1C9IA

Peptide-in-groove interactions link target proteins to the b-propeller of clathrin
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
355
structure length
355
Chain Sequence
QILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLATHRIN
publication title Peptide-in-groove interactions link target proteins to the beta-propeller of clathrin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis/exocytosis
total genus 73
structure length 355
sequence length 355
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01394 Clathrin_propel Clathrin propeller repeat
A PF09268 Clathrin-link Clathrin, heavy-chain linker
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.110 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Clathrin heavy-chain terminal domain 1c9iA00
1BPOA 3GD1I 5M5TA 3GC3B 4G55A 1C9IA 5M61A 5M5RA 2XZGA 5M5SA 1UTCA 5M5UA 5M5VA 1C9LA
chains in the Genus database with same CATH superfamily
2I0SA 3ZE0A 5IT9g 4OZUA 4J8BA 2HYEA 2CNXA 3OW8A 4JSPC 4AX4A 3SJLD 4J84A 3UVMA 2BKLA 1M1XA 5CYKB 1UOOA 4U7AA 1Q47A 3PXTD 3SHFA 3ZE2A 5FA5B 1SHYB 5M5UA 4O02A 2IWFA 4ERQA 1H2YA 1T2XA 2XYIA 3DWLC 4A11B 3K71A 2P9IC 2G9AA 3KRWB 2PM7B 4FB1D 2OJYA 4O3UB 3N0EA 5EAMA 3SXTD 1H2XA 1U4CA 3EI1B 2AGWA 3PVWB 1GOTB 4RE5A 5I5JA 1K3IA 3BG1A 1R5MA 4L1MA 4R7AB 3RMZD 2YNNA 5FFOA 5M5TA 3O4JA 2Z2NA 2HU7A 5E6RA 3I7OA 5EARA 3EI3A 2O9KA 2Z2PA 1L5GA 4FAVD 3EQ8A 4FWWA 2HJ4A 4LG8A 4BH6A 3KRXB 1MG3A 1B9XA 4BCBA 2I3TA 2UZXB 5CXBB 1YFQA 4A08B 2B5LA 4CI1A 4NENA 2H9NA 5HDBA 4GM3A 1U8CA 2CE8A 5HQGA 4UI9R 5IC7A 2Q7QA 2IURA 2QC5A 3QI0A 3IIYA 3SCYA 3SWSD 1GP2B 3KCIA 2AGYA 3C5MA 3OKYA 3ZE1A 4XEIC 3RN1D 3NIDA 4QT8A 2IAAA 5K1CC 3EWEA 4G1MA 2I3SA 3V7DB 2P9NC 3AL8B 4WK0A 3EQ7A 5I5IA 2OVRB 5KDOB 2HXCA 4CI3A 2VDLA 2H6NA 4UM9A 4QAMA 4A7JA 4FA5D 2H6KA 2PM6B 3C9CA 3MUOA 2AH1A 4ZN4A 4A0BB 2H6QA 2HKRA 2PM9A 5HYNB 2P9LC 2IUPA 3A0FA 2HU8A 4AN0A 4TZ4A 4AN1A 4N14A 1C9LA 2EIEA 1NEXB 3IUJA 3NIGA 5TEFA 4CZVA 3IJ0A 4IRZA 4J81A 1JTDB 