1C9IA

Peptide-in-groove interactions link target proteins to the b-propeller of clathrin
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
355
structure length
355
Chain Sequence
QILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis/exocytosis
molecule keywords CLATHRIN
publication title Peptide-in-groove interactions link target proteins to the beta-propeller of clathrin.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 73
structure length 355
sequence length 355
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01394 Clathrin_propel Clathrin propeller repeat
A PF09268 Clathrin-link Clathrin, heavy-chain linker
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.110 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Clathrin heavy-chain terminal domain 1c9iA00
5M5RA 3GC3B 2XZGA 1BPOA 5M5UA 1C9LA 5M5SA 1C9IA 5M5TA 1UTCA 3GD1I 4G55A 5M61A 5M5VA
chains in the Genus database with same CATH superfamily
5I5JA 4DNWA 4NBMA 4WJKA 3IULA 3GD1I 5CYKA 4CZXA 3SCYA 2H9MA 5EMJB 5EAPA 2J57G 3SMRA 3SHFA 1VZ2A 4FB1D 4GQ1A 3CFVA 1BPOA 3I7LA 2Q7QA 1C9IA 1UTCA 3C5MA 4CY2A 5AFU3 2OVRB 5H17A 1PEVA 2OK4A 5FA5B 4QQEA 5GXIA 4J81A 3UVMA 2H14A 4HDJA 4J8GA 3KCIA 4O3TB 5FKSA 4J73A 3L4MD 3V4VA 3SBQA 4PBYA 4E5ZB 2P9NC 2IUVA 3ZWLB 3OL2A 4K3JB 2JKXA 2IWKA 2HU5A 4MMXA 4FA1D 4ERQA 4A09B 3SLED 3EQ7A 4XYHA 3DXKC 1GOGA 4WK2A 2OIZA 3O4HA 3J81g 4O9DA 3EI2B 3N0EA 5CXCA 3MKQA 5C2VB 5K19A 3N0DA 5C92A 4A0BB 3OKYA 5I5MA 4X63B 3I8CA 3V5WB 2H6KA 4JSXC 3EI1A 5FKQA 5AMSA 3VH0A 3I7PA 1FWXA 4JT6C 2AGLA 2QZPA 1H2ZA 4A2LA 3JAMg 1N6DA 5IJ8E 5FFOA 3C75H 4A08B 3SBRA 2YMUA 1PGUA 4Z7QA 2AGZA 2J55H 3MXXA 2Z2PA 3SVWD 3MZLA 5E6UA 5FLXg 2Z2OA 4WK4A 5EMKB 2VDKA 3NIDA 3SJLD 4A0AA 3JZNA 4LG8A 4QRJA 2VZ1A 1VYHC 2H6NA 4U7AA 4J84A 4CY1A 1GOHA 3DDUA 3OF7A 4A2MA 4AN1A 5M61A 2PM7B 1TBGA 4A7JA 2CN2A 1JMXB 3I8EA 2EIEA 2H6QA 1JOFA 1E8NA 4CI8A 3SXTD 3MMYA 4N14A 4IRZA 3IJEA 3U4YA 3DSMA 3IUMA 5C2WB 3PSCB 3E0CA 2IWFA 4BUJC 4GQBB 2YNOA 4BCDA 