3L4OD

Crystal structure of the maug/pre-methylamine dehydrogenase complex after treatment with hydrogen peroxide
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords Methylamine utilization protein mauG
publication title In crystallo posttranslational modification within a MauG/pre-methylamine dehydrogenase complex.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 94
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3l4oD00
3I8CA 4CI1A 3OW8A 1GXRA 4J8GA 4UI9R 5B4WA 1PI6A 3UKUC 3EWEA 4J0WA 2I0TA 4A2LA 4FA9D 5CXCA 2P9NC 3VH0A 4A08B 3OKYA 2Z2OA 4E54B 2J57G 4O9DA 4PBZA 2P9LC 3MKSB 5H17A 3NVXA 3JROA 3L4MD 2G9AA 4CI3A 3JAMg 2AH0A 1N6FA 3J80g 2UZYB 3IJ1A 3SHFA 3EI3A 4A2MA 4FA4D 4L3GD 2PM7B 1MDAH 3IIYA 3C75H 5EAMA 2GC4A 3I7OA 4PSWB 2H47A 3E0CA 5FKTA 2H14A 5GSAA 4JT6C 3CIKB 3OL2A 1B9XA 4LGNA 4CI8A 2IWKA 5CXBB 5IGOA 1S4UX 4CY2A 3I7KA 3UKRC 4PNKB 4O3TB 4TZ4A 4D0KA 5TEFA 3UVNA 3JB9L 3RN1D 4JXMA 3F3FA 3RRMC 5CYKA 4BH6A 5GMKn 3C99A 3EI2B 1VYHC 4L1QD 4E5ZB 4QT8A 2HESX 2PM9B 5FQDA 4EWRA 3EI4A 5GXIA 2GNQA 5FLXg 3BG1A 1GG2B 3MXXA 3FM0A 1ERJA 4ZOXA 3U4YA 3PXWD 2HKMA 4FAND 3B7FA 3P4FA 4ZOYA 5TEEA 3FGBA 3FRXA 1MG2A 4CY3A 2H9NA 1NEXB 4LG8A 5FA5B 3SCYA 5KDOB 4O3UB 2J56H 5EM2A 3JZNA 5IJ8E 2BCJB 4NSXA 2TRCB 4GM9A 4A09A 5C9ZB 3K27A 4I79A 2HKRA 2AQ5A 2P9KC 2CE8A 4J0XA 3MZKA 5I5JA 3UVLA 4FA5D 5EMLB 2HYEA 2B4EA 1TYQC 3IKOA 3V7DB 2PBIB 5CXCB 3C5MA 1L0QA 3BWSA 4H5JA 4R7AB 3ZWLB 4QRJA 3OKYB 4HDJA 2IUQA 3UVKA 1PEVA 1N6DA 4ESGA 3V9FA 5IJ7E 3JRPA 4J84A 2CN3A 5IC7A 3MZLA 1XIPA 3PXSD 4LG9A 4ERYA 3EI1A 5A2Qg 4J8BA 3JZHA 2OK6A 3EI3B 3DSMA 2OVPB 3DXMC 1GOTB 1QNIA 4GGCA 2H6NA 3PE7A 2YNNA 4BUJC 1Q47A 3L4OD 4GGAA 3J81g 2G99A 1FWXA 1U4CA 3OL2B 3RMZD 4XYIA 3SXTD 2YNPA 5FKQA 3NVNA 1PBYB 2HXCA 3OKWA 4GQBB 4Y5RD 3AL8A 2IWFA 4JT5C 2HJBA 1RI6A 3A0FA 3W15A 3KRXB 5IGQA 5FXYA 4FAVD 1U2VC 3PSLA 3CFVA 4ZOZA 4GQ1A 2IUPA 4FB1D 5GXHA 4QL1A 2B5NA 2CNXA 4JD2C 2H6QA 5CYKB 4Z8LA 4A0AA 2AGYA 3I7LA 2H68A 2QC5A 2W18A 5EMMB 4BL0A 4J79A 4A11B 4YVDA 3RSEC 1YFQA 2UZXB 3RLMD 2AGWA 3GFCA 3F3GA 3PSCB 3SBPA 4J73A 3SFZA 3EI4B 4JSNC 4JSXC 5SXMA 3SLED 5K19A 4PBYA 4ZOVA 2OJYA 2CE9A 2H13A 3IIWA 4A0BA 5HYNB 3MKQA 2XU7A 4XYHA 3DWLC 4CZYA 1SHYB 5TF2A 2XYIA 4ES0A 1A0RB 2H6KA 5IT9g 1SQJA 1JJUB 4GM8A 4ERZA 5I5MA 1TBGA 2YBAA 3I8EA 3SJLD 3NVQA 4GGDA 2CO0C 3RN0D 5EM2B 3PVUB 3JZGA 3I89A 4J78A 4CI2A 5HE1B 2Z2NA 4A09B 2GC7A 3CFSB 4J77A 4PSXB 4IA9A 4X61B 2P9UC 2AGLA 2H9LA 1B9YA 4JSVC 1K8KC 4Y7RA 3AH8B 2CO0A 2YNOA 3SWSD 4U7AA 2QXVA 2I0RA 3DM0A 4J86A 2AGXA 5FKRA 3V5WB 5EMJB 3JPXA 2I3TA 3PVWB 3KRWB 5H14A 3EU7A 3PXTD 4FA1D 2I0SA 2P9SC 4OWRA 4PXWA 4AOWA 3SVWD 2H3XA 3EI1B 2J55H 2P9PC 5H1MA 4CZXA 3HFQA 2IAAA 4ERQA 5FKSA 2B5MA 1OMWB 4IMMA 3UR4A 3VA6A 1SQ9A 3I7NA 4O1QD 4X60B 3N0EA 2B5LA 5TDHB 2H9MA 3I2NA 4N14A 3OTTA 4A08A 3AL8B 4CZVA 3I7HA 4E54A 1XHMA 4OZUA 2BBKH 3DXKC 5AFU3 5C2VB 3SBQA 3F3PA 4U1EI 1K32A 3IJ0A 4H5IA 3ULEC 4A0AB 1N6EA 3RFHA 4J81A 2EBSA 5C2WB 4GQ2P 4GM3A 4X63B 2XL3A 3C9CA 3IJCA 4PC0A 3SMRA 2OK4A 3EG6A 5AJAA 5K1CC 3RFGA 3BG0A 4A0BB 2OVQB 3GREA 3MMYA 4FHLA 4MK0B 5CXBA 2P9IC 2XL2A 1JMXB 5THAA 3OKTA 4XEIC 4A7JA 3UVMA 1JOFA 2Q7QA 1PGUA 2AGZA 4CY5A 2AH1A 4JSPC 4A11A 3EMHA 4G56B 5JWZA 5AMSA 5EARA 4CC9A 3SBRA 4AEZA 2OVRB 2PM6B 2OIZA 2IURA 3ORVD 3EI2A 2YB8B 4K3ID 2H9PA 5EAPA 5HE3B 1MG3A 4E5ZA 5I5IA 2PM9A 3SN6B 1R5MA 3N0DA 4KFMB 4O45A 2O9KA 3K26A 2MTAH 3AFCA 4J82A 5HQGA 4GMBA 2I3SA 2YMUA 4D6VA 1JMZB 1NR0A 4QQEA 3I7PA 3ODTA 4K3JB 2HJ4A 5HE2B 4CY1A 2IUVA 1P22A 3UVOA 5HE0B 4FWWA 2CN2A 1XKSA 2Z2PA 4J87A 4GZ8A 3AL9A 4L3HD 1GP2B 3VGZA 5EMKB 1OLZA 4ZN4A 5EALA 4X3EA 4L9OA
