3AL8A

Plexin a2 / semaphorin 6a complex
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
550
structure length
537
Chain Sequence
GFPEDSEPISITKQYPVFVGHRHRLDIQMIMIMNRTLYVAARDHIYTVDIDTSHTEEIYCSKKLTWKSRQADVDTCRMKGKHKDECHNFIKVLLKKNDDTLFVCGTNAFNPSCRNYRVDTLETFGDEFSGMARCPYDAKHANIALFADGKLYSATVTDFLAIDAVIYRSLGDSPTLRTVKHDSKWLKEPYFVQAVDYGDYIYFFFREIAVEYNTMGKVVFPRVAQVCKNDMGGSQRVLEKQWTSFLKARLNCSVPGDSHFYFNILQAVTDVIRINGRDVVLATFSTPYNSIPGSAVCAYDMLDIANVFTGRFKEQKSPDSTWTPVPDERVPKPRPGCCAGSSSLEKYATSNEFPDDTLNFIKTHPLMDEAVPSIINRPWFLRTMVRYRLTKIAVDNAAGPYQNHTVVFLGSEKGIILKFLARIGSSGFLNGSLFLEEMNVYNPEKCSYDGVEDKRIMGMQLDRASGSLYVAFSTCVIKVPLGRCERHGKCKKTCIASRDPYCGWVRESGSCAHLSPLSRLTFEQDIERGNTDGLGDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Semaphorin-6A
publication title Structural basis for semaphorin signalling through the plexin receptor.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 111
structure length 537
sequence length 550
ec nomenclature
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01403 Sema Sema domain
A PF01437 PSI Plexin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3al8A01
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3al8A02
5FA5B 4ERZA 3AL8B 3SBRA 3OL2A 4WK4B 5CXBB 3I7OA 3JZGA 3OTTA 3PVUB 5C9ZB 2P26A 4A2LA 3PVWB 3I7KA 5E6UB 4A2MA 3NVQA 3C5MA 2BBKH 2YNOA 4CZXA 3IJCA 2UZXB 5IGOA 3ZE2B 4ESGA 2IWKA 3ULEC 3PXTD 4O3TB 5FXYA 2Q7QA 3HFQA 3PXSD 5HE1B 3ORVD 4D0KA 3IIYA 4CI1A 5CYKA 1B9YA 4A0BA 5H14A 1ERJA 2OVPB 4UI9R 3RN1D 2O9KA 4JSVC 3RRMC 1GG2B 2PM9A 1JJUB 4XEIC 4JD2C 3PSLA 4U1EI 4J82A 2P9LC 4GZ8A 1FWXA 3K27A 5HQGA 3UVOA 1TYEB 2VDMB 5EALA 1GOTB 2YBAA 3VH0A 3IKOA 3V9FA 2G99A 4YVDA 5HE2B 1PI6A 3RFHA 5I5JA 2I0SA 5AJAA 3MZLA 2VDKB 5B4WA 5EMJB 4AEZA 5TEFA 3J80g 3KRWB 3OKYA 5FQDA 2H9MA 3I7HA 4A7JA 3NIFB 4G56B 3DXKC 4GGDA 5AFU3 3ZE0B 4CC9A 3EG6A 2CN2A 2B5NA 4FAVD 4GGCA 4WK2B 2H6QA 2H9LA 4OWRA 2HJ4A 1P22A 4ZN4A 2J57G 5FKQA 3VI4B 4O1QD 4N14A 4H5IA 5EAMA 2CO0A 5H1MA 5HE3B 4J77A 5CXCA 3AFCA 3KRXB 4MK0B 4J8BA 2P28A 3UVMA 3OKYB 3SWSD 1U8CB 3SFZA 3RMZD 4X3EA 3AL9A 2IUPA 4L3HD 5THAA 1N6DA 5K1CC 3C75H 5IC7A 2CO0C 4Y7RA 4ERQA 3JAMg 3V5WB 3UR4A 3P4FA 3DWLC 1NEXB 3NVNA 1JMZB 4A09A 3VGZA 4GGAA 1PBYB 5GMKn 3RFGA 4A0AA 5CXCB 4BH6A 4PBYA 2W18A 4K3ID 2YB8B 4GQBB 3U4YA 2HESX 1RI6A 5FKRA 4XYHA 2YNNA 3ZDXB 3EWEA 1PEVA 4PC0A 