2P9SC 4GZ8A 5K19A 4E54A 3DXKC 4PBZA 2H68A 3PXWD 5TEEA 3E0CA 4JSNC 5M5SA 3GC3B 4PSWB 5CXCA 3VH0A 3RSEC 4CY2A 4AMZA 4K3JB 4ERYA 3MVDK 5TF2A 5AFU3 1K32A 4XYIA 2IWKA 4NBMA 2AGLA 4Z8LA 1TBGA 4E5ZB 3JROA 5GSAA 3QHYB 3B7FA 5C92A 3I7LA 4O45A 4WK2A 2XDWA 3C99A 4JXMA 4A09A 2W18A 4Z7QA 4O1QD 3FRXA 3F3FA 5IGQA 3K72A 3UKUC 5GMKn 5GXHA 3RRMC 4BP9A 2XU7A 4ES0A 1N6DA 2P9KC 4X61B 3ZWLB 1I2MB 5HE0B 2AGXA 4GQ1A 5EMJB 4U1EI 4JT6C 5EMKB 5IJ7E 3IUQA 2YNOA 3JZGA 1BPOA 2IUQA 3N0DA 4WJKA 3DSMA 3UVLA 1JJUB 2QXVA 1PBYB 4D9SA 3V4PA 1E8NA 1OLZA 1TYQC 4I79A 1XIPA 5EMLB 4H5IA 5H14A 1QFSA 1FWXA 4GQ2P 3SLED 5FQDA 2YB8B 3PXSD 3I2NA 1VE6A 3PSLA 1A12A 1S4UX 5FKTA 2CN3A 2J56H 2VZ1A 2CE9A 2GNQA 2XL2A 2YMUA 3EI3B 4A11A 3NVNA 3V9FA 2AQ5A 5H1MA 4AOWA 3MZLA 3UVKA 2VDOA 4K3ID 5M5VA 5E6UA 3JAMg 3K6SA 3J81g 1C9IA 3RFHA 4J82A 3BWSA 4NSXA 3SBPA 5IGOA 5E6SA 2BCJB 3JZNA 1TYEA 3IKOA 3IUNA 3OL2A 4IMMA 4PXWA 3NIFA 2B4EA 4ESGA 3EI2A 1VZ2A 4L9OA 3SN6B 3FM0A 3F3GA 4J8GA 4G56B 2AH0A 4ZOVA 5FKRA 4FAND 4GGAA 1PEVA 4J78A 2CO0C 3IVMA 5A2Qg 3EU7A 3AFCA 5FLXg 4QRJA 3NVXA 2QR5A 1N6FA 3I7KA 5C9ZB 5THAA 5HE2B 3MKSB 1YR2A 5C2WB 3ODTA 3VI3A 3I7PA 3MKQA 4A0AA 4A2LA 4DNVA 2JKXA 4J86A 4JD2C 4NAAA 3OF7A 2VDRA 3W15A 5FFGA 1SQ9A 2B5MA 2P9PC 3FCUA 3GREA 2OIZA 4XYHA 3O4HA 2BBKH 4AEZA 4IA9A 4L3HD 2H3XA 3EQ9A 3IURA 3VGZA 3U4YA 4E54B 4QL1A 2VDMA 4FA1D 5EM2A 4G1EA 5CXCB 3BG0A 4H5JA 3CFSB 3K26A 3AL9A 2G99A 3NVQA 4X3EA 4A0BA 1P22A 2Z2OA 3IIWA 2CO0A 5HE3B 4CY1A 1QFMA 3OTTA 3ULEC 4GGDA 3UR4A 4DNUA 3IJ1A 1H2ZA 2EIBA 4J73A 5EAPA 3I8CA 4HDJA 5AJAA 4A09B 3EG6A 4CZXA 4MK0B 1ERJA 4JSXC 3CFVA 4G55A 1MG2A 3K27A 3DDUA 3HFQA 5AMSA 5M5RA 4JHPC 1A0RB 4BP8A 2WQ8A 4BCDA 4JT5C 1RI6A 4E5ZA 2VC2A 2GC4A 4CZYA 4J79A 1UOQA 4CY5A 3OKWA 3EI4A 3V4VA 2VDNA 2H9PA 4D6VA 2UZYB 2XE4A 1OMWB 2VDQA 4X60B 2AGZA 4J0XA 5EALA 3SFZA 5HE1B 4PSXB 2H9LA 2CN2A 3FCSA 5CYKA 3J80g 1H2WA 3I7NA 1VZ3A 3IULA 1N6EA 5TDHB 1B9YA 2P9UC 4J0WA 3SMRA 2H13A 4MMZA 4O3TB 3I8EA 3MXXA 3EI1A 1UTCA 3RLMD 1U2VC 3P4FA 1XHMA 