3KRXB 4GZ8A 4Z8LA 3UVOA 2GC4A 3EI4A 4A11A 1UOQA 5GMKn 1XKSA 2VDMA 2AGYA 3OL2B 2Z2NA 2IUQA 4MMZA 2HU7A 1M1XA 2EIDA 3IURA 3K6SA 2P9IC 3VI3A 1P22A 1XHMA 3OKTA 4PSXB 3DWLC 3VI4A 5EMMB 3K26A 4BCCA 3P4FA 3K71A 5CXCB 3FGBA 3C99A 3O4JA 2H13A 3OKYB 1S4UX 3ULEC 3K72A 4ZOZA 3EI1B 4AMYA 3V4PA 2EIBA 1C9LA 5M5SA 4J78A 3QHYB 4FHLA 2XL2A 2IAAA 3DXMC 5M5VA 3JB9L 4PBZA 1N6FA 5FXYA 2OJYA 4AEZA 3W15A 4AX4A 1MG2A 2YNNA 5M5UA 3KRWB 3EI3A 4GM8A 4QL1A 3IJCA 3NVNA 4O3UB 5K1CC 4CZVA 2PBIB 1E8MA 5CXBA 4A0AB 3NIFA 2WQ8A 4DNUA 2GNQA 1RI6A 4L3GD 1OMWB 2H9PA 3ODTA 4NENA 2B4EA 3O4GA 2XZGA 1U2VC 4PSWB 3CIKB 4JXMA 2TRCB 3EQ9A 5TDHB 2H9LA 4H5JA 4YVDA 3ZDYA 4GQ2P 4L1MA 3AL8A 3PSLA 1SHYB 2XL3A 1JV2A 5IC7A 2PM6B 3QI0A 3EQ8A 3BG1A 4L3HD 4Y7RA 2B5NA 3MVDK 3I7HA 4L9OA 4TZ4A 3EG6A 2QXVA 3EI4B 4A11B 4ERZA 4BP8A 3PVWB 3I7KA 2VDOA 3MUNA 4ZN4A 4UM9A 4JHPC 4FA9D 1PI6A 1YFQA 3AH8B 2HESX 3JROA 2VDLA 4E54B 2IUPA 4NSXA 2CO0C 2VDPA 5THAA 3MZKA 3I7OA 3UVKA 3BWSA 3PVUB 2HJ4A 4CZYA 4J0XA 3ORVD 2VDNA 3K27A 1U4CA 4G55A 1SQ9A 3MKSB 3RRMC 5M5RA 4IMMA 4ESGA 5A2Qg 5GXHA 2HJBA 5CYKB 3UKUC 1K32A 3VGZA 4D0KA 4O45A 2XE4A 2VDRA 1E5TA 2I0RA 2HYEA 5IGOA 3ZDXA 1TYEA 3EI3B 2P9UC 5HDBA 5CXBB 3ZDZA 3I7NA 2HXCA 3B7FA 3IIWA 2W18A 5EM2A 5C9ZB 2HKMA 4G1EA 4GGCA 5HYNB 4CC9A 2XU7A 4RE5A 5EALA 3SFZA 1H2WA 3O4IA 4R7AB 4JSVC 4OZUA 1L5GA 4NAAA 3DM0A 3JZGA 2CE9A 2AH1A 2PM9A 4GGDA 1SQJA 3AL8B 4CY5A 4ES0A 4UI9R 3BG0A 5HE3B 2XYIA 5I5IA 3F3FA 2J56H 4MMYA 3V7DB 2AH0A 1JJUB 3F3PA 1B9XA 2OVQB 5KDOB 1GP2B 2HKRA 3NIGA 1NEXB 1QFSA 3PXWD 1H2YA 2CNXA 2VDQA 1K3IA 4J87A 1JTDB 5HE1B 4FAVD 1GOFA 5C86A 5AJAA 4BCBA 2OK6A 4IA9A 2I0TA 4AN0A 5E6RA 2P9PC 4FA4D 1O6FA 3RFGA 5JWZA 4Z7OA 5IGQA 3EWEA 4J82A 3IKOA 5EMLB 1VE7A 2P9SC 5HE2B 3I2NA 5HQGA 4JHNA 3ZE1A 3IJ0A 1QNIA 3OKWA 3GC3B 3JRPA 4JSNC 4QAMA 4FWWA 3PE7A 5M5TA 4PC0A 3UR4A 2OVPB 4J79A 1UOPA 3I89A 1VZ3A 3NVXA 1MG3A 1QFMA 1XIPA 3T3PA 3AL9A 4OWRA 4ZOYA 3SN6B 1K8KC 2GC7A 2XDWA 3SBPA 5GSAA 4GM3A 3V9FA 3OTTA 4G1MA 4X3EA 3EU7A 4XEIC 3EMHA 