2CNXA

Wdr5 and histone h3 lysine 4 dimethyl complex at 2.1 angstrom
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
306
structure length
306
Chain Sequence
TPVKPNYALMFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGMCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD-REPEAT PROTEIN 5
publication title Histone H3 Recognition and Presentation by the Wdr5 Module of the Mll1 Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 96
structure length 306
sequence length 306
ec nomenclature
pdb deposition date 2006-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2cnxA00
3SXTD 1N6FA 4Y5RD 4XYHA 5TF2A 2B5LA 4J84A 4CI3A 5GXHA 1K32A 2H9NA 3E0CA 3FGBA 5K1CC 1SHYB 2IUVA 1QNIA 3JZNA 1OMWB 4A7JA 2Z2OA 2PBIB 4GGDA 3J80g 3EI3A 5FKSA 4ZOYA 2G9AA 3JPXA 2I3SA 4XYIA 1XKSA 4L3HD 3I2NA 5HQGA 3UVKA 5I5MA 4A08B 4J8BA 4L9OA 1ERJA 4QL1A 1R5MA 3AFCA 1XIPA 2QC5A 3EG6A 3KRWB 4PNKB 2H14A 1SQJA 4CY5A 3IKOA 3IIWA 5IJ7E 4G56B 5C2VB 2IWKA 4K3ID 4O3TB 2UZXB 4U7AA 4A11A 3AL9A 2HJ4A 1Q47A 3B7FA 3I8EA 3BG0A 1A0RB 4GM8A 2H9LA 4GQ1A 4O3UB 2IUQA 2OVPB 3N0DA 4LG9A 4FHLA 5FXYA 3EI4A 5HE1B 2H6NA 4ZN4A 3SBPA 3DXKC 4L1QD 2I0TA 3OKYB 2IWFA 2AGLA 2G99A 3NVNA 3ORVD 4PSWB 2H3XA 4ERQA 3ULEC 4JSXC 2QXVA 2Z2NA 5IJ8E 4Y7RA 3RRMC 3V7DB 4PBZA 4A0AB 4CY3A 4CY2A 5EAMA 1N6EA 2CNXA 5CXBA 5EMJB 5I5JA 1U2VC 3SVWD 4N14A 4FA9D 2PM6B 4JSVC 4KFMB 1MG2A 3AH8B 1JJUB 5EMMB 3SN6B 3SBQA 4GM9A 3IIYA 2YNNA 2I3TA 3OW8A 3EWEA 3UVMA 1PBYB 4Z8LA 4CY1A 5EM2A 2AGWA 2YB8B 3RN1D 2YBAA 5GSAA 3P4FA 1TBGA 2HJBA 4IMMA 3PXWD 4JXMA 5GXIA 2PM7B 2HYEA 3OL2B 3EI1B 4GM3A 5FKTA 2H9PA 3SFZA 5H1MA 3V5WB 4R7AB 1B9YA 5THAA 2J55H 4J78A 5TDHB 1GOTB 4J79A 4BH6A 4AOWA 2CE8A 5CXCB 4J86A 4D0KA 2H13A 4X60B 4ERZA 2YMUA 2CN2A 1YFQA 4K3JB 3I7PA 3C9CA 3UR4A 4FAVD 4E54A 4JD2C 4A09B 1MDAH 4UI9R 5HE3B 5AMSA 4QQEA 3JAMg 2OK4A 4LGNA 3C75H 3OKWA 4CI8A 4TZ4A 3MKQA 1OLZA 2OK6A 4A11B 2AGXA 5B4WA 3EU7A 2J57G 2XL2A 1B9XA 3GREA 5KDOB 4A0BB 2PM9B 5EMLB 2W18A 3VA6A 2B5NA 3JZGA 4A08A 4X61B 4H5JA 5K19A 4PXWA 4EWRA 3PVUB 3CIKB 3VGZA 4A2MA 2BBKH 5JWZA 2P9UC 1K8KC 3F3FA 2HKRA 4J81A 3NVQA 4YVDA 5H14A 3FM0A 3UVOA 2GC7A 3VH0A 4QT8A 2XYIA 4FA1D 4JT6C 2HKMA 3I7OA 3EI2B 4O9DA 4BL0A 4JSNC 3JZHA 3ZWLB 3DSMA 3JB9L 5C9ZB 5FKQA 3MZKA 2GNQA 2O9KA 1GXRA 3RFGA 1JOFA 5AFU3 4HDJA 5IGOA 5HYNB 2CO0A 3RN0D 3ODTA 3PXTD 5CYKB 2AQ5A 2P9IC 5SXMA 4ES0A 3AL8B 2IURA 3GFCA 4J8GA 3HFQA 3PSCB 4JT5C 1L0QA 3OKYA 3L4OD 3SWSD 5I5IA 2IAAA 2CN3A 3I89A 2B5MA 1GP2B 4I79A 4ZOVA 2H9MA 2AH0A 3U4YA 3I8CA 3UKRC 5GMKn 5IT9g 1NR0A 2XL3A 2CE9A 4E5ZA 2OVRB 4BUJC 3SJLD 3K26A 4OWRA 4CZXA 3I7NA 3MXXA 4PSXB 3CFVA 2P9KC 4GQ2P 4H5IA 2H6KA 3A0FA 3FRXA 3EI3B 1N6DA 3IJCA 3PXSD 2HXCA 4FA4D 3PE7A 2I0RA 4LG8A 4FA5D 4E54B 4QRJA 5AJAA 2Q7QA 3OTTA 4GGCA 4GMBA 3SLED 3SHFA 4CI1A 4U1EI 3OL2A 3EI1A 5HE0B 5IGQA 2UZYB 3I7KA 3UVLA 2J56H 4OZUA 5TEFA 5A2Qg 4J0XA 2OIZA 4GGAA 2H68A 1XHMA 5H17A 3DM0A 2P9LC 4FWWA 4J73A 5CXCA 4J77A 4L3GD 5FKRA 3UKUC 3PSLA 2OJYA 1P22A 2GC4A 3C99A 3RFHA 1GG2B 1VYHC 4J0WA 4GQBB 3W15A 4A2LA 4A09A 4FAND 4ERYA 4J87A 1MG3A 4GZ8A 4X3EA 3RMZD 3EI4B 5FQDA 2AH1A 3BWSA 5C2WB 1FWXA 2B4EA 2I0SA 2OVQB 5EAPA 5TEEA 2P9SC 1JMZB 4MK0B 4A0BA 2PM9A 2HESX 3DXMC 4PC0A 4CZYA 4IA9A 3V9FA 3F3GA 3K27A 3MZLA 2H47A 3NVXA 5IC7A 2EBSA 2H6QA 2XU7A 5CXBB 2YNPA 4CI2A 2MTAH 4ESGA 2TRCB 1RI6A 3SBRA 4ZOZA 4ZOXA 2YNOA 5EMKB 5HE2B 2P9PC 3EI2A 3N0EA 4O1QD 1U4CA 4PBYA 3JRPA 5FLXg 4O45A 3J81g 3OKTA 4J82A 3PVWB 5EM2B 4E5ZB 2AGZA 1PGUA 2CO0C 2IUPA 3SMRA 5EALA 4AEZA 4CZVA 4A0AA 3L4MD 3SCYA 3JROA 1PI6A 3MMYA 5CYKA 3RSEC 3F3PA 3BG1A 5EARA 3AL8A 3CFSB 4CC9A 4D6VA 2AGYA 1NEXB 2BCJB 1JMXB 1TYQC 3MKSB 4FB1D 3DWLC 3KRXB 4NSXA 4JSPC 1S4UX 2P9NC 4XEIC 3RLMD 1SQ9A 3IJ1A 3I7HA 2Z2PA 3UVNA 3C5MA 3IJ0A 4X63B 3I7LA 1PEVA 5FA5B 3EMHA