2IUVA 2HESX 4CC9A 3DM0A 4L3GD 3OL2B 2GC7A 3F3PA 2OVQB 2OVPB 4JSVC 4ZOZA 2VDKA 5FKQA 1SQJA 3EI2B 1PGUA 3VA6A 4D0KA 1K8KC 4FHLA 4QQEA 4PC0A 3OKYB 4WK4A 3RFGA 4CY3A 5M61A 3GFCA 3ZDXA 5FXYA 3T3PA 4ERZA 3EMHA 1E8MA 2XL3A 3MZKA 3GD1I 3IUMA 4Y7RA 2J55H 3O4GA 2I0TA 5CXBA 3DXMC 4A08A 1GXRA 2I0RA 1JMXB 3ZDZA 3O4IA 4MMXA 3UKRC 2VZ3A 4A0AB 3VI4A 1QNIA 4BCCA 2PM9B 1O6FA 1PI6A 4Z7OA 3RN0D 3L4MD 5C86A 2VDPA 2H47A 2OK6A 3CIKB 1JMZB 4BUJC 3OKTA 1JOFA 5I5MA 3SVWD 1O6GA 2YBAA 4KFMB 4PNKB 4YVDA 2OK4A 1VE7A 4LG9A 5C2VB 5GXIA 3T3MA 3AL8A 4FA4D 3UVOA 5EM2B 3JB9L 1VYHC 4PBYA 5FKSA 3PSCB 3L4OD 3V5WB 1JV2A 4J87A 4J77A 2MTAH 3SBQA 4CI8A 4RE6A 3C75H 2H14A 2B5NA 5JWZA 4GMBA 3PVUB 4BL0A 3JRPA 1GG2B 1L0QA 4Y5RD 3FGBA 5H17A 4X63B 2TRCB 4GGCA 2PBIB 4GM9A 3MUNA 1UOPA 4FA9D 4DNWA 4LGNA 4A2MA 3SBRA 4ZOXA 4UM8A 2HKMA 4O2WA 4CI2A 5IJ8E 4NC4A 1GOHA 4Z7NA 1GOGA 3IJCA 2H9MA 4JHNA 1XKSA 3JZHA 2HU5A 3PE7A 2J57G 3I7HA 3ZDYA 4GM8A 3MMYA 3ORVD 4ZOYA 5SXMA 5B4WA 4L1QD 4GQBB 5EMMB 2EICA 1GOFA 3EI4B 1E5TA 3IJEA 4MMYA 2YNPA 4O9DA 4AMYA 4EWRA 1MDAH 3UVNA 2QZPA 2HJBA 3AH8B 2EBSA 2XZGA 3I89A 2EIDA 1NR0A 3JPXA 4OWRA
chains in the Genus database with same CATH topology
1BPOA 3GD1I 5M5TA 3GC3B 4G55A 1C9IA 5M61A 5M5RA 2XZGA 5M5SA 1UTCA 5M5UA 5M5VA 1C9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BPO A;  3GD1 I;  5M5T A;  3GC3 B;  4G55 A;  1C9I A;  5M61 A;  5M5R A;  2XZG A;  5M5S A;  1UTC A;  5M5U A;  5M5V A;  1C9L A; 
#chains in the Genus database with same CATH topology
 2I0S A;  3ZE0 A;  5IT9 g;  4OZU A;  4J8B A;  2HYE A;  2CNX A;  3OW8 A;  4JSP C;  4AX4 A;  3SJL D;  4J84 A;  3UVM A;  2BKL A;  1M1X A;  5CYK B;  1UOO A;  4U7A A;  1Q47 A;  3PXT D;  3SHF A;  3ZE2 A;  5FA5 B;  1SHY B;  5M5U A;  4O02 A;  2IWF A;  4ERQ A;  1H2Y A;  1T2X A;  2XYI A;  3DWL C;  4A11 B;  3K71 A;  2P9I C;  2G9A A;  3KRW B;  2PM7 B;  4FB1 D;  2OJY A;  4O3U B;  3N0E A;  5EAM A;  3SXT D;  1H2X A;  1U4C A;  3EI1 B;  2AGW A;  3PVW B;  1GOT B;  4RE5 A;  5I5J A;  1K3I A;  3BG1 A;  1R5M A;  4L1M A;  4R7A B;  3RMZ D;  2YNN A;  5FFO A;  5M5T A;  3O4J A;  2Z2N A;  2HU7 A;  5E6R A;  3I7O A;  5EAR A;  3EI3 A;  2O9K A;  2Z2P A;  1L5G A;  4FAV D;  3EQ8 A;  4FWW A;  2HJ4 A;  4LG8 A;  4BH6 A;  3KRX B;  1MG3 A;  1B9X A;  4BCB A;  2I3T A;  2UZX B;  5CXB B;  1YFQ A;  4A08 B;  2B5L A;  4CI1 A;  4NEN A;  2H9N A;  5HDB A;  4GM3 A;  1U8C A;  2CE8 A;  5HQG A;  4UI9 R;  5IC7 A;  2Q7Q A;  2IUR A;  2QC5 A;  3QI0 A;  3IIY A;  3SCY A;  3SWS D;  1GP2 B;  3KCI A;  2AGY A;  3C5M A;  3OKY A;  3ZE1 A;  4XEI C;  3RN1 D;  3NID A;  4QT8 A;  2IAA A;  5K1C C;  3EWE A;  4G1M A;  2I3S A;  3V7D B;  2P9N C;  3AL8 B;  4WK0 A;  3EQ7 A;  5I5I A;  2OVR B;  5KDO B;  2HXC A;  4CI3 A;  2VDL A;  2H6N A;  4UM9 A;  4QAM A;  4A7J A;  4FA5 D;  2H6K A;  2PM6 B;  3C9C A;  3MUO A;  2AH1 A;  4ZN4 A;  4A0B B;  2H6Q A;  2HKR A;  2PM9 A;  5HYN B;  2P9L C;  2IUP A;  3A0F A;  2HU8 A;  4AN0 A;  4TZ4 A;  4AN1 A;  4N14 A;  1C9L A;  2EIE A;  1NEX B;  3IUJ A;  3NIG A;  5TEF A;  4CZV A;  3IJ0 A;  4IRZ A;  4J81 A;  1JTD B;  2P9S C;  4GZ8 A;  5K19 A;  4E54 A;  3DXK C;  4PBZ A;  2H68 A;  3PXW D;  5TEE A;  3E0C A;  4JSN C;  5M5S A;  3GC3 B;  4PSW B;  5CXC A;  3VH0 A;  3RSE C;  4CY2 A;  4AMZ A;  4K3J B;  4ERY A;  3MVD K;  5TF2 A;  5AFU 3;  1K32 A;  4XYI A;  2IWK A;  4NBM A;  2AGL A;  4Z8L A;  1TBG A;  4E5Z B;  3JRO A;  5GSA A;  3QHY B;  3B7F A;  5C92 A;  3I7L A;  4O45 A;  4WK2 A;  2XDW A;  3C99 A;  4JXM A;  4A09 A;  2W18 A;  4Z7Q A;  4O1Q D;  3FRX A;  3F3F A;  5IGQ A;  3K72 A;  3UKU C;  5GMK n;  5GXH A;  3RRM C;  4BP9 A;  2XU7 A;  4ES0 A;  1N6D A;  2P9K C;  4X61 B;  3ZWL B;  1I2M B;  5HE0 B;  2AGX A;  4GQ1 A;  5EMJ B;  4U1E I;  4JT6 C;  5EMK B;  5IJ7 E;  3IUQ A;  2YNO A;  3JZG A;  1BPO A;  2IUQ A;  3N0D A;  4WJK A;  3DSM A;  3UVL A;  1JJU B;  2QXV A;  1PBY B;  4D9S A;  3V4P A;  1E8N A;  1OLZ A;  1TYQ C;  4I79 A;  1XIP A;  5EML B;  4H5I A;  5H14 A;  1QFS A;  1FWX A;  4GQ2 P;  3SLE D;  5FQD A;  2YB8 B;  3PXS D;  3I2N A;  1VE6 A;  3PSL A;  1A12 A;  1S4U X;  5FKT A;  2CN3 A;  2J56 H;  2VZ1 A;  2CE9 A;  2GNQ A;  2XL2 A;  2YMU A;  3EI3 B;  4A11 A;  3NVN A;  3V9F A;  2AQ5 A;  5H1M A;  4AOW A;  3MZL A;  3UVK A;  2VDO A;  4K3I D;  5M5V A;  5E6U A;  3JAM g;  3K6S A;  3J81 g;  1C9I A;  3RFH A;  4J82 A;  3BWS A;  4NSX A;  3SBP A;  5IGO A;  5E6S A;  2BCJ B;  3JZN A;  1TYE A;  3IKO A;  3IUN A;  3OL2 A;  4IMM A;  4PXW A;  3NIF A;  2B4E A;  4ESG A;  3EI2 A;  1VZ2 A;  4L9O A;  3SN6 B;  3FM0 A;  3F3G A;  4J8G A;  4G56 B;  2AH0 A;  4ZOV A;  5FKR A;  4FAN D;  4GGA A;  1PEV A;  4J78 A;  2CO0 C;  3IVM A;  5A2Q g;  3EU7 A;  3AFC A;  5FLX g;  4QRJ A;  3NVX A;  2QR5 A;  1N6F A;  3I7K A;  5C9Z B;  5THA A;  5HE2 B;  3MKS B;  1YR2 A;  5C2W B;  3ODT A;  3VI3 A;  3I7P A;  3MKQ A;  4A0A A;  4A2L A;  4DNV A;  2JKX A;  4J86 A;  4JD2 C;  4NAA A;  3OF7 A;  2VDR A;  3W15 A;  5FFG A;  1SQ9 A;  2B5M A;  2P9P C;  3FCU A;  3GRE A;  2OIZ A;  4XYH A;  3O4H A;  2BBK H;  4AEZ A;  4IA9 A;  4L3H D;  2H3X A;  3EQ9 A;  3IUR A;  3VGZ A;  3U4Y A;  4E54 B;  4QL1 A;  2VDM A;  4FA1 D;  5EM2 A;  4G1E A;  5CXC B;  3BG0 A;  4H5J A;  3CFS B;  3K26 A;  3AL9 A;  2G99 A;  3NVQ A;  4X3E A;  4A0B A;  1P22 A;  2Z2O A;  3IIW A;  2CO0 A;  5HE3 B;  4CY1 A;  1QFM A;  3OTT A;  3ULE C;  4GGD A;  3UR4 A;  4DNU A;  3IJ1 A;  1H2Z A;  2EIB A;  4J73 A;  5EAP A;  3I8C A;  4HDJ A;  5AJA A;  4A09 B;  3EG6 A;  4CZX A;  4MK0 B;  1ERJ A;  4JSX C;  3CFV A;  4G55 A;  1MG2 A;  3K27 A;  3DDU A;  3HFQ A;  5AMS A;  5M5R A;  4JHP C;  1A0R B;  4BP8 A;  2WQ8 A;  4BCD A;  4JT5 C;  1RI6 A;  4E5Z A;  2VC2 A;  2GC4 A;  4CZY A;  4J79 A;  1UOQ A;  4CY5 A;  3OKW A;  3EI4 A;  3V4V A;  2VDN A;  2H9P A;  4D6V A;  2UZY B;  2XE4 A;  1OMW B;  2VDQ A;  4X60 B;  2AGZ A;  4J0X A;  5EAL A;  3SFZ A;  5HE1 B;  4PSX B;  2H9L A;  2CN2 A;  3FCS A;  5CYK A;  3J80 g;  1H2W A;  3I7N A;  1VZ3 A;  3IUL A;  1N6E A;  5TDH B;  1B9Y A;  2P9U C;  4J0W A;  3SMR A;  2H13 A;  4MMZ A;  4O3T B;  3I8E A;  