3T3P A;  1JJU B;  1BPO A;  1R5M A;  5K19 A;  4EWR A;  2PBI B;  2EIC A;  4BP8 A;  2G99 A;  2CO0 C;  3F3P A;  2YNN A;  5FKT A;  4O02 A;  2B5L A;  4QT8 A;  3OF7 A;  1TYE A;  2IUQ A;  3EI3 B;  4MK0 B;  3UVN A;  4Z7O A;  3NVQ A;  4BL0 A;  3IJ0 A;  2MTA H;  1GOG A;  2P9U C;  4AEZ A;  4BCC A;  5AMS A;  4PXW A;  4GM8 A;  2XZG A;  1JTD B;  3IUJ A;  4A0B A;  4QQE A;  2OVQ B;  3K71 A;  3VH0 A;  4IMM A;  5FKS A;  4GGA A;  2I3T A;  4LG9 A;  3I7N A;  4JSV C;  5M5R A;  4BP9 A;  1FWX A;  3UKU C;  4A7J A;  4G56 B;  1C9L A;  1GOT B;  3SBR A;  3EWE A;  3P4F A;  3EQ8 A;  3I8E A;  1B9X A;  3O4I A;  3DDU A;  1PGU A;  3ZE1 A;  4HDJ A;  5C92 A;  1P22 A;  5CXC A;  1NEX B;  4DNW A;  3KCI A;  4JSN C;  4Y7R A;  3MZK A;  2H6N A;  4I79 A;  1VE7 A;  5EAP A;  1K8K C;  3JAM g;  4GGD A;  2XL3 A;  3RRM C;  2VDO A;  3AL9 A;  2Z2N A;  3O4J A;  4CZV A;  5THA A;  3DXK C;  2OVP B;  2Q7Q A;  5AFU 3;  3JRO A;  2VDN A;  3F3G A;  3UVK A;  4AN1 A;  5I5M A;  2CO0 A;  2VZ1 A;  3GC3 B;  2HKR A;  1A12 A;  2JKX A;  4FA4 D;  5IJ8 E;  2CE8 A;  2AGX A;  1GP2 B;  1O6F A;  3IVM A;  2BCJ B;  3IJ1 A;  2J55 H;  2EBS A;  1H2Z A;  1GOF A;  4A09 A;  2P9K C;  5E6S A;  5I5J A;  2CN3 A;  3JRP A;  1E5T A;  2XE4 A;  3EQ9 A;  3JB9 L;  2OK6 A;  3PXW D;  5EML B;  2BBK H;  4JT6 C;  5FFO A;  3FGB A;  2VDR A;  2H9M A;  1U4C A;  5CXB A;  2AH0 A;  3MKQ A;  4U1E I;  3ZDX A;  5M5S A;  5JWZ A;  2VDK A;  2HU7 A;  1E8M A;  4J86 A;  4NSX A;  5GXI A;  4A2M A;  2H6K A;  3AFC A;  4ZOY A;  3J81 g;  3OL2 A;  3SWS D;  3V9F A;  1N6D A;  4A0B B;  3SJL D;  3RFG A;  3EG6 A;  4BCD A;  1I2M B;  4QL1 A;  2AH1 A;  5GMK n;  4J79 A;  2OK4 A;  1VE6 A;  2Z2O A;  2XYI A;  4ERY A;  4O9D A;  3C99 A;  3ZDZ A;  4DNU A;  4ESG A;  3N0D A;  5FQD A;  2HU8 A;  5TEF A;  5C2W B;  3DSM A;  3E0C A;  4U7A A;  1C9I A;  2VZ3 A;  3EU7 A;  5IGQ A;  4OWR A;  2HJ4 A;  2VDM A;  1U2V C;  4MMY A;  4PC0 A;  4UM8 A;  3OKY A;  5TF2 A;  2VC2 A;  3FCU A;  4WK4 A;  1XIP A;  5CXC B;  4FAN D;  4JT5 C;  3T3M A;  2H6Q A;  3IUL A;  3UR4 A;  3OW8 A;  4Z7Q A;  4NBM A;  4CI8 A;  2J57 G;  4UI9 R;  3IUN A;  3I89 A;  4XYH A;  5M5U A;  3I2N A;  1OMW B;  2OVR B;  1XHM A;  4E54 A;  3DXM C;  4YVD A;  1UOP A;  2CN2 A;  4GZ8 A;  3SVW D;  3MMY A;  4O45 A;  4CI1 A;  2IWK A;  3UKR C;  2QZP A;  4O3U B;  3SBP A;  5HE3 B;  2UZY B;  2EIB A;  2HKM A;  4FA5 D;  1GG2 B;  1SHY B;  3V7D B;  4WJK A;  5A2Q g;  4A09 B;  1PEV A;  1SQJ A;  2GC7 A;  1H2X A;  5AJA A;  5FA5 B;  4CI3 A;  5H1M A;  4XEI C;  2HYE A;  1B9Y A;  4CY2 A;  4A0A A;  5E6U A;  3NVX A;  4WK0 A;  2QXV A;  2PM6 B;  4AMZ A;  1TBG A;  5CXB B;  4RE6 A;  5EMK B;  3SHF A;  2EIE A;  3C5M A;  3JPX A;  1VZ3 A;  4QAM A;  5FKQ A;  2O9K A;  3O4H A;  5GSA A;  1S4U X;  3OL2 B;  5I5I A;  4K3J B;  4O2W A;  4Z7N A;  3RN1 D;  1JMZ B;  3N0E A;  4ZOX A;  3PSC B;  4R7A B;  2H3X A;  5IGO A;  4J84 A; 