chains in the Genus database with same CATH superfamily
3SXTD 1N6FA 4Y5RD 4XYHA 5TF2A 2B5LA 1H2XA 4J84A 3ZDXA 4CI3A 5GXHA 1E8MA 1K32A 2H9NA 3E0CA 5E6RA 3FGBA 5K1CC 3GC3B 1SHYB 2IUVA 2EICA 1QNIA 3JZNA 1OMWB 4A7JA 2Z2OA 2PBIB 1E8NA 4GGDA 3J80g 3EI3A 5FKSA 4ZOYA 2G9AA 1U8CA 3JPXA 4MMZA 4NBMA 2I3SA 2EIBA 4XYIA 1XKSA 4L3HD 3I2NA 4AN1A 5HQGA 3UVKA 5I5MA 4A08B 4J8BA 4L9OA 1ERJA 4QL1A 1R5MA 3AFCA 1XIPA 2QC5A 3EG6A 3KRWB 4PNKB 2H14A 1VZ2A 1SQJA 4CY5A 4DNWA 3IKOA 3IIWA 1QFMA 5IJ7E 4G56B 5C2VB 3V4VA 1A12A 2IWKA 4K3ID 4O3TB 2UZXB 4U7AA 3IJEA 4A11A 3AL9A 2VDPA 2HJ4A 1Q47A 2VDQA 3B7FA 4AMYA 3I8EA 3BG0A 1A0RB 2QZPA 4GM8A 2H9LA 4GQ1A 4L1MA 4O3UB 2IUQA 2OVPB 3N0DA 4LG9A 4FHLA 5FXYA 1GOHA 3EI4A 5HE1B 2H6NA 4ZN4A 4BCDA 3SBPA 3DXKC 4L1QD 2I0TA 4UM9A 3OKYB 2IWFA 2AGLA 2G99A 3NVNA 3ORVD 4G55A 3DDUA 4PSWB 2H3XA 4ERQA 3ULEC 4JSXC 2QXVA 1O6GA 2Z2NA 5IJ8E 4Y7RA 2XE4A 3RRMC 3V7DB 1UOOA 3O4IA 4PBZA 3V4PA 4A0AB 4CY3A 4CY2A 5EAMA 2XZGA 3ZE2A 2QR5A 1N6EA 2CNXA 4Z7QA 5CXBA 5EMJB 5I5JA 1U2VC 3SVWD 4N14A 4FA9D 2PM6B 4JSVC 4KFMB 1UOPA 1MG2A 4BCCA 3AH8B 1JJUB 3IUQA 5M5VA 5EMMB 4RE5A 3SN6B 3SBQA 4GM9A 3ZE1A 3IIYA 4MMXA 4D9SA 2YNNA 2I3TA 3OW8A 3EWEA 3UVMA 1PBYB 4Z8LA 2VDLA 4CY1A 5EM2A 2AGWA 2YB8B 3RN1D 2YBAA 5GSAA 3P4FA 1TBGA 2HJBA 4IMMA 3PXWD 4JXMA 5GXIA 1VZ3A 2PM7B 2HYEA 1YR2A 3OL2B 3EI1B 4GM3A 5FKTA 3K71A 2H9PA 3SFZA 5H1MA 3V5WB 1E5TA 4R7AB 1B9YA 5THAA 2J55H 3O4HA 4J78A 5TDHB 4WK2A 3ZDYA 1GOTB 4J79A 4BH6A 1JTDB 4AOWA 2CE8A 5CXCB 1H2WA 4J86A 4D0KA 2H13A 4X60B 4ERZA 2YMUA 5E6SA 2CN2A 1YFQA 4K3JB 3I7PA 3C9CA 3UR4A 4FAVD 4E54A 4AMZA 4NENA 4JD2C 4A09B 1MDAH 4UI9R 5HE3B 3EQ7A 5AMSA 4QQEA 4MMYA 3JAMg 2OK4A 4LGNA 3C75H 3ZDZA 1I2MB 3OKWA 4CI8A 4TZ4A 3MKQA 1OLZA 2VDKA 2OK6A 4A11B 2AGXA 5B4WA 3EU7A 4JHPC 2J57G 2HU5A 2XL2A 1B9XA 3GREA 5KDOB 4A0BB 2PM9B 5EMLB 2W18A 3VA6A 5E6UA 2B5NA 3JZGA 4A08A 3NIDA 4X61B 4H5JA 5K19A 4PXWA 1M1XA 4EWRA 3PVUB 3CIKB 4QAMA 3VGZA 4A2MA 2VDRA 2BBKH 1K3IA 5JWZA 1QFSA 3QHYB 2P9UC 1K8KC 3F3FA 2HKRA 4J81A 3NVQA 4YVDA 5H14A 3FM0A 3UVOA 5M5TA 4Z7NA 2GC7A 3VH0A 4QT8A 2XYIA 4FA1D 4JT6C 4AN0A 2HKMA 3I7OA 3EI2B 4O9DA 3IURA 4BL0A 4JSNC 3JZHA 3FCSA 3ZWLB 3DSMA 3JB9L 5C9ZB 5FKQA 3MZKA 2GNQA 3IVMA 2O9KA 1GXRA 2WQ8A 3VI4A 4DNUA 3IUNA 1JOFA 3RFGA 5AFU3 4JHNA 4HDJA 5IGOA 5HYNB 2CO0A 3RN0D 3ODTA 4DNVA 3PXTD 5CYKB 2AQ5A 2P9IC 5SXMA 4ES0A 3AL8B 2IURA 3GFCA 4J8GA 3GD1I 3HFQA 3PSCB 4JT5C 1L0QA 3O4GA 3OKYA 3IUJA 3ZE0A 3L4OD 3SWSD 5I5IA 4BP9A 2IAAA 2CN3A 3I89A 2B5MA 5C92A 1GP2B 4I79A 4ZOVA 2H9MA 2AH0A 3U4YA 3I8CA 3UKRC 5GMKn 5IT9g 5M61A 1C9LA 1NR0A 2XL3A 2CE9A 4E5ZA 2OVRB 4BUJC 5FFOA 3SJLD 3K26A 4OWRA 3K72A 1JV2A 4CZXA 4Z7OA 1GOFA 3MVDK 1H2ZA 3I7NA 4BP8A 3MXXA 4PSXB 1O6FA 3CFVA 2P9KC 4GQ2P 1H2YA 3VI3A 4H5IA 3NIFA 3K6SA 2H6KA 3A0FA 3FRXA 3EI3B 1N6DA 3IJCA 3PXSD 2HXCA 4FA4D 4WJKA 2VDNA 3PE7A 2I0RA 4LG8A 4FA5D 4E54B 4QRJA 5AJAA 2Q7QA 4NC4A 3OTTA 4GGCA 4GMBA 3SLED 3SHFA 1BPOA 4CI1A 4U1EI 2VZ3A 1GOGA 3OL2A 3EI1A 3IULA 5HE0B 5IGQA 1C9IA 2UZYB 3I7KA 3UVLA 4O02A 2J56H 4OZUA 