3UVKA 1K8KC 3I7NA 2PM6B 3CFSB 2P9UC 1MG3A 2VDNB 4ZOZA 1SHYB 5JWZA 4A11A 4BUJC 4X61B 3EI2A 3OKWA 4CI8A 5IJ7E 4WJKB 2BCJB 1N6EA 2AGXA 4X60B 1U4CA 2CN3A 3DSMA 4UM9D 2I3TA 4CI3A 5E6SB 1K32A 2VDOB 4FA9D 3OL2B 4NSXA 4FHLA 5AMSA 4XYIA 3EMHA 4Z8LA 4JSNC 3B7FA 4ZOYA 4UM9B 2B5MA 3MKSB 4GQ2P 1A0RB 4CY2A 4UM8B 2H13A 3I7LA 1N6FA 2H9PA 4J0XA 1QNIA 3PSCB 4A11B 4L9OA 2QC5A 4CY3A 3EI2B 4FA5D 3SMRA 4GQ1A 2I3SA 1Q47A 2H6KA 1SQ9A 2GC7A 2I0RA 3NIDB 1TBGA 5EAPA 3MZKA 4E54A 2IUQA 5CYKB 2IUVA 4J81A 2G9AA 4LG9A 2Z2OA 4A0BB 3RN0D 1GXRA 2CE9A 4IMMA 1S4UX 4AOWA 2H6NA 3CIKB 2H3XA 2PM9B 4EWRA 1TYQC 4ZOVA 2GC4A 2TRCB 2VDRB 3DXMC 2XL2A 3IIWA 1NR0A 2P9KC 4HDJA 4CY1A 3PE7A 5H17A 2OVQB 3T3MB 2I0TA 3VA6A 4Z7NB 3J81g 2GNQA 2YNPA 1XKSA 3W15A 2CE8A 4J8GA 2QXVA 5IGQA 4H5JA 5KDOB 2AGYA 4PNKB 2AGZA 2HYEA 4O45A 3IJ0A 5I5IA 1OLZA 4J79A 2AGLA 4Y5RD 2OJYA 2HJBA 5E6RB 4GMBA 5HE0B 3RLMD 3BWSA 4U7AA 3BG0A 4O3UB 3JB9L 4LG8A 3GREA 4Z7QB 4FB1D 2AGWA 5EMMB 4JXMA 3L4OD 2IWFA 2MTAH 1MDAH 2P9IC 4GM8A 3EI1A 4QT8A 3F3FA 4JT5C 4CI2A 3F3PA 1R5MA 1VYHC 1SQJA 1JMXB 4L3GD 3K26A 3SN6B 1GP2B 5C2VB 4E5ZA 2AH1A 1MG2A 4R7AB 3FCUB 2H14A 2P9SC 2EBSA 3L4MD 3BG1A 2IURA 3CFVA 5I5MA 2AH0A 5HYNB 2VDQB 1PGUA 3N0DA 5A2Qg 3NIGB 4A08A 3SBPA 4ES0A 4OZUA 4GM9A 4D6VA 4I79A 4A09B 3UVLA 5GSAA 4ERYA 3NVXA 4JT6C 4A0AB 4K3JB 2B4EA 3I89A 3EI1B 3PXWD 3SBQA 2UZYB 5EMLB 3T3PB 4WK0B 4E5ZB 2PM7B 4FWWA 4O9DA 1L0QA 3MXXA 3I7PA 4BL0A 3IJ1A 3AH8B 4L1QD 5K19A 3ZDZB 4A08B 2J55H 1B9XA 1XHMA 5EARA 3A0FA 3MKQA 3FRXA 3MMYA 2YMUA 2B5LA 2OIZA 3FM0A 1XIPA 4J84A 2OVRB 4KFMB 5EMKB 4CZYA 3DM0A 5HDBB 5EM2A 2P9PC 3JZNA 2VDLB 5TF2A 2OK6A 2XU7A 4TZ4A 2PBIB 3ODTA 3SXTD 3OW8A 3SLED 2H47A 5GXIA 4FAND 3EI4A 1SSLA 4PSXB 5SXMA 3SCYA 4J0WA 3SHFA 4JSXC 5TEEA 3ZE1B 3C99A 2VDPB 4PXWA 3JPXA 5FKTA 1YUKA 5FLXg 2XYIA 3I8CA 3E0CA 2OK4A 3GFCA 2VC2B 3JRPA 4E54B 1JOFA 2AQ5A 3UKUC 2H9NA 3EU7A 5EM2B 4FA1D 5TDHB 3VI3B 4J78A 5IT9g 3EI3A 4PSWB 3V7DB 2CNXA 5C2WB 3C9CA 3FGBA 3I2NA 4J86A 1U2VC 1OMWB 1YFQA 5FKSA 2J56H 4FA4D 3RSEC 4CY5A 3EI4B 4QL1A 2HKMA 3AL8A 3SJLD 3UKRC 5GXHA 4QRJA 4JSPC 5CXBA 4PBZA 4J87A 3OKTA 4LGNA 4QQEA 2XL3A 3SVWD 2Z2PA 4ZOXA 4GM3A 5IJ8E 2HKRA 2H68A 3N0EA 4IA9A 4Z7OB 4CZVA 3F3GA 4X63B 3UVNA 3EI3B 2P9NC 2IAAA 4J73A 3ZDYB 3JZHA 3JROA 3ZWLB 2Z2NA 2HXCA 3I8EA
chains in the Genus database with same CATH superfamily
