2CNXA

Wdr5 and histone h3 lysine 4 dimethyl complex at 2.1 angstrom
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
306
structure length
306
Chain Sequence
TPVKPNYALMFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGMCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords WD-REPEAT PROTEIN 5
publication title Histone H3 Recognition and Presentation by the Wdr5 Module of the Mll1 Complex
pubmed doi rcsb
source organism Homo sapiens
total genus 96
structure length 306
sequence length 306
ec nomenclature
pdb deposition date 2006-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2cnxA00
2P9PC 4ZOZA 2H3XA 4PBYA 2H9NA 4FB1D 4XEIC 3SN6B 3SJLD 2HESX 3MKQA 1PGUA 3N0DA 3EMHA 3PXWD 3DM0A 4JSPC 4O3TB 4A0BA 2B5LA 4YVDA 3RN1D 4A7JA 4OZUA 4LG9A 4QQEA 3AFCA 4ERZA 5CXBA 3JB9L 3W15A 4FAND 1VYHC 3ODTA 2GC4A 4MK0B 3SLED 3JZNA 1JMXB 3SBPA 3KRXB 3CFVA 4CY1A 4N14A 5CXCA 2H9MA 4E5ZA 4UI9R 2AGYA 4J86A 2QXVA 3L4OD 5TF2A 2IAAA 4ESGA 4QT8A 4O9DA 4BH6A 3I7KA 2IUVA 5SXMA 5FA5B 1QNIA 4GQ2P 4X61B 3HFQA 3AL8B 4GMBA 3NVQA 2B4EA 4IMMA 3I7PA 3JROA 5EMMB 2AH0A 3OKYA 2P9UC 4CY5A 3N0EA 2XU7A 1SHYB 2XYIA 4JD2C 5CYKA 5GXIA 4BL0A 1TBGA 1S4UX 2CN3A 2HJBA 1MG2A 3JPXA 3AH8B 2YNPA 4NSXA 2B5NA 2OVQB 5EALA 2Z2NA 5IJ7E 4J81A 1OLZA 2CNXA 5EMJB 3EI2A 2YMUA 5FXYA 5C9ZB 2CN2A 3NVNA 4J77A 4A0BB 2TRCB 4CI8A 3L4MD 3IIYA 3IKOA 1B9YA 1MDAH 4IA9A 3B7FA 3CFSB 3RLMD 3RSEC 2CO0C 3E0CA 3UVNA 3RRMC 1NEXB 5EM2A 4Z8LA 2P9LC 2J57G 4BUJC 2IURA 3SBQA 3RN0D 1RI6A 2HYEA 5CXCB 5EMKB 3UVMA 3DXMC 4E5ZB 3C9CA 2AGXA 4HDJA 2PM7B 3I2NA 3EI3A 5IT9g 3F3FA 5HE1B 4E54A 2OK6A 3MKSB 4QRJA 1PI6A 3RMZD 2H6QA 4JT6C 4FA4D 2UZYB 2I0SA 1GP2B 2H13A 4L9OA 1N6FA 1A0RB 5CYKB 5IGOA 4PNKB 3FGBA 4J73A 4Y5RD 1YFQA 4U7AA 3I8EA 4ERYA 5FLXg 3OKTA 5HQGA 3SVWD 2G99A 4FA1D 4LG8A 4FWWA 2J56H 3JAMg 3EI2B 1PBYB 1TYQC 2Q7QA 5KDOB 3DSMA 4JT5C 4LGNA 3PVUB 2EBSA 5FKTA 2QC5A 2HKRA 3SMRA 4PXWA 3MXXA 1PEVA 4A2MA 1FWXA 2G9AA 4QL1A 4X60B 3MZLA 2I3SA 3DWLC 3UVKA 5A2Qg 4CI1A 3P4FA 4GM8A 2XL3A 5FKQA 2OVPB 4CZXA 2J55H 1GOTB 3BWSA 5EM2B 5K19A 2IWFA 4J0WA 3PVWB 4FA5D 5K1CC 2P9IC 4CY3A 3EI1A 2P9SC 3RFHA 1JOFA 3BG1A 3I89A 3AL9A 4ES0A 3A0FA 3OTTA 4PSWB 2W18A 1ERJA 4A09A 4GM9A 5EAPA 4GGCA 4X3EA 5TEFA 3SFZA 3IJCA 4PSXB 4E54B 2PBIB 1XHMA 2P9KC 2H9LA 3IIWA 3J80g 3UR4A 1GG2B 5HYNB 2I3TA 5H17A 4J82A 1XKSA 4TZ4A 5AMSA 4CI3A 5HE3B 4EWRA 4J0XA 2AGZA 4U1EI 5CXBB 4CC9A 5FQDA 3V9FA 3PXTD 4JXMA 5B4WA 4ZN4A 2AGLA 2BBKH 2UZXB 4JSXC 5IC7A 5IGQA 4XYIA 3VGZA 3I7NA 1U4CA 3OW8A 5I5IA 2AH1A 5EARA 4G56B 3ZWLB 3SXTD 4ERQA 1K32A 4J87A 3KRWB 3V7DB 3V5WB 3JZGA 3PSCB 5THAA 4J79A 3MZKA 4A11A 4O45A 2GC7A 4PC0A 4J8BA 5I5MA 3UVOA 4ZOYA 3SHFA 3ULEC 1N6DA 2BCJB 1R5MA 3BG0A 5FKRA 5H1MA 3RFGA 3EI1B 2H68A 3OKYB 4A2LA 4H5IA 4H5JA 4GQBB 2I0RA 2P9NC 2IUPA 3C5MA 5GMKn 1MG3A 2HXCA 3OL2A 4A09B 4GGAA 3MMYA 4I79A 5TEEA 3VA6A 4CZVA 1U2VC 4R7AB 2YNOA 1K8KC 1SQJA 3EI4A 2IWKA 3I7LA 3J81g 4A08A 4D6VA 3F3GA 5IJ8E 1GXRA 3C75H 2GNQA 1JMZB 4FAVD 3C99A 2AQ5A 5AJAA 3SCYA 4A0AA 5C2WB 5GSAA 3PSLA 4K3JB 3IJ1A 2I0TA 3ORVD 2XL2A 4J78A 3PXSD 5AFU3 2PM6B 2CO0A 3FM0A 2PM9A 5HE2B 4J8GA 4JSVC 2HJ4A 2YNNA 3EWEA 4ZOVA 3K27A 2CE9A 4L3HD 4O3UB 3UKRC 3CIKB 1JJUB 2OVRB 4L1QD 3UVLA 1SQ9A 4PBZA 4GQ1A 5I5JA 3DXKC 4Y7RA 4FHLA 4A11B 3UKUC 3EI3B 4GM3A 1L0QA 4K3ID 4D0KA 3VH0A 2H6KA 5HE0B 3I8CA 5GXHA 5EAMA 2HKMA 3EU7A 4AOWA 1XIPA 4OWRA 2Z2OA 5JWZA 3SWSD 3EG6A 1OMWB 2IUQA 4AEZA 4CZYA 2OIZA 2OK4A 4J84A 3GFCA 5H14A 2AGWA 3OL2B 3F3PA 1N6EA 2MTAH 5C2VB 1NR0A 3EI4B 4FA9D 4A08B 2CE8A 1Q47A 4L3GD 4JSNC 3SBRA 4O1QD 3K26A 4GGDA 3IJ0A 2YB8B 2OJYA 4GZ8A 4A0AB 5EMLB 2H9PA 3PE7A 3U4YA 4CY2A 4ZOXA 2YBAA 2PM9B 3FRXA 3I7HA 5TDHB 3AL8A 3OKWA 2H6NA 3NVXA 1B9XA 4XYHA 3JRPA 4X63B 2H47A 1P22A 2O9KA 2H14A 3I7OA 2B5MA 3JZHA 3GREA 2Z2PA 4KFMB 4CI2A 5FKSA