#chains in the Genus database with same CATH homology
 2Z2P A;  4H5J A;  3I7K A;  2W18 A;  4PSX B;  2YNO A;  2IUR A;  4A08 A;  2IUV A;  1RI6 A;  3BG1 A;  3IJC A;  4CY3 A;  3OKY B;  3RSE C;  3PXT D;  4J87 A;  3PVU B;  3VGZ A;  3GRE A;  4ERQ A;  2OJY A;  5HE1 B;  1SQ9 A;  3IIY A;  3PVW B;  3J80 g;  4D0K A;  3ODT A;  2YNP A;  2IWF A;  3SLE D;  4FA1 D;  4E54 B;  2P9P C;  3DWL C;  3KRX B;  2B5N A;  5CYK A;  3W15 A;  2B5M A;  3MXX A;  5HE0 B;  2PM9 A;  4A0A B;  2HES X;  3HFQ A;  4J82 A;  4Z8L A;  4LGN A;  3CFS B;  4JSP C;  4D6V A;  3GFC A;  2XL2 A;  3UVM A;  2PM7 B;  4JXM A;  4X60 B;  5FXY A;  3I7P A;  2YBA A;  4H5I A;  1QNI A;  3ORV D;  3EI2 A;  3EI1 A;  2CNX A;  3OTT A;  2GNQ A;  1PBY B;  1A0R B;  1GXR A;  3A0F A;  3SCY A;  3PSL A;  2IUP A;  4Y5R D;  2XU7 A;  2CE9 A;  3PE7 A;  4CY5 A;  3IKO A;  5FKR A;  4A08 B;  3V5W B;  4JSX C;  1YFQ A;  1MG3 A;  2P9S C;  1JMX B;  4A2L A;  1TYQ C;  2H13 A;  4N14 A;  1K32 A;  3AL8 A;  4J77 A;  5FLX g;  3I7H A;  1Q47 A;  3JZG A;  4E5Z A;  2H9L A;  3ZWL B;  4PNK B;  3JZN A;  4FB1 D;  3UVO A;  2H9P A;  2AGZ A;  1ERJ A;  3MZL A;  4ZOZ A;  3DM0 A;  2GC4 A;  2I3S A;  3RLM D;  4O3T B;  3U4Y A;  2I0T A;  3KRW B;  4ES0 A;  5CYK B;  3C75 H;  4AOW A;  3I7L A;  4JD2 C;  2QC5 A;  5EM2 B;  4LG8 A;  2PM9 B;  3FRX A;  1N6E A;  5EMM B;  3EMH A;  4X61 B;  4GMB A;  3EI4 A;  2P9L C;  4J81 A;  5SXM A;  1MG2 A;  2AQ5 A;  5IC7 A;  4GQ1 A;  3UVL A;  1JOF A;  4L1Q D;  4OZU A;  3K26 A;  3NVN A;  3SFZ A;  4CC9 A;  3K27 A;  3EI2 B;  3EI1 B;  5C2V B;  3L4O D;  1N6F A;  4CI2 A;  3JZH A;  1NR0 A;  5HQG A;  2HJB A;  5HE2 B;  4J8G A;  5B4W A;  3ULE C;  4IA9 A;  4J78 A;  4A11 B;  5GXH A;  4GQ2 P;  4GM3 A;  4J8B A;  4PBY A;  1VYH C;  4PSW B;  2YB8 B;  2YMU A;  5TDH B;  2I0S A;  4L3G D;  3F3F A;  4BUJ C;  3AH8 B;  4ZN4 A;  3AL8 B;  4BH6 A;  2J56 H;  4X3E A;  2H9N A;  1PI6 A;  4J73 A;  3RMZ D;  4FA9 D;  4J0X A;  3FM0 A;  2H47 A;  4E5Z B;  3BG0 A;  5C9Z B;  3EI3 A;  3RN0 D;  5EM2 A;  3I7O A;  4QRJ A;  4CY1 A;  4K3I D;  3OKT A;  5IT9 g;  2TRC B;  4CZX A;  3SBQ A;  3L4M D;  4J0W A;  2AGY A;  5EMJ B;  4ZOV A;  3SN6 B;  2P9N C;  1XKS A;  3IIW A;  4ERZ A;  2H68 A;  2IAA A;  4FAV D;  2AGW A;  4L9O A;  3MKS B;  4GQB B;  2OIZ A;  2G9A A;  3EI4 