5TEFA 3EQ8A 5M5RA 5A2Qg 1VE6A 4J0XA 2OIZA 4GGAA 2H68A 1XHMA 5H17A 3DM0A 5M5UA 2P9LC 4FWWA 4J73A 5CXCA 4J77A 1UTCA 2VZ1A 4G1MA 4L3GD 5FKRA 2XDWA 3UKUC 4WK0A 3EQ9A 2OJYA 3PSLA 1P22A 2GC4A 3C99A 3RFHA 1GG2B 1VYHC 4J0WA 4GQBB 3W15A 4A2LA 4A09A 4FAND 4ERYA 4J87A 1MG3A 4AX4A 4GZ8A 2VDMA 4X3EA 3RMZD 3EI4B 5FQDA 2BKLA 2AH1A 3BWSA 5C2WB 1FWXA 3KCIA 2B4EA 2I0SA 2OVQB 5EAPA 3OF7A 5TEEA 2P9SC 4G1EA 1JMZB 4MK0B 1L5GA 4A0BA 2PM9A 2HESX 3DXMC 4PC0A 5C86A 3FCUA 4CZYA 4IA9A 3V9FA 3F3GA 3K27A 3MZLA 2H47A 3MUOA 3NVXA 5IC7A 2EBSA 4WK4A 2H6QA 2VC2A 2XU7A 5CXBB 5HDBA 1UOQA 2YNPA 3MUNA 2MTAH 4CI2A 4ESGA 2TRCB 5FFGA 4BCBA 1RI6A 3SBRA 4ZOZA 4ZOXA 1T2XA 2YNOA 5EMKB 5HE2B 2P9PC 3EI2A 3NIGA 3N0EA 4O1QD 1U4CA 2HU8A 3JRPA 4IRZA 4PBYA 5FLXg 4O45A 3T3PA 3QI0A 3J81g 3OKTA 4J82A 4O2WA 3PVWB 5EM2B 4E5ZB 2AGZA 2JKXA 1PGUA 2CO0C 5M5SA 3O4JA 1TYEA 2IUPA 3SMRA 5EALA 4AEZA 4CZVA 4A0AA 3L4MD 2EIEA 3SCYA 3JROA 1PI6A 3MMYA 5CYKA 3RSEC 3F3PA 3BG1A 4NAAA 3AL8A 3CFSB 5EARA 4CC9A 4D6VA 2AGYA 1NEXB 2BCJB 1JMXB 1TYQC 3MKSB 4FB1D 3DWLC 3KRXB 4NSXA 2VDOA 3T3MA 4JSPC 1S4UX 4UM8A 2P9NC 2HU7A 4XEIC 3RLMD 1SQ9A 2EIDA 3IJ1A 3I7HA 2Z2PA 3UVNA 3C5MA 3IJ0A 4X63B 1VE7A 3I7LA 1PEVA 3IUMA 5FA5B 4RE6A 3EMHA
chains in the Genus database with same CATH topology
3SXTD 1N6FA 4Y5RD 4XYHA 5TF2A 2B5LA 4J84A 4CI3A 5GXHA 1K32A 2H9NA 3E0CA 3FGBA 5K1CC 1SHYB 2IUVA 1QNIA 3JZNA 1OMWB 4A7JA 2Z2OA 2PBIB 4GGDA 3J80g 3EI3A 5FKSA 4ZOYA 2G9AA 3JPXA 2I3SA 4XYIA 1XKSA 4L3HD 3I2NA 5HQGA 3UVKA 5I5MA 4A08B 4J8BA 4L9OA 1ERJA 4QL1A 1R5MA 3AFCA 1XIPA 2QC5A 3EG6A 3KRWB 4PNKB 2H14A 1SQJA 4CY5A 3IKOA 3IIWA 5IJ7E 4G56B 5C2VB 2IWKA 4K3ID 4O3TB 2UZXB 4U7AA 4A11A 3AL9A 2HJ4A 1Q47A 3B7FA 3I8EA 3BG0A 1A0RB 4GM8A 2H9LA 4GQ1A 4O3UB 2IUQA 2OVPB 3N0DA 4LG9A 4FHLA 5FXYA 3EI4A 5HE1B 2H6NA 4ZN4A 3SBPA 3DXKC 4L1QD 2I0TA 3OKYB 2IWFA 2AGLA 2G99A 3NVNA 3ORVD 4PSWB 2H3XA 4ERQA 3ULEC 4JSXC 2QXVA 2Z2NA 5IJ8E 4Y7RA 3RRMC 3V7DB 4PBZA 4A0AB 4CY3A 4CY2A 5EAMA 1N6EA 2CNXA 5CXBA 5EMJB 5I5JA 1U2VC 3SVWD 4N14A 4FA9D 2PM6B 4JSVC 4KFMB 1MG2A 3AH8B 1JJUB 5EMMB 3SN6B 3SBQA 4GM9A 3IIYA 2YNNA 2I3TA 3OW8A 3EWEA 3UVMA 1PBYB 4Z8LA 4CY1A 5EM2A 2AGWA 2YB8B 3RN1D 2YBAA 5GSAA 3P4FA 1TBGA 2HJBA 4IMMA 3PXWD 4JXMA 5GXIA 2PM7B 2HYEA 3OL2B 3EI1B 4GM3A 5FKTA 2H9PA 3SFZA 5H1MA 3V5WB 4R7AB 1B9YA 5THAA 2J55H 4J78A 5TDHB 1GOTB 4J79A 4BH6A 4AOWA 2CE8A 5CXCB 4J86A 4D0KA 2H13A 4X60B 4ERZA 2YMUA 2CN2A 1YFQA 4K3JB 3I7PA 3C9CA 3UR4A 4FAVD 4E54A 4JD2C 4A09B 1MDAH 4UI9R 5HE3B 5AMSA 4QQEA 3JAMg 2OK4A 4LGNA 3C75H 3OKWA 4CI8A 4TZ4A 3MKQA 1OLZA 2OK6A 4A11B 2AGXA 5B4WA 3EU7A 2J57G 2XL2A 1B9XA 3GREA 5KDOB 4A0BB 2PM9B 5EMLB 2W18A 3VA6A 2B5NA 3JZGA 4A08A 4X61B 4H5JA 5K19A 4PXWA 4EWRA 3PVUB 3CIKB 3VGZA 4A2MA 2BBKH 5JWZA 2P9UC 1K8KC 3F3FA 2HKRA 4J81A 3NVQA 4YVDA 5H14A 3FM0A 3UVOA 2GC7A 3VH0A 4QT8A 2XYIA 4FA1D 4JT6C 2HKMA 3I7OA 3EI2B 4O9DA 4BL0A 4JSNC 3JZHA 3ZWLB 3DSMA 3JB9L 5C9ZB 5FKQA 3MZKA 2GNQA 2O9KA 1GXRA 3RFGA 1JOFA 5AFU3 4HDJA 5IGOA 5HYNB 2CO0A 3RN0D 3ODTA 3PXTD 5CYKB 2AQ5A 2P9IC 5SXMA 4ES0A 3AL8B 2IURA 3GFCA 4J8GA 3HFQA 3PSCB 4JT5C 1L0QA 3OKYA 3L4OD 3SWSD 5I5IA 2IAAA 2CN3A 3I89A 2B5MA 1GP2B 4I79A 4ZOVA 2H9MA 2AH0A 3U4YA 3I8CA 3UKRC 5GMKn 5IT9g 1NR0A 2XL3A 2CE9A 4E5ZA 2OVRB 4BUJC 3SJLD 3K26A 4OWRA 4CZXA 3I7NA 3MXXA 4PSXB 3CFVA 2P9KC 4GQ2P 4H5IA 2H6KA 3A0FA 3FRXA 3EI3B 1N6DA 3IJCA 3PXSD 2HXCA 4FA4D 3PE7A 2I0RA 4LG8A 4FA5D 4E54B 4QRJA 