chains in the Genus database with same CATH superfamily
2P9PC 4ZOZA 2H3XA 4PBYA 2H9NA 4FB1D 4XEIC 3SN6B 3SJLD 5M5TA 2HESX 3MKQA 1PGUA 2HU5A 3N0DA 3EMHA 3PXWD 3DM0A 5C86A 4JSPC 4O3TB 1I2MB 2B5LA 4A0BA 5M5RA 4YVDA 3RN1D 4A7JA 4OZUA 4BP9A 4LG9A 4QQEA 3AFCA 4ERZA 5CXBA 3JB9L 3W15A 4FAND 1VYHC 3ODTA 2VDPA 2GC4A 4MK0B 3SLED 3JZNA 1JMXB 2VDQA 1UOQA 3SBPA 3KRXB 3CFVA 4CY1A 4N14A 4O02A 5CXCA 2XDWA 1C9LA 2H9MA 4E5ZA 4UI9R 2AGYA 4J86A 2QXVA 3L4OD 5TF2A 2IAAA 4ESGA 4QT8A 4D9SA 4O9DA 4BH6A 3I7KA 2IUVA 3IVMA 5SXMA 4WJKA 5FA5B 1QNIA 4GQ2P 4X61B 2XE4A 4MMYA 3HFQA 3AL8B 4GMBA 4UM9A 3NVQA 2B4EA 1YR2A 4IMMA 3I7PA 3JROA 5EMMB 2AH0A 3OKYA 2P9UC 5E6SA 4CY5A 3N0EA 3IUQA 2XU7A 1SHYB 2VDRA 2XYIA 4JD2C 2JKXA 5CYKA 1JV2A 4AMZA 5GXIA 4BL0A 1TBGA 1S4UX 2CN3A 2HJBA 1MG2A 3JPXA 3AH8B 3GC3B 2YNPA 4NSXA 4DNWA 2B5NA 2OVQB 5EALA 2Z2NA 5IJ7E 1OLZA 2CNXA 4J81A 1GOFA 5EMJB 2YMUA 5FXYA 3EI2A 3K6SA 5C9ZB 5M5VA 4NBMA 2CN2A 4NC4A 3NVNA 4J77A 4A0BB 2TRCB 3ZDYA 1BPOA 3OF7A 1T2XA 4CI8A 3L4MD 1C9IA 3IIYA 3IKOA 1B9YA 1MDAH 4IA9A 3B7FA 3CFSB 3RLMD 3RSEC 2HU7A 5E6RA 2CO0C 2VDMA 3E0CA 3UVNA 3RRMC 1NEXB 5EM2A 2VZ3A 4Z8LA 2P9LC 4DNVA 2J57G 4BUJC 2IURA 3SBQA 3MUNA 1JTDB 1RI6A 3RN0D 5CXCB 5EMKB 2HYEA 3KCIA 3UVMA 4Z7QA 3DXMC 4Z7OA 4E5ZB 3C9CA 3V4VA 4L1MA 1H2XA 2AGXA 4HDJA 4AN0A 3ZE1A 4IRZA 2PM7B 3NIGA 3I2NA 3EI3A 5HDBA 5IT9g 5C92A 1H2YA 3F3FA 3QI0A 5HE1B 4E54A 2OK6A 3MKSB 4QRJA 4G1MA 1PI6A 1UOOA 3RMZD 2H6QA 2VZ1A 4JT6C 4FA4D 2UZYB 2VC2A 2I0SA 1GP2B 2H13A 2QR5A 4G1EA 1O6FA 1N6FA 4L9OA 1QFSA 1A0RB 5CYKB 5IGOA 4PNKB 3FGBA 4J73A 4Y5RD 1YFQA 4BCDA 4U7AA 1VZ3A 3I8EA 4ERYA 5FLXg 3OKTA 5HQGA 3SVWD 4JHNA 2G99A 4FA1D 4LG8A 4FWWA 2J56H 3JAMg 3EI2B 1PBYB 3IUNA 4WK2A 1TYQC 2Q7QA 5KDOB 3DSMA 4JT5C 4LGNA 3PVUB 2EBSA 3O4IA 5FKTA 5FFOA 2QC5A 2HKRA 3SMRA 4PXWA 3MXXA 1PEVA 4RE5A 3VI3A 4A2MA 1FWXA 2G9AA 4QL1A 4X60B 3MZLA 2I3SA 3DWLC 3UVKA 5A2Qg 4CI1A 3EQ9A 3P4FA 4GM8A 2XL3A 5FKQA 2OVPB 4CZXA 2J55H 1M1XA 4BCCA 1GOTB 3BWSA 2BKLA 1TYEA 5EM2B 5K19A 2IWFA 4J0WA 2QZPA 3PVWB 3MUOA 4FA5D 5K1CC 2P9IC 4CY3A 4AX4A 1A12A 3EI1A 2P9SC 3RFHA 1JOFA 3BG1A 3I89A 3ZDXA 3AL9A 4ES0A 3A0FA 3OTTA 4PSWB 2W18A 2VDOA 1ERJA 4A09A 4GM9A 5EAPA 4GGCA 4X3EA 5TEFA 3SFZA 3IJCA 4PSXB 4MMZA 4E54B 2PBIB 1XHMA 2P9KC 2H9LA 3IIWA 3O4GA 3EQ7A 3J80g 3UR4A 1GG2B 5HYNB 2I3TA 3IUMA 4UM8A 5H17A 4J82A 1XKSA 4TZ4A 5AMSA 4CI3A 1K3IA 5HE3B 1E8MA 4EWRA 4J0XA 2AGZA 4U1EI 5CXBB 4CC9A 5FQDA 3V9FA 3VI4A 3FCUA 3PXTD 4JXMA 5B4WA 4ZN4A 2AGLA 2BBKH 2UZXB 4G55A 4JSXC 5IC7A 5IGQA 1GOHA 4XYIA 3VGZA 3I7NA 1L5GA 1E8NA 1U4CA 3OW8A 4AN1A 2AH1A 5I5IA 5EARA 4MMXA 1E5TA 4G56B 2HU8A 3ZWLB 3SXTD 4ERQA 1K32A 4J87A 3KRWB 3V7DB 3V5WB 3JZGA 2VDNA 3PSCB 5THAA 4J79A 3MZKA 4A11A 4O45A 2GC7A 4PC0A 3T3PA 4J8BA 5I5MA 3UVOA 4ZOYA 1O6GA 3SHFA 3ULEC 1N6DA 2BCJB 1R5MA 3BG0A 3IJEA 5FKRA 5H1MA 1VE7A 3RFGA 3EI1B 2H68A 3OKYB 4A2LA 3QHYB 4H5IA 4JHPC 4H5JA 3EQ8A 5M61A 4GQBB 2I0RA 2P9NC 2IUPA 3C5MA 5GMKn 1MG3A 1VZ2A 2HXCA 3OL2A 4A09B 4GGAA 3MMYA 4I79A 5TEEA 3VA6A 4CZVA 1U2VC 