4CZXA

Complex of neurospora crassa pan2 (wd40) with pan3 (c-term)
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
324
structure length
324
Chain Sequence
PHMMDSRDWTQLGCVAYPSPIHPDYHAGPASTIAFDNQDELLWIGTQKGFAGSFIGRELKRFTAFRIHPETDGPLRQFLFVDKGVIFLGSRSVYMAARSGVPIWSIRHESMQDLRAMSFTSKGTSEILVAGWQNKMLVIDVNKGEVVKELPTQDQYSFLKMSRYICAATNKGTVNILDPITFTIKKQWQAHGAFINDLDTSNDFIVTCGGSHRQTHNTPAILDPYVKVFDLKNMSAMNPVPFAPLAAHVRMHPRMLTTAIVVNQAGQIHVTDLLNPSNSQVCYTQPQGVVLHFDVSRTGEGKALADNKHNTYVWGSPNKIQFTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PAB-DEPENDENT POLY(A)-SPECIFIC RIBONUCLEASE SUBUNIT PAN2
publication title An Asymmetric Pan3 Dimer Recruits a Single Pan2 Exonuclease to Mediate Mrna Deadenylation and Decay.
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Gene regulation
total genus 82
structure length 324
sequence length 324
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2014-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4czxA00
5K1CC 3MZKA 2IWFA 3EI2B 5FKQA 3CFVA 1OLZA 2IUPA 4D0KA 4ZOYA 1JMXB 4A0AB 4CZVA 2H9MA 2YNOA 4KFMB 1MDAH 3SVWD 5SXMA 1SHYB 3C99A 2CE8A 1TYQC 4R7AB 4X3EA 3JRPA 4FB1D 4AOWA 5EAMA 4J8GA 5IT9g 4J0WA 3IKOA 5EM2A 4J8BA 3RN1D 4FA5D 4E54B 4CI3A 2B4EA 2I3TA 3V9FA 5CXCA 5GMKn 5FKSA 4UI9R 4L9OA 3VGZA 2MTAH 4CC9A 5HQGA 5I5IA 1VYHC 5GSAA 4TZ4A 4GGAA 4GGDA 3UKUC 3SBQA 2QXVA 2H9NA 4A2LA 2P9IC 4U1EI 5FKTA 5B4WA 3J80g 4YVDA 2CN2A 3OKYA 3F3PA 4PSXB 3VA6A 2AGWA 3SN6B 4XEIC 3DSMA 3EU7A 4ZN4A 3IJ1A 3C75H 2CN3A 3I7LA 4J82A 5HE1B 4MK0B 4A08A 2P9LC 3IJCA 2Z2PA 3AFCA 3DXMC 2H9LA 4N14A 5CYKA 4IA9A 2OIZA 2B5LA 3KRXB 2P9PC 3BG0A 3JZNA 4JXMA 2AGZA 1ERJA 5KDOB 4A09B 3SHFA 3P4FA 3PXSD 4PSWB 3SBRA 2I0SA 2IURA 2OVRB 1PBYB 3I2NA 3FRXA 3EI3B 3I8CA 4J87A 4ZOXA 4JSNC 4E5ZB 5GXIA 3ZWLB 4J78A 4GQBB 2OK4A 4CZYA 5EMMB 4E54A 5I5MA 2OVQB 3A0FA 3W15A 3F3FA 3GFCA 3PVUB 4K3ID 2UZXB 3SJLD 4FA9D 3AH8B 3OTTA 1PI6A 3FM0A 4LGNA 2AQ5A 2I0RA 2OVPB 4GGCA 3SXTD 5C2WB 4FWWA 4JT6C 1K32A 3EI4B 2XU7A 3VH0A 4BH6A 3U4YA 2O9KA 4CY5A 2H13A 1U4CA 3GREA 3IJ0A 1XIPA 1NR0A 3I7KA 3N0EA 4J86A 5C2VB 5TF2A 3JZGA 2AGYA 3AL8B 2H6QA 4QRJA 5AFU3 3FGBA 5FQDA 4FA4D 2W18A 2G99A 4QT8A 4CI8A 2CE9A 3I7OA 3L4OD 1K8KC 3I8EA 3EG6A 2IAAA 5TEEA 3I7NA 4CY2A 5JWZA 1B9YA 5AMSA 4O9DA 1U2VC 4ERQA 2OJYA 4ES0A 5AJAA 4IMMA 4Z8LA 2HJBA 4A11A 2G9AA 2I0TA 1B9XA 3EI3A 1JMZB 2I3SA 2H47A 4D6VA 3JROA 1P22A 2YB8B 3E0CA 2PBIB 5EARA 5IJ7E 2TRCB 4QQEA 2CO0A 3SMRA 3UVOA 3EI1B 3UVMA 3DM0A 4ESGA 2AGXA 2YMUA 3I7PA 3OL2B 3OW8A 3CIKB 3V5WB 3PXTD 5IGOA 4PBZA 3OKWA 1GOTB 3N0DA 2H3XA 4Y5RD 4JSVC 4FHLA 1N6FA 2XYIA 3HFQA 3UKRC 2J57G 4O3UB 4LG9A 1TBGA 3I7HA 4ERYA 3AL9A 1N6DA 3EI2A 2BBKH 3C5MA 3RMZD 3NVQA 4GM8A 4XYHA 4J79A 2OK6A 4L3GD 4PC0A 3UR4A 4A0AA 3C9CA 3AL8A 3EWEA 5EAPA 4I79A 3KRWB 2B5MA 5FA5B 3NVNA 2HYEA 2IUVA 2HKRA 4NSXA 5CXBB 3K27A 2Q7QA 3MZLA 2J55H 3PXWD 2H6KA 2BCJB 2HJ4A 5IJ8E 2H68A 1XKSA 1FWXA 4FA1D 4X63B 2XL2A 5EALA 2PM9B 3RLMD 1SQ9A 2IUQA 4O45A 3SFZA 4Y7RA 2PM7B 3K26A 2Z2NA 3IIYA 2J56H 2AH1A 1QNIA 4L3HD 3SBPA 3OL2A 1XHMA 4GQ1A 1MG2A 3OKYB 3EMHA 5HE2B 4X61B 1GG2B 4CY1A 2QC5A 4J73A 5FXYA 3F3GA 2HESX 3I89A 4A08B 5EMJB 2H9PA 5IC7A 4X60B 2PM6B 2CNXA 4J0XA 5CYKB 5H17A 2EBSA 3CFSB 2YNNA 2HXCA 4CY3A 4OWRA 4AEZA 3SWSD 1R5MA 4A0BB 4A09A 3OKTA 3ODTA 2P9SC 5CXBA 4GQ2P 4CI2A 3ULEC 5H14A 4E5ZA 4JD2C 5TEFA 1GP2B 1JOFA 3PVWB 2B5NA 1PGUA 1RI6A 3MXXA 4GMBA 3RRMC 1MG3A 4G56B 5HE3B 3JZHA 4J81A 3BWSA 4QL1A 4OZUA 