5AJAA 2Q7QA 3OTTA 4GGCA 4GMBA 3SLED 3SHFA 4CI1A 4U1EI 3OL2A 3EI1A 5HE0B 5IGQA 2UZYB 3I7KA 3UVLA 2J56H 4OZUA 5TEFA 5A2Qg 4J0XA 2OIZA 4GGAA 2H68A 1XHMA 5H17A 3DM0A 2P9LC 4FWWA 4J73A 5CXCA 4J77A 4L3GD 5FKRA 3UKUC 3PSLA 2OJYA 1P22A 2GC4A 3C99A 3RFHA 1GG2B 1VYHC 4J0WA 4GQBB 3W15A 4A2LA 4A09A 4FAND 4ERYA 4J87A 1MG3A 4GZ8A 4X3EA 3RMZD 3EI4B 5FQDA 2AH1A 3BWSA 5C2WB 1FWXA 2B4EA 2I0SA 2OVQB 5EAPA 5TEEA 2P9SC 1JMZB 4MK0B 4A0BA 2PM9A 2HESX 3DXMC 4PC0A 4CZYA 4IA9A 3V9FA 3F3GA 3K27A 3MZLA 2H47A 3NVXA 5IC7A 2EBSA 2H6QA 2XU7A 5CXBB 2YNPA 4CI2A 2MTAH 4ESGA 2TRCB 1RI6A 3SBRA 4ZOZA 4ZOXA 2YNOA 5EMKB 5HE2B 2P9PC 3EI2A 3N0EA 4O1QD 1U4CA 4PBYA 3JRPA 5FLXg 4O45A 3J81g 3OKTA 4J82A 3PVWB 5EM2B 4E5ZB 2AGZA 1PGUA 2CO0C 2IUPA 3SMRA 5EALA 4AEZA 4CZVA 4A0AA 3L4MD 3SCYA 3JROA 1PI6A 3MMYA 5CYKA 3RSEC 3F3PA 3BG1A 5EARA 3AL8A 3CFSB 4CC9A 4D6VA 2AGYA 1NEXB 2BCJB 1JMXB 1TYQC 3MKSB 4FB1D 3DWLC 3KRXB 4NSXA 4JSPC 1S4UX 2P9NC 4XEIC 3RLMD 1SQ9A 3IJ1A 3I7HA 2Z2PA 3UVNA 3C5MA 3IJ0A 4X63B 3I7LA 1PEVA 5FA5B 3EMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SXT D;  1N6F A;  4Y5R D;  4XYH A;  5TF2 A;  2B5L A;  4J84 A;  4CI3 A;  5GXH A;  1K32 A;  2H9N A;  3E0C A;  3FGB A;  5K1C C;  1SHY B;  2IUV A;  1QNI A;  3JZN A;  1OMW B;  4A7J A;  2Z2O A;  2PBI B;  4GGD A;  3J80 g;  3EI3 A;  5FKS A;  4ZOY A;  2G9A A;  3JPX A;  2I3S A;  4XYI A;  1XKS A;  4L3H D;  3I2N A;  5HQG A;  3UVK A;  5I5M A;  4A08 B;  4J8B A;  4L9O A;  1ERJ A;  4QL1 A;  1R5M A;  3AFC A;  1XIP A;  2QC5 A;  3EG6 A;  3KRW B;  4PNK B;  2H14 A;  1SQJ A;  4CY5 A;  3IKO A;  3IIW A;  5IJ7 E;  4G56 B;  5C2V B;  2IWK A;  4K3I D;  4O3T B;  2UZX B;  4U7A A;  4A11 A;  3AL9 A;  2HJ4 A;  1Q47 A;  3B7F A;  3I8E A;  3BG0 A;  1A0R B;  4GM8 A;  2H9L A;  4GQ1 A;  4O3U B;  2IUQ A;  2OVP B;  3N0D A;  4LG9 A;  4FHL A;  5FXY A;  3EI4 A;  5HE1 B;  2H6N A;  4ZN4 A;  3SBP A;  3DXK C;  4L1Q D;  2I0T A;  3OKY B;  2IWF A;  2AGL A;  2G99 A;  3NVN A;  3ORV D;  4PSW B;  2H3X A;  4ERQ A;  3ULE C;  4JSX C;  2QXV A;  2Z2N A;  5IJ8 E;  4Y7R A;  3RRM C;  3V7D B;  4PBZ A;  4A0A B;  4CY3 A;  4CY2 A;  5EAM A;  1N6E A;  2CNX A;  5CXB A;  5EMJ B;  5I5J A;  1U2V C;  3SVW D;  4N14 A;  4FA9 D;  2PM6 B;  4JSV C;  4KFM B;  1MG2 A;  3AH8 B;  1JJU B;  5EMM B;  3SN6 B;  3SBQ A;  4GM9 A;  3IIY A;  2YNN A;  2I3T A;  3OW8 A;  3EWE A;  3UVM A;  1PBY B;  4Z8L A;  4CY1 A;  5EM2 A;  2AGW A;  2YB8 B;  3RN1 D;  2YBA A;  5GSA A;  3P4F A;  1TBG A;  2HJB A;  4IMM A;  3PXW D;  4JXM A;  5GXI A;  2PM7 B;  2HYE A;  3OL2 B;  3EI1 B;  4GM3 A;  5FKT A;  2H9P A;  3SFZ A;  5H1M A;  3V5W B;  4R7A B;  1B9Y A;  5THA A;  2J55 H;  4J78 A;  5TDH B;  1GOT B;  4J79 A;  4BH6 A;  4AOW A;  2CE8 A;  5CXC B;  4J86 A;  4D0K A;  2H13 A;  4X60 B;  4ERZ A;  2YMU A;  2CN2 A;  1YFQ A;  4K3J B;  3I7P A;  3C9C A;  3UR4 A;  4FAV D;  4E54 A;  4JD2 C;  4A09 B;  1MDA H;  4UI9 R;  5HE3 B;  5AMS A;  4QQE A;  3JAM g;  2OK4 A;  4LGN A;  3C75 H;  3OKW A;  4CI8 A;  4TZ4 A;  3MKQ A;  1OLZ A;  2OK6 A;  4A11 B;  2AGX A;  5B4W A;  3EU7 A;  2J57 G;  2XL2 A;  1B9X A;  3GRE A;  5KDO B;  4A0B B;  2PM9 B;  5EML B;  2W18 A;  3VA6 A;  2B5N A;  3JZG A;  4A08 A;  4X61 B;  4H5J A;  5K19 A;  4PXW A;  4EWR A;  3PVU B;  3CIK B;  3VGZ A;  4A2M A;  2BBK H;  5JWZ A;  2P9U C;  1K8K C;  3F3F A;  2HKR A;  4J81 A;  3NVQ A;  4YVD A;  5H14 A;  3FM0 A;  3UVO A;  2GC7 A;  3VH0 A;  4QT8 A;  