3ZDZA 4R7AB 2YNOA 3K72A 1K8KC 1SQJA 3EI4A 2IWKA 3I7LA 4O2WA 3J81g 4A08A 4DNUA 3O4HA 4D6VA 3F3GA 5IJ8E 1GXRA 4NAAA 3C75H 2GNQA 1JMZB 5FFGA 3IURA 4FAVD 3C99A 2AQ5A 5AJAA 2VDLA 3SCYA 4A0AA 5C2WB 3IULA 4AMYA 5GSAA 3PSLA 4K3JB 3NIFA 3IJ1A 2I0TA 3ORVD 2XL2A 4J78A 3T3MA 3PXSD 5AFU3 2EIDA 2PM6B 2CO0A 3FM0A 2PM9A 5HE2B 4J8GA 4JSVC 2EIEA 2HJ4A 3FCSA 2YNNA 3EWEA 4ZOVA 3K27A 2CE9A 4L3HD 4O3UB 2EICA 3O4JA 3UKRC 3CIKB 1JJUB 2OVRB 4L1QD 3UVLA 1SQ9A 4PBZA 4GQ1A 1UTCA 5I5JA 3K71A 2XZGA 3DXKC 4Y7RA 4FHLA 4A11B 3UKUC 3EI3B 4GM3A 1L0QA 3V4PA 4K3ID 4D0KA 3IUJA 3VH0A 2H6KA 5HE0B 3I8CA 5GXHA 5EAMA 2HKMA 4WK0A 3EU7A 4AOWA 3ZE0A 1UOPA 1XIPA 4OWRA 2Z2OA 1H2ZA 3GD1I 5JWZA 3SWSD 4NENA 3EG6A 4Z7NA 1OMWB 2IUQA 4AEZA 4BP8A 4CZYA 2OIZA 2OK4A 4J84A 1H2WA 3GFCA 5H14A 2AGWA 3OL2B 3F3PA 1N6EA 2MTAH 1GOGA 5C2VB 1NR0A 3EI4B 5M5SA 4FA9D 4A08B 2CE8A 1Q47A 4L3GD 4JSNC 3SBRA 4O1QD 3K26A 4GGDA 3IJ0A 2EIBA 2YB8B 2WQ8A 5M5UA 2OJYA 3MVDK 4GZ8A 4A0AB 2VDKA 5EMLB 2H9PA 3PE7A 3U4YA 4CY2A 3DDUA 1VE6A 4ZOXA 4QAMA 3ZE2A 3NIDA 2YBAA 2PM9B 3FRXA 3I7HA 5TDHB 3AL8A 3OKWA 2H6NA 4BCBA 3NVXA 1B9XA 4XYHA 1QFMA 3JRPA 4X63B 1U8CA 4WK4A 2H47A 1P22A 2O9KA 2H14A 4RE6A 3I7OA 2B5MA 3JZHA 3GREA 2Z2PA 4KFMB 4CI2A 5E6UA 5FKSA
chains in the Genus database with same CATH topology
2P9PC 4ZOZA 2H3XA 4PBYA 2H9NA 4FB1D 4XEIC 3SN6B 3SJLD 2HESX 3MKQA 1PGUA 3N0DA 3EMHA 3PXWD 3DM0A 4JSPC 4O3TB 4A0BA 2B5LA 4YVDA 3RN1D 4A7JA 4OZUA 4LG9A 4QQEA 3AFCA 4ERZA 5CXBA 3JB9L 3W15A 4FAND 1VYHC 3ODTA 2GC4A 4MK0B 3SLED 3JZNA 1JMXB 3SBPA 3KRXB 3CFVA 4CY1A 4N14A 5CXCA 2H9MA 4E5ZA 4UI9R 2AGYA 4J86A 2QXVA 3L4OD 5TF2A 2IAAA 4ESGA 4QT8A 4O9DA 4BH6A 3I7KA 2IUVA 5SXMA 5FA5B 1QNIA 4GQ2P 4X61B 3HFQA 3AL8B 4GMBA 3NVQA 2B4EA 4IMMA 3I7PA 3JROA 5EMMB 2AH0A 3OKYA 2P9UC 4CY5A 3N0EA 2XU7A 1SHYB 2XYIA 4JD2C 5CYKA 5GXIA 4BL0A 1TBGA 1S4UX 2CN3A 2HJBA 1MG2A 3JPXA 3AH8B 2YNPA 4NSXA 2B5NA 2OVQB 5EALA 2Z2NA 5IJ7E 4J81A 1OLZA 2CNXA 5EMJB 3EI2A 2YMUA 5FXYA 5C9ZB 2CN2A 3NVNA 4J77A 4A0BB 2TRCB 4CI8A 3L4MD 3IIYA 3IKOA 1B9YA 1MDAH 4IA9A 3B7FA 3CFSB 3RLMD 3RSEC 2CO0C 3E0CA 3UVNA 3RRMC 1NEXB 5EM2A 4Z8LA 2P9LC 2J57G 4BUJC 2IURA 3SBQA 3RN0D 1RI6A 2HYEA 5CXCB 5EMKB 3UVMA 3DXMC 4E5ZB 3C9CA 2AGXA 4HDJA 2PM7B 3I2NA 3EI3A 5IT9g 3F3FA 5HE1B 4E54A 2OK6A 3MKSB 4QRJA 1PI6A 3RMZD 2H6QA 4JT6C 4FA4D 2UZYB 2I0SA 1GP2B 2H13A 4L9OA 1N6FA 1A0RB 5CYKB 5IGOA 4PNKB 3FGBA 4J73A 4Y5RD 1YFQA 4U7AA 3I8EA 4ERYA 5FLXg 3OKTA 5HQGA 3SVWD 2G99A 4FA1D 4LG8A 4FWWA 2J56H 3JAMg 3EI2B 1PBYB 1TYQC 2Q7QA 5KDOB 3DSMA 4JT5C 4LGNA 3PVUB 2EBSA 5FKTA 2QC5A 2HKRA 3SMRA 4PXWA 3MXXA 1PEVA 4A2MA 1FWXA 2G9AA 4QL1A 4X60B 3MZLA 2I3SA 3DWLC 3UVKA 5A2Qg 4CI1A 3P4FA 4GM8A 2XL3A 5FKQA 2OVPB 4CZXA 2J55H 1GOTB 3BWSA 5EM2B 5K19A 2IWFA 4J0WA 3PVWB 4FA5D 5K1CC 2P9IC 4CY3A 3EI1A 2P9SC 3RFHA 1JOFA 3BG1A 3I89A 3AL9A 4ES0A 3A0FA 3OTTA 4PSWB 2W18A 1ERJA 4A09A 4GM9A 5EAPA 4GGCA 4X3EA 5TEFA 3SFZA 3IJCA 4PSXB 4E54B 2PBIB 1XHMA 2P9KC 2H9LA 3IIWA 3J80g 3UR4A 1GG2B 5HYNB 2I3TA 5H17A 4J82A 1XKSA 4TZ4A 5AMSA 4CI3A 5HE3B 4EWRA 4J0XA 2AGZA 4U1EI 5CXBB 4CC9A 5FQDA 3V9FA 3PXTD 4JXMA 5B4WA 4ZN4A 2AGLA 2BBKH 2UZXB 4JSXC 5IC7A 5IGQA 4XYIA 3VGZA 3I7NA 1U4CA 3OW8A 5I5IA 2AH1A 5EARA 4G56B 3ZWLB 3SXTD 4ERQA 1K32A 4J87A 3KRWB 3V7DB 3V5WB 3JZGA 3PSCB 5THAA 4J79A 3MZKA 4A11A 4O45A 2GC7A 4PC0A 4J8BA 5I5MA 3UVOA 4ZOYA 3SHFA 3ULEC 1N6DA 2BCJB 1R5MA 3BG0A 5FKRA 5H1MA 3RFGA 3EI1B 2H68A 3OKYB 