4JSPC 5EMKB 3BG1A 2GC7A 1A0RB 2PM9A 3RFGA 4FAND 4O3TB 3JPXA 4HDJA 3PE7A 2Z2OA 3MMYA 4O1QD 3EI4A 4ZOZA 5H1MA 1NEXB 2YBAA 4CZXA 2IWKA 4J77A 2GC4A 3JB9L 5C9ZB 5HE0B 3JAMg 5GXHA 2P9KC 4GM3A 1PEVA 3NVXA 4BL0A 5EMLB 5FKRA 1JJUB 1Q47A 5A2Qg 1YFQA 4PBYA 3V7DB 5HYNB 3MKSB 4J84A 4GZ8A 1L0QA 3SCYA 3PSCB 4FAVD 2P9NC 4ZOVA 4CI1A 1SQJA 4A0BA 3UVKA 4ERZA 5EM2B 3L4MD 1S4UX 4GM9A 2YNPA 3PSLA 3B7FA 2XL3A 2CO0C 1OMWB 2HKMA 4EWRA 4BUJC 2AGLA 3ORVD 5CXCB 5IGQA 3RSEC 4PNKB 4A11B 5I5JA 2H14A 2UZYB 3DWLC 1N6EA 5TDHB 2GNQA 4PXWA 4U7AA 4L1QD 3EI1A 5K19A 3IIWA 3RFHA 3DXKC 4A2MA 4H5JA 5FLXg 3UVNA 2AH0A 3SLED 1GXRA 4JT5C 3RN0D 3J81g 3UVLA 4A7JA 2H6NA 4JSXC 4LG8A 4K3JB 4H5IA 5THAA 4XYIA 2P9UC 3MKQA
chains in the Genus database with same CATH superfamily
5K1CC 3MZKA 1JTDB 2IWFA 2VZ1A 3EI2B 5FKQA 3CFVA 1OLZA 2IUPA 4D0KA 4ZOYA 1JMXB 3O4HA 4A0AB 4CZVA 2H9MA 2YNOA 1K3IA 4KFMB 1MDAH 3IURA 3SVWD 5SXMA 2EIBA 1SHYB 3C99A 2CE8A 1TYQC 4R7AB 3ZE1A 4X3EA 3JRPA 4FB1D 4AOWA 1BPOA 5EAMA 4J8GA 5IT9g 4J0WA 3IKOA 5EM2A 4J8BA 3RN1D 4FA5D 4E54B 5E6RA 4CI3A 2B4EA 2I3TA 3V9FA 1T2XA 5CXCA 5GMKn 5FKSA 4UI9R 4L9OA 3VGZA 2MTAH 4CC9A 3GC3B 4DNUA 5HQGA 5I5IA 1VYHC 5GSAA 3IUQA 4TZ4A 4GGAA 4GGDA 3UKUC 3SBQA 2QXVA 2H9NA 2EICA 4A2LA 2P9IC 4U1EI 5FKTA 5B4WA 2QR5A 3T3MA 3J80g 4YVDA 3ZDYA 2CN2A 3OKYA 4WK4A 3F3PA 4PSXB 3VA6A 1O6FA 2AGWA 4BCDA 3SN6B 4XEIC 3DSMA 3EU7A 4ZN4A 3IJ1A 3C75H 2CN3A 2VC2A 3I7LA 4J82A 5HE1B 4MK0B 4A08A 2P9LC 3IJCA 2Z2PA 3AFCA 1I2MB 3DXMC 2H9LA 4N14A 5CYKA 4G1MA 4O02A 3IULA 4IA9A 4WK2A 5C92A 2OIZA 3NIGA 2B5LA 3DDUA 3KRXB 3EQ9A 2P9PC 3IJEA 3BG0A 5E6UA 5M5UA 3JZNA 3MUOA 4JXMA 2AGZA 1ERJA 3ZE2A 5KDOB 4A09B 3SHFA 3P4FA 4AMYA 2VDPA 3PXSD 4PSWB 3SBRA 2I0SA 2IURA 2XDWA 4JHNA 2OVRB 1PBYB 3I2NA 3FRXA 3EI3B 5FFOA 3I8CA 4J87A 3IUJA 4G1EA 4JSNC 4ZOXA 4E5ZB 5GXIA 2VDNA 4J78A 3ZWLB 4GQBB 2OK4A 4CZYA 3OF7A 5EMMB 4E54A 5I5MA 3V4VA 4Z7OA 2OVQB 3A0FA 3W15A 3F3FA 3GFCA 3PVUB 4RE5A 4K3ID 2UZXB 3SJLD 4FA9D 3AH8B 3OTTA 1PI6A 3O4GA 3FM0A 4LGNA 2AQ5A 2I0RA 2OVPB 4GGCA 3SXTD 5C2WB 5M5SA 4FWWA 4JT6C 1K32A 3EI4B 2XU7A 2XE4A 3VH0A 4BH6A 3U4YA 5M5VA 2O9KA 4CY5A 3K72A 1C9IA 2H13A 1U4CA 3FCSA 3GREA 3IJ0A 1XIPA 1NR0A 4UM8A 3I7KA 3N0EA 4J86A 5C2VB 2VDOA 1A12A 2VDKA 5TF2A 3JZGA 2AGYA 3AL8B 2H6QA 4QRJA 5AFU3 2JKXA 3FGBA 5FQDA 2P9UC 4FA4D 2W18A 2G99A 4QT8A 4CI8A 2CE9A 3I7OA 3L4OD 1K8KC 3I8EA 3EG6A 2IAAA 1VE7A 5TEEA 3I7NA 4CY2A 5JWZA 1B9YA 5AMSA 4O9DA 3ZE0A 1U2VC 4ERQA 2OJYA 4ES0A 5AJAA 4IMMA 4Z8LA 2HJBA 4A11A 2G9AA 2I0TA 4D9SA 2VZ3A 1B9XA 3EI3A 1JMZB 2I3SA 2H47A 3QHYB 4D6VA 3JROA 1P22A 2YB8B 3E0CA 2PBIB 5EARA 5IJ7E 2TRCB 1H2ZA 4QQEA 2CO0A 3SMRA 4MMYA 3UVOA 3EI1B 4MMXA 3UVMA 3DM0A 4ESGA 2AGXA 2YMUA 3I7PA 3OL2B 3OW8A 4WK0A 3CIKB 3V5WB 3PXTD 5IGOA 4PBZA 3OKWA 1GOTB 1E5TA 3N0DA 2H3XA 4Y5RD 4JSVC 3GD1I 1N6FA 1TYEA 2XYIA 3HFQA 4FHLA 1GOHA 5M5RA 3UKRC 5C86A 2J57G 4O3UB 4LG9A 4O2WA 1TBGA 3I7HA 3ZDZA 4ERYA 3AL9A 1N6DA 1UTCA 3EI2A 2BBKH 3C5MA 3RMZD 3NVQA 2VDMA 4GM8A 4XYHA 4J79A 2OK6A 4L3GD 4PC0A 3UR4A 4A0AA 3C9CA 1QFSA 3AL8A 3EWEA 3MUNA 5EAPA 4I79A 3KRWB 2B5MA 5FA5B 3NVNA 2HYEA 2IUVA 2HKRA 2HU7A 2VDLA 4NSXA 5CXBB 3K27A 1UOQA 2Q7QA 3MZLA 2J55H 3PXWD 4WJKA 2H6KA 1GOFA 2BCJB 2HJ4A 5FFGA 1E8MA 5IJ8E 2H68A 1XKSA 4Z7QA 1FWXA 4FA1D 2EIEA 4X63B 3K71A 2XL2A 1E8NA 5EALA 2PM9B 3O4IA 3RLMD 1SQ9A 2IUQA 4G55A 4O45A 3SFZA 4Y7RA 2PM7B 3K26A 3V4PA 2Z2NA 4MMZA 3IIYA 2J56H 2AH1A 1QNIA 4L3HD 3SBPA 3OL2A 1XHMA 3FCUA 4GQ1A 1MG2A 3OKYB 