chains in the Genus database with same CATH superfamily
4AMZA 4BCCA 3I8CA 4CI1A 3OW8A 1GXRA 2VZ3A 4J8GA 4UI9R 1PI6A 5B4WA 3UKUC 2HU5A 3EWEA 3O4IA 4J0WA 2I0TA 4A2LA 4FA9D 4AX4A 5CXCA 2P9NC 3VH0A 4A08B 4G1MA 3OKYA 2Z2OA 4WK0A 4E54B 2J57G 4O9DA 4PBZA 2P9LC 3MKSB 5H17A 3NVXA 2HU8A 3ZDYA 3JROA 3L4MD 2G9AA 4CI3A 3JAMg 2AH0A 1N6FA 3J80g 1VE7A 2UZYB 3IJ1A 4RE6A 3SHFA 1L5GA 3EI3A 4A2MA 4WJKA 4FA4D 4L3GD 2PM7B 1MDAH 3IIYA 3C75H 5EAMA 2GC4A 3I7OA 1U8CA 3MUNA 4PSWB 3IUMA 4O02A 2H47A 3E0CA 3MVDK 5FKTA 2H14A 5GSAA 4BP8A 4JT6C 3CIKB 3OL2A 5C92A 1B9XA 4LGNA 4CI8A 2IWKA 5CXBB 5IGOA 1S4UX 4CY2A 3I7KA 3UKRC 4PNKB 4O3TB 4DNUA 4TZ4A 2HU7A 3O4HA 4D0KA 5TEFA 3OF7A 3UVNA 4DNVA 2VDOA 3JB9L 3RN1D 4JXMA 1BPOA 1H2ZA 3F3FA 4JHNA 3RRMC 3ZE0A 5CYKA 4BH6A 5GMKn 3DDUA 4UM8A 3C99A 3EI2B 1VYHC 4L1QD 4E5ZB 4BP9A 4QT8A 2HESX 2PM9B 2XE4A 5FQDA 4EWRA 3EI4A 5GXIA 2GNQA 5FLXg 3BG1A 5C86A 1GG2B 2VZ1A 3MXXA 3FM0A 1ERJA 4ZOXA 2VDMA 3U4YA 3PXWD 2HKMA 4FAND 3B7FA 3P4FA 4ZOYA 1GOHA 5TEEA 3FGBA 3FRXA 1MG2A 4CY3A 2H9NA 1NEXB 4LG8A 5FA5B 3SCYA 5KDOB 4O3UB 3IULA 2J56H 5EM2A 3JZNA 5IJ8E 2BCJB 1GOFA 4NSXA 2TRCB 4GM9A 5M5SA 4A09A 1UOPA 5C9ZB 3K27A 4I79A 2HKRA 2AQ5A 2P9KC 2CE8A 4J0XA 3MZKA 2XZGA 5I5JA 3UVLA 4FA5D 5EMLB 2HYEA 2B4EA 3K6SA 1TYQC 3IKOA 3V7DB 2PBIB 5CXCB 3C5MA 1L0QA 3BWSA 4H5JA 4R7AB 5M5RA 3FCSA 4QRJA 3OKYB 4HDJA 3ZWLB 5FFGA 2IUQA 3UVKA 1PEVA 4Z7QA 1N6DA 1M1XA 4ESGA 3V9FA 5IJ7E 3JRPA 4J84A 2CN3A 4WK4A 3MZLA 1XIPA 5IC7A 3T3PA 4JHPC 3PXSD 4LG9A 4ERYA 3EI1A 2VDQA 5A2Qg 4J8BA 3JZHA 2OK6A 3EI3B 3DSMA 2OVPB 3DXMC 1GOTB 1QNIA 4BCBA 4G55A 4GGCA 2H6NA 3PE7A 1VZ2A 2YNNA 2BKLA 4BUJC 1Q47A 4AN1A 3L4OD 4GGAA 4NBMA 3J81g 2G99A 3IUNA 3ZDZA 1FWXA 1U4CA 3OL2B 3RMZD 4XYIA 3SXTD 2YNPA 1JV2A 5FKQA 3NVNA 2VDPA 1PBYB 2HXCA 3OKWA 4GQBB 3K71A 2EIBA 4Y5RD 3AL8A 2IWFA 4JT5C 2HJBA 2WQ8A 1H2XA 1RI6A 3A0FA 3KRXB 3W15A 5IGQA 5FXYA 1H2YA 4FAVD 5FFOA 1U2VC 3PSLA 3CFVA 4ZOZA 4GQ1A 2IUPA 4FB1D 5GXHA 4QL1A 2B5NA 2CNXA 4JD2C 2H6QA 5CYKB 4Z8LA 4A0AA 2AGYA 3I7LA 2H68A 2QC5A 2W18A 1H2WA 5EMMB 4BL0A 4J79A 4A11B 4YVDA 3RSEC 1YFQA 2UZXB 3RLMD 2AGWA 3GFCA 3IJEA 3F3GA 3PSCB 3SBPA 4J73A 3SFZA 5M5TA 3EI4B 4JSNC 4JSXC 5SXMA 3SLED 5K19A 4PBYA 4ZOVA 2OJYA 2CE9A 2H13A 2EICA 3IIWA 3NIFA 4A0BA 5HYNB 3MKQA 2XU7A 4XYHA 5E6SA 3DWLC 4CZYA 1SHYB 5TF2A 2XYIA 3FCUA 2EIEA 1UOQA 4ES0A 1A0RB 2H6KA 5IT9g 1SQJA 4NAAA 1JJUB 4GM8A 4ERZA 5I5MA 1TBGA 3EQ9A 2YBAA 3I8EA 3VI3A 3SJLD 3NVQA 2VC2A 4GGDA 2CO0C 3RN0D 5EM2B 3PVUB 3ZE1A 3JZGA 3I89A 1A12A 4J78A 4CI2A 5HE1B 2VDNA 2Z2NA 1UOOA 4A09B 3IUJA 2GC7A 3CFSB 4J77A 4PSXB 4AN0A 4RE5A 4IA9A 4X61B 2P9UC 2AGLA 4L1MA 2H9LA 1B9YA 4JSVC 1K8KC 4Y7RA 3AH8B 2CO0A 3MUOA 2YNOA 3SWSD 4U7AA 2QXVA 2I0RA 3DM0A 3IVMA 3GD1I 2AGXA 3GC3B 4J86A 4NENA 5FKRA 3VI4A 3V5WB 5EMJB 4DNWA 4QAMA 1TYEA 3JPXA 2I3TA 4MMYA 3PVWB 3KRWB 5H14A 3EU7A 3PXTD 4FA1D 1E8MA 2JKXA 2I0SA 2P9SC 4OWRA 4PXWA 3QI0A 4AOWA 3O4JA 3SVWD 1E5TA 2H3XA 3EI1B 4D9SA 2J55H 2P9PC 5H1MA 4CZXA 3HFQA 2IAAA 4ERQA 5FKSA 2B5MA 1OMWB 5M5VA 4IMMA 3UR4A 3VA6A 1O6FA 3NIDA 1VZ3A 1SQ9A 3I7NA 4O1QD 4X60B 3N0EA 2B5LA 2VDLA 5TDHB 2H9MA 3I2NA 5M5UA 4N14A 3OTTA 4A08A 3AL8B 4CZVA 