4A2LA 4H5IA 4H5JA 4GQBB 2I0RA 2P9NC 2IUPA 3C5MA 5GMKn 1MG3A 2HXCA 3OL2A 4A09B 4GGAA 3MMYA 4I79A 5TEEA 3VA6A 4CZVA 1U2VC 4R7AB 2YNOA 1K8KC 1SQJA 3EI4A 2IWKA 3I7LA 3J81g 4A08A 4D6VA 3F3GA 5IJ8E 1GXRA 3C75H 2GNQA 1JMZB 4FAVD 3C99A 2AQ5A 5AJAA 3SCYA 4A0AA 5C2WB 5GSAA 3PSLA 4K3JB 3IJ1A 2I0TA 3ORVD 2XL2A 4J78A 3PXSD 5AFU3 2PM6B 2CO0A 3FM0A 2PM9A 5HE2B 4J8GA 4JSVC 2HJ4A 2YNNA 3EWEA 4ZOVA 3K27A 2CE9A 4L3HD 4O3UB 3UKRC 3CIKB 1JJUB 2OVRB 4L1QD 3UVLA 1SQ9A 4PBZA 4GQ1A 5I5JA 3DXKC 4Y7RA 4FHLA 4A11B 3UKUC 3EI3B 4GM3A 1L0QA 4K3ID 4D0KA 3VH0A 2H6KA 5HE0B 3I8CA 5GXHA 5EAMA 2HKMA 3EU7A 4AOWA 1XIPA 4OWRA 2Z2OA 5JWZA 3SWSD 3EG6A 1OMWB 2IUQA 4AEZA 4CZYA 2OIZA 2OK4A 4J84A 3GFCA 5H14A 2AGWA 3OL2B 3F3PA 1N6EA 2MTAH 5C2VB 1NR0A 3EI4B 4FA9D 4A08B 2CE8A 1Q47A 4L3GD 4JSNC 3SBRA 4O1QD 3K26A 4GGDA 3IJ0A 2YB8B 2OJYA 4GZ8A 4A0AB 5EMLB 2H9PA 3PE7A 3U4YA 4CY2A 4ZOXA 2YBAA 2PM9B 3FRXA 3I7HA 5TDHB 3AL8A 3OKWA 2H6NA 3NVXA 1B9XA 4XYHA 3JRPA 4X63B 2H47A 1P22A 2O9KA 2H14A 3I7OA 2B5MA 3JZHA 3GREA 2Z2PA 4KFMB 4CI2A 5FKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9P C;  4ZOZ A;  2H3X A;  4PBY A;  2H9N A;  4FB1 D;  4XEI C;  3SN6 B;  3SJL D;  2HES X;  3MKQ A;  1PGU A;  3N0D A;  3EMH A;  3PXW D;  3DM0 A;  4JSP C;  4O3T B;  4A0B A;  2B5L A;  4YVD A;  3RN1 D;  4A7J A;  4OZU A;  4LG9 A;  4QQE A;  3AFC A;  4ERZ A;  5CXB A;  3JB9 L;  3W15 A;  4FAN D;  1VYH C;  3ODT A;  2GC4 A;  4MK0 B;  3SLE D;  3JZN A;  1JMX B;  3SBP A;  3KRX B;  3CFV A;  4CY1 A;  4N14 A;  5CXC A;  2H9M A;  4E5Z A;  4UI9 R;  2AGY A;  4J86 A;  2QXV A;  3L4O D;  5TF2 A;  2IAA A;  4ESG A;  4QT8 A;  4O9D A;  4BH6 A;  3I7K A;  2IUV A;  5SXM A;  5FA5 B;  1QNI A;  4GQ2 P;  4X61 B;  3HFQ A;  3AL8 B;  4GMB A;  3NVQ A;  2B4E A;  4IMM A;  3I7P A;  3JRO A;  5EMM B;  2AH0 A;  3OKY A;  2P9U C;  4CY5 A;  3N0E A;  2XU7 A;  1SHY B;  2XYI A;  4JD2 C;  5CYK A;  5GXI A;  4BL0 A;  1TBG A;  1S4U X;  2CN3 A;  2HJB A;  1MG2 A;  3JPX A;  3AH8 B;  2YNP A;  4NSX A;  2B5N A;  2OVQ B;  5EAL A;  2Z2N A;  5IJ7 E;  4J81 A;  1OLZ A;  2CNX A;  5EMJ B;  3EI2 A;  2YMU A;  5FXY A;  5C9Z B;  2CN2 A;  3NVN A;  4J77 A;  4A0B B;  2TRC B;  4CI8 A;  3L4M D;  3IIY A;  3IKO A;  1B9Y A;  1MDA H;  4IA9 A;  3B7F A;  3CFS B;  3RLM D;  3RSE C;  2CO0 C;  3E0C A;  3UVN A;  3RRM C;  1NEX B;  5EM2 A;  4Z8L A;  2P9L C;  2J57 G;  4BUJ C;  2IUR A;  3SBQ A;  3RN0 D;  1RI6 A;  2HYE A;  5CXC B;  5EMK B;  3UVM A;  3DXM C;  4E5Z B;  3C9C A;  2AGX A;  4HDJ A;  2PM7 B;  3I2N A;  3EI3 A;  5IT9 g;  3F3F A;  5HE1 B;  4E54 A;  2OK6 A;  3MKS B;  4QRJ A;  1PI6 A;  3RMZ D;  2H6Q A;  4JT6 C;  4FA4 D;  2UZY B;  2I0S A;  1GP2 B;  2H13 A;  4L9O A;  1N6F A;  1A0R B;  5CYK B;  5IGO A;  4PNK B;  3FGB A;  4J73 A;  4Y5R D;  1YFQ A;  4U7A A;  3I8E A;  4ERY A;  5FLX g;  3OKT A;  5HQG A;  3SVW D;  2G99 A;  4FA1 D;  4LG8 A;  4FWW A;  2J56 H;  3JAM g;  3EI2 B;  1PBY B;  1TYQ C;  2Q7Q A;  5KDO B;  3DSM A;  4JT5 C;  4LGN A;  3PVU B;  2EBS A;  5FKT A;  2QC5 A;  2HKR A;  3SMR A;  4PXW A;  3MXX A;  1PEV A;  4A2M A;  1FWX A;  2G9A A;  4QL1 A;  4X60 B;  3MZL A;  2I3S A;  3DWL C;  3UVK A;  5A2Q g;  4CI1 A;  3P4F A;  4GM8 A;  2XL3 A;  5FKQ A;  2OVP B;  4CZX A;  2J55 H;  1GOT B;  3BWS A;  5EM2 B;  5K19 A;  2IWF A;  4J0W A;  3PVW B;  4FA5 D;  5K1C C;  2P9I C;  4CY3 A;  3EI1 A;  2P9S C;  3RFH A;  1JOF A;  3BG1 A;  3I89 A;  3AL9 A;  4ES0 A;  3A0F A;  