3EMHA 1H2WA 5HE2B 4X61B 1GG2B 4CY1A 2QC5A 4J73A 4NAAA 5FXYA 3F3GA 2BKLA 4AN1A 1JV2A 2HESX 2EIDA 3ZDXA 1VZ3A 3I89A 3VI4A 4A08B 4UM9A 1M1XA 4AN0A 5EMJB 2H9PA 5IC7A 1H2YA 4X60B 2PM6B 2CNXA 2VDQA 4J0XA 5CYKB 2EBSA 4NC4A 5H17A 4DNVA 3K6SA 3CFSB 4AMZA 2YNNA 2HXCA 4CY3A 2HU8A 4OWRA 4AEZA 3SWSD 1R5MA 3NIFA 4A0BB 2XZGA 4A09A 3OKTA 3ODTA 3EQ7A 2P9SC 5CXBA 1UOPA 4GQ2P 4CI2A 3T3PA 1H2XA 5H14A 5HDBA 3ULEC 4E5ZA 4JD2C 5TEFA 1GP2B 1JOFA 3PVWB 2B5NA 3O4JA 1PGUA 1RI6A 3MXXA 4QAMA 4GMBA 3RRMC 1MG3A 4BCBA 2HU5A 4G56B 3JZHA 5HE3B 4J81A 4Z7NA 3BWSA 1QFMA 4QL1A 4OZUA 4JSPC 5EMKB 3BG1A 2GC7A 4DNWA 1A0RB 2PM9A 3RFGA 4FAND 4O3TB 3JPXA 1VZ2A 4HDJA 3PE7A 2Z2OA 3MMYA 4O1QD 3EI4A 4ZOZA 5H1MA 1NEXB 5M5TA 2YBAA 3IVMA 4CZXA 2IWKA 4J77A 1C9LA 2GC4A 5M61A 3JB9L 5C9ZB 5HE0B 3JAMg 5GXHA 4RE6A 2P9KC 4GM3A 1PEVA 3NVXA 4BL0A 5EMLB 3KCIA 5FKRA 1U8CA 1JJUB 1YR2A 1UOOA 1Q47A 5A2Qg 1YFQA 4PBYA 3V7DB 5HYNB 3MKSB 4J84A 4JHPC 4GZ8A 1L0QA 3SCYA 3PSCB 4FAVD 2P9NC 4ZOVA 4L1MA 4CI1A 1SQJA 4NENA 4A0BA 3QI0A 3UVKA 1GOGA 3NIDA 4ERZA 5EM2B 3L4MD 4IRZA 1S4UX 4GM9A 2VDRA 2YNPA 3PSLA 3B7FA 2XL3A 2CO0C 1OMWB 2HKMA 4BP9A 4EWRA 4BUJC 2AGLA 3ORVD 5CXCB 2QZPA 3RSEC 5IGQA 4PNKB 4A11B 5I5JA 2H14A 4AX4A 2UZYB 3DWLC 1N6EA 5TDHB 2GNQA 4PXWA 3IUNA 4U7AA 4L1QD 2WQ8A 3EI1A 5E6SA 5K19A 3IIWA 1L5GA 3RFHA 3DXKC 4A2MA 4H5JA 5FLXg 3UVNA 2AH0A 3SLED 1GXRA 4BCCA 4JT5C 3RN0D 1VE6A 4NBMA 4BP8A 3J81g 3UVLA 3MVDK 3EQ8A 2H6NA 3VI3A 4JSXC 4A7JA 4LG8A 1O6GA 4H5IA 4K3JB 5THAA 4XYIA 3IUMA 3MKQA
chains in the Genus database with same CATH topology
5K1CC 3MZKA 2IWFA 3EI2B 5FKQA 3CFVA 1OLZA 2IUPA 4D0KA 4ZOYA 1JMXB 4A0AB 4CZVA 2H9MA 2YNOA 4KFMB 1MDAH 3SVWD 5SXMA 1SHYB 3C99A 2CE8A 1TYQC 4R7AB 4X3EA 3JRPA 4FB1D 4AOWA 5EAMA 4J8GA 5IT9g 4J0WA 3IKOA 5EM2A 4J8BA 3RN1D 4FA5D 4E54B 4CI3A 2B4EA 2I3TA 3V9FA 5CXCA 5GMKn 5FKSA 4UI9R 4L9OA 3VGZA 2MTAH 4CC9A 5HQGA 5I5IA 1VYHC 5GSAA 4TZ4A 4GGAA 4GGDA 3UKUC 3SBQA 2QXVA 2H9NA 4A2LA 2P9IC 4U1EI 5FKTA 5B4WA 3J80g 4YVDA 2CN2A 3OKYA 3F3PA 4PSXB 3VA6A 2AGWA 3SN6B 4XEIC 3DSMA 3EU7A 4ZN4A 3IJ1A 3C75H 2CN3A 3I7LA 4J82A 5HE1B 4MK0B 4A08A 2P9LC 3IJCA 2Z2PA 3AFCA 3DXMC 2H9LA 4N14A 5CYKA 4IA9A 2OIZA 2B5LA 3KRXB 2P9PC 3BG0A 3JZNA 4JXMA 2AGZA 1ERJA 5KDOB 4A09B 3SHFA 3P4FA 3PXSD 4PSWB 3SBRA 2I0SA 2IURA 2OVRB 1PBYB 3I2NA 3FRXA 3EI3B 3I8CA 4J87A 4ZOXA 4JSNC 4E5ZB 5GXIA 3ZWLB 4J78A 4GQBB 2OK4A 4CZYA 5EMMB 4E54A 5I5MA 2OVQB 3A0FA 3W15A 3F3FA 3GFCA 3PVUB 4K3ID 2UZXB 3SJLD 4FA9D 3AH8B 3OTTA 1PI6A 3FM0A 4LGNA 2AQ5A 2I0RA 2OVPB 4GGCA 3SXTD 5C2WB 4FWWA 4JT6C 1K32A 3EI4B 2XU7A 3VH0A 4BH6A 3U4YA 2O9KA 4CY5A 2H13A 1U4CA 3GREA 3IJ0A 1XIPA 1NR0A 3I7KA 3N0EA 4J86A 5C2VB 5TF2A 3JZGA 2AGYA 3AL8B 2H6QA 4QRJA 5AFU3 3FGBA 5FQDA 4FA4D 2W18A 2G99A 4QT8A 4CI8A 2CE9A 3I7OA 3L4OD 1K8KC 3I8EA 3EG6A 2IAAA 5TEEA 3I7NA 4CY2A 5JWZA 1B9YA 5AMSA 4O9DA 1U2VC 4ERQA 2OJYA 4ES0A 5AJAA 4IMMA 4Z8LA 2HJBA 4A11A 2G9AA 2I0TA 1B9XA 3EI3A 1JMZB 2I3SA 2H47A 4D6VA 3JROA 1P22A 2YB8B 3E0CA 2PBIB 5EARA 5IJ7E 2TRCB 4QQEA 2CO0A 3SMRA 3UVOA 3EI1B 3UVMA 3DM0A 4ESGA 2AGXA 2YMUA 3I7PA 3OL2B 3OW8A 3CIKB 3V5WB 3PXTD 5IGOA 4PBZA 3OKWA 1GOTB 3N0DA 2H3XA 4Y5RD 4JSVC 4FHLA 1N6FA 2XYIA 3HFQA 3UKRC 2J57G 4O3UB 4LG9A 1TBGA 3I7HA 4ERYA 3AL9A 1N6DA 3EI2A 2BBKH 3C5MA 3RMZD 3NVQA 4GM8A 4XYHA 4J79A 2OK6A 4L3GD 4PC0A 3UR4A 4A0AA 3C9CA 3AL8A 3EWEA 5EAPA 4I79A 3KRWB 2B5MA 5FA5B 3NVNA 2HYEA 2IUVA 2HKRA 4NSXA 5CXBB 3K27A 2Q7QA 3MZLA 2J55H 3PXWD 2H6KA 2BCJB 2HJ4A 