2XYI A;  4FA1 D;  4JT6 C;  2HKM A;  3I7O A;  3EI2 B;  4O9D A;  4BL0 A;  4JSN C;  3JZH A;  3ZWL B;  3DSM A;  3JB9 L;  5C9Z B;  5FKQ A;  3MZK A;  2GNQ A;  2O9K A;  1GXR A;  3RFG A;  1JOF A;  5AFU 3;  4HDJ A;  5IGO A;  5HYN B;  2CO0 A;  3RN0 D;  3ODT A;  3PXT D;  5CYK B;  2AQ5 A;  2P9I C;  5SXM A;  4ES0 A;  3AL8 B;  2IUR A;  3GFC A;  4J8G A;  3HFQ A;  3PSC B;  4JT5 C;  1L0Q A;  3OKY A;  3L4O D;  3SWS D;  5I5I A;  2IAA A;  2CN3 A;  3I89 A;  2B5M A;  1GP2 B;  4I79 A;  4ZOV A;  2H9M A;  2AH0 A;  3U4Y A;  3I8C A;  3UKR C;  5GMK n;  5IT9 g;  1NR0 A;  2XL3 A;  2CE9 A;  4E5Z A;  2OVR B;  4BUJ C;  3SJL D;  3K26 A;  4OWR A;  4CZX A;  3I7N A;  3MXX A;  4PSX B;  3CFV A;  2P9K C;  4GQ2 P;  4H5I A;  2H6K A;  3A0F A;  3FRX A;  3EI3 B;  1N6D A;  3IJC A;  3PXS D;  2HXC A;  4FA4 D;  3PE7 A;  2I0R A;  4LG8 A;  4FA5 D;  4E54 B;  4QRJ A;  5AJA A;  2Q7Q A;  3OTT A;  4GGC A;  4GMB A;  3SLE D;  3SHF A;  4CI1 A;  4U1E I;  3OL2 A;  3EI1 A;  5HE0 B;  5IGQ A;  2UZY B;  3I7K A;  3UVL A;  2J56 H;  4OZU A;  5TEF A;  5A2Q g;  4J0X A;  2OIZ A;  4GGA A;  2H68 A;  1XHM A;  5H17 A;  3DM0 A;  2P9L C;  4FWW A;  4J73 A;  5CXC A;  4J77 A;  4L3G D;  5FKR A;  3UKU C;  3PSL A;  2OJY A;  1P22 A;  2GC4 A;  3C99 A;  3RFH A;  1GG2 B;  1VYH C;  4J0W A;  4GQB B;  3W15 A;  4A2L A;  4A09 A;  4FAN D;  4ERY A;  4J87 A;  1MG3 A;  4GZ8 A;  4X3E A;  3RMZ D;  3EI4 B;  5FQD A;  2AH1 A;  3BWS A;  5C2W B;  1FWX A;  2B4E A;  2I0S A;  2OVQ B;  5EAP A;  5TEE A;  2P9S C;  1JMZ B;  4MK0 B;  4A0B A;  2PM9 A;  2HES X;  3DXM C;  4PC0 A;  4CZY A;  4IA9 A;  3V9F A;  3F3G A;  3K27 A;  3MZL A;  2H47 A;  3NVX A;  5IC7 A;  2EBS A;  2H6Q A;  2XU7 A;  5CXB B;  2YNP A;  4CI2 A;  2MTA H;  4ESG A;  2TRC B;  1RI6 A;  3SBR A;  4ZOZ A;  4ZOX A;  2YNO A;  5EMK B;  5HE2 B;  2P9P C;  3EI2 A;  3N0E A;  4O1Q D;  1U4C A;  4PBY A;  3JRP A;  5FLX g;  4O45 A;  3J81 g;  3OKT A;  4J82 A;  3PVW B;  5EM2 B;  4E5Z B;  2AGZ A;  1PGU A;  2CO0 C;  2IUP A;  3SMR A;  5EAL A;  4AEZ A;  4CZV A;  4A0A A;  3L4M D;  3SCY A;  3JRO A;  1PI6 A;  3MMY A;  5CYK A;  3RSE C;  3F3P A;  3BG1 A;  5EAR A;  3AL8 A;  3CFS B;  4CC9 A;  4D6V A;  2AGY A;  1NEX B;  2BCJ B;  1JMX B;  1TYQ C;  3MKS B;  4FB1 D;  3DWL C;  3KRX B;  4NSX A;  4JSP C;  1S4U X;  2P9N C;  4XEI C;  3RLM D;  1SQ9 A;  3IJ1 A;  3I7H A;  2Z2P A;  3UVN A;  3C5M A;  3IJ0 A;  4X63 B;  3I7L A;  1PEV A;  5FA5 B;  3EMH A; 
#chains in the Genus database with same CATH topology
 3SXT D;  1N6F A;  4Y5R D;  4XYH A;  5TF2 A;  2B5L A;  1H2X A;  4J84 A;  3ZDX A;  4CI3 A;  5GXH A;  1E8M A;  1K32 A;  2H9N A;  3E0C A;  5E6R A;  3FGB A;  5K1C C;  3GC3 B;  1SHY B;  2IUV A;  2EIC A;  1QNI A;  3JZN A;  1OMW B;  4A7J A;  2Z2O A;  2PBI B;  1E8N A;  4GGD A;  3J80 g;  3EI3 A;  5FKS A;  4ZOY A;  2G9A A;  1U8C A;  3JPX A;  4MMZ A;  4NBM A;  2I3S A;  2EIB A;  4XYI A;  1XKS A;  4L3H D;  3I2N A;  4AN1 A;  5HQG A;  3UVK A;  5I5M A;  4A08 B;  4J8B A;  4L9O A;  1ERJ A;  4QL1 A;  1R5M A;  3AFC A;  1XIP A;  2QC5 A;  3EG6 A;  3KRW B;  4PNK B;  2H14 A;  1VZ2 A;  1SQJ A;  4CY5 A;  4DNW A;  3IKO A;  3IIW A;  1QFM A;  5IJ7 E;  4G56 B;  5C2V B;  3V4V A;  1A12 A;  2IWK A;  4K3I D;  4O3T B;  2UZX B;  4U7A A;  3IJE A;  4A11 A;  3AL9 A;  2VDP A;  2HJ4 A;  1Q47 A;  2VDQ A;  3B7F A;  4AMY A;  3I8E A;  3BG0 A;  1A0R B;  2QZP A;  4GM8 A;  2H9L A;  4GQ1 A;  4L1M A;  4O3U B;  2IUQ A;  2OVP B;  3N0D A;  4LG9 A;  4FHL A;  5FXY A;  1GOH A;  3EI4 A;  5HE1 B;  2H6N A;  4ZN4 A;  4BCD A;  3SBP A;  3DXK C;  4L1Q D;  2I0T A;  4UM9 A;  3OKY B;  2IWF A;  2AGL A;  2G99 A;  3NVN A;  3ORV D;  4G55 A;  3DDU A;  4PSW B;  2H3X A;  4ERQ A;  3ULE C;  4JSX C;  2QXV A;  1O6G A;  2Z2N A;  5IJ8 E;  4Y7R A;  2XE4 A;  3RRM C;  3V7D B;  1UOO A;  3O4I A;  4PBZ A;  3V4P A;  4A0A B;  4CY3 A;  4CY2 A;  5EAM A;  2XZG A;  3ZE2 A;  2QR5 A;  1N6E A;  2CNX A;  4Z7Q A;  5CXB A;  5EMJ B;  5I5J A;  1U2V C;  3SVW D;  4N14 A;  4FA9 D;  2PM6 B;  4JSV C;  4KFM B;  1UOP A;  1MG2 A;  4BCC A;  3AH8 B;  1JJU B;  3IUQ A;  5M5V A;  5EMM B;  4RE5 A;  3SN6 B;  3SBQ A;  4GM9 A;  3ZE1 A;  3IIY A;  4MMX A;  4D9S A;  2YNN A;  2I3T A;  3OW8 A;  3EWE A;  3UVM A;  1PBY B;  4Z8L A;  2VDL A;  4CY1 A;  5EM2 A;  2AGW A;  2YB8 B;  3RN1 D;  2YBA A;  5GSA A;  3P4F A;  1TBG A;  2HJB A;  4IMM A;  3PXW D;  4JXM A;  5GXI A;  1VZ3 A;  2PM7 B;  2HYE A;  1YR2 A;  3OL2 B;  3EI1 B;  4GM3 A;  5FKT A;  3K71 A;  2H9P A;  3SFZ A;  5H1M A;  3V5W B;  1E5T A;  4R7A B;  1B9Y A;  5THA A;  2J55 H;  3O4H A;  4J78 A;  5TDH B;  4WK2 A;  3ZDY A;  1GOT B;  4J79 A;  4BH6 A;  1JTD B;  4AOW A;  2CE8 A;  5CXC B;  1H2W A;  4J86 A;  4D0K A;  2H13 A;  4X60 B;  4ERZ A;  2YMU A;  5E6S A;  2CN2 A;  1YFQ A;  4K3J B;  3I7P A;  3C9C A;  3UR4 A;  4FAV D;  4E54 A;  4AMZ A;  4NEN A;  4JD2 C;  4A09 B;  1MDA H;  4UI9 R;  5HE3 B;  3EQ7 A;  5AMS A;  4QQE A;  4MMY A;  3JAM g;  2OK4 A;  4LGN A;  3C75 H;  3ZDZ A;  1I2M B;  3OKW A;  4CI8 A;  4TZ4 A;  3MKQ A;  1OLZ A;  2VDK A;  2OK6 A;  4A11 B;  2AGX A;  5B4W A;  3EU7 A;  4JHP C;  2J57 G;  2HU5 A;  2XL2 A;  1B9X A;  3GRE A;  5KDO B;  4A0B B;  2PM9 B;  5EML B;  2W18 A;  3VA6 A;  5E6U A;  2B5N A;  3JZG A;  4A08 A;  3NID A;  4X61 B;  4H5J A;  5K19 A;  4PXW A;  1M1X A;  4EWR A;  3PVU B;  3CIK B;  4QAM A;  3VGZ A;  4A2M A;  2VDR A;  2BBK H;  1K3I A;  5JWZ A;  1QFS A;  3QHY B;  2P9U C;  1K8K C;  3F3F A;  2HKR A;  4J81 A;  3NVQ A;  4YVD A;  5H14 A;  3FM0 A;  3UVO A;  5M5T A;  4Z7N A;  2GC7 A;  3VH0 A;  4QT8 A;  2XYI A;  4FA1 D;  4JT6 C;  4AN0 A;  2HKM A;  3I7O A;  3EI2 B;  4O9D A;  3IUR A;  4BL0 A;  4JSN C;  3JZH A;  3FCS A;  3ZWL B;  3DSM A;  3JB9 L;  5C9Z B;  5FKQ A;  3MZK A;  2GNQ A;  3IVM A;  2O9K A;  1GXR A;  2WQ8 A;  3VI4 A;  4DNU A;  3IUN A;  1JOF A;  3RFG A;  5AFU 3;  4JHN A;  4HDJ A;  5IGO A;  5HYN B;  2CO0 A;  3RN0 D;  3ODT A;  4DNV A;  3PXT D;  5CYK B;  2AQ5 A;  2P9I C;  5SXM A;  4ES0 A;  3AL8 B;  2IUR A;  3GFC A;  4J8G A;  3GD1 I;  3HFQ A;  3PSC B;  4JT5 C;  1L0Q A;  3O4G A;  3OKY A;  3IUJ A;  3ZE0 A;  3L4O D;  3SWS D;  5I5I A;  4BP9 A;  2IAA A;  2CN3 A;  3I89 A;  2B5M A;  5C92 A;  1GP2 B;  4I79 A;  4ZOV A;  2H9M A;  2AH0 A;  3U4Y A;  3I8C A;  3UKR C;  5GMK n;  5IT9 g;  5M61 A;  1C9L A;  1NR0 A;  2XL3 A;  2CE9 A;  4E5Z A;  2OVR B;  4BUJ C;  5FFO A;  3SJL D;  3K26 A;  4OWR A;  3K72 A;  1JV2 A;  4CZX A;  4Z7O A;  1GOF A;  3MVD K;  1H2Z A;  3I7N A;  4BP8 A;  3MXX A;  4PSX B;  1O6F A;  3CFV A;  2P9K C;  4GQ2 P;  1H2Y A;  3VI3 A;  4H5I A;  3NIF A;  3K6S A;  2H6K A;  3A0F A;  3FRX A;  3EI3 B;  1N6D A;  3IJC A;  3PXS D;  2HXC A;  4FA4 D;  4WJK A;  2VDN A;  3PE7 A;  2I0R A;  4LG8 A;  4FA5 D;  4E54 B;  4QRJ A;  5AJA A;  2Q7Q A;  4NC4 A;  3OTT A;  4GGC A;  4GMB A;  3SLE D;  3SHF A;  1BPO A;  4CI1 A;  4U1E I;  2VZ3 A;  