B;  4FHL A;  3VA6 A;  2HXC A;  4KFM B;  4CZY A;  2H14 A;  3CFV A;  4A11 A;  3C9C A;  3SMR A;  3OKW A;  5K1C C;  3SXT D;  4XYI A;  5EAM A;  5EAR A;  5IJ7 E;  4TZ4 A;  3CIK B;  5TEE A;  4GM9 A;  4O1Q D;  3BWS A;  5HYN B;  5H14 A;  2I0R A;  4FWW A;  3PXS D;  2P9I C;  1MDA H;  1OLZ A;  2UZX B;  2AGL A;  3RFH A;  2B4E A;  4PBZ A;  5EAL A;  5KDO B;  3I8C A;  5H17 A;  4L3H D;  1L0Q A;  4X63 B;  3B7F A;  4GGC A;  1JJU B;  1R5M A;  5K19 A;  4EWR A;  2PBI B;  2G99 A;  2CO0 C;  3F3P A;  2YNN A;  5FKT A;  2B5L A;  4QT8 A;  2IUQ A;  3EI3 B;  4MK0 B;  3UVN A;  3NVQ A;  4BL0 A;  3IJ0 A;  2MTA H;  2P9U C;  4AEZ A;  5AMS A;  4PXW A;  4GM8 A;  4A0B A;  4QQE A;  2OVQ B;  3VH0 A;  4IMM A;  5FKS A;  4GGA A;  2I3T A;  4LG9 A;  3I7N A;  4JSV C;  1FWX A;  3UKU C;  4A7J A;  4G56 B;  1GOT B;  3SBR A;  3EWE A;  3P4F A;  3I8E A;  1B9X A;  1PGU A;  4HDJ A;  1P22 A;  5CXC A;  1NEX B;  4JSN C;  4Y7R A;  3MZK A;  2H6N A;  4I79 A;  5EAP A;  1K8K C;  3JAM g;  4GGD A;  2XL3 A;  3RRM C;  3AL9 A;  2Z2N A;  4CZV A;  5THA A;  3DXK C;  2OVP B;  2Q7Q A;  5AFU 3;  3JRO A;  3UVK A;  3F3G A;  5I5M A;  2CO0 A;  2HKR A;  4FA4 D;  5IJ8 E;  2CE8 A;  2AGX A;  1GP2 B;  2BCJ B;  3IJ1 A;  2J55 H;  2EBS A;  4A09 A;  2P9K C;  5I5J A;  2CN3 A;  3JRP A;  3JB9 L;  2OK6 A;  3PXW D;  5EML B;  2BBK H;  4JT6 C;  3FGB A;  2H9M A;  1U4C A;  5CXB A;  2AH0 A;  3MKQ A;  4U1E I;  5JWZ A;  4J86 A;  4NSX A;  5GXI A;  4A2M A;  2H6K A;  3AFC A;  4ZOY A;  3J81 g;  3OL2 A;  3SWS D;  3V9F A;  1N6D A;  4A0B B;  3SJL D;  3RFG A;  3EG6 A;  4QL1 A;  2AH1 A;  5GMK n;  4J79 A;  2OK4 A;  2Z2O A;  2XYI A;  4ERY A;  4O9D A;  3C99 A;  4ESG A;  3N0D A;  5FQD A;  5TEF A;  5C2W B;  3DSM A;  3E0C A;  4U7A A;  3EU7 A;  5IGQ A;  4OWR A;  2HJ4 A;  1U2V C;  4PC0 A;  3OKY A;  5TF2 A;  1XIP A;  5CXC B;  4FAN D;  4JT5 C;  2H6Q A;  3UR4 A;  3OW8 A;  4CI8 A;  2J57 G;  4UI9 R;  3I89 A;  4XYH A;  3I2N A;  1OMW B;  2OVR B;  1XHM A;  4E54 A;  3DXM C;  4YVD A;  4GZ8 A;  2CN2 A;  3SVW D;  3MMY A;  4O45 A;  4CI1 A;  2IWK A;  3UKR C;  4O3U B;  3SBP A;  5HE3 B;  2UZY B;  2HKM A;  4FA5 D;  1GG2 B;  1SHY B;  3V7D B;  5A2Q g;  4A09 B;  1PEV A;  1SQJ A;  2GC7 A;  5AJA A;  5FA5 B;  4CI3 A;  5H1M A;  4XEI C;  2HYE A;  1B9Y A;  4CY2 A;  4A0A A;  3NVX A;  2QXV A;  2PM6 B;  1TBG A;  5CXB B;  5EMK B;  3SHF A;  3C5M A;  3JPX A;  5FKQ A;  2O9K A;  5GSA A;  1S4U X;  3OL2 B;  5I5I A;  4K3J B;  3RN1 D;  1JMZ B;  3N0E A;  4ZOX A;  3PSC B;  4R7A B;  2H3X A;  5IGO A;  4J84 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...