5IJ8E 2H68A 1XKSA 1FWXA 4FA1D 4X63B 2XL2A 5EALA 2PM9B 3RLMD 1SQ9A 2IUQA 4O45A 3SFZA 4Y7RA 2PM7B 3K26A 2Z2NA 3IIYA 2J56H 2AH1A 1QNIA 4L3HD 3SBPA 3OL2A 1XHMA 4GQ1A 1MG2A 3OKYB 3EMHA 5HE2B 4X61B 1GG2B 4CY1A 2QC5A 4J73A 5FXYA 3F3GA 2HESX 3I89A 4A08B 5EMJB 2H9PA 5IC7A 4X60B 2PM6B 2CNXA 4J0XA 5CYKB 5H17A 2EBSA 3CFSB 2YNNA 2HXCA 4CY3A 4OWRA 4AEZA 3SWSD 1R5MA 4A0BB 4A09A 3OKTA 3ODTA 2P9SC 5CXBA 4GQ2P 4CI2A 3ULEC 5H14A 4E5ZA 4JD2C 5TEFA 1GP2B 1JOFA 3PVWB 2B5NA 1PGUA 1RI6A 3MXXA 4GMBA 3RRMC 1MG3A 4G56B 5HE3B 3JZHA 4J81A 3BWSA 4QL1A 4OZUA 4JSPC 5EMKB 3BG1A 2GC7A 1A0RB 2PM9A 3RFGA 4FAND 4O3TB 3JPXA 4HDJA 3PE7A 2Z2OA 3MMYA 4O1QD 3EI4A 4ZOZA 5H1MA 1NEXB 2YBAA 4CZXA 2IWKA 4J77A 2GC4A 3JB9L 5C9ZB 5HE0B 3JAMg 5GXHA 2P9KC 4GM3A 1PEVA 3NVXA 4BL0A 5EMLB 5FKRA 1JJUB 1Q47A 5A2Qg 1YFQA 4PBYA 3V7DB 5HYNB 3MKSB 4J84A 4GZ8A 1L0QA 3SCYA 3PSCB 4FAVD 2P9NC 4ZOVA 4CI1A 1SQJA 4A0BA 3UVKA 4ERZA 5EM2B 3L4MD 1S4UX 4GM9A 2YNPA 3PSLA 3B7FA 2XL3A 2CO0C 1OMWB 2HKMA 4EWRA 4BUJC 2AGLA 3ORVD 5CXCB 5IGQA 3RSEC 4PNKB 4A11B 5I5JA 2H14A 2UZYB 3DWLC 1N6EA 5TDHB 2GNQA 4PXWA 4U7AA 4L1QD 3EI1A 5K19A 3IIWA 3RFHA 3DXKC 4A2MA 4H5JA 5FLXg 3UVNA 2AH0A 3SLED 1GXRA 4JT5C 3RN0D 3J81g 3UVLA 4A7JA 2H6NA 4JSXC 4LG8A 4K3JB 4H5IA 5THAA 4XYIA 2P9UC 3MKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K1C C;  3MZK A;  2IWF A;  3EI2 B;  5FKQ A;  3CFV A;  1OLZ A;  2IUP A;  4D0K A;  4ZOY A;  1JMX B;  4A0A B;  4CZV A;  2H9M A;  2YNO A;  4KFM B;  1MDA H;  3SVW D;  5SXM A;  1SHY B;  3C99 A;  2CE8 A;  1TYQ C;  4R7A B;  4X3E A;  3JRP A;  4FB1 D;  4AOW A;  5EAM A;  4J8G A;  5IT9 g;  4J0W A;  3IKO A;  5EM2 A;  4J8B A;  3RN1 D;  4FA5 D;  4E54 B;  4CI3 A;  2B4E A;  2I3T A;  3V9F A;  5CXC A;  5GMK n;  5FKS A;  4UI9 R;  4L9O A;  3VGZ A;  2MTA H;  4CC9 A;  5HQG A;  5I5I A;  1VYH C;  5GSA A;  4TZ4 A;  4GGA A;  4GGD A;  3UKU C;  3SBQ A;  2QXV A;  2H9N A;  4A2L A;  2P9I C;  4U1E I;  5FKT A;  5B4W A;  3J80 g;  4YVD A;  2CN2 A;  3OKY A;  3F3P A;  4PSX B;  3VA6 A;  2AGW A;  3SN6 B;  4XEI C;  3DSM A;  3EU7 A;  4ZN4 A;  3IJ1 A;  3C75 H;  2CN3 A;  3I7L A;  4J82 A;  5HE1 B;  4MK0 B;  4A08 A;  2P9L C;  3IJC A;  2Z2P A;  3AFC A;  3DXM C;  2H9L A;  4N14 A;  5CYK A;  4IA9 A;  2OIZ A;  2B5L A;  3KRX B;  2P9P C;  3BG0 A;  3JZN A;  4JXM A;  2AGZ A;  1ERJ A;  5KDO B;  4A09 B;  3SHF A;  3P4F A;  3PXS D;  4PSW B;  3SBR A;  2I0S A;  2IUR A;  2OVR B;  1PBY B;  3I2N A;  3FRX A;  3EI3 B;  3I8C A;  4J87 A;  4ZOX A;  4JSN C;  4E5Z B;  5GXI A;  3ZWL B;  4J78 A;  4GQB B;  2OK4 A;  4CZY A;  5EMM B;  4E54 A;  5I5M A;  2OVQ B;  3A0F A;  3W15 A;  3F3F A;  3GFC A;  3PVU B;  4K3I D;  2UZX B;  3SJL D;  4FA9 D;  3AH8 B;  3OTT A;  1PI6 A;  3FM0 A;  4LGN A;  2AQ5 A;  2I0R A;  2OVP B;  4GGC A;  3SXT D;  5C2W B;  4FWW A;  4JT6 C;  1K32 A;  3EI4 B;  2XU7 A;  3VH0 A;  4BH6 A;  3U4Y A;  2O9K A;  4CY5 A;  2H13 A;  1U4C A;  3GRE A;  3IJ0 A;  1XIP A;  1NR0 A;  3I7K A;  3N0E A;  4J86 A;  5C2V B;  5TF2 A;  3JZG A;  2AGY A;  3AL8 B;  2H6Q A;  4QRJ A;  5AFU 3;  3FGB A;  5FQD A;  4FA4 D;  2W18 A;  2G99 A;  4QT8 A;  4CI8 A;  2CE9 A;  3I7O A;  3L4O D;  1K8K C;  3I8E A;  3EG6 A;  2IAA A;  5TEE A;  3I7N A;  4CY2 A;  5JWZ A;  1B9Y A;  5AMS A;  4O9D A;  1U2V C;  4ERQ A;  2OJY A;  4ES0 A;  5AJA A;  4IMM A;  4Z8L A;  2HJB A;  4A11 A;  2G9A A;  2I0T A;  1B9X A;  3EI3 A;  1JMZ B;  2I3S A;  2H47 A;  4D6V A;  3JRO A;  1P22 A;  2YB8 B;  3E0C A;  2PBI B;  5EAR