3NIGA 3I7HA 4E54A 1XHMA 1E8NA 4OZUA 2BBKH 3DXKC 5AFU3 5C2VB 3SBQA 3F3PA 3V4PA 4U1EI 1K32A 3IJ0A 4H5IA 4UM9A 3ULEC 4A0AB 1N6EA 4MMXA 3RFHA 4J81A 2EBSA 5C2WB 3EQ8A 4GQ2P 4GM3A 4X63B 1GOGA 2XL3A 2VDRA 4WK2A 3C9CA 3IJCA 4PC0A 3SMRA 2OK4A 3EG6A 5AJAA 3QHYB 4IRZA 3V4VA 4AMYA 3KCIA 4NC4A 5K1CC 3RFGA 1VE6A 5E6UA 3BG0A 5M61A 4Z7NA 4A0BB 1O6GA 2QR5A 2OVQB 3ZE2A 1QFMA 3GREA 3MMYA 4FHLA 4MK0B 5CXBA 2P9IC 2XL2A 1JMXB 5THAA 3OKTA 1I2MB 4XEIC 4A7JA 3O4GA 3UVMA 1JOFA 2Q7QA 3T3MA 4G1EA 1JTDB 1PGUA 2AGZA 4CY5A 3IURA 2AH1A 1UTCA 2QZPA 4JSPC 1YR2A 5E6RA 4A11A 3EMHA 4G56B 5JWZA 5AMSA 5EARA 4CC9A 3SBRA 4AEZA 3K72A 2OVRB 3ZDXA 2PM6B 2OIZA 2IURA 3ORVD 3EI2A 2YB8B 1K3IA 2H9PA 4K3ID 5EAPA 5HE3B 1MG3A 4E5ZA 2XDWA 5I5IA 2PM9A 3IUQA 3SN6B 1R5MA 3N0DA 4BCDA 4KFMB 4O45A 2O9KA 3K26A 2MTAH 5HDBA 3AFCA 1T2XA 4J82A 5HQGA 4GMBA 4Z7OA 2I3SA 2YMUA 4D6VA 1JMZB 1NR0A 2VDKA 4QQEA 3I7PA 3ODTA 4K3JB 2HJ4A 5HE2B 4CY1A 1QFSA 2IUVA 1C9IA 1P22A 3UVOA 5HE0B 4FWWA 2CN2A 1XKSA 2Z2PA 4J87A 4GZ8A 3AL9A 4L3HD 1GP2B 3VGZA 4MMZA 1C9LA 2EIDA 5EMKB 1OLZA 4O2WA 3EQ7A 4ZN4A 5EALA 4X3EA 4L9OA
chains in the Genus database with same CATH topology
3I8CA 4CI1A 3OW8A 1GXRA 4J8GA 4UI9R 5B4WA 1PI6A 3UKUC 3EWEA 4J0WA 2I0TA 4A2LA 4FA9D 5CXCA 2P9NC 3VH0A 4A08B 3OKYA 2Z2OA 4E54B 2J57G 4O9DA 4PBZA 2P9LC 3MKSB 5H17A 3NVXA 3JROA 3L4MD 2G9AA 4CI3A 3JAMg 2AH0A 1N6FA 3J80g 2UZYB 3IJ1A 3SHFA 3EI3A 4A2MA 4FA4D 4L3GD 2PM7B 1MDAH 3IIYA 3C75H 5EAMA 2GC4A 3I7OA 4PSWB 2H47A 3E0CA 5FKTA 2H14A 5GSAA 4JT6C 3CIKB 3OL2A 1B9XA 4LGNA 4CI8A 2IWKA 5CXBB 5IGOA 1S4UX 4CY2A 3I7KA 3UKRC 4PNKB 4O3TB 4TZ4A 4D0KA 5TEFA 3UVNA 3JB9L 3RN1D 4JXMA 3F3FA 3RRMC 5CYKA 4BH6A 5GMKn 3C99A 3EI2B 1VYHC 4L1QD 4E5ZB 4QT8A 2HESX 2PM9B 5FQDA 4EWRA 3EI4A 5GXIA 2GNQA 5FLXg 3BG1A 1GG2B 3MXXA 3FM0A 1ERJA 4ZOXA 3U4YA 3PXWD 2HKMA 4FAND 3B7FA 3P4FA 4ZOYA 5TEEA 3FGBA 3FRXA 1MG2A 4CY3A 2H9NA 1NEXB 4LG8A 5FA5B 3SCYA 5KDOB 4O3UB 2J56H 5EM2A 3JZNA 5IJ8E 2BCJB 4NSXA 2TRCB 4GM9A 4A09A 5C9ZB 3K27A 4I79A 2HKRA 2AQ5A 2P9KC 2CE8A 4J0XA 3MZKA 5I5JA 3UVLA 4FA5D 5EMLB 2HYEA 2B4EA 1TYQC 3IKOA 3V7DB 2PBIB 5CXCB 3C5MA 1L0QA 3BWSA 4H5JA 4R7AB 3ZWLB 4QRJA 3OKYB 4HDJA 2IUQA 3UVKA 1PEVA 1N6DA 4ESGA 3V9FA 5IJ7E 3JRPA 4J84A 2CN3A 5IC7A 3MZLA 1XIPA 3PXSD 4LG9A 4ERYA 3EI1A 5A2Qg 4J8BA 3JZHA 2OK6A 3EI3B 3DSMA 2OVPB 3DXMC 1GOTB 1QNIA 4GGCA 2H6NA 3PE7A 2YNNA 4BUJC 1Q47A 3L4OD 4GGAA 3J81g 2G99A 1FWXA 1U4CA 3OL2B 3RMZD 4XYIA 3SXTD 2YNPA 5FKQA 3NVNA 1PBYB 2HXCA 3OKWA 4GQBB 4Y5RD 3AL8A 2IWFA 4JT5C 2HJBA 1RI6A 3A0FA 3W15A 3KRXB 5IGQA 5FXYA 4FAVD 1U2VC 3PSLA 3CFVA 4ZOZA 4GQ1A 2IUPA 4FB1D 5GXHA 4QL1A 2B5NA 2CNXA 4JD2C 2H6QA 5CYKB 4Z8LA 4A0AA 2AGYA 3I7LA 2H68A 2QC5A 2W18A 5EMMB 4BL0A 4J79A 4A11B 4YVDA 3RSEC 1YFQA 2UZXB 3RLMD 2AGWA 3GFCA 3F3GA 3PSCB 3SBPA 4J73A 3SFZA 3EI4B 4JSNC 4JSXC 5SXMA 3SLED 5K19A 4PBYA 4ZOVA 2OJYA 2CE9A 2H13A 3IIWA 4A0BA 5HYNB 3MKQA 2XU7A 4XYHA 3DWLC 4CZYA 1SHYB 5TF2A 2XYIA 4ES0A 1A0RB 2H6KA 5IT9g 1SQJA 1JJUB 4GM8A 4ERZA 5I5MA 1TBGA 2YBAA 3I8EA 3SJLD 3NVQA 4GGDA 2CO0C 3RN0D 5EM2B 3PVUB 3JZGA 3I89A 4J78A 4CI2A 5HE1B 2Z2NA 4A09B 2GC7A 3CFSB 4J77A 4PSXB 4IA9A 4X61B 2P9UC 2AGLA 2H9LA 1B9YA 4JSVC 1K8KC 4Y7RA 3AH8B 2CO0A 2YNOA 3SWSD 4U7AA 2QXVA 2I0RA 3DM0A 4J86A 2AGXA 5FKRA 3V5WB 5EMJB 3JPXA 2I3TA 3PVWB 3KRWB 5H14A 3EU7A 3PXTD 4FA1D 2I0SA 2P9SC 4OWRA 4PXWA 4AOWA 3SVWD 2H3XA 3EI1B 2J55H 2P9PC 5H1MA 4CZXA 