3RLMD 2G99A 3CFSB 2H47A 3AFCA 4JSPC 4BP9A 2CE8A 3NVQA 5EM2B 2H9NA 1B9YA 3T3MA 1YR2A 4BL0A 2I3SA 1L0QA 4Y5RD 4LGNA 5H14A 4D6VA 4JT5C 3UVLA 2CN3A 2BBKH 3FCSA 2YNPA 4MK0B 2PM9B 3OW8A 4K3ID 3VA6A 1PBYB 3J80g 2CO0A 4PXWA 4WK0A 2EBSA 4ERYA 4J77A 2B5MA 1NR0A 5HE0B 3C9CA 3IUQA 5FKRA 5B4WA 2P9LC 2QR5A 1H2XA 4X60B 4CI2A 3GREA 3SWSD 3RN0D 2I3TA 3JZHA 2BKLA 1N6EA 3FRXA 2VC2A 2I0SA 3IUNA 1GXRA 2AQ5A 3RFHA 4XYIA 3IVMA 4RE6A 5FQDA 1UOOA 1U8CA 2H3XA 3ZE2A 1T2XA 3PXTD 5TF2A 4GMBA 2BCJB 5TEFA 5IJ7E 2VZ3A 3MUOA 4Z7NA 4H5IA 1A12A 3F3GA 3FCUA 4QT8A 2AGXA 4J0WA 3ZE0A 4GM9A 2B5LA 1R5MA 3HFQA 4U1EI 4J8BA 5E6SA 2O9KA 3A0FA 4JD2C 4FA5D 1I2MB 4E5ZA 4KFMB 2H68A 1VE6A 1MDAH 1OLZA 1JMZB 4A09A 2G9AA 1Q47A 3JPXA 4O02A 5SXMA 4LG9A 4AMZA 4BH6A 4AOWA 4O2WA 1ERJA 3RMZD 4PNKB 4CY3A 3EI2A 1TYQC 5IT9g 2AGWA 4O1QD 1A0RB 4J86A 4A0BA 4NC4A 2UZXB 3L4OD 4I79A 3IUJA 2IURA 3IJ1A 4X61B 1O6GA 1GOTB 5EAMA 3IIYA 4L1QD 2YBAA 4GGAA 2QC5A 2HU8A 4E54A 2P9KC 5EARA 3RSEC 4A08A 3FM0A 2YB8B 5TEEA 2MTAH 4D9SA 4ZOXA 4CI1A 5FKTA 3UVNA 1GG2B 4CI3A 4FAND 3RN1D 3PXSD 4UM8A 5FFGA 5H1MA 4ZOVA 4EWRA 4G56B 2EICA 4DNVA 3GFCA 2UZYB 3UKRC
chains in the Genus database with same CATH topology
5M5RA 3GC3B 2XZGA 1BPOA 5M5UA 1C9LA 5M5SA 1C9IA 5M5TA 1UTCA 3GD1I 4G55A 5M61A 5M5VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M5R A;  3GC3 B;  2XZG A;  1BPO A;  5M5U A;  1C9L A;  5M5S A;  1C9I A;  5M5T A;  1UTC A;  3GD1 I;  4G55 A;  5M61 A;  5M5V A; 
#chains in the Genus database with same CATH topology
 5I5J A;  4DNW A;  4NBM A;  4WJK A;  3IUL A;  3GD1 I;  5CYK A;  4CZX A;  3SCY A;  2H9M A;  5EMJ B;  5EAP A;  2J57 G;  3SMR A;  3SHF A;  1VZ2 A;  4FB1 D;  4GQ1 A;  3CFV A;  1BPO A;  3I7L A;  2Q7Q A;  1C9I A;  1UTC A;  3C5M A;  4CY2 A;  5AFU 3;  2OVR B;  5H17 A;  1PEV A;  2OK4 A;  5FA5 B;  4QQE A;  5GXI A;  4J81 A;  3UVM A;  2H14 A;  4HDJ A;  4J8G A;  3KCI A;  4O3T B;  5FKS A;  4J73 A;  3L4M D;  3V4V A;  3SBQ A;  4PBY A;  4E5Z B;  2P9N C;  2IUV A;  3ZWL B;  