A;  5IJ7 E;  2TRC B;  4QQE A;  2CO0 A;  3SMR A;  3UVO A;  3EI1 B;  3UVM A;  3DM0 A;  4ESG A;  2AGX A;  2YMU A;  3I7P A;  3OL2 B;  3OW8 A;  3CIK B;  3V5W B;  3PXT D;  5IGO A;  4PBZ A;  3OKW A;  1GOT B;  3N0D A;  2H3X A;  4Y5R D;  4JSV C;  4FHL A;  1N6F A;  2XYI A;  3HFQ A;  3UKR C;  2J57 G;  4O3U B;  4LG9 A;  1TBG A;  3I7H A;  4ERY A;  3AL9 A;  1N6D A;  3EI2 A;  2BBK H;  3C5M A;  3RMZ D;  3NVQ A;  4GM8 A;  4XYH A;  4J79 A;  2OK6 A;  4L3G D;  4PC0 A;  3UR4 A;  4A0A A;  3C9C A;  3AL8 A;  3EWE A;  5EAP A;  4I79 A;  3KRW B;  2B5M A;  5FA5 B;  3NVN A;  2HYE A;  2IUV A;  2HKR A;  4NSX A;  5CXB B;  3K27 A;  2Q7Q A;  3MZL A;  2J55 H;  3PXW D;  2H6K A;  2BCJ B;  2HJ4 A;  5IJ8 E;  2H68 A;  1XKS A;  1FWX A;  4FA1 D;  4X63 B;  2XL2 A;  5EAL A;  2PM9 B;  3RLM D;  1SQ9 A;  2IUQ A;  4O45 A;  3SFZ A;  4Y7R A;  2PM7 B;  3K26 A;  2Z2N A;  3IIY A;  2J56 H;  2AH1 A;  1QNI A;  4L3H D;  3SBP A;  3OL2 A;  1XHM A;  4GQ1 A;  1MG2 A;  3OKY B;  3EMH A;  5HE2 B;  4X61 B;  1GG2 B;  4CY1 A;  2QC5 A;  4J73 A;  5FXY A;  3F3G A;  2HES X;  3I89 A;  4A08 B;  5EMJ B;  2H9P A;  5IC7 A;  4X60 B;  2PM6 B;  2CNX A;  4J0X A;  5CYK B;  5H17 A;  2EBS A;  3CFS B;  2YNN A;  2HXC A;  4CY3 A;  4OWR A;  4AEZ A;  3SWS D;  1R5M A;  4A0B B;  4A09 A;  3OKT A;  3ODT A;  2P9S C;  5CXB A;  4GQ2 P;  4CI2 A;  3ULE C;  5H14 A;  4E5Z A;  4JD2 C;  5TEF A;  1GP2 B;  1JOF A;  3PVW B;  2B5N A;  1PGU A;  1RI6 A;  3MXX A;  4GMB A;  3RRM C;  1MG3 A;  4G56 B;  5HE3 B;  3JZH A;  4J81 A;  3BWS A;  4QL1 A;  4OZU A;  4JSP C;  5EMK B;  3BG1 A;  2GC7 A;  1A0R B;  2PM9 A;  3RFG A;  4FAN D;  4O3T B;  3JPX A;  4HDJ A;  3PE7 A;  2Z2O A;  3MMY A;  4O1Q D;  3EI4 A;  4ZOZ A;  5H1M A;  1NEX B;  2YBA A;  4CZX A;  2IWK A;  4J77 A;  2GC4 A;  3JB9 L;  5C9Z B;  5HE0 B;  3JAM g;  5GXH A;  2P9K C;  4GM3 A;  1PEV A;  3NVX A;  4BL0 A;  5EML B;  5FKR A;  1JJU B;  1Q47 A;  5A2Q g;  1YFQ A;  4PBY A;  3V7D B;  5HYN B;  3MKS B;  4J84 A;  4GZ8 A;  1L0Q A;  3SCY A;  3PSC B;  4FAV D;  2P9N C;  4ZOV A;  4CI1 A;  1SQJ A;  4A0B A;  3UVK A;  4ERZ A;  5EM2 B;  3L4M D;  1S4U X;  4GM9 A;  2YNP A;  3PSL A;  3B7F A;  2XL3 A;  2CO0 C;  1OMW B;  2HKM A;  4EWR A;  4BUJ C;  2AGL A;  3ORV D;  5CXC B;  5IGQ A;  3RSE C;  4PNK B;  4A11 B;  5I5J A;  2H14 A;  2UZY B;  3DWL C;  1N6E A;  5TDH B;  2GNQ A;  4PXW A;  4U7A A;  4L1Q D;  3EI1 A;  5K19 A;  3IIW A;  3RFH A;  3DXK C;  4A2M A;  4H5J A;  5FLX g;  3UVN A;  2AH0 A;  3SLE D;  1GXR A;  4JT5 C;  3RN0 D;  3J81 g;  3UVL A;  4A7J A;  2H6N A;  4JSX C;  4LG8 A;  4K3J B;  4H5I A;  5THA A;  4XYI A;  2P9U C;  3MKQ A; 
#chains in the Genus database with same CATH topology
 5K1C C;  3MZK A;  1JTD B;  2IWF A;  2VZ1 A;  3EI2 B;  5FKQ A;  3CFV A;  1OLZ A;  2IUP A;  4D0K A;  4ZOY A;  1JMX B;  3O4H A;  4A0A B;  4CZV A;  2H9M A;  2YNO A;  1K3I A;  4KFM B;  1MDA H;  3IUR A;  3SVW D;  5SXM A;  2EIB A;  1SHY B;  3C99 A;  2CE8 A;  1TYQ C;  4R7A B;  3ZE1 A;  4X3E A;  3JRP A;  4FB1 D;  4AOW A;  1BPO A;  5EAM A;  4J8G A;  5IT9 g;  4J0W A;  3IKO A;  5EM2 A;  4J8B A;  3RN1 D;  4FA5 D;  4E54 B;  5E6R A;  4CI3 A;  2B4E A;  2I3T A;  3V9F A;  1T2X A;  5CXC A;  5GMK n;  5FKS A;  4UI9 R;  4L9O A;  3VGZ A;  2MTA H;  4CC9 A;  3GC3 B;  4DNU A;  5HQG A;  5I5I A;  1VYH C;  5GSA A;  3IUQ A;  4TZ4 A;  4GGA A;  4GGD A;  3UKU C;  3SBQ A;  2QXV A;  2H9N A;  2EIC A;  4A2L A;  2P9I C;  4U1E I;  5FKT A;  5B4W A;  2QR5 A;  3T3M A;  3J80 