4JHPC 5FA5B 4ERZA 3AL8B 3SBRA 1E8NA 3OL2A 4WK4B 5CXBB 3I7OA 3JZGA 3OTTA 3PVUB 5C9ZB 2P26A 4A2LA 4BCDA 3PVWB 3I7KA 1L5GA 5E6UB 4A2MA 3NVQA 1VZ2A 1TYEA 3C5MA 2VDMA 2BBKH 2YNOA 4CZXA 3IJCA 4AX4A 2UZXB 5IGOA 2QZPA 3ZE2B 4ESGA 2IWKA 3ULEC 3PXTD 2QR5A 4O3TB 5FXYA 2Q7QA 3HFQA 3PXSD 5HE1B 3ORVD 4D0KA 3IIYA 2VDKA 1O6FA 4CI1A 5CYKA 3GD1I 3QHYB 1B9YA 4A0BA 3EQ7A 3K72A 5H14A 1ERJA 2OVPB 4UI9R 4L1MA 3EQ8A 3RN1D 2O9KA 1GOHA 4JSVC 1GG2B 2PM9A 1JJUB 3RRMC 3NIFA 4XEIC 4JD2C 4IRZA 3PSLA 3ZE0A 4U1EI 4GZ8A 2P9LC 4J82A 1FWXA 3K27A 4NENA 5HQGA 3UVOA 1TYEB 2VDMB 5EALA 1GOTB 1H2ZA 2YBAA 3VI4A 3VH0A 3IKOA 1H2YA 1UOOA 3V9FA 2G99A 4YVDA 4QAMA 5HE2B 1PI6A 3T3MA 3RFHA 5I5JA 2I0SA 5AJAA 3MZLA 2VDKB 5B4WA 5EMJB 4NC4A 4AEZA 5TEFA 3J80g 3KRWB 2HU5A 3OKYA 5FQDA 2H9MA 2JWGA 3I7HA 4A7JA 3NIFB 4G56B 3DXKC 4GGDA 5AFU3 4JHNA 3ZE0B 4CC9A 3EG6A 2CN2A 2B5NA 4FAVD 4GGCA 5E6RA 4WK2B 2H6QA 2H9LA 4OWRA 2HJ4A 1P22A 4ZN4A 2J57G 5FKQA 3VI4B 4Z7QA 1C9LA 4O1QD 4N14A 4H5IA 5EAMA 2CO0A 5H1MA 5HE3B 4J77A 3K71A 1I2MB 5FFGA 5CXCA 3AFCA 3KRXB 4MK0B 4J8BA 5M5RA 2P28A 3UVMA 3ZDXA 3OKYB 4DNWA 3SWSD 1U8CB 1BPOA 3SFZA 3RMZD 3FCUA 4X3EA 3AL9A 2IUPA 4L3HD 5THAA 2VDNA 1N6DA 5K1CC 3C75H 5IC7A 2VDQA 4AN0A 2CO0C 4Y7RA 4ERQA 3JAMg 3V5WB 3UR4A 3P4FA 1GOGA 3DWLC 1NEXB 3NVNA 1JMZB 4A09A 3VGZA 4GGAA 5C86A 1PBYB 5GMKn 1K3IA 3RFGA 1VZ3A 4A0AA 5CXCB 1VE7A 4PBYA 4BH6A 2W18A 4K3ID 2YB8B 5E6SA 2VDOA 4GQBB 3U4YA 2HESX 1RI6A 5FKRA 4XYHA 4G55A 2YNNA 3ZDXB 3KCIA 3EWEA 4WK0A 1PEVA 4PC0A 3UVKA 1K8KC 4UM9A 3I7NA 3K6SA 2PM6B 3CFSB 2P9UC 1MG3A 4UM8A 2VDNB 4ZOZA 1SHYB 2EIBA 5JWZA 4A11A 5M5UA 4BUJC 1H2WA 3IUNA 4X61B 3EI2A 1E8MA 3V4PA 1YR2A 3OKWA 5FFOA 4CI8A 5IJ7E 2EIDA 4WJKB 2BCJB 1N6EA 2AGXA 2JWHA 4X60B 2VZ3A 1U4CA 2CN3A 3DSMA 4UM9D 2I3TA 4CI3A 3NIDA 5E6SB 3O4JA 1K32A 4G1EA 2VDOB 4FA9D 3OL2B 3O4HA 3FCSA 1QFSA 3V4VA 4NSXA 2XE4A 4FHLA 5AMSA 4XYIA 3EMHA 4Z8LA 4JSNC 3B7FA 4ZOYA 4UM9B 2B5MA 3IJEA 3MKSB 4GQ2P 1A0RB 4CY2A 4UM8B 2H13A 3I7LA 4O2WA 1N6FA 2H9PA 2VDRA 4J0XA 1QNIA 3PSCB 4A11B 5M5VA 4L9OA 2QC5A 4CY3A 3EI2B 4FA5D 2HU8A 3SMRA 1UTCA 4GQ1A 2I3SA 4MMXA 1Q47A 2H6KA 3IUJA 1SQ9A 4RE6A 2GC7A 2I0RA 3NIDB 1TBGA 5EAPA 2VC2A 3MZKA 4Z7NA 4E54A 2IUQA 5CYKB 2IUVA 4J81A 2G9AA 4LG9A 2Z2OA 4A0BB 3RN0D 2CE9A 1GXRA 4IMMA 1S4UX 4AOWA 2H6NA 3CIKB 2H3XA 1UOQA 2PM9B 4EWRA 1TYQC 4ZOVA 2GC4A 2TRCB 4AMZA 2VDRB 4G1MA 3DXMC 2XL2A 