3HFQA 2IAAA 4ERQA 5FKSA 2B5MA 1OMWB 4IMMA 3UR4A 3VA6A 1SQ9A 3I7NA 4O1QD 4X60B 3N0EA 2B5LA 5TDHB 2H9MA 3I2NA 4N14A 3OTTA 4A08A 3AL8B 4CZVA 3I7HA 4E54A 1XHMA 4OZUA 2BBKH 3DXKC 5AFU3 5C2VB 3SBQA 3F3PA 4U1EI 1K32A 3IJ0A 4H5IA 3ULEC 4A0AB 1N6EA 3RFHA 4J81A 2EBSA 5C2WB 4GQ2P 4GM3A 4X63B 2XL3A 3C9CA 3IJCA 4PC0A 3SMRA 2OK4A 3EG6A 5AJAA 5K1CC 3RFGA 3BG0A 4A0BB 2OVQB 3GREA 3MMYA 4FHLA 4MK0B 5CXBA 2P9IC 2XL2A 1JMXB 5THAA 3OKTA 4XEIC 4A7JA 3UVMA 1JOFA 2Q7QA 1PGUA 2AGZA 4CY5A 2AH1A 4JSPC 4A11A 3EMHA 4G56B 5JWZA 5AMSA 5EARA 4CC9A 3SBRA 4AEZA 2OVRB 2PM6B 2OIZA 2IURA 3ORVD 3EI2A 2YB8B 4K3ID 2H9PA 5EAPA 5HE3B 1MG3A 4E5ZA 5I5IA 2PM9A 3SN6B 1R5MA 3N0DA 4KFMB 4O45A 2O9KA 3K26A 2MTAH 3AFCA 4J82A 5HQGA 4GMBA 2I3SA 2YMUA 4D6VA 1JMZB 1NR0A 4QQEA 3I7PA 3ODTA 4K3JB 2HJ4A 5HE2B 4CY1A 2IUVA 1P22A 3UVOA 5HE0B 4FWWA 2CN2A 1XKSA 2Z2PA 4J87A 4GZ8A 3AL9A 4L3HD 1GP2B 3VGZA 5EMKB 1OLZA 4ZN4A 5EALA 4X3EA 4L9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I8C A;  4CI1 A;  3OW8 A;  1GXR A;  4J8G A;  4UI9 R;  5B4W A;  1PI6 A;  3UKU C;  3EWE A;  4J0W A;  2I0T A;  4A2L A;  4FA9 D;  5CXC A;  2P9N C;  3VH0 A;  4A08 B;  3OKY A;  2Z2O A;  4E54 B;  2J57 G;  4O9D A;  4PBZ A;  2P9L C;  3MKS B;  5H17 A;  3NVX A;  3JRO A;  3L4M D;  2G9A A;  4CI3 A;  3JAM g;  2AH0 A;  1N6F A;  3J80 g;  2UZY B;  3IJ1 A;  3SHF A;  3EI3 A;  4A2M A;  4FA4 D;  4L3G D;  2PM7 B;  1MDA H;  3IIY A;  3C75 H;  5EAM A;  2GC4 A;  3I7O A;  4PSW B;  2H47 A;  3E0C A;  5FKT A;  2H14 A;  5GSA A;  4JT6 C;  3CIK B;  3OL2 A;  1B9X A;  4LGN A;  4CI8 A;  2IWK A;  5CXB B;  5IGO A;  1S4U X;  4CY2 A;  3I7K A;  3UKR C;  4PNK B;  4O3T B;  4TZ4 A;  4D0K A;  5TEF A;  3UVN A;  3JB9 L;  3RN1 D;  4JXM A;  3F3F A;  3RRM C;  5CYK A;  4BH6 A;  5GMK n;  3C99 A;  3EI2 B;  1VYH C;  4L1Q D;  4E5Z B;  4QT8 A;  2HES X;  2PM9 B;  5FQD A;  4EWR A;  3EI4 A;  5GXI A;  2GNQ A;  5FLX g;  3BG1 A;  1GG2 B;  3MXX A;  3FM0 A;  1ERJ A;  4ZOX A;  3U4Y A;  3PXW D;  2HKM A;  4FAN D;  3B7F A;  3P4F A;  4ZOY A;  5TEE A;  3FGB A;  3FRX A;  1MG2 A;  4CY3 A;  2H9N A;  1NEX B;  4LG8 A;  5FA5 B;  3SCY A;  5KDO B;  4O3U B;  2J56 H;  5EM2 A;  3JZN A;  5IJ8 E;  2BCJ B;  4NSX A;  2TRC B;  4GM9 A;  4A09 A;  5C9Z B;  3K27 A;  4I79 A;  2HKR A;  2AQ5 A;  2P9K C;  2CE8 A;  4J0X A;  3MZK A;  5I5J A;  3UVL A;  4FA5 D;  5EML B;  2HYE A;  2B4E A;  1TYQ C;  3IKO A;  3V7D B;  2PBI B;  5CXC B;  3C5M A;  1L0Q A;  3BWS A;  4H5J A;  4R7A B;  3ZWL B;  4QRJ A;  3OKY B;  4HDJ A;  2IUQ A;  3UVK A;  1PEV A;  1N6D A;  4ESG A;  3V9F A;  5IJ7 E;  3JRP A;  4J84 A;  2CN3 A;  5IC7 A;  3MZL A;  1XIP A;  3PXS D;  4LG9 A;  4ERY A;  3EI1 A;  5A2Q g;  4J8B A;  3JZH A;  2OK6 A;  3EI3 B;  3DSM A;  2OVP B;  3DXM C;  1GOT B;  1QNI A;  4GGC A;  2H6N A;  3PE7 A;  2YNN A;  4BUJ C;  1Q47 A;  3L4O D;  4GGA A;  3J81 g;  2G99 A;  1FWX A;  1U4C A;  3OL2 B;  3RMZ D;  4XYI A;  3SXT D;  2YNP A;  5FKQ A;  3NVN A;  1PBY B;  2HXC A;  3OKW A;  4GQB B;  4Y5R D;  3AL8 A;  2IWF A;  4JT5 C;  2HJB A;  1RI6 A;  3A0F A;  3W15 A;  3KRX B;  5IGQ A;  5FXY A;  4FAV D;  1U2V C;  3PSL A;  3CFV A;  4ZOZ A;  4GQ1 A;  2IUP A;  4FB1 D;  5GXH A;  4QL1 A;  2B5N A;  2CNX A;  4JD2 C;  2H6Q A;  5CYK B;  4Z8L A;  4A0A A;  2AGY A;  3I7L A;  2H68 A;  2QC5 A;  2W18 A;  5EMM B;  4BL0 A;  4J79 A;  4A11 B;  4YVD A;  3RSE C;  1YFQ A;  2UZX B;  3RLM D;  2AGW A;  