1GOG A;  3OL2 A;  3EI1 A;  3IUL A;  5HE0 B;  5IGQ A;  1C9I A;  2UZY B;  3I7K A;  3UVL A;  4O02 A;  2J56 H;  4OZU A;  5TEF A;  3EQ8 A;  5M5R A;  5A2Q g;  1VE6 A;  4J0X A;  2OIZ A;  4GGA A;  2H68 A;  1XHM A;  5H17 A;  3DM0 A;  5M5U A;  2P9L C;  4FWW A;  4J73 A;  5CXC A;  4J77 A;  1UTC A;  2VZ1 A;  4G1M A;  4L3G D;  5FKR A;  2XDW A;  3UKU C;  4WK0 A;  3EQ9 A;  2OJY A;  3PSL A;  1P22 A;  2GC4 A;  3C99 A;  3RFH A;  1GG2 B;  1VYH C;  4J0W A;  4GQB B;  3W15 A;  4A2L A;  4A09 A;  4FAN D;  4ERY A;  4J87 A;  1MG3 A;  4AX4 A;  4GZ8 A;  2VDM A;  4X3E A;  3RMZ D;  3EI4 B;  5FQD A;  2BKL A;  2AH1 A;  3BWS A;  5C2W B;  1FWX A;  3KCI A;  2B4E A;  2I0S A;  2OVQ B;  5EAP A;  3OF7 A;  5TEE A;  2P9S C;  4G1E A;  1JMZ B;  4MK0 B;  1L5G A;  4A0B A;  2PM9 A;  2HES X;  3DXM C;  4PC0 A;  5C86 A;  3FCU A;  4CZY A;  4IA9 A;  3V9F A;  3F3G A;  3K27 A;  3MZL A;  2H47 A;  3MUO A;  3NVX A;  5IC7 A;  2EBS A;  4WK4 A;  2H6Q A;  2VC2 A;  2XU7 A;  5CXB B;  5HDB A;  1UOQ A;  2YNP A;  3MUN A;  2MTA H;  4CI2 A;  4ESG A;  2TRC B;  5FFG A;  4BCB A;  1RI6 A;  3SBR A;  4ZOZ A;  4ZOX A;  1T2X A;  2YNO A;  5EMK B;  5HE2 B;  2P9P C;  3EI2 A;  3NIG A;  3N0E A;  4O1Q D;  1U4C A;  2HU8 A;  3JRP A;  4IRZ A;  4PBY A;  5FLX g;  4O45 A;  3T3P A;  3QI0 A;  3J81 g;  3OKT A;  4J82 A;  4O2W A;  3PVW B;  5EM2 B;  4E5Z B;  2AGZ A;  2JKX A;  1PGU A;  2CO0 C;  5M5S A;  3O4J A;  1TYE A;  2IUP A;  3SMR A;  5EAL A;  4AEZ A;  4CZV A;  4A0A A;  3L4M D;  2EIE A;  3SCY A;  3JRO A;  1PI6 A;  3MMY A;  5CYK A;  3RSE C;  3F3P A;  3BG1 A;  4NAA A;  3AL8 A;  3CFS B;  5EAR A;  4CC9 A;  4D6V A;  2AGY A;  1NEX B;  2BCJ B;  1JMX B;  1TYQ C;  3MKS B;  4FB1 D;  3DWL C;  3KRX B;  4NSX A;  2VDO A;  3T3M A;  4JSP C;  1S4U X;  4UM8 A;  2P9N C;  2HU7 A;  4XEI C;  3RLM D;  1SQ9 A;  2EID A;  3IJ1 A;  3I7H A;  2Z2P A;  3UVN A;  3C5M A;  3IJ0 A;  4X63 B;  1VE7 A;  3I7L A;  1PEV A;  3IUM A;  5FA5 B;  4RE6 A;  3EMH A; 
#chains in the Genus database with same CATH homology
 3SXT D;  1N6F A;  4Y5R D;  4XYH A;  5TF2 A;  2B5L A;  4J84 A;  4CI3 A;  5GXH A;  1K32 A;  2H9N A;  3E0C A;  3FGB A;  5K1C C;  1SHY B;  2IUV A;  1QNI A;  3JZN A;  1OMW B;  4A7J A;  2Z2O A;  2PBI B;  4GGD A;  3J80 g;  3EI3 A;  5FKS A;  4ZOY A;  2G9A A;  3JPX A;  2I3S A;  4XYI A;  1XKS A;  4L3H D;  3I2N A;  5HQG A;  3UVK A;  5I5M A;  4A08 B;  4J8B A;  4L9O A;  1ERJ A;  4QL1 A;  1R5M A;  3AFC A;  1XIP A;  2QC5 A;  3EG6 A;  3KRW B;  4PNK B;  2H14 A;  1SQJ A;  4CY5 A;  3IKO A;  3IIW A;  5IJ7 E;  4G56 B;  5C2V B;  2IWK A;  4K3I D;  4O3T B;  2UZX B;  4U7A A;  4A11 A;  3AL9 A;  2HJ4 A;  1Q47 A;  3B7F A;  3I8E A;  3BG0 A;  1A0R B;  4GM8 A;  2H9L A;  4GQ1 A;  4O3U B;  2IUQ A;  2OVP B;  3N0D A;  4LG9 A;  4FHL A;  5FXY A;  3EI4 A;  5HE1 B;  2H6N A;  4ZN4 A;  3SBP A;  3DXK C;  4L1Q D;  2I0T A;  3OKY B;  2IWF A;  2AGL A;  2G99 A;  3NVN A;  3ORV D;  4PSW B;  2H3X A;  4ERQ A;  3ULE C;  4JSX C;  2QXV A;  2Z2N A;  5IJ8 E;  4Y7R A;  3RRM C;  3V7D B;  4PBZ A;  4A0A B;  4CY3 A;  4CY2 A;  5EAM A;  1N6E A;  2CNX A;  5CXB A;  5EMJ B;  5I5J A;  1U2V C;  3SVW D;  4N14 A;  4FA9 D;  2PM6 B;  4JSV C;  4KFM B;  1MG2 A;  3AH8 B;  1JJU B;  5EMM B;  3SN6 B;  3SBQ A;  4GM9 A;  3IIY A;  2YNN A;  2I3T A;  3OW8 A;  3EWE A;  3UVM A;  1PBY B;  4Z8L A;  4CY1 A;  5EM2 A;  2AGW A;  2YB8 B;  3RN1 D;  2YBA A;  5GSA A;  3P4F A;  1TBG A;  2HJB A;  