3IIWA 1NR0A 2P9KC 2EIEA 4HDJA 4CY1A 3PE7A 4AMYA 1T2XA 5H17A 2OVQB 3T3MB 2I0TA 3VA6A 4Z7NB 3J81g 2GNQA 2YNPA 1XKSA 4BP9A 3W15A 2CE8A 4J8GA 2QXVA 5IGQA 4H5JA 4Z7OA 5KDOB 2AGYA 4PNKB 2AGZA 2HYEA 3ZDYA 4O45A 3IJ0A 5I5IA 1OLZA 4J79A 2AGLA 4Y5RD 2OJYA 3NIGA 2HJBA 4MMYA 4GMBA 5E6RB 1E5TA 5HE0B 3RLMD 3BWSA 4U7AA 3BG0A 1A12A 2XZGA 4O3UB 4D9SA 3JB9L 4LG8A 3GREA 4AN1A 4Z7QB 4FB1D 4WK4A 2AGWA 5EMMB 4JXMA 3L4OD 2IWFA 2MTAH 1MDAH 2P9IC 4GM8A 3IUQA 3EI1A 4QT8A 3F3FA 4JT5C 4CI2A 3F3PA 1R5MA 1VYHC 1SQJA 1JMXB 4L3GD 3K26A 3SN6B 4BCCA 3T3PA 1GP2B 5C2VB 4E5ZA 2AH1A 1MG2A 5M5SA 4R7AB 3O4GA 3FCUB 2H14A 2P9SC 2EBSA 3L4MD 3BG1A 2IURA 1H2XA 3CFVA 5I5MA 2AH0A 5HYNB 2VDQB 1PGUA 3N0DA 5A2Qg 3NIGB 3ZDZA 4A08A 3SBPA 4ES0A 4OZUA 4GM9A 2WQ8A 4D6VA 1M1XA 4I79A 4A09B 3UVLA 5GSAA 4ERYA 3NVXA 4JT6C 4A0AB 4K3JB 3O4IA 2B4EA 3I89A 3EI1B 3MUOA 3PXWD 3DDUA 3SBQA 2UZYB 5EMLB 1UOPA 3T3PB 5HDBA 1O6GA 4WK0B 4E5ZB 2VDLA 2PM7B 1JTDB 4FWWA 4O9DA 3IUMA 2JKXA 2VZ1A 1L0QA 4DNUA 3MXXA 3I7PA 4BL0A 3IURA 3IJ1A 3AH8B 4L1QD 5K19A 1QFMA 1C9IA 3ZDZB 4A08B 2J55H 1B9XA 1GOFA 3OF7A 1XHMA 5EARA 4MMZA 3A0FA 3MKQA 3FRXA 3MMYA 2YMUA 3ZE1A 2VDPA 5C92A 2HU7A 2B5LA 2OIZA 3FM0A 1XIPA 4J84A 4DNVA 2OVRB 4BCBA 4KFMB 5EMKB 4CZYA 3DM0A 5HDBB 5EM2A 2P9PC 1VE6A 3VI3A 3JZNA 4WK2A 2VDLB 5TF2A 2OK6A 2XU7A 4TZ4A 2PBIB 3ODTA 3SXTD 3OW8A 3SLED 2H47A 5GXIA 4FAND 3EI4A 1SSLA 4PSXB 5SXMA 3SCYA 4J0WA 3IVMA 3SHFA 4JSXC 5TEEA 3ZE1B 3C99A 2VDPB 1U8CA 4PXWA 3EQ9A 3JPXA 5FKTA 1YUKA 5FLXg 2XYIA 3I8CA 3E0CA 2OK4A 3GFCA 2VC2B 3JRPA 4E54B 1JOFA 5M5TA 2AQ5A 3UKUC 4NAAA 2H9NA 2EICA 3EU7A 5EM2B 4FA1D 5TDHB 3VI3B 4J78A 5IT9g 3EI3A 4PSWB 3V7DB 2CNXA 5C2WB 3C9CA 3FGBA 3MVDK 3I2NA 4J86A 1U2VC 1OMWB 1YFQA 4O02A 2J56H 3IULA 4RE5A 5FKSA 3RSEC 4BP8A 4FA4D 3GC3B 4CY5A 3EI4B 4QL1A 2HKMA 3AL8A 3SJLD 3UKRC 5GXHA 4QRJA 1JV2A 4JSPC 5CXBA 4PBZA 5M61A 2BKLA 4J87A 3OKTA 4LGNA 4QQEA 2XL3A 3SVWD 2Z2PA 4ZOXA 4GM3A 5IJ8E 2XDWA 2HKRA 2H68A 3N0EA 5E6UA 4IA9A 3MUNA 4Z7OB 4CZVA 3F3GA 4X63B 3UVNA 3EI3B 2P9NC 2IAAA 4J73A 3ZDYB 3JZHA 3JROA 4NBMA 4WJKA 3ZWLB 3ZE2A 2Z2NA 3QI0A 2HXCA 3I8EA
chains in the Genus database with same CATH topology