g;  4YVD A;  3ZDY A;  2CN2 A;  3OKY A;  4WK4 A;  3F3P A;  4PSX B;  3VA6 A;  1O6F A;  2AGW A;  4BCD A;  3SN6 B;  4XEI C;  3DSM A;  3EU7 A;  4ZN4 A;  3IJ1 A;  3C75 H;  2CN3 A;  2VC2 A;  3I7L A;  4J82 A;  5HE1 B;  4MK0 B;  4A08 A;  2P9L C;  3IJC A;  2Z2P A;  3AFC A;  1I2M B;  3DXM C;  2H9L A;  4N14 A;  5CYK A;  4G1M A;  4O02 A;  3IUL A;  4IA9 A;  4WK2 A;  5C92 A;  2OIZ A;  3NIG A;  2B5L A;  3DDU A;  3KRX B;  3EQ9 A;  2P9P C;  3IJE A;  3BG0 A;  5E6U A;  5M5U A;  3JZN A;  3MUO A;  4JXM A;  2AGZ A;  1ERJ A;  3ZE2 A;  5KDO B;  4A09 B;  3SHF A;  3P4F A;  4AMY A;  2VDP A;  3PXS D;  4PSW B;  3SBR A;  2I0S A;  2IUR A;  2XDW A;  4JHN A;  2OVR B;  1PBY B;  3I2N A;  3FRX A;  3EI3 B;  5FFO A;  3I8C A;  4J87 A;  3IUJ A;  4G1E A;  4JSN C;  4ZOX A;  4E5Z B;  5GXI A;  2VDN A;  4J78 A;  3ZWL B;  4GQB B;  2OK4 A;  4CZY A;  3OF7 A;  5EMM B;  4E54 A;  5I5M A;  3V4V A;  4Z7O A;  2OVQ B;  3A0F A;  3W15 A;  3F3F A;  3GFC A;  3PVU B;  4RE5 A;  4K3I D;  2UZX B;  3SJL D;  4FA9 D;  3AH8 B;  3OTT A;  1PI6 A;  3O4G A;  3FM0 A;  4LGN A;  2AQ5 A;  2I0R A;  2OVP B;  4GGC A;  3SXT D;  5C2W B;  5M5S A;  4FWW A;  4JT6 C;  1K32 A;  3EI4 B;  2XU7 A;  2XE4 A;  3VH0 A;  4BH6 A;  3U4Y A;  5M5V A;  2O9K A;  4CY5 A;  3K72 A;  1C9I A;  2H13 A;  1U4C A;  3FCS A;  3GRE A;  3IJ0 A;  1XIP A;  1NR0 A;  4UM8 A;  3I7K A;  3N0E A;  4J86 A;  5C2V B;  2VDO A;  1A12 A;  2VDK A;  5TF2 A;  3JZG A;  2AGY A;  3AL8 B;  2H6Q A;  4QRJ A;  5AFU 3;  2JKX A;  3FGB A;  5FQD A;  2P9U C;  4FA4 D;  2W18 A;  2G99 A;  4QT8 A;  4CI8 A;  2CE9 A;  3I7O A;  3L4O D;  1K8K C;  3I8E A;  3EG6 A;  2IAA A;  1VE7 A;  5TEE A;  3I7N A;  4CY2 A;  5JWZ A;  1B9Y A;  5AMS A;  4O9D A;  3ZE0 A;  1U2V C;  4ERQ A;  2OJY A;  4ES0 A;  5AJA A;  4IMM A;  4Z8L A;  2HJB A;  4A11 A;  2G9A A;  2I0T A;  4D9S A;  2VZ3 A;  1B9X A;  3EI3 A;  1JMZ B;  2I3S A;  2H47 A;  3QHY B;  4D6V A;  3JRO A;  1P22 A;  2YB8 B;  3E0C A;  2PBI B;  5EAR A;  5IJ7 E;  2TRC B;  1H2Z A;  4QQE A;  2CO0 A;  3SMR A;  4MMY A;  3UVO A;  3EI1 B;  4MMX A;  3UVM A;  3DM0 A;  4ESG A;  2AGX A;  2YMU A;  3I7P A;  3OL2 B;  3OW8 A;  4WK0 A;  3CIK B;  3V5W B;  3PXT D;  5IGO A;  4PBZ A;  3OKW A;  1GOT B;  1E5T A;  3N0D A;  2H3X A;  4Y5R D;  4JSV C;  3GD1 I;  1N6F A;  1TYE A;  2XYI A;  3HFQ A;  4FHL A;  1GOH A;  5M5R A;  3UKR C;  5C86 A;  2J57 G;  4O3U B;  4LG9 A;  4O2W A;  1TBG A;  3I7H A;  3ZDZ A;  4ERY A;  3AL9 A;  1N6D A;  1UTC A;  3EI2 A;  2BBK H;  3C5M A;  3RMZ D;  3NVQ A;  2VDM A;  4GM8 A;  4XYH A;  4J79 A;  2OK6 A;  4L3G D;  4PC0 A;  3UR4 A;  4A0A A;  3C9C A;  1QFS A;  3AL8 A;  3EWE A;  3MUN A;  5EAP A;  4I79 A;  3KRW B;  2B5M A;  5FA5 B;  3NVN A;  2HYE A;  2IUV A;  2HKR A;  2HU7 A;  2VDL A;  4NSX A;  5CXB B;  3K27 A;  1UOQ A;  2Q7Q A;  3MZL A;  2J55 H;  3PXW D;  4WJK A;  2H6K A;  1GOF A;  2BCJ B;  2HJ4 A;  5FFG A;  1E8M A;  5IJ8 E;  2H68 A;  1XKS A;  4Z7Q A;  1FWX A;  4FA1 D;  2EIE A;  4X63 B;  3K71 A;  2XL2 A;  1E8N A;  5EAL A;  2PM9 B;  3O4I A;  3RLM D;  1SQ9 A;  2IUQ A;  4G55 A;  4O45 A;  3SFZ A;  4Y7R A;  2PM7 B;  3K26 A;  3V4P A;  2Z2N A;  4MMZ A;  3IIY A;  2J56 H;  2AH1 A;  1QNI A;  4L3H D;  3SBP A;  3OL2 A;  1XHM A;  3FCU A;  4GQ1 A;  1MG2 A;  3OKY B;  3EMH A;  1H2W A;  5HE2 B;  4X61 B;  1GG2 B;  4CY1 A;  2QC5 A;  4J73 A;  4NAA A;  5FXY A;  3F3G A;  2BKL A;  4AN1 A;  1JV2 A;  2HES X;  2EID A;  3ZDX A;  1VZ3 A;  3I89 A;  3VI4 A;  4A08 B;  4UM9 A;  