3GFC A;  3F3G A;  3PSC B;  3SBP A;  4J73 A;  3SFZ A;  3EI4 B;  4JSN C;  4JSX C;  5SXM A;  3SLE D;  5K19 A;  4PBY A;  4ZOV A;  2OJY A;  2CE9 A;  2H13 A;  3IIW A;  4A0B A;  5HYN B;  3MKQ A;  2XU7 A;  4XYH A;  3DWL C;  4CZY A;  1SHY B;  5TF2 A;  2XYI A;  4ES0 A;  1A0R B;  2H6K A;  5IT9 g;  1SQJ A;  1JJU B;  4GM8 A;  4ERZ A;  5I5M A;  1TBG A;  2YBA A;  3I8E A;  3SJL D;  3NVQ A;  4GGD A;  2CO0 C;  3RN0 D;  5EM2 B;  3PVU B;  3JZG A;  3I89 A;  4J78 A;  4CI2 A;  5HE1 B;  2Z2N A;  4A09 B;  2GC7 A;  3CFS B;  4J77 A;  4PSX B;  4IA9 A;  4X61 B;  2P9U C;  2AGL A;  2H9L A;  1B9Y A;  4JSV C;  1K8K C;  4Y7R A;  3AH8 B;  2CO0 A;  2YNO A;  3SWS D;  4U7A A;  2QXV A;  2I0R A;  3DM0 A;  4J86 A;  2AGX A;  5FKR A;  3V5W B;  5EMJ B;  3JPX A;  2I3T A;  3PVW B;  3KRW B;  5H14 A;  3EU7 A;  3PXT D;  4FA1 D;  2I0S A;  2P9S C;  4OWR A;  4PXW A;  4AOW A;  3SVW D;  2H3X A;  3EI1 B;  2J55 H;  2P9P C;  5H1M A;  4CZX A;  3HFQ A;  2IAA A;  4ERQ A;  5FKS A;  2B5M A;  1OMW B;  4IMM A;  3UR4 A;  3VA6 A;  1SQ9 A;  3I7N A;  4O1Q D;  4X60 B;  3N0E A;  2B5L A;  5TDH B;  2H9M A;  3I2N A;  4N14 A;  3OTT A;  4A08 A;  3AL8 B;  4CZV A;  3I7H A;  4E54 A;  1XHM A;  4OZU A;  2BBK H;  3DXK C;  5AFU 3;  5C2V B;  3SBQ A;  3F3P A;  4U1E I;  1K32 A;  3IJ0 A;  4H5I A;  3ULE C;  4A0A B;  1N6E A;  3RFH A;  4J81 A;  2EBS A;  5C2W B;  4GQ2 P;  4GM3 A;  4X63 B;  2XL3 A;  3C9C A;  3IJC A;  4PC0 A;  3SMR A;  2OK4 A;  3EG6 A;  5AJA A;  5K1C C;  3RFG A;  3BG0 A;  4A0B B;  2OVQ B;  3GRE A;  3MMY A;  4FHL A;  4MK0 B;  5CXB A;  2P9I C;  2XL2 A;  1JMX B;  5THA A;  3OKT A;  4XEI C;  4A7J A;  3UVM A;  1JOF A;  2Q7Q A;  1PGU A;  2AGZ A;  4CY5 A;  2AH1 A;  4JSP C;  4A11 A;  3EMH A;  4G56 B;  5JWZ A;  5AMS A;  5EAR A;  4CC9 A;  3SBR A;  4AEZ A;  2OVR B;  2PM6 B;  2OIZ A;  2IUR A;  3ORV D;  3EI2 A;  2YB8 B;  4K3I D;  2H9P A;  5EAP A;  5HE3 B;  1MG3 A;  4E5Z A;  5I5I A;  2PM9 A;  3SN6 B;  1R5M A;  3N0D A;  4KFM B;  4O45 A;  2O9K A;  3K26 A;  2MTA H;  3AFC A;  4J82 A;  5HQG A;  4GMB A;  2I3S A;  2YMU A;  4D6V A;  1JMZ B;  1NR0 A;  4QQE A;  3I7P A;  3ODT A;  4K3J B;  2HJ4 A;  5HE2 B;  4CY1 A;  2IUV A;  1P22 A;  3UVO A;  5HE0 B;  4FWW A;  2CN2 A;  1XKS A;  2Z2P A;  4J87 A;  4GZ8 A;  3AL9 A;  4L3H D;  1GP2 B;  3VGZ A;  5EMK B;  1OLZ A;  4ZN4 A;  5EAL A;  4X3E A;  4L9O A; 
#chains in the Genus database with same CATH topology
 4AMZ A;  4BCC A;  3I8C A;  4CI1 A;  3OW8 A;  1GXR A;  2VZ3 A;  4J8G A;  4UI9 R;  1PI6 A;  5B4W A;  3UKU C;  2HU5 A;  3EWE A;  3O4I A;  4J0W A;  2I0T A;  4A2L A;  4FA9 D;  4AX4 A;  5CXC A;  2P9N C;  3VH0 A;  4A08 B;  4G1M A;  3OKY A;  2Z2O A;  4WK0 A;  4E54 B;  2J57 G;  4O9D A;  4PBZ A;  2P9L C;  3MKS B;  5H17 A;  3NVX A;  2HU8 A;  3ZDY A;  3JRO A;  3L4M D;  2G9A A;  4CI3 A;  3JAM g;  2AH0 A;  1N6F A;  3J80 g;  1VE7 A;  2UZY B;  3IJ1 A;  4RE6 A;  3SHF A;  1L5G A;  3EI3 A;  4A2M A;  4WJK A;  4FA4 D;  4L3G D;  2PM7 B;  1MDA H;  3IIY A;  3C75 H;  5EAM A;  2GC4 A;  3I7O A;  1U8C A;  3MUN A;  4PSW B;  3IUM A;  4O02 A;  2H47 A;  3E0C A;  3MVD K;  5FKT A;  2H14 A;  5GSA A;  4BP8 A;  4JT6 C;  3CIK B;  3OL2 A;  5C92 A;  1B9X A;  4LGN A;  4CI8 A;  2IWK A;  5CXB B;  5IGO A;  1S4U X;  4CY2 A;  3I7K A;  3UKR C;  4PNK B;  4O3T B;  4DNU A;  4TZ4 A;  2HU7 A;  3O4H A;  4D0K A;  5TEF A;  3OF7 A;  3UVN A;  4DNV A;  2VDO A;  3JB9 L;  3RN1 D;  