3OL2 A;  4K3J B;  2JKX A;  2IWK A;  2HU5 A;  4MMX A;  4FA1 D;  4ERQ A;  4A09 B;  3SLE D;  3EQ7 A;  4XYH A;  3DXK C;  1GOG A;  4WK2 A;  2OIZ A;  3O4H A;  3J81 g;  4O9D A;  3EI2 B;  3N0E A;  5CXC A;  3MKQ A;  5C2V B;  5K19 A;  3N0D A;  5C92 A;  4A0B B;  3OKY A;  5I5M A;  4X63 B;  3I8C A;  3V5W B;  2H6K A;  4JSX C;  3EI1 A;  5FKQ A;  5AMS A;  3VH0 A;  3I7P A;  1FWX A;  4JT6 C;  2AGL A;  2QZP A;  1H2Z A;  4A2L A;  3JAM g;  1N6D A;  5IJ8 E;  5FFO A;  3C75 H;  4A08 B;  3SBR A;  2YMU A;  1PGU A;  4Z7Q A;  2AGZ A;  2J55 H;  3MXX A;  2Z2P A;  3SVW D;  3MZL A;  5E6U A;  5FLX g;  2Z2O A;  4WK4 A;  5EMK B;  2VDK A;  3NID A;  3SJL D;  4A0A A;  3JZN A;  4LG8 A;  4QRJ A;  2VZ1 A;  1VYH C;  2H6N A;  4U7A A;  4J84 A;  4CY1 A;  1GOH A;  3DDU A;  3OF7 A;  4A2M A;  4AN1 A;  5M61 A;  2PM7 B;  1TBG A;  4A7J A;  2CN2 A;  1JMX B;  3I8E A;  2EIE A;  2H6Q A;  1JOF A;  1E8N A;  4CI8 A;  3SXT D;  3MMY A;  4N14 A;  4IRZ A;  3IJE A;  3U4Y A;  3DSM A;  3IUM A;  5C2W B;  3PSC B;  3E0C A;  2IWF A;  4BUJ C;  4GQB B;  2YNO A;  4BCD A;  3KRX B;  4GZ8 A;  4Z8L A;  3UVO A;  2GC4 A;  3EI4 A;  4A11 A;  1UOQ A;  5GMK n;  1XKS A;  2VDM A;  2AGY A;  3OL2 B;  2Z2N A;  2IUQ A;  4MMZ A;  2HU7 A;  1M1X A;  2EID A;  3IUR A;  3K6S A;  2P9I C;  3VI3 A;  1P22 A;  1XHM A;  3OKT A;  4PSX B;  3DWL C;  3VI4 A;  5EMM B;  3K26 A;  4BCC A;  3P4F A;  3K71 A;  5CXC B;  3FGB A;  3C99 A;  3O4J A;  2H13 A;  3OKY B;  1S4U X;  3ULE C;  3K72 A;  4ZOZ A;  3EI1 B;  4AMY A;  3V4P A;  2EIB A;  1C9L A;  5M5S A;  4J78 A;  3QHY B;  4FHL A;  2XL2 A;  2IAA A;  3DXM C;  5M5V A;  3JB9 L;  4PBZ A;  1N6F A;  5FXY A;  2OJY A;  4AEZ A;  3W15 A;  4AX4 A;  1MG2 A;  2YNN A;  5M5U A;  3KRW B;  3EI3 A;  4GM8 A;  4QL1 A;  3IJC A;  3NVN A;  4O3U B;  5K1C C;  4CZV A;  2PBI B;  1E8M A;  5CXB A;  4A0A B;  3NIF A;  2WQ8 A;  4DNU A;  2GNQ A;  1RI6 A;  4L3G D;  1OMW B;  2H9P A;  3ODT A;  4NEN A;  2B4E A;  3O4G A;  2XZG A;  1U2V C;  4PSW B;  3CIK B;  4JXM A;  2TRC B;  3EQ9 A;  