1M1X A;  4AN0 A;  5EMJ B;  2H9P A;  5IC7 A;  1H2Y A;  4X60 B;  2PM6 B;  2CNX A;  2VDQ A;  4J0X A;  5CYK B;  2EBS A;  4NC4 A;  5H17 A;  4DNV A;  3K6S A;  3CFS B;  4AMZ A;  2YNN A;  2HXC A;  4CY3 A;  2HU8 A;  4OWR A;  4AEZ A;  3SWS D;  1R5M A;  3NIF A;  4A0B B;  2XZG A;  4A09 A;  3OKT A;  3ODT A;  3EQ7 A;  2P9S C;  5CXB A;  1UOP A;  4GQ2 P;  4CI2 A;  3T3P A;  1H2X A;  5H14 A;  5HDB A;  3ULE C;  4E5Z A;  4JD2 C;  5TEF A;  1GP2 B;  1JOF A;  3PVW B;  2B5N A;  3O4J A;  1PGU A;  1RI6 A;  3MXX A;  4QAM A;  4GMB A;  3RRM C;  1MG3 A;  4BCB A;  2HU5 A;  4G56 B;  3JZH A;  5HE3 B;  4J81 A;  4Z7N A;  3BWS A;  1QFM A;  4QL1 A;  4OZU A;  4JSP C;  5EMK B;  3BG1 A;  2GC7 A;  4DNW A;  1A0R B;  2PM9 A;  3RFG A;  4FAN D;  4O3T B;  3JPX A;  1VZ2 A;  4HDJ A;  3PE7 A;  2Z2O A;  3MMY A;  4O1Q D;  3EI4 A;  4ZOZ A;  5H1M A;  1NEX B;  5M5T A;  2YBA A;  3IVM A;  4CZX A;  2IWK A;  4J77 A;  1C9L A;  2GC4 A;  5M61 A;  3JB9 L;  5C9Z B;  5HE0 B;  3JAM g;  5GXH A;  4RE6 A;  2P9K C;  4GM3 A;  1PEV A;  3NVX A;  4BL0 A;  5EML B;  3KCI A;  5FKR A;  1U8C A;  1JJU B;  1YR2 A;  1UOO A;  1Q47 A;  5A2Q g;  1YFQ A;  4PBY A;  3V7D B;  5HYN B;  3MKS B;  4J84 A;  4JHP C;  4GZ8 A;  1L0Q A;  3SCY A;  3PSC B;  4FAV D;  2P9N C;  4ZOV A;  4L1M A;  4CI1 A;  1SQJ A;  4NEN A;  4A0B A;  3QI0 A;  3UVK A;  1GOG A;  3NID A;  4ERZ A;  5EM2 B;  3L4M D;  4IRZ A;  1S4U X;  4GM9 A;  2VDR A;  2YNP A;  3PSL A;  3B7F A;  2XL3 A;  2CO0 C;  1OMW B;  2HKM A;  4BP9 A;  4EWR A;  4BUJ C;  2AGL A;  3ORV D;  5CXC B;  2QZP A;  3RSE C;  5IGQ A;  4PNK B;  4A11 B;  5I5J A;  2H14 A;  4AX4 A;  2UZY B;  3DWL C;  1N6E A;  5TDH B;  2GNQ A;  4PXW A;  3IUN A;  4U7A A;  4L1Q D;  2WQ8 A;  3EI1 A;  5E6S A;  5K19 A;  3IIW A;  1L5G A;  3RFH A;  3DXK C;  4A2M A;  4H5J A;  5FLX g;  3UVN A;  2AH0 A;  3SLE D;  1GXR A;  4BCC A;  4JT5 C;  3RN0 D;  1VE6 A;  4NBM A;  4BP8 A;  3J81 g;  3UVL A;  3MVD K;  3EQ8 A;  2H6N A;  3VI3 A;  4JSX C;  4A7J A;  4LG8 A;  1O6G A;  4H5I A;  4K3J B;  5THA A;  4XYI A;  3IUM A;  3MKQ A; 
#chains in the Genus database with same CATH homology
 5K1C C;  3MZK A;  2IWF A;  3EI2 B;  5FKQ A;  3CFV A;  1OLZ A;  2IUP A;  4D0K A;  4ZOY A;  1JMX B;  4A0A B;  4CZV A;  2H9M A;  2YNO A;  4KFM B;  1MDA H;  3SVW D;  5SXM A;  1SHY B;  3C99 A;  2CE8 A;  1TYQ C;  4R7A B;  4X3E A;  3JRP A;  4FB1 D;  4AOW A;  5EAM A;  4J8G A;  5IT9 g;  4J0W A;  3IKO A;  5EM2 A;  4J8B A;  3RN1 D;  4FA5 D;  4E54 B;  4CI3 A;  2B4E A;  2I3T A;  3V9F A;  5CXC A;  5GMK n;  5FKS A;  4UI9 R;  4L9O A;  3VGZ A;  2MTA H;  4CC9 A;  5HQG A;  5I5I A;  1VYH C;  5GSA A;  4TZ4 A;  4GGA A;  4GGD A;  3UKU C;  3SBQ A;  2QXV A;  2H9N A;  4A2L A;  2P9I C;  4U1E I;  5FKT A;  5B4W A;  3J80 g;  4YVD A;  2CN2 A;  3OKY A;  3F3P A;  4PSX B;  3VA6 A;  2AGW A;  3SN6 B;  4XEI C;  3DSM A;  3EU7 A;  4ZN4 A;  3IJ1 A;  3C75 H;  2CN3 A;  3I7L A;  4J82 A;  5HE1 B;  4MK0 B;  4A08 A;  2P9L C;  3IJC A;  2Z2P A;  3AFC A;  3DXM C;  2H9L A;  4N14 A;  5CYK A;  4IA9 A;  2OIZ A;  2B5L A;  3KRX B;  2P9P C;  3BG0 A;  3JZN A;  4JXM A;  2AGZ A;  1ERJ A;  5KDO B;  4A09 B;  3SHF A;  3P4F A;  3PXS D;  4PSW B;  3SBR A;  2I0S A;  2IUR A;  2OVR B;  1PBY B;  3I2N A;  3FRX A;  3EI3 B;  3I8C A;  4J87 A;  4ZOX A;  4JSN C;  4E5Z B;  5GXI A;  3ZWL B;  4J78 A;  4GQB B;  2OK4 A;  4CZY A;  5EMM B;  4E54 A;  5I5M A;  2OVQ B;  3A0F A;  3W15 A;  3F3F A;  3GFC A;  3PVU B;  4K3I D;  2UZX B;  3SJL