3OTT A;  4PSW B;  2W18 A;  1ERJ A;  4A09 A;  4GM9 A;  5EAP A;  4GGC A;  4X3E A;  5TEF A;  3SFZ A;  3IJC A;  4PSX B;  4E54 B;  2PBI B;  1XHM A;  2P9K C;  2H9L A;  3IIW A;  3J80 g;  3UR4 A;  1GG2 B;  5HYN B;  2I3T A;  5H17 A;  4J82 A;  1XKS A;  4TZ4 A;  5AMS A;  4CI3 A;  5HE3 B;  4EWR A;  4J0X A;  2AGZ A;  4U1E I;  5CXB B;  4CC9 A;  5FQD A;  3V9F A;  3PXT D;  4JXM A;  5B4W A;  4ZN4 A;  2AGL A;  2BBK H;  2UZX B;  4JSX C;  5IC7 A;  5IGQ A;  4XYI A;  3VGZ A;  3I7N A;  1U4C A;  3OW8 A;  5I5I A;  2AH1 A;  5EAR A;  4G56 B;  3ZWL B;  3SXT D;  4ERQ A;  1K32 A;  4J87 A;  3KRW B;  3V7D B;  3V5W B;  3JZG A;  3PSC B;  5THA A;  4J79 A;  3MZK A;  4A11 A;  4O45 A;  2GC7 A;  4PC0 A;  4J8B A;  5I5M A;  3UVO A;  4ZOY A;  3SHF A;  3ULE C;  1N6D A;  2BCJ B;  1R5M A;  3BG0 A;  5FKR A;  5H1M A;  3RFG A;  3EI1 B;  2H68 A;  3OKY B;  4A2L A;  4H5I A;  4H5J A;  4GQB B;  2I0R A;  2P9N C;  2IUP A;  3C5M A;  5GMK n;  1MG3 A;  2HXC A;  3OL2 A;  4A09 B;  4GGA A;  3MMY A;  4I79 A;  5TEE A;  3VA6 A;  4CZV A;  1U2V C;  4R7A B;  2YNO A;  1K8K C;  1SQJ A;  3EI4 A;  2IWK A;  3I7L A;  3J81 g;  4A08 A;  4D6V A;  3F3G A;  5IJ8 E;  1GXR A;  3C75 H;  2GNQ A;  1JMZ B;  4FAV D;  3C99 A;  2AQ5 A;  5AJA A;  3SCY A;  4A0A A;  5C2W B;  5GSA A;  3PSL A;  4K3J B;  3IJ1 A;  2I0T A;  3ORV D;  2XL2 A;  4J78 A;  3PXS D;  5AFU 3;  2PM6 B;  2CO0 A;  3FM0 A;  2PM9 A;  5HE2 B;  4J8G A;  4JSV C;  2HJ4 A;  2YNN A;  3EWE A;  4ZOV A;  3K27 A;  2CE9 A;  4L3H D;  4O3U B;  3UKR C;  3CIK B;  1JJU B;  2OVR B;  4L1Q D;  3UVL A;  1SQ9 A;  4PBZ A;  4GQ1 A;  5I5J A;  3DXK C;  4Y7R A;  4FHL A;  4A11 B;  3UKU C;  3EI3 B;  4GM3 A;  1L0Q A;  4K3I D;  4D0K A;  3VH0 A;  2H6K A;  5HE0 B;  3I8C A;  5GXH A;  5EAM A;  2HKM A;  3EU7 A;  4AOW A;  1XIP A;  4OWR A;  2Z2O A;  5JWZ A;  3SWS D;  3EG6 A;  1OMW B;  2IUQ A;  4AEZ A;  4CZY A;  2OIZ A;  2OK4 A;  4J84 A;  3GFC A;  5H14 A;  2AGW A;  3OL2 B;  3F3P A;  1N6E A;  2MTA H;  5C2V B;  1NR0 A;  3EI4 B;  4FA9 D;  4A08 B;  2CE8 A;  1Q47 A;  4L3G D;  4JSN C;  3SBR A;  4O1Q D;  3K26 A;  4GGD A;  3IJ0 A;  2YB8 B;  2OJY A;  4GZ8 A;  4A0A B;  5EML B;  2H9P A;  3PE7 A;  3U4Y A;  4CY2 A;  4ZOX A;  2YBA A;  2PM9 B;  3FRX A;  3I7H A;  5TDH B;  3AL8 A;  3OKW A;  2H6N A;  3NVX A;  1B9X A;  4XYH A;  3JRP A;  4X63 B;  2H47 A;  1P22 A;  2O9K A;  2H14 A;  3I7O A;  2B5M A;  3JZH A;  3GRE A;  2Z2P A;  4KFM B;  4CI2 A;  5FKS A; 
#chains in the Genus database with same CATH topology
 2P9P C;  4ZOZ A;  2H3X A;  4PBY A;  2H9N A;  4FB1 D;  4XEI C;  3SN6 B;  3SJL D;  5M5T A;  2HES X;  3MKQ A;  1PGU A;  2HU5 A;  3N0D A;  3EMH A;  3PXW D;  3DM0 A;  5C86 A;  4JSP C;  4O3T B;  1I2M B;  2B5L A;  4A0B A;  5M5R A;  4YVD A;  3RN1 D;  4A7J A;  4OZU A;  4BP9 A;  4LG9 A;  4QQE A;  3AFC A;  4ERZ A;  5CXB A;  3JB9 L;  3W15 A;  4FAN D;  1VYH C;  3ODT A;  2VDP A;  2GC4 A;  4MK0 B;  3SLE D;  3JZN A;  1JMX B;  2VDQ A;  1UOQ A;  3SBP A;  3KRX B;  3CFV A;  4CY1 A;  4N14 A;  4O02 A;  5CXC A;  2XDW A;  1C9L A;  2H9M A;  4E5Z A;  4UI9 R;  2AGY A;  4J86 A;  2QXV A;  3L4O D;  5TF2 A;  2IAA A;  4ESG A;  4QT8 A;  4D9S A;  4O9D A;  4BH6 A;  3I7K A;  2IUV A;  3IVM A;  5SXM A;  4WJK A;  5FA5 B;  1QNI A;  4GQ2 P;  4X61 B;  2XE4 A;  4MMY A;  3HFQ A;  3AL8 B;  4GMB A;  4UM9 A;  3NVQ A;  2B4E A;  1YR2 A;  4IMM A;  3I7P A;  3JRO A;  5EMM B;  2AH0 A;  3OKY A;  2P9U C;  5E6S A;  