5FA5B 4ERZA 3AL8B 3SBRA 3OL2A 4WK4B 5CXBB 3I7OA 3JZGA 3OTTA 3PVUB 5C9ZB 2P26A 4A2LA 3PVWB 3I7KA 5E6UB 4A2MA 3NVQA 3C5MA 2BBKH 2YNOA 4CZXA 3IJCA 2UZXB 5IGOA 3ZE2B 4ESGA 2IWKA 3ULEC 3PXTD 4O3TB 5FXYA 2Q7QA 3HFQA 3PXSD 5HE1B 3ORVD 4D0KA 3IIYA 4CI1A 5CYKA 1B9YA 4A0BA 5H14A 1ERJA 2OVPB 4UI9R 3RN1D 2O9KA 4JSVC 3RRMC 1GG2B 2PM9A 1JJUB 4XEIC 4JD2C 3PSLA 4U1EI 4J82A 2P9LC 4GZ8A 1FWXA 3K27A 5HQGA 3UVOA 1TYEB 2VDMB 5EALA 1GOTB 2YBAA 3VH0A 3IKOA 3V9FA 2G99A 4YVDA 5HE2B 1PI6A 3RFHA 5I5JA 2I0SA 5AJAA 3MZLA 2VDKB 5B4WA 5EMJB 4AEZA 5TEFA 3J80g 3KRWB 3OKYA 5FQDA 2H9MA 2JWGA 3I7HA 4A7JA 3NIFB 4G56B 3DXKC 4GGDA 5AFU3 3ZE0B 4CC9A 3EG6A 2CN2A 2B5NA 4FAVD 4GGCA 4WK2B 2H6QA 2H9LA 4OWRA 2HJ4A 1P22A 4ZN4A 2J57G 5FKQA 3VI4B 4O1QD 4N14A 4H5IA 5EAMA 2CO0A 5H1MA 5HE3B 4J77A 5CXCA 3AFCA 3KRXB 4MK0B 4J8BA 2P28A 3UVMA 3OKYB 3SWSD 1U8CB 3SFZA 3RMZD 4X3EA 3AL9A 2IUPA 4L3HD 5THAA 1N6DA 5K1CC 3C75H 5IC7A 2CO0C 4Y7RA 4ERQA 3JAMg 3V5WB 3UR4A 3P4FA 3DWLC 1NEXB 3NVNA 1JMZB 4A09A 3VGZA 4GGAA 1PBYB 5GMKn 3RFGA 4A0AA 5CXCB 4BH6A 4PBYA 2W18A 4K3ID 2YB8B 4GQBB 3U4YA 2HESX 1RI6A 5FKRA 4XYHA 2YNNA 3ZDXB 3EWEA 1PEVA 4PC0A 3UVKA 1K8KC 3I7NA 2PM6B 3CFSB 2P9UC 1MG3A 2VDNB 4ZOZA 1SHYB 5JWZA 4A11A 4BUJC 4X61B 3EI2A 3OKWA 4CI8A 5IJ7E 4WJKB 2BCJB 1N6EA 2AGXA 2JWHA 4X60B 1U4CA 2CN3A 3DSMA 4UM9D 2I3TA 4CI3A 5E6SB 1K32A 2VDOB 4FA9D 3OL2B 4NSXA 4FHLA 5AMSA 4XYIA 3EMHA 4Z8LA 4JSNC 3B7FA 4ZOYA 4UM9B 2B5MA 3MKSB 4GQ2P 1A0RB 4CY2A 4UM8B 2H13A 3I7LA 1N6FA 2H9PA 4J0XA 1QNIA 3PSCB 4A11B 4L9OA 2QC5A 4CY3A 3EI2B 4FA5D 3SMRA 4GQ1A 2I3SA 1Q47A 2H6KA 1SQ9A 2GC7A 2I0RA 3NIDB 1TBGA 5EAPA 3MZKA 4E54A 2IUQA 5CYKB 2IUVA 4J81A 2G9AA 4LG9A 2Z2OA 4A0BB 3RN0D 1GXRA 2CE9A 4IMMA 1S4UX 4AOWA 2H6NA 3CIKB 2H3XA 2PM9B 4EWRA 1TYQC 4ZOVA 2GC4A 2TRCB 2VDRB 3DXMC 2XL2A 3IIWA 1NR0A 2P9KC 4HDJA 4CY1A 3PE7A 5H17A 2OVQB 3T3MB 2I0TA 3VA6A 4Z7NB 3J81g 2GNQA 2YNPA 1XKSA 3W15A 2CE8A 4J8GA 2QXVA 5IGQA 4H5JA 5KDOB 2AGYA 4PNKB 2AGZA 2HYEA 4O45A 3IJ0A 5I5IA 1OLZA 4J79A 2AGLA 4Y5RD 2OJYA 2HJBA 5E6RB 4GMBA 5HE0B 3RLMD 3BWSA 4U7AA 3BG0A 4O3UB 3JB9L 4LG8A 3GREA 4Z7QB 4FB1D 2AGWA 5EMMB 4JXMA 3L4OD 2IWFA 2MTAH 1MDAH 2P9IC 4GM8A 3EI1A 4QT8A 3F3FA 4JT5C 4CI2A 3F3PA 1R5MA 1VYHC 1SQJA 1JMXB 4L3GD 3K26A 3SN6B 1GP2B 5C2VB 4E5ZA 2AH1A 1MG2A 4R7AB 3FCUB 2H14A 2P9SC 2EBSA 3L4MD 3BG1A 2IURA 3CFVA 5I5MA 2AH0A 5HYNB 2VDQB 1PGUA 3N0DA 5A2Qg 3NIGB 4A08A 3SBPA 4ES0A 4OZUA 4GM9A 4D6VA 4I79A 4A09B 3UVLA 5GSAA 4ERYA 3NVXA 4JT6C 4A0AB 4K3JB 2B4EA 3I89A 3EI1B 3PXWD 3SBQA 2UZYB 5EMLB 3T3PB 4WK0B 4E5ZB 2PM7B 4FWWA 4O9DA 