3MXX A;  3EI1 A;  1UTC A;  3RLM D;  1U2V C;  3P4F A;  1XHM A;  2IUV A;  2HES X;  4CC9 A;  3DM0 A;  4L3G D;  3OL2 B;  2GC7 A;  3F3P A;  2OVQ B;  2OVP B;  4JSV C;  4ZOZ A;  2VDK A;  5FKQ A;  1SQJ A;  3EI2 B;  1PGU A;  3VA6 A;  4D0K A;  1K8K C;  4FHL A;  4QQE A;  4PC0 A;  3OKY B;  4WK4 A;  3RFG A;  4CY3 A;  5M61 A;  3GFC A;  3ZDX A;  5FXY A;  3T3P A;  4ERZ A;  3EMH A;  1E8M A;  2XL3 A;  3MZK A;  3GD1 I;  3IUM A;  4Y7R A;  2J55 H;  3O4G A;  2I0T A;  5CXB A;  3DXM C;  4A08 A;  1GXR A;  2I0R A;  1JMX B;  3ZDZ A;  3O4I A;  4MMX A;  3UKR C;  2VZ3 A;  4A0A B;  3VI4 A;  1QNI A;  4BCC A;  2PM9 B;  1O6F A;  1PI6 A;  4Z7O A;  3RN0 D;  3L4M D;  5C86 A;  2VDP A;  2H47 A;  2OK6 A;  3CIK B;  1JMZ B;  4BUJ C;  3OKT A;  1JOF A;  5I5M A;  3SVW D;  1O6G A;  2YBA A;  4KFM B;  4PNK B;  4YVD A;  2OK4 A;  1VE7 A;  4LG9 A;  5C2V B;  5GXI A;  3T3M A;  3AL8 A;  4FA4 D;  3UVO A;  5EM2 B;  3JB9 L;  1VYH C;  4PBY A;  5FKS A;  3PSC B;  3L4O D;  3V5W B;  1JV2 A;  4J87 A;  4J77 A;  2MTA H;  3SBQ A;  4CI8 A;  4RE6 A;  3C75 H;  2H14 A;  2B5N A;  5JWZ A;  4GMB A;  3PVU B;  4BL0 A;  3JRP A;  1GG2 B;  1L0Q A;  4Y5R D;  3FGB A;  5H17 A;  4X63 B;  2TRC B;  4GGC A;  2PBI B;  4GM9 A;  3MUN A;  1UOP A;  4FA9 D;  4DNW A;  4LGN A;  4A2M A;  3SBR A;  4ZOX A;  4UM8 A;  2HKM A;  4O2W A;  4CI2 A;  5IJ8 E;  4NC4 A;  1GOH A;  4Z7N A;  1GOG A;  3IJC A;  2H9M A;  4JHN A;  1XKS A;  3JZH A;  2HU5 A;  3PE7 A;  2J57 G;  3I7H A;  3ZDY A;  4GM8 A;  3MMY A;  3ORV D;  4ZOY A;  5SXM A;  5B4W A;  4L1Q D;  4GQB B;  5EMM B;  2EIC A;  1GOF A;  3EI4 B;  1E5T A;  3IJE A;  4MMY A;  2YNP A;  4O9D A;  4AMY A;  4EWR A;  1MDA H;  3UVN A;  2QZP A;  2HJB A;  3AH8 B;  2EBS A;  2XZG A;  3I89 A;  2EID A;  1NR0 A;  3JPX A;  4OWR A; 
#chains in the Genus database with same CATH homology
 1BPO A;  3GD1 I;  5M5T A;  3GC3 B;  4G55 A;  1C9I A;  5M61 A;  5M5R A;  2XZG A;  5M5S A;  1UTC A;  5M5U A;  5M5V A;  1C9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...