4CY5 A;  3N0E A;  3IUQ A;  2XU7 A;  1SHY B;  2VDR A;  2XYI A;  4JD2 C;  2JKX A;  5CYK A;  1JV2 A;  4AMZ A;  5GXI A;  4BL0 A;  1TBG A;  1S4U X;  2CN3 A;  2HJB A;  1MG2 A;  3JPX A;  3AH8 B;  3GC3 B;  2YNP A;  4NSX A;  4DNW A;  2B5N A;  2OVQ B;  5EAL A;  2Z2N A;  5IJ7 E;  1OLZ A;  2CNX A;  4J81 A;  1GOF A;  5EMJ B;  2YMU A;  5FXY A;  3EI2 A;  3K6S A;  5C9Z B;  5M5V A;  4NBM A;  2CN2 A;  4NC4 A;  3NVN A;  4J77 A;  4A0B B;  2TRC B;  3ZDY A;  1BPO A;  3OF7 A;  1T2X A;  4CI8 A;  3L4M D;  1C9I A;  3IIY A;  3IKO A;  1B9Y A;  1MDA H;  4IA9 A;  3B7F A;  3CFS B;  3RLM D;  3RSE C;  2HU7 A;  5E6R A;  2CO0 C;  2VDM A;  3E0C A;  3UVN A;  3RRM C;  1NEX B;  5EM2 A;  2VZ3 A;  4Z8L A;  2P9L C;  4DNV A;  2J57 G;  4BUJ C;  2IUR A;  3SBQ A;  3MUN A;  1JTD B;  1RI6 A;  3RN0 D;  5CXC B;  5EMK B;  2HYE A;  3KCI A;  3UVM A;  4Z7Q A;  3DXM C;  4Z7O A;  4E5Z B;  3C9C A;  3V4V A;  4L1M A;  1H2X A;  2AGX A;  4HDJ A;  4AN0 A;  3ZE1 A;  4IRZ A;  2PM7 B;  3NIG A;  3I2N A;  3EI3 A;  5HDB A;  5IT9 g;  5C92 A;  1H2Y A;  3F3F A;  3QI0 A;  5HE1 B;  4E54 A;  2OK6 A;  3MKS B;  4QRJ A;  4G1M A;  1PI6 A;  1UOO A;  3RMZ D;  2H6Q A;  2VZ1 A;  4JT6 C;  4FA4 D;  2UZY B;  2VC2 A;  2I0S A;  1GP2 B;  2H13 A;  2QR5 A;  4G1E A;  1O6F A;  1N6F A;  4L9O A;  1QFS A;  1A0R B;  5CYK B;  5IGO A;  4PNK B;  3FGB A;  4J73 A;  4Y5R D;  1YFQ A;  4BCD A;  4U7A A;  1VZ3 A;  3I8E A;  4ERY A;  5FLX g;  3OKT A;  5HQG A;  3SVW D;  4JHN A;  2G99 A;  4FA1 D;  4LG8 A;  4FWW A;  2J56 H;  3JAM g;  3EI2 B;  1PBY B;  3IUN A;  4WK2 A;  1TYQ C;  2Q7Q A;  5KDO B;  3DSM A;  4JT5 C;  4LGN A;  3PVU B;  2EBS A;  3O4I A;  5FKT A;  5FFO A;  2QC5 A;  2HKR A;  3SMR A;  4PXW A;  3MXX A;  1PEV A;  4RE5 A;  3VI3 A;  4A2M A;  1FWX A;  2G9A A;  4QL1 A;  4X60 B;  3MZL A;  2I3S A;  3DWL C;  3UVK A;  5A2Q g;  4CI1 A;  3EQ9 A;  3P4F A;  4GM8 A;  2XL3 A;  5FKQ A;  2OVP B;  4CZX A;  2J55 H;  1M1X A;  4BCC A;  1GOT B;  3BWS A;  2BKL A;  1TYE A;  5EM2 B;  5K19 A;  2IWF A;  4J0W A;  2QZP A;  3PVW B;  3MUO A;  4FA5 D;  5K1C C;  2P9I C;  4CY3 A;  4AX4 A;  1A12 A;  3EI1 A;  2P9S C;  3RFH A;  1JOF A;  3BG1 A;  3I89 A;  3ZDX A;  3AL9 A;  4ES0 A;  3A0F A;  3OTT A;  4PSW B;  2W18 A;  2VDO A;  1ERJ A;  4A09 A;  4GM9 A;  5EAP A;  4GGC A;  4X3E A;  5TEF A;  3SFZ A;  3IJC A;  4PSX B;  4MMZ A;  4E54 B;  2PBI B;  1XHM A;  2P9K C;  2H9L A;  3IIW A;  3O4G A;  3EQ7 A;  3J80 g;  3UR4 A;  1GG2 B;  5HYN B;  2I3T A;  3IUM A;  4UM8 A;  5H17 A;  4J82 A;  1XKS A;  4TZ4 A;  5AMS A;  4CI3 A;  1K3I A;  5HE3 B;  1E8M A;  4EWR A;  4J0X A;  2AGZ A;  4U1E I;  5CXB B;  4CC9 A;  5FQD A;  3V9F A;  3VI4 A;  3FCU A;  3PXT D;  4JXM A;  5B4W A;  4ZN4 A;  2AGL A;  2BBK H;  2UZX B;  4G55 A;  4JSX C;  5IC7 A;  5IGQ A;  1GOH A;  4XYI A;  3VGZ A;  3I7N A;  1L5G A;  1E8N A;  1U4C A;  3OW8 A;  4AN1 A;  2AH1 A;  5I5I A;  5EAR A;  4MMX A;  1E5T A;  4G56 B;  2HU8 A;  3ZWL B;  3SXT D;  4ERQ A;  1K32 A;  4J87 A;  3KRW B;  3V7D B;  3V5W B;  3JZG A;  2VDN A;  3PSC B;  5THA A;  4J79 A;  3MZK A;  4A11 A;  4O45 A;  2GC7 A;  4PC0 A;  3T3P A;  4J8B A;  5I5M A;  3UVO A;  4ZOY A;  1O6G A;  3SHF A;  3ULE C;  1N6D A;  2BCJ B;  1R5M A;  3BG0 A;  3IJE A;  5FKR A;  5H1M A;  1VE7 A;  3RFG A;  3EI1 B;  2H68 A;  3OKY B;  4A2L A;  3QHY B;  4H5I A;  4JHP C;  4H5J A;  3EQ8 A;  5M61 A;  4GQB B;  2I0R A;  2P9N C;  2IUP A;  3C5M A;  5GMK n;  1MG3 A;  