1L0QA 3MXXA 3I7PA 4BL0A 3IJ1A 3AH8B 4L1QD 5K19A 3ZDZB 4A08B 2J55H 1B9XA 1XHMA 5EARA 3A0FA 3MKQA 3FRXA 3MMYA 2YMUA 2B5LA 2OIZA 3FM0A 1XIPA 4J84A 2OVRB 4KFMB 5EMKB 4CZYA 3DM0A 5HDBB 5EM2A 2P9PC 3JZNA 2VDLB 5TF2A 2OK6A 2XU7A 4TZ4A 2PBIB 3ODTA 3SXTD 3OW8A 3SLED 2H47A 5GXIA 4FAND 3EI4A 1SSLA 4PSXB 5SXMA 3SCYA 4J0WA 3SHFA 4JSXC 5TEEA 3ZE1B 3C99A 2VDPB 4PXWA 3JPXA 5FKTA 1YUKA 5FLXg 2XYIA 3I8CA 3E0CA 2OK4A 3GFCA 2VC2B 3JRPA 4E54B 1JOFA 2AQ5A 3UKUC 2H9NA 3EU7A 5EM2B 4FA1D 5TDHB 3VI3B 4J78A 5IT9g 3EI3A 4PSWB 3V7DB 2CNXA 5C2WB 3C9CA 3FGBA 3I2NA 4J86A 1U2VC 1OMWB 1YFQA 5FKSA 2J56H 4FA4D 3RSEC 4CY5A 3EI4B 4QL1A 2HKMA 3AL8A 3SJLD 3UKRC 5GXHA 4QRJA 4JSPC 5CXBA 4PBZA 4J87A 3OKTA 4LGNA 4QQEA 2XL3A 3SVWD 2Z2PA 4ZOXA 4GM3A 5IJ8E 2HKRA 2H68A 3N0EA 4IA9A 4Z7OB 4CZVA 3F3GA 4X63B 3UVNA 3EI3B 2P9NC 2IAAA 4J73A 3ZDYB 3JZHA 3JROA 3ZWLB 2Z2NA 2HXCA 3I8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FA5 B;  4ERZ A;  3AL8 B;  3SBR A;  3OL2 A;  4WK4 B;  5CXB B;  3I7O A;  3JZG A;  3OTT A;  3PVU B;  5C9Z B;  2P26 A;  4A2L A;  3PVW B;  3I7K A;  5E6U B;  4A2M A;  3NVQ A;  3C5M A;  2BBK H;  2YNO A;  4CZX A;  3IJC A;  2UZX B;  5IGO A;  3ZE2 B;  4ESG A;  2IWK A;  3ULE C;  3PXT D;  4O3T B;  5FXY A;  2Q7Q A;  3HFQ A;  3PXS D;  5HE1 B;  3ORV D;  4D0K A;  3IIY A;  4CI1 A;  5CYK A;  1B9Y A;  4A0B A;  5H14 A;  1ERJ A;  2OVP B;  4UI9 R;  3RN1 D;  2O9K A;  4JSV C;  3RRM C;  1GG2 B;  2PM9 A;  1JJU B;  4XEI C;  4JD2 C;  3PSL A;  4U1E I;  4J82 A;  2P9L C;  4GZ8 A;  1FWX A;  3K27 A;  5HQG A;  3UVO A;  1TYE B;  2VDM B;  5EAL A;  1GOT B;  2YBA A;  3VH0 A;  3IKO A;  3V9F A;  2G99 A;  4YVD A;  5HE2 B;  1PI6 A;  3RFH A;  5I5J A;  2I0S A;  5AJA A;  3MZL A;  2VDK B;  5B4W A;  5EMJ B;  4AEZ A;  5TEF A;  3J80 g;  3KRW B;  3OKY A;  5FQD A;  2H9M A;  3I7H A;  4A7J A;  3NIF B;  4G56 B;  3DXK C;  4GGD A;  5AFU 3;  3ZE0 B;  4CC9 A;  3EG6 A;  2CN2 A;  2B5N A;  4FAV D;  4GGC A;  4WK2 B;  2H6Q A;  2H9L A;  4OWR A;  2HJ4 A;  1P22 A;  4ZN4 A;  2J57 G;  5FKQ A;  3VI4 B;  4O1Q D;  4N14 A;  4H5I A;  5EAM A;  2CO0 A;  5H1M A;  5HE3 B;  4J77 A;  5CXC A;  3AFC A;  3KRX B;  4MK0 B;  4J8B A;  2P28 A;  3UVM A;  3OKY B;  3SWS D;  1U8C B;  3SFZ A;  3RMZ D;  4X3E A;  3AL9 A;  2IUP A;  4L3H D;  5THA A;  1N6D A;  5K1C C;  3C75 H;  5IC7 A;  2CO0 C;  4Y7R A;  4ERQ A;  3JAM g;  3V5W B;  