D;  4FA9 D;  3AH8 B;  3OTT A;  1PI6 A;  3FM0 A;  4LGN A;  2AQ5 A;  2I0R A;  2OVP B;  4GGC A;  3SXT D;  5C2W B;  4FWW A;  4JT6 C;  1K32 A;  3EI4 B;  2XU7 A;  3VH0 A;  4BH6 A;  3U4Y A;  2O9K A;  4CY5 A;  2H13 A;  1U4C A;  3GRE A;  3IJ0 A;  1XIP A;  1NR0 A;  3I7K A;  3N0E A;  4J86 A;  5C2V B;  5TF2 A;  3JZG A;  2AGY A;  3AL8 B;  2H6Q A;  4QRJ A;  5AFU 3;  3FGB A;  5FQD A;  4FA4 D;  2W18 A;  2G99 A;  4QT8 A;  4CI8 A;  2CE9 A;  3I7O A;  3L4O D;  1K8K C;  3I8E A;  3EG6 A;  2IAA A;  5TEE A;  3I7N A;  4CY2 A;  5JWZ A;  1B9Y A;  5AMS A;  4O9D A;  1U2V C;  4ERQ A;  2OJY A;  4ES0 A;  5AJA A;  4IMM A;  4Z8L A;  2HJB A;  4A11 A;  2G9A A;  2I0T A;  1B9X A;  3EI3 A;  1JMZ B;  2I3S A;  2H47 A;  4D6V A;  3JRO A;  1P22 A;  2YB8 B;  3E0C A;  2PBI B;  5EAR A;  5IJ7 E;  2TRC B;  4QQE A;  2CO0 A;  3SMR A;  3UVO A;  3EI1 B;  3UVM A;  3DM0 A;  4ESG A;  2AGX A;  2YMU A;  3I7P A;  3OL2 B;  3OW8 A;  3CIK B;  3V5W B;  3PXT D;  5IGO A;  4PBZ A;  3OKW A;  1GOT B;  3N0D A;  2H3X A;  4Y5R D;  4JSV C;  4FHL A;  1N6F A;  2XYI A;  3HFQ A;  3UKR C;  2J57 G;  4O3U B;  4LG9 A;  1TBG A;  3I7H A;  4ERY A;  3AL9 A;  1N6D A;  3EI2 A;  2BBK H;  3C5M A;  3RMZ D;  3NVQ A;  4GM8 A;  4XYH A;  4J79 A;  2OK6 A;  4L3G D;  4PC0 A;  3UR4 A;  4A0A A;  3C9C A;  3AL8 A;  3EWE A;  5EAP A;  4I79 A;  3KRW B;  2B5M A;  5FA5 B;  3NVN A;  2HYE A;  2IUV A;  2HKR A;  4NSX A;  5CXB B;  3K27 A;  2Q7Q A;  3MZL A;  2J55 H;  3PXW D;  2H6K A;  2BCJ B;  2HJ4 A;  5IJ8 E;  2H68 A;  1XKS A;  1FWX A;  4FA1 D;  4X63 B;  2XL2 A;  5EAL A;  2PM9 B;  3RLM D;  1SQ9 A;  2IUQ A;  4O45 A;  3SFZ A;  4Y7R A;  2PM7 B;  3K26 A;  2Z2N A;  3IIY A;  2J56 H;  2AH1 A;  1QNI A;  4L3H D;  3SBP A;  3OL2 A;  1XHM A;  4GQ1 A;  1MG2 A;  3OKY B;  3EMH A;  5HE2 B;  4X61 B;  1GG2 B;  4CY1 A;  2QC5 A;  4J73 A;  5FXY A;  3F3G A;  2HES X;  3I89 A;  4A08 B;  5EMJ B;  2H9P A;  5IC7 A;  4X60 B;  2PM6 B;  2CNX A;  4J0X A;  5CYK B;  5H17 A;  2EBS A;  3CFS B;  2YNN A;  2HXC A;  4CY3 A;  4OWR A;  4AEZ A;  3SWS D;  1R5M A;  4A0B B;  4A09 A;  3OKT A;  3ODT A;  2P9S C;  5CXB A;  4GQ2 P;  4CI2 A;  3ULE C;  5H14 A;  4E5Z A;  4JD2 C;  5TEF A;  1GP2 B;  1JOF A;  3PVW B;  2B5N A;  1PGU A;  1RI6 A;  3MXX A;  4GMB A;  3RRM C;  1MG3 A;  4G56 B;  5HE3 B;  3JZH A;  4J81 A;  3BWS A;  4QL1 A;  4OZU A;  4JSP C;  5EMK B;  3BG1 A;  2GC7 A;  1A0R B;  2PM9 A;  3RFG A;  4FAN D;  4O3T B;  3JPX A;  4HDJ A;  3PE7 A;  2Z2O A;  3MMY A;  4O1Q D;  3EI4 A;  4ZOZ A;  5H1M A;  1NEX B;  2YBA A;  4CZX A;  2IWK A;  4J77 A;  2GC4 A;  3JB9 L;  5C9Z B;  5HE0 B;  3JAM g;  5GXH A;  2P9K C;  4GM3 A;  1PEV A;  3NVX A;  4BL0 A;  5EML B;  5FKR A;  1JJU B;  1Q47 A;  5A2Q g;  1YFQ A;  4PBY A;  3V7D B;  5HYN B;  3MKS B;  4J84 A;  4GZ8 A;  1L0Q A;  3SCY A;  3PSC B;  4FAV D;  2P9N C;  4ZOV A;  4CI1 A;  1SQJ A;  4A0B A;  3UVK A;  4ERZ A;  5EM2 B;  3L4M D;  1S4U X;  4GM9 A;  2YNP A;  3PSL A;  3B7F A;  2XL3 A;  2CO0 C;  1OMW B;  2HKM A;  4EWR A;  4BUJ C;  2AGL A;  3ORV D;  5CXC B;  5IGQ A;  3RSE C;  4PNK B;  4A11 B;  5I5J A;  2H14 A;  2UZY B;  3DWL C;  1N6E A;  5TDH B;  2GNQ A;  4PXW A;  4U7A A;  4L1Q D;  3EI1 A;  5K19 A;  3IIW A;  3RFH A;  3DXK C;  4A2M A;  4H5J A;  5FLX g;  3UVN A;  2AH0 A;  3SLE D;  1GXR A;  4JT5 C;  3RN0 D;  3J81 g;  3UVL A;  4A7J A;  2H6N A;  4JSX C;  4LG8 A;  4K3J B;  4H5I A;  5THA A;  4XYI A;  2P9U C;  3MKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...