4JXM A;  1BPO A;  1H2Z A;  3F3F A;  4JHN A;  3RRM C;  3ZE0 A;  5CYK A;  4BH6 A;  5GMK n;  3DDU A;  4UM8 A;  3C99 A;  3EI2 B;  1VYH C;  4L1Q D;  4E5Z B;  4BP9 A;  4QT8 A;  2HES X;  2PM9 B;  2XE4 A;  5FQD A;  4EWR A;  3EI4 A;  5GXI A;  2GNQ A;  5FLX g;  3BG1 A;  5C86 A;  1GG2 B;  2VZ1 A;  3MXX A;  3FM0 A;  1ERJ A;  4ZOX A;  2VDM A;  3U4Y A;  3PXW D;  2HKM A;  4FAN D;  3B7F A;  3P4F A;  4ZOY A;  1GOH A;  5TEE A;  3FGB A;  3FRX A;  1MG2 A;  4CY3 A;  2H9N A;  1NEX B;  4LG8 A;  5FA5 B;  3SCY A;  5KDO B;  4O3U B;  3IUL A;  2J56 H;  5EM2 A;  3JZN A;  5IJ8 E;  2BCJ B;  1GOF A;  4NSX A;  2TRC B;  4GM9 A;  5M5S A;  4A09 A;  1UOP A;  5C9Z B;  3K27 A;  4I79 A;  2HKR A;  2AQ5 A;  2P9K C;  2CE8 A;  4J0X A;  3MZK A;  2XZG A;  5I5J A;  3UVL A;  4FA5 D;  5EML B;  2HYE A;  2B4E A;  3K6S A;  1TYQ C;  3IKO A;  3V7D B;  2PBI B;  5CXC B;  3C5M A;  1L0Q A;  3BWS A;  4H5J A;  4R7A B;  5M5R A;  3FCS A;  4QRJ A;  3OKY B;  4HDJ A;  3ZWL B;  5FFG A;  2IUQ A;  3UVK A;  1PEV A;  4Z7Q A;  1N6D A;  1M1X A;  4ESG A;  3V9F A;  5IJ7 E;  3JRP A;  4J84 A;  2CN3 A;  4WK4 A;  3MZL A;  1XIP A;  5IC7 A;  3T3P A;  4JHP C;  3PXS D;  4LG9 A;  4ERY A;  3EI1 A;  2VDQ A;  5A2Q g;  4J8B A;  3JZH A;  2OK6 A;  3EI3 B;  3DSM A;  2OVP B;  3DXM C;  1GOT B;  1QNI A;  4BCB A;  4G55 A;  4GGC A;  2H6N A;  3PE7 A;  1VZ2 A;  2YNN A;  2BKL A;  4BUJ C;  1Q47 A;  4AN1 A;  3L4O D;  4GGA A;  4NBM A;  3J81 g;  2G99 A;  3IUN A;  3ZDZ A;  1FWX A;  1U4C A;  3OL2 B;  3RMZ D;  4XYI A;  3SXT D;  2YNP A;  1JV2 A;  5FKQ A;  3NVN A;  2VDP A;  1PBY B;  2HXC A;  3OKW A;  4GQB B;  3K71 A;  2EIB A;  4Y5R D;  3AL8 A;  2IWF A;  4JT5 C;  2HJB A;  2WQ8 A;  1H2X A;  1RI6 A;  3A0F A;  3KRX B;  3W15 A;  5IGQ A;  5FXY A;  1H2Y A;  4FAV D;  5FFO A;  1U2V C;  3PSL A;  3CFV A;  4ZOZ A;  4GQ1 A;  2IUP A;  4FB1 D;  5GXH A;  4QL1 A;  2B5N A;  2CNX A;  4JD2 C;  2H6Q A;  5CYK B;  4Z8L A;  4A0A A;  2AGY A;  3I7L A;  2H68 A;  2QC5 A;  2W18 A;  1H2W A;  5EMM B;  4BL0 A;  4J79 A;  4A11 B;  4YVD A;  3RSE C;  1YFQ A;  2UZX B;  3RLM D;  2AGW A;  3GFC A;  3IJE A;  3F3G A;  3PSC B;  3SBP A;  4J73 A;  3SFZ A;  5M5T A;  3EI4 B;  4JSN C;  4JSX C;  5SXM A;  3SLE D;  5K19 A;  4PBY A;  4ZOV A;  2OJY A;  2CE9 A;  2H13 A;  2EIC A;  3IIW A;  3NIF A;  4A0B A;  5HYN B;  3MKQ A;  2XU7 A;  4XYH A;  5E6S A;  3DWL C;  4CZY A;  1SHY B;  5TF2 A;  2XYI A;  3FCU A;  2EIE A;  1UOQ A;  4ES0 A;  1A0R B;  2H6K A;  5IT9 g;  1SQJ A;  4NAA A;  1JJU B;  4GM8 A;  4ERZ A;  5I5M A;  1TBG A;  3EQ9 A;  2YBA A;  3I8E A;  3VI3 A;  3SJL D;  3NVQ A;  2VC2 A;  4GGD A;  2CO0 C;  3RN0 D;  5EM2 B;  3PVU B;  3ZE1 A;  3JZG A;  3I89 A;  1A12 A;  4J78 A;  4CI2 A;  5HE1 B;  2VDN A;  2Z2N A;  1UOO A;  4A09 B;  3IUJ A;  2GC7 A;  3CFS B;  4J77 A;  4PSX B;  4AN0 A;  4RE5 A;  4IA9 A;  4X61 B;  2P9U C;  2AGL A;  4L1M A;  2H9L A;  1B9Y A;  4JSV C;  1K8K C;  4Y7R A;  3AH8 B;  2CO0 A;  3MUO A;  2YNO A;  3SWS D;  4U7A A;  2QXV A;  2I0R A;  3DM0 A;  3IVM A;  3GD1 I;  2AGX A;  3GC3 B;  4J86 A;  4NEN A;  5FKR A;  3VI4 A;  3V5W B;  5EMJ B;  4DNW A;  4QAM A;  1TYE A;  3JPX A;  2I3T A;  4MMY A;  3PVW B;  3KRW B;  5H14 A;  3EU7 A;  3PXT D;  4FA1 D;  1E8M A;  2JKX A;  2I0S A;  2P9S C;  4OWR A;  4PXW A;  3QI0 A;  4AOW A;  3O4J A;  3SVW D;  1E5T A;  2H3X A;  3EI1 B;  4D9S A;  2J55 H;  2P9P C;  5H1M A;  4CZX A;  3HFQ A;  2IAA