3UR4 A;  3P4F A;  3DWL C;  1NEX B;  3NVN A;  1JMZ B;  4A09 A;  3VGZ A;  4GGA A;  1PBY B;  5GMK n;  3RFG A;  4A0A A;  5CXC B;  4BH6 A;  4PBY A;  2W18 A;  4K3I D;  2YB8 B;  4GQB B;  3U4Y A;  2HES X;  1RI6 A;  5FKR A;  4XYH A;  2YNN A;  3ZDX B;  3EWE A;  1PEV A;  4PC0 A;  3UVK A;  1K8K C;  3I7N A;  2PM6 B;  3CFS B;  2P9U C;  1MG3 A;  2VDN B;  4ZOZ A;  1SHY B;  5JWZ A;  4A11 A;  4BUJ C;  4X61 B;  3EI2 A;  3OKW A;  4CI8 A;  5IJ7 E;  4WJK B;  2BCJ B;  1N6E A;  2AGX A;  4X60 B;  1U4C A;  2CN3 A;  3DSM A;  4UM9 D;  2I3T A;  4CI3 A;  5E6S B;  1K32 A;  2VDO B;  4FA9 D;  3OL2 B;  4NSX A;  4FHL A;  5AMS A;  4XYI A;  3EMH A;  4Z8L A;  4JSN C;  3B7F A;  4ZOY A;  4UM9 B;  2B5M A;  3MKS B;  4GQ2 P;  1A0R B;  4CY2 A;  4UM8 B;  2H13 A;  3I7L A;  1N6F A;  2H9P A;  4J0X A;  1QNI A;  3PSC B;  4A11 B;  4L9O A;  2QC5 A;  4CY3 A;  3EI2 B;  4FA5 D;  3SMR A;  4GQ1 A;  2I3S A;  1Q47 A;  2H6K A;  1SQ9 A;  2GC7 A;  2I0R A;  3NID B;  1TBG A;  5EAP A;  3MZK A;  4E54 A;  2IUQ A;  5CYK B;  2IUV A;  4J81 A;  2G9A A;  4LG9 A;  2Z2O A;  4A0B B;  3RN0 D;  1GXR A;  2CE9 A;  4IMM A;  1S4U X;  4AOW A;  2H6N A;  3CIK B;  2H3X A;  2PM9 B;  4EWR A;  1TYQ C;  4ZOV A;  2GC4 A;  2TRC B;  2VDR B;  3DXM C;  2XL2 A;  3IIW A;  1NR0 A;  2P9K C;  4HDJ A;  4CY1 A;  3PE7 A;  5H17 A;  2OVQ B;  3T3M B;  2I0T A;  3VA6 A;  4Z7N B;  3J81 g;  2GNQ A;  2YNP A;  1XKS A;  3W15 A;  2CE8 A;  4J8G A;  2QXV A;  5IGQ A;  4H5J A;  5KDO B;  2AGY A;  4PNK B;  2AGZ A;  2HYE A;  4O45 A;  3IJ0 A;  5I5I A;  1OLZ A;  4J79 A;  2AGL A;  4Y5R D;  2OJY A;  2HJB A;  5E6R B;  4GMB A;  5HE0 B;  3RLM D;  3BWS A;  4U7A A;  3BG0 A;  4O3U B;  3JB9 L;  4LG8 A;  3GRE A;  4Z7Q B;  4FB1 D;  2AGW A;  5EMM B;  4JXM A;  3L4O D;  2IWF A;  2MTA H;  1MDA H;  2P9I C;  4GM8 A;  3EI1 A;  4QT8 A;  3F3F A;  4JT5 C;  4CI2 A;  3F3P A;  1R5M A;  1VYH C;  1SQJ A;  1JMX B;  4L3G D;  3K26 A;  3SN6 B;  1GP2 B;  5C2V B;  4E5Z A;  2AH1 A;  1MG2 A;  4R7A B;  3FCU B;  2H14 A;  2P9S C;  2EBS A;  3L4M D;  3BG1 A;  2IUR A;  3CFV A;  5I5M A;  2AH0 A;  5HYN B;  2VDQ B;  1PGU A;  3N0D A;  5A2Q g;  3NIG B;  4A08 A;  3SBP A;  4ES0 A;  4OZU A;  4GM9 A;  4D6V A;  4I79 A;  4A09 B;  3UVL A;  5GSA A;  4ERY A;  3NVX A;  4JT6 C;  4A0A B;  4K3J B;  2B4E A;  3I89 A;  3EI1 B;  3PXW D;  3SBQ A;  2UZY B;  5EML B;  3T3P B;  4WK0 B;  4E5Z