5TDH B;  2H9L A;  4H5J A;  4YVD A;  3ZDY A;  4GQ2 P;  4L1M A;  3AL8 A;  3PSL A;  1SHY B;  2XL3 A;  1JV2 A;  5IC7 A;  2PM6 B;  3QI0 A;  3EQ8 A;  3BG1 A;  4L3H D;  4Y7R A;  2B5N A;  3MVD K;  3I7H A;  4L9O A;  4TZ4 A;  3EG6 A;  2QXV A;  3EI4 B;  4A11 B;  4ERZ A;  4BP8 A;  3PVW B;  3I7K A;  2VDO A;  3MUN A;  4ZN4 A;  4UM9 A;  4JHP C;  4FA9 D;  1PI6 A;  1YFQ A;  3AH8 B;  2HES X;  3JRO A;  2VDL A;  4E54 B;  2IUP A;  4NSX A;  2CO0 C;  2VDP A;  5THA A;  3MZK A;  3I7O A;  3UVK A;  3BWS A;  3PVU B;  2HJ4 A;  4CZY A;  4J0X A;  3ORV D;  2VDN A;  3K27 A;  1U4C A;  4G55 A;  1SQ9 A;  3MKS B;  3RRM C;  5M5R A;  4IMM A;  4ESG A;  5A2Q g;  5GXH A;  2HJB A;  5CYK B;  3UKU C;  1K32 A;  3VGZ A;  4D0K A;  4O45 A;  2XE4 A;  2VDR A;  1E5T A;  2I0R A;  2HYE A;  5IGO A;  3ZDX A;  1TYE A;  3EI3 B;  2P9U C;  5HDB A;  5CXB B;  3ZDZ A;  3I7N A;  2HXC A;  3B7F A;  3IIW A;  2W18 A;  5EM2 A;  5C9Z B;  2HKM A;  4G1E A;  4GGC A;  5HYN B;  4CC9 A;  2XU7 A;  4RE5 A;  5EAL A;  3SFZ A;  1H2W A;  3O4I A;  4R7A B;  4JSV C;  4OZU A;  1L5G A;  4NAA A;  3DM0 A;  3JZG A;  2CE9 A;  2AH1 A;  2PM9 A;  4GGD A;  1SQJ A;  3AL8 B;  4CY5 A;  4ES0 A;  4UI9 R;  3BG0 A;  5HE3 B;  2XYI A;  5I5I A;  3F3F A;  2J56 H;  4MMY A;  3V7D B;  2AH0 A;  1JJU B;  3F3P A;  1B9X A;  2OVQ B;  5KDO B;  1GP2 B;  2HKR A;  3NIG A;  1NEX B;  1QFS A;  3PXW D;  1H2Y A;  2CNX A;  2VDQ A;  1K3I A;  4J87 A;  1JTD B;  5HE1 B;  4FAV D;  1GOF A;  5C86 A;  5AJA A;  4BCB A;  2OK6 A;  4IA9 A;  2I0T A;  4AN0 A;  5E6R A;  2P9P C;  4FA4 D;  1O6F A;  3RFG A;  5JWZ A;  4Z7O A;  5IGQ A;  3EWE A;  4J82 A;  3IKO A;  5EML B;  1VE7 A;  2P9S C;  5HE2 B;  3I2N A;  5HQG A;  4JHN A;  3ZE1 A;  3IJ0 A;  1QNI A;  3OKW A;  3GC3 B;  3JRP A;  4JSN C;  4QAM A;  4FWW A;  3PE7 A;  5M5T A;  4PC0 A;  3UR4 A;  2OVP B;  4J79 A;  1UOP A;  3I89 A;  1VZ3 A;  3NVX A;  1MG3 A;  1QFM A;  1XIP A;  3T3P A;  3AL9 A;  4OWR A;  4ZOY A;  3SN6 B;  1K8K C;  2GC7 A;  2XDW A;  3SBP A;  5GSA A;  4GM3 A;  3V9F A;  