A;  4ERQ A;  5FKS A;  2B5M A;  1OMW B;  5M5V A;  4IMM A;  3UR4 A;  3VA6 A;  1O6F A;  3NID A;  1VZ3 A;  1SQ9 A;  3I7N A;  4O1Q D;  4X60 B;  3N0E A;  2B5L A;  2VDL A;  5TDH B;  2H9M A;  3I2N A;  5M5U A;  4N14 A;  3OTT A;  4A08 A;  3AL8 B;  4CZV A;  3NIG A;  3I7H A;  4E54 A;  1XHM A;  1E8N A;  4OZU A;  2BBK H;  3DXK C;  5AFU 3;  5C2V B;  3SBQ A;  3F3P A;  3V4P A;  4U1E I;  1K32 A;  3IJ0 A;  4H5I A;  4UM9 A;  3ULE C;  4A0A B;  1N6E A;  4MMX A;  3RFH A;  4J81 A;  2EBS A;  5C2W B;  3EQ8 A;  4GQ2 P;  4GM3 A;  4X63 B;  1GOG A;  2XL3 A;  2VDR A;  4WK2 A;  3C9C A;  3IJC A;  4PC0 A;  3SMR A;  2OK4 A;  3EG6 A;  5AJA A;  3QHY B;  4IRZ A;  3V4V A;  4AMY A;  3KCI A;  4NC4 A;  5K1C C;  3RFG A;  1VE6 A;  5E6U A;  3BG0 A;  5M61 A;  4Z7N A;  4A0B B;  1O6G A;  2QR5 A;  2OVQ B;  3ZE2 A;  1QFM A;  3GRE A;  3MMY A;  4FHL A;  4MK0 B;  5CXB A;  2P9I C;  2XL2 A;  1JMX B;  5THA A;  3OKT A;  1I2M B;  4XEI C;  4A7J A;  3O4G A;  3UVM A;  1JOF A;  2Q7Q A;  3T3M A;  4G1E A;  1JTD B;  1PGU A;  2AGZ A;  4CY5 A;  3IUR A;  2AH1 A;  1UTC A;  2QZP A;  4JSP C;  1YR2 A;  5E6R A;  4A11 A;  3EMH A;  4G56 B;  5JWZ A;  5AMS A;  5EAR A;  4CC9 A;  3SBR A;  4AEZ A;  3K72 A;  2OVR B;  3ZDX A;  2PM6 B;  2OIZ A;  2IUR A;  3ORV D;  3EI2 A;  2YB8 B;  1K3I A;  2H9P A;  4K3I D;  5EAP A;  5HE3 B;  1MG3 A;  4E5Z A;  2XDW A;  5I5I A;  2PM9 A;  3IUQ A;  3SN6 B;  1R5M A;  3N0D A;  4BCD A;  4KFM B;  4O45 A;  2O9K A;  3K26 A;  2MTA H;  5HDB A;  3AFC A;  1T2X A;  4J82 A;  5HQG A;  4GMB A;  4Z7O A;  2I3S A;  2YMU A;  4D6V A;  1JMZ B;  1NR0 A;  2VDK A;  4QQE A;  3I7P A;  3ODT A;  4K3J B;  2HJ4 A;  5HE2 B;  4CY1 A;  1QFS A;  2IUV A;  1C9I A;  1P22 A;  3UVO A;  5HE0 B;  4FWW A;  2CN2 A;  1XKS A;  2Z2P A;  4J87 A;  4GZ8 A;  3AL9 A;  4L3H D;  1GP2 B;  3VGZ A;  4MMZ A;  1C9L A;  2EID A;  5EMK B;  1OLZ A;  4O2W A;  3EQ7 A;  4ZN4 A;  5EAL A;  4X3E A;  4L9O A; 
#chains in the Genus database with same CATH homology
 3I8C A;  4CI1 A;  3OW8 A;  1GXR A;  4J8G A;  4UI9 R;  5B4W A;  1PI6 A;  3UKU C;  3EWE A;  4J0W A;  2I0T A;  4A2L A;  4FA9 D;  5CXC A;  2P9N C;  3VH0 A;  4A08 B;  3OKY A;  2Z2O A;  4E54 B;  2J57 G;  4O9D A;  4PBZ A;  2P9L C;  3MKS B;  5H17 A;  3NVX A;  3JRO A;  3L4M D;  2G9A A;  4CI3 A;  3JAM g;  2AH0 A;  1N6F A;  3J80 g;  2UZY B;  3IJ1 A;  3SHF A;  3EI3 A;  4A2M A;  4FA4 D;  4L3G D;  2PM7 B;  1MDA H;  3IIY A;  3C75 H;  5EAM A;  2GC4 A;  3I7O A;  4PSW B;  2H47 A;  3E0C A;  5FKT A;  2H14 A;  5GSA A;  4JT6 C;  3CIK B;  3OL2 A;  1B9X A;  4LGN A;  4CI8 A;  2IWK A;  5CXB B;  5IGO A;  1S4U X;  4CY2 A;  3I7K A;  3UKR C;  4PNK B;  4O3T B;  4TZ4 A;  4D0K A;  5TEF A;  3UVN A;  3JB9 L;  3RN1 D;  4JXM A;  3F3F A;  3RRM C;  5CYK A;  4BH6 A;  5GMK n;  3C99 A;  3EI2 B;  1VYH C;  4L1Q D;  4E5Z B;  4QT8 A;  2HES X;  2PM9 B;  5FQD A;  4EWR A;  3EI4 A;  5GXI A;  2GNQ A;  5FLX g;  3BG1 A;  1GG2 B;  3MXX A;  3FM0 A;  1ERJ A;  4ZOX A;  3U4Y A;  3PXW D;  2HKM A;  4FAN D;  3B7F A;  3P4F A;  4ZOY A;  5TEE A;  3FGB A;  3FRX A;  1MG2 A;  4CY3 A;  2H9N A;  1NEX B;  4LG8 A;  5FA5 B;  3SCY A;  5KDO B;  4O3U B;  2J56 H;  5EM2 A;  3JZN A;  5IJ8 E;  2BCJ B;  4NSX A;  2TRC B;  4GM9 A;  4A09 A;  5C9Z B;  3K27 A;  4I79 A;  2HKR A;  2AQ5 A;  2P9K C;  2CE8 A;  4J0X A;  3MZK A;  5I5J A;  3UVL A;  4FA5 D;  5EML B;  2HYE A;  2B4E A;  1TYQ C;  3IKO A;  3V7D B;  