4IMM A;  3PXW D;  4JXM A;  5GXI A;  2PM7 B;  2HYE A;  3OL2 B;  3EI1 B;  4GM3 A;  5FKT A;  2H9P A;  3SFZ A;  5H1M A;  3V5W B;  4R7A B;  1B9Y A;  5THA A;  2J55 H;  4J78 A;  5TDH B;  1GOT B;  4J79 A;  4BH6 A;  4AOW A;  2CE8 A;  5CXC B;  4J86 A;  4D0K A;  2H13 A;  4X60 B;  4ERZ A;  2YMU A;  2CN2 A;  1YFQ A;  4K3J B;  3I7P A;  3C9C A;  3UR4 A;  4FAV D;  4E54 A;  4JD2 C;  4A09 B;  1MDA H;  4UI9 R;  5HE3 B;  5AMS A;  4QQE A;  3JAM g;  2OK4 A;  4LGN A;  3C75 H;  3OKW A;  4CI8 A;  4TZ4 A;  3MKQ A;  1OLZ A;  2OK6 A;  4A11 B;  2AGX A;  5B4W A;  3EU7 A;  2J57 G;  2XL2 A;  1B9X A;  3GRE A;  5KDO B;  4A0B B;  2PM9 B;  5EML B;  2W18 A;  3VA6 A;  2B5N A;  3JZG A;  4A08 A;  4X61 B;  4H5J A;  5K19 A;  4PXW A;  4EWR A;  3PVU B;  3CIK B;  3VGZ A;  4A2M A;  2BBK H;  5JWZ A;  2P9U C;  1K8K C;  3F3F A;  2HKR A;  4J81 A;  3NVQ A;  4YVD A;  5H14 A;  3FM0 A;  3UVO A;  2GC7 A;  3VH0 A;  4QT8 A;  2XYI A;  4FA1 D;  4JT6 C;  2HKM A;  3I7O A;  3EI2 B;  4O9D A;  4BL0 A;  4JSN C;  3JZH A;  3ZWL B;  3DSM A;  3JB9 L;  5C9Z B;  5FKQ A;  3MZK A;  2GNQ A;  2O9K A;  1GXR A;  3RFG A;  1JOF A;  5AFU 3;  4HDJ A;  5IGO A;  5HYN B;  2CO0 A;  3RN0 D;  3ODT A;  3PXT D;  5CYK B;  2AQ5 A;  2P9I C;  5SXM A;  4ES0 A;  3AL8 B;  2IUR A;  3GFC A;  4J8G A;  3HFQ A;  3PSC B;  4JT5 C;  1L0Q A;  3OKY A;  3L4O D;  3SWS D;  5I5I A;  2IAA A;  2CN3 A;  3I89 A;  2B5M A;  1GP2 B;  4I79 A;  4ZOV A;  2H9M A;  2AH0 A;  3U4Y A;  3I8C A;  3UKR C;  5GMK n;  5IT9 g;  1NR0 A;  2XL3 A;  2CE9 A;  4E5Z A;  2OVR B;  4BUJ C;  3SJL D;  3K26 A;  4OWR A;  4CZX A;  3I7N A;  3MXX A;  4PSX B;  3CFV A;  2P9K C;  4GQ2 P;  4H5I A;  2H6K A;  3A0F A;  3FRX A;  3EI3 B;  1N6D A;  3IJC A;  3PXS D;  2HXC A;  4FA4 D;  3PE7 A;  2I0R A;  4LG8 A;  4FA5 D;  4E54 B;  4QRJ A;  5AJA A;  2Q7Q A;  3OTT A;  4GGC A;  4GMB A;  3SLE D;  3SHF A;  4CI1 A;  4U1E I;  3OL2 A;  3EI1 A;  5HE0 B;  5IGQ A;  2UZY B;  3I7K A;  3UVL A;  2J56 H;  4OZU A;  5TEF A;  5A2Q g;  4J0X A;  2OIZ A;  4GGA A;  2H68 A;  1XHM A;  5H17 A;  3DM0 A;  2P9L C;  4FWW A;  4J73 A;  5CXC A;  4J77 A;  4L3G D;  5FKR A;  3UKU C;  3PSL A;  2OJY A;  1P22 A;  2GC4 A;  3C99 A;  3RFH A;  1GG2 B;  1VYH C;  4J0W A;  4GQB B;  3W15 A;  4A2L A;  4A09 A;  4FAN D;  4ERY A;  4J87 A;  1MG3 A;  4GZ8 A;  4X3E A;  3RMZ D;  3EI4 B;  5FQD A;  2AH1 A;  3BWS A;  5C2W B;  1FWX A;  2B4E A;  2I0S A;  2OVQ B;  5EAP A;  5TEE A;  2P9S C;  1JMZ B;  4MK0 B;  4A0B A;  2PM9 A;  2HES X;  3DXM C;  4PC0 A;  4CZY A;  4IA9 A;  3V9F A;  3F3G A;  3K27 A;  3MZL A;  2H47 A;  3NVX A;  5IC7 A;  2EBS A;  2H6Q A;  2XU7 A;  5CXB B;  2YNP A;  4CI2 A;  2MTA H;  4ESG A;  2TRC B;  1RI6 A;  3SBR A;  4ZOZ A;  4ZOX A;  2YNO A;  5EMK B;  5HE2 B;  2P9P C;  3EI2 A;  3N0E A;  4O1Q D;  1U4C A;  4PBY A;  3JRP A;  5FLX g;  4O45 A;  3J81 g;  3OKT A;  4J82 A;  3PVW B;  5EM2 B;  4E5Z B;  2AGZ A;  1PGU A;  2CO0 C;  2IUP A;  3SMR A;  5EAL A;  4AEZ A;  4CZV A;  4A0A A;  3L4M D;  3SCY A;  3JRO A;  1PI6 A;  3MMY A;  5CYK A;  3RSE C;  3F3P A;  3BG1 A;  5EAR A;  3AL8 A;  3CFS B;  4CC9 A;  4D6V A;  2AGY A;  1NEX B;  2BCJ B;  1JMX B;  1TYQ C;  3MKS B;  4FB1 D;  3DWL C;  3KRX B;  4NSX A;  4JSP C;  1S4U X;  2P9N C;  4XEI C;  3RLM D;  1SQ9 A;  3IJ1 A;  3I7H A;  2Z2P A;  3UVN A;  3C5M A;  3IJ0 A;  4X63 B;  3I7L A;  1PEV A;  5FA5 B;  3EMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...