3OTT A;  4G1M A;  4X3E A;  3EU7 A;  4XEI C;  3EMH A;  3RLM D;  2G99 A;  3CFS B;  2H47 A;  3AFC A;  4JSP C;  4BP9 A;  2CE8 A;  3NVQ A;  5EM2 B;  2H9N A;  1B9Y A;  3T3M A;  1YR2 A;  4BL0 A;  2I3S A;  1L0Q A;  4Y5R D;  4LGN A;  5H14 A;  4D6V A;  4JT5 C;  3UVL A;  2CN3 A;  2BBK H;  3FCS A;  2YNP A;  4MK0 B;  2PM9 B;  3OW8 A;  4K3I D;  3VA6 A;  1PBY B;  3J80 g;  2CO0 A;  4PXW A;  4WK0 A;  2EBS A;  4ERY A;  4J77 A;  2B5M A;  1NR0 A;  5HE0 B;  3C9C A;  3IUQ A;  5FKR A;  5B4W A;  2P9L C;  2QR5 A;  1H2X A;  4X60 B;  4CI2 A;  3GRE A;  3SWS D;  3RN0 D;  2I3T A;  3JZH A;  2BKL A;  1N6E A;  3FRX A;  2VC2 A;  2I0S A;  3IUN A;  1GXR A;  2AQ5 A;  3RFH A;  4XYI A;  3IVM A;  4RE6 A;  5FQD A;  1UOO A;  1U8C A;  2H3X A;  3ZE2 A;  1T2X A;  3PXT D;  5TF2 A;  4GMB A;  2BCJ B;  5TEF A;  5IJ7 E;  2VZ3 A;  3MUO A;  4Z7N A;  4H5I A;  1A12 A;  3F3G A;  3FCU A;  4QT8 A;  2AGX A;  4J0W A;  3ZE0 A;  4GM9 A;  2B5L A;  1R5M A;  3HFQ A;  4U1E I;  4J8B A;  5E6S A;  2O9K A;  3A0F A;  4JD2 C;  4FA5 D;  1I2M B;  4E5Z A;  4KFM B;  2H68 A;  1VE6 A;  1MDA H;  1OLZ A;  1JMZ B;  4A09 A;  2G9A A;  1Q47 A;  3JPX A;  4O02 A;  5SXM A;  4LG9 A;  4AMZ A;  4BH6 A;  4AOW A;  4O2W A;  1ERJ A;  3RMZ D;  4PNK B;  4CY3 A;  3EI2 A;  1TYQ C;  5IT9 g;  2AGW A;  4O1Q D;  1A0R B;  4J86 A;  4A0B A;  4NC4 A;  2UZX B;  3L4O D;  4I79 A;  3IUJ A;  2IUR A;  3IJ1 A;  4X61 B;  1O6G A;  1GOT B;  5EAM A;  3IIY A;  4L1Q D;  2YBA A;  4GGA A;  2QC5 A;  2HU8 A;  4E54 A;  2P9K C;  5EAR A;  3RSE C;  4A08 A;  3FM0 A;  2YB8 B;  5TEE A;  2MTA H;  4D9S A;  4ZOX A;  4CI1 A;  5FKT A;  3UVN A;  1GG2 B;  4CI3 A;  4FAN D;  3RN1 D;  3PXS D;  4UM8 A;  5FFG A;  5H1M A;  4ZOV A;  4EWR A;  4G56 B;  2EIC A;  4DNV A;  3GFC A;  2UZY B;  3UKR C; 
#chains in the Genus database with same CATH homology
 5M5R A;  3GC3 B;  2XZG A;  1BPO A;  5M5U A;  1C9L A;  5M5S A;  1C9I A;  5M5T A;  1UTC A;  3GD1 I;  4G55 A;  5M61 A;  5M5V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...