2PBI B;  5CXC B;  3C5M A;  1L0Q A;  3BWS A;  4H5J A;  4R7A B;  3ZWL B;  4QRJ A;  3OKY B;  4HDJ A;  2IUQ A;  3UVK A;  1PEV A;  1N6D A;  4ESG A;  3V9F A;  5IJ7 E;  3JRP A;  4J84 A;  2CN3 A;  5IC7 A;  3MZL A;  1XIP A;  3PXS D;  4LG9 A;  4ERY A;  3EI1 A;  5A2Q g;  4J8B A;  3JZH A;  2OK6 A;  3EI3 B;  3DSM A;  2OVP B;  3DXM C;  1GOT B;  1QNI A;  4GGC A;  2H6N A;  3PE7 A;  2YNN A;  4BUJ C;  1Q47 A;  3L4O D;  4GGA A;  3J81 g;  2G99 A;  1FWX A;  1U4C A;  3OL2 B;  3RMZ D;  4XYI A;  3SXT D;  2YNP A;  5FKQ A;  3NVN A;  1PBY B;  2HXC A;  3OKW A;  4GQB B;  4Y5R D;  3AL8 A;  2IWF A;  4JT5 C;  2HJB A;  1RI6 A;  3A0F A;  3W15 A;  3KRX B;  5IGQ A;  5FXY A;  4FAV D;  1U2V C;  3PSL A;  3CFV A;  4ZOZ A;  4GQ1 A;  2IUP A;  4FB1 D;  5GXH A;  4QL1 A;  2B5N A;  2CNX A;  4JD2 C;  2H6Q A;  5CYK B;  4Z8L A;  4A0A A;  2AGY A;  3I7L A;  2H68 A;  2QC5 A;  2W18 A;  5EMM B;  4BL0 A;  4J79 A;  4A11 B;  4YVD A;  3RSE C;  1YFQ A;  2UZX B;  3RLM D;  2AGW A;  3GFC A;  3F3G A;  3PSC B;  3SBP A;  4J73 A;  3SFZ A;  3EI4 B;  4JSN C;  4JSX C;  5SXM A;  3SLE D;  5K19 A;  4PBY A;  4ZOV A;  2OJY A;  2CE9 A;  2H13 A;  3IIW A;  4A0B A;  5HYN B;  3MKQ A;  2XU7 A;  4XYH A;  3DWL C;  4CZY A;  1SHY B;  5TF2 A;  2XYI A;  4ES0 A;  1A0R B;  2H6K A;  5IT9 g;  1SQJ A;  1JJU B;  4GM8 A;  4ERZ A;  5I5M A;  1TBG A;  2YBA A;  3I8E A;  3SJL D;  3NVQ A;  4GGD A;  2CO0 C;  3RN0 D;  5EM2 B;  3PVU B;  3JZG A;  3I89 A;  4J78 A;  4CI2 A;  5HE1 B;  2Z2N A;  4A09 B;  2GC7 A;  3CFS B;  4J77 A;  4PSX B;  4IA9 A;  4X61 B;  2P9U C;  2AGL A;  2H9L A;  1B9Y A;  4JSV C;  1K8K C;  4Y7R A;  3AH8 B;  2CO0 A;  2YNO A;  3SWS D;  4U7A A;  2QXV A;  2I0R A;  3DM0 A;  4J86 A;  2AGX A;  5FKR A;  3V5W B;  5EMJ B;  3JPX A;  2I3T A;  3PVW B;  3KRW B;  5H14 A;  3EU7 A;  3PXT D;  4FA1 D;  2I0S A;  2P9S C;  4OWR A;  4PXW A;  4AOW A;  3SVW D;  2H3X A;  3EI1 B;  2J55 H;  2P9P C;  5H1M A;  4CZX A;  3HFQ A;  2IAA A;  4ERQ A;  5FKS A;  2B5M A;  1OMW B;  4IMM A;  3UR4 A;  3VA6 A;  1SQ9 A;  3I7N A;  4O1Q D;  4X60 B;  3N0E A;  2B5L A;  5TDH B;  2H9M A;  3I2N A;  4N14 A;  3OTT A;  4A08 A;  3AL8 B;  4CZV A;  3I7H A;  4E54 A;  1XHM A;  4OZU A;  2BBK H;  3DXK C;  5AFU 3;  5C2V B;  3SBQ A;  3F3P A;  4U1E I;  1K32 A;  3IJ0 A;  4H5I A;  3ULE C;  4A0A B;  1N6E A;  3RFH A;  4J81 A;  2EBS A;  5C2W B;  4GQ2 P;  4GM3 A;  4X63 B;  2XL3 A;  3C9C A;  3IJC A;  4PC0 A;  3SMR A;  2OK4 A;  3EG6 A;  5AJA A;  5K1C C;  3RFG A;  3BG0 A;  4A0B B;  2OVQ B;  3GRE A;  3MMY A;  4FHL A;  4MK0 B;  5CXB A;  2P9I C;  2XL2 A;  1JMX B;  5THA A;  3OKT A;  4XEI C;  4A7J A;  3UVM A;  1JOF A;  2Q7Q A;  1PGU A;  2AGZ A;  4CY5 A;  2AH1 A;  4JSP C;  4A11 A;  3EMH A;  4G56 B;  5JWZ A;  5AMS A;  5EAR A;  4CC9 A;  3SBR A;  4AEZ A;  2OVR B;  2PM6 B;  2OIZ A;  2IUR A;  3ORV D;  3EI2 A;  2YB8 B;  4K3I D;  2H9P A;  5EAP A;  5HE3 B;  1MG3 A;  4E5Z A;  5I5I A;  2PM9 A;  3SN6 B;  1R5M A;  3N0D A;  4KFM B;  4O45 A;  2O9K A;  3K26 A;  2MTA H;  3AFC A;  4J82 A;  5HQG A;  4GMB A;  2I3S A;  2YMU A;  4D6V A;  1JMZ B;  1NR0 A;  4QQE A;  3I7P A;  3ODT A;  4K3J B;  2HJ4 A;  5HE2 B;  4CY1 A;  2IUV A;  1P22 A;  3UVO A;  5HE0 B;  4FWW A;  2CN2 A;  1XKS A;  2Z2P A;  4J87 A;  4GZ8 A;  3AL9 A;  4L3H D;  1GP2 B;  3VGZ A;  5EMK B;  1OLZ A;  4ZN4 A;  5EAL A;  4X3E A;  4L9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...