1VZ2 A;  2HXC A;  3OL2 A;  4A09 B;  4GGA A;  3MMY A;  4I79 A;  5TEE A;  3VA6 A;  4CZV A;  1U2V C;  3ZDZ A;  4R7A B;  2YNO A;  3K72 A;  1K8K C;  1SQJ A;  3EI4 A;  2IWK A;  3I7L A;  4O2W A;  3J81 g;  4A08 A;  4DNU A;  3O4H A;  4D6V A;  3F3G A;  5IJ8 E;  1GXR A;  4NAA A;  3C75 H;  2GNQ A;  1JMZ B;  5FFG A;  3IUR A;  4FAV D;  3C99 A;  2AQ5 A;  5AJA A;  2VDL A;  3SCY A;  4A0A A;  5C2W B;  3IUL A;  4AMY A;  5GSA A;  3PSL A;  4K3J B;  3NIF A;  3IJ1 A;  2I0T A;  3ORV D;  2XL2 A;  4J78 A;  3T3M A;  3PXS D;  5AFU 3;  2EID A;  2PM6 B;  2CO0 A;  3FM0 A;  2PM9 A;  5HE2 B;  4J8G A;  4JSV C;  2EIE A;  2HJ4 A;  3FCS A;  2YNN A;  3EWE A;  4ZOV A;  3K27 A;  2CE9 A;  4L3H D;  4O3U B;  2EIC A;  3O4J A;  3UKR C;  3CIK B;  1JJU B;  2OVR B;  4L1Q D;  3UVL A;  1SQ9 A;  4PBZ A;  4GQ1 A;  1UTC A;  5I5J A;  3K71 A;  2XZG A;  3DXK C;  4Y7R A;  4FHL A;  4A11 B;  3UKU C;  3EI3 B;  4GM3 A;  1L0Q A;  3V4P A;  4K3I D;  4D0K A;  3IUJ A;  3VH0 A;  2H6K A;  5HE0 B;  3I8C A;  5GXH A;  5EAM A;  2HKM A;  4WK0 A;  3EU7 A;  4AOW A;  3ZE0 A;  1UOP A;  1XIP A;  4OWR A;  2Z2O A;  1H2Z A;  3GD1 I;  5JWZ A;  3SWS D;  4NEN A;  3EG6 A;  4Z7N A;  1OMW B;  2IUQ A;  4AEZ A;  4BP8 A;  4CZY A;  2OIZ A;  2OK4 A;  4J84 A;  1H2W A;  3GFC A;  5H14 A;  2AGW A;  3OL2 B;  3F3P A;  1N6E A;  2MTA H;  1GOG A;  5C2V B;  1NR0 A;  3EI4 B;  5M5S A;  4FA9 D;  4A08 B;  2CE8 A;  1Q47 A;  4L3G D;  4JSN C;  3SBR A;  4O1Q D;  3K26 A;  4GGD A;  3IJ0 A;  2EIB A;  2YB8 B;  2WQ8 A;  5M5U A;  2OJY A;  3MVD K;  4GZ8 A;  4A0A B;  2VDK A;  5EML B;  2H9P A;  3PE7 A;  3U4Y A;  4CY2 A;  3DDU A;  1VE6 A;  4ZOX A;  4QAM A;  3ZE2 A;  3NID A;  2YBA A;  2PM9 B;  3FRX A;  3I7H A;  5TDH B;  3AL8 A;  3OKW A;  2H6N A;  4BCB A;  3NVX A;  1B9X A;  4XYH A;  1QFM A;  3JRP A;  4X63 B;  1U8C A;  4WK4 A;  2H47 A;  1P22 A;  2O9K A;  2H14 A;  4RE6 A;  3I7O A;  2B5M A;  3JZH A;  3GRE A;  2Z2P A;  4KFM B;  4CI2 A;  5E6U A;  5FKS A; 
#chains in the Genus database with same CATH homology
 2P9P C;  4ZOZ A;  2H3X A;  4PBY A;  2H9N A;  4FB1 D;  4XEI C;  3SN6 B;  3SJL D;  2HES X;  3MKQ A;  1PGU A;  3N0D A;  3EMH A;  3PXW D;  3DM0 A;  4JSP C;  4O3T B;  4A0B A;  2B5L A;  4YVD A;  3RN1 D;  4A7J A;  4OZU A;  4LG9 A;  4QQE A;  3AFC A;  4ERZ A;  5CXB A;  3JB9 L;  3W15 A;  4FAN D;  1VYH C;  3ODT A;  2GC4 A;  4MK0 B;  3SLE D;  3JZN A;  1JMX B;  3SBP A;  3KRX B;  3CFV A;  4CY1 A;  4N14 A;  5CXC A;  2H9M A;  4E5Z A;  4UI9 R;  2AGY A;  4J86 A;  2QXV A;  3L4O D;  5TF2 A;  2IAA A;  4ESG A;  4QT8 A;  4O9D A;  4BH6 A;  3I7K A;  2IUV A;  5SXM A;  5FA5 B;  1QNI A;  4GQ2 P;  4X61 B;  3HFQ A;  3AL8 B;  4GMB A;  3NVQ A;  2B4E A;  4IMM A;  3I7P A;  3JRO A;  5EMM B;  2AH0 A;  3OKY A;  2P9U C;  4CY5 A;  3N0E A;  2XU7 A;  1SHY B;  2XYI A;  4JD2 C;  5CYK A;  5GXI A;  4BL0 A;  1TBG A;  1S4U X;  2CN3 A;  2HJB A;  1MG2 A;  3JPX A;  3AH8 B;  2YNP A;  4NSX A;  2B5N A;  2OVQ B;  5EAL A;  2Z2N A;  5IJ7 E;  4J81 A;  1OLZ A;  2CNX A;  5EMJ B;  3EI2 A;  2YMU A;  5FXY A;  5C9Z B;  2CN2 A;  3NVN A;  4J77 A;  4A0B B;  2TRC B;  4CI8 A;  3L4M D;  3IIY A;  3IKO A;  1B9Y A;  1MDA H;  4IA9 A;  3B7F A;  3CFS B;  3RLM D;  3RSE C;  2CO0 C;  3E0C A;  3UVN A;  3RRM C;  1NEX B;  5EM2 A;  4Z8L A;  2P9L C;  2J57 G;  4BUJ C;  2IUR A;  3SBQ A;  3RN0 D;  1RI6 A;  2HYE A;  5CXC B;  5EMK B;  3UVM A;  3DXM C;  4E5Z B;  3C9C A;  2AGX A;  4HDJ A;  2PM7 B;  3I2N A;  3EI3 A;  5IT9 g;  3F3F A;  5HE1 B;  4E54 A;  2OK6 A;  3MKS B;  4QRJ A;  1PI6 A;  3RMZ D;  2H6Q A;  4JT6 C;  4FA4 D;  2UZY B;  2I0S A;  1GP2 B;  2H13 A;  4L9O A;  1N6F A;  1A0R B;  5CYK B;  5IGO A;  4PNK B;  3FGB A;  4J73 A;  4Y5R D;  1YFQ A;  4U7A A;  3I8E A;  4ERY A;  5FLX g;  3OKT A;  5HQG A;  3SVW D;  2G99 A;  4FA1 D;  4LG8 A;  4FWW A;  2J56 H;  3JAM g;  3EI2 B;  1PBY B;  1TYQ C;  2Q7Q A;  5KDO B;  3DSM A;  4JT5 C;  4LGN A;  3PVU B;  2EBS A;  5FKT A;  2QC5 A;  2HKR A;  3SMR A;  4PXW A;  3MXX A;  1PEV A;  4A2M A;  1FWX A;  2G9A A;  4QL1 A;  4X60 B;  3MZL A;  2I3S A;  3DWL C;  3UVK A;  5A2Q g;  4CI1 A;  3P4F A;  4GM8 A;  2XL3 A;  5FKQ A;  2OVP B;  4CZX A;  2J55 H;  1GOT B;  3BWS A;  5EM2 B;  5K19 A;  2IWF A;  4J0W A;  3PVW B;  4FA5 D;  5K1C C;  2P9I C;  4CY3 A;  3EI1 A;  2P9S C;  3RFH A;  1JOF A;  3BG1 A;  3I89 A;  3AL9 A;  4ES0 A;  3A0F A;  3OTT A;  4PSW B;  2W18 A;  1ERJ A;  4A09 A;  4GM9 A;  5EAP A;  4GGC A;  4X3E A;  5TEF A;  3SFZ A;  3IJC A;  4PSX B;  4E54 B;  2PBI B;  1XHM A;  2P9K C;  2H9L A;  3IIW A;  3J80 g;  3UR4 A;  1GG2 B;  5HYN B;  2I3T A;  5H17 A;  4J82 A;  1XKS A;  4TZ4 A;  5AMS A;  4CI3 A;  5HE3 B;  4EWR A;  4J0X A;  2AGZ A;  4U1E I;  5CXB B;  4CC9 A;  5FQD A;  3V9F A;  3PXT D;  4JXM A;  5B4W A;  4ZN4 A;  2AGL A;  2BBK H;  2UZX B;  4JSX C;  5IC7 A;  5IGQ A;  4XYI A;  3VGZ A;  3I7N A;  1U4C A;  3OW8 A;  5I5I A;  2AH1 A;  5EAR A;  4G56 B;  3ZWL B;  3SXT D;  4ERQ A;  1K32 A;  4J87 A;  3KRW B;  3V7D B;  3V5W B;  3JZG A;  3PSC B;  5THA A;  4J79 A;  3MZK A;  4A11 A;  4O45 A;  2GC7 A;  4PC0 A;  4J8B A;  5I5M A;  3UVO A;  4ZOY A;  3SHF A;  3ULE C;  1N6D A;  2BCJ B;  1R5M A;  3BG0 A;  5FKR A;  5H1M A;  3RFG A;  3EI1 B;  2H68 A;  3OKY B;  4A2L A;  4H5I A;  4H5J A;  4GQB B;  2I0R A;  2P9N C;  2IUP A;  3C5M A;  5GMK n;  1MG3 A;  2HXC A;  3OL2 A;  4A09 B;  4GGA A;  3MMY A;  4I79 A;  5TEE A;  3VA6 A;  4CZV A;  1U2V C;  4R7A B;  2YNO A;  1K8K C;  1SQJ A;  3EI4 A;  2IWK A;  3I7L A;  3J81 g;  4A08 A;  4D6V A;  3F3G A;  5IJ8 E;  1GXR A;  3C75 H;  2GNQ A;  1JMZ B;  4FAV D;  3C99 A;  2AQ5 A;  5AJA A;  3SCY A;  4A0A A;  5C2W B;  5GSA A;  3PSL A;  4K3J B;  3IJ1 A;  2I0T A;  3ORV D;  2XL2 A;  4J78 A;  3PXS D;  5AFU 3;  2PM6 B;  2CO0 A;  3FM0 A;  2PM9 A;  5HE2 B;  4J8G A;  4JSV C;  2HJ4 A;  2YNN A;  3EWE A;  4ZOV A;  3K27 A;  2CE9 A;  4L3H D;  4O3U B;  3UKR C;  3CIK B;  1JJU B;  2OVR B;  4L1Q D;  3UVL A;  1SQ9 A;  4PBZ A;  4GQ1 A;  5I5J A;  3DXK C;  4Y7R A;  4FHL A;  4A11 B;  3UKU C;  3EI3 B;  4GM3 A;  1L0Q A;  4K3I D;  4D0K A;  3VH0 A;  2H6K A;  5HE0 B;  3I8C A;  5GXH A;  5EAM A;  2HKM A;  3EU7 A;  4AOW A;  1XIP A;  4OWR A;  2Z2O A;  5JWZ A;  3SWS D;  3EG6 A;  1OMW B;  2IUQ A;  4AEZ A;  4CZY A;  2OIZ A;  2OK4 A;  4J84 A;  3GFC A;  5H14 A;  2AGW A;  3OL2 B;  3F3P A;  1N6E A;  2MTA H;  5C2V B;  1NR0 A;  3EI4 B;  4FA9 D;  4A08 B;  2CE8 A;  1Q47 A;  4L3G D;  4JSN C;  3SBR A;  4O1Q D;  3K26 A;  4GGD A;  3IJ0 A;  2YB8 B;  2OJY A;  4GZ8 A;  4A0A B;  5EML B;  2H9P A;  3PE7 A;  3U4Y A;  4CY2 A;  4ZOX A;  2YBA A;  2PM9 B;  3FRX A;  3I7H A;  5TDH B;  3AL8 A;  3OKW A;  2H6N A;  3NVX A;  1B9X A;  4XYH A;  3JRP A;  4X63 B;  2H47 A;  1P22 A;  2O9K A;  2H14 A;  3I7O A;  2B5M A;  3JZH A;  3GRE A;  2Z2P A;  4KFM B;  4CI2 A;  5FKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...