B;  2PM7 B;  4FWW A;  4O9D A;  1L0Q A;  3MXX A;  3I7P A;  4BL0 A;  3IJ1 A;  3AH8 B;  4L1Q D;  5K19 A;  3ZDZ B;  4A08 B;  2J55 H;  1B9X A;  1XHM A;  5EAR A;  3A0F A;  3MKQ A;  3FRX A;  3MMY A;  2YMU A;  2B5L A;  2OIZ A;  3FM0 A;  1XIP A;  4J84 A;  2OVR B;  4KFM B;  5EMK B;  4CZY A;  3DM0 A;  5HDB B;  5EM2 A;  2P9P C;  3JZN A;  2VDL B;  5TF2 A;  2OK6 A;  2XU7 A;  4TZ4 A;  2PBI B;  3ODT A;  3SXT D;  3OW8 A;  3SLE D;  2H47 A;  5GXI A;  4FAN D;  3EI4 A;  1SSL A;  4PSX B;  5SXM A;  3SCY A;  4J0W A;  3SHF A;  4JSX C;  5TEE A;  3ZE1 B;  3C99 A;  2VDP B;  4PXW A;  3JPX A;  5FKT A;  1YUK A;  5FLX g;  2XYI A;  3I8C A;  3E0C A;  2OK4 A;  3GFC A;  2VC2 B;  3JRP A;  4E54 B;  1JOF A;  2AQ5 A;  3UKU C;  2H9N A;  3EU7 A;  5EM2 B;  4FA1 D;  5TDH B;  3VI3 B;  4J78 A;  5IT9 g;  3EI3 A;  4PSW B;  3V7D B;  2CNX A;  5C2W B;  3C9C A;  3FGB A;  3I2N A;  4J86 A;  1U2V C;  1OMW B;  1YFQ A;  5FKS A;  2J56 H;  4FA4 D;  3RSE C;  4CY5 A;  3EI4 B;  4QL1 A;  2HKM A;  3AL8 A;  3SJL D;  3UKR C;  5GXH A;  4QRJ A;  4JSP C;  5CXB A;  4PBZ A;  4J87 A;  3OKT A;  4LGN A;  4QQE A;  2XL3 A;  3SVW D;  2Z2P A;  4ZOX A;  4GM3 A;  5IJ8 E;  2HKR A;  2H68 A;  3N0E A;  4IA9 A;  4Z7O B;  4CZV A;  3F3G A;  4X63 B;  3UVN A;  3EI3 B;  2P9N C;  2IAA A;  4J73 A;  3ZDY B;  3JZH A;  3JRO A;  3ZWL B;  2Z2N A;  2HXC A;  3I8E A; 
#chains in the Genus database with same CATH topology
 4JHP C;  5FA5 B;  4ERZ A;  3AL8 B;  3SBR A;  1E8N A;  3OL2 A;  4WK4 B;  5CXB B;  3I7O A;  3JZG A;  3OTT A;  3PVU B;  5C9Z B;  2P26 A;  4A2L A;  4BCD A;  3PVW B;  3I7K A;  1L5G A;  5E6U B;  4A2M A;  3NVQ A;  1VZ2 A;  1TYE A;  3C5M A;  2VDM A;  2BBK H;  2YNO A;  4CZX A;  3IJC A;  4AX4 A;  2UZX B;  5IGO A;  2QZP A;  3ZE2 B;  4ESG A;  2IWK A;  3ULE C;  3PXT D;  2QR5 A;  4O3T B;  5FXY A;  2Q7Q A;  3HFQ A;  3PXS D;  5HE1 B;  3ORV D;  4D0K A;  3IIY A;  2VDK A;  1O6F A;  4CI1 A;  5CYK A;  3GD1 I;  3QHY B;  1B9Y A;  4A0B A;  3EQ7 A;  3K72 A;  5H14 A;  1ERJ A;  2OVP B;  4UI9 R;  4L1M A;  3EQ8 A;  3RN1 D;  2O9K A;  1GOH A;  4JSV C;  1GG2 B;  2PM9 A;  1JJU B;  3RRM C;  3NIF A;  4XEI C;  4JD2 C;  4IRZ A;  3PSL A;  3ZE0 A;  4U1E I;  4GZ8 A;  2P9L C;  4J82 A;  1FWX A;  3K27 A;  4NEN A;  5HQG A;  3UVO A;  1TYE B;  2VDM B;  5EAL A;  1GOT B;  1H2Z A;  2YBA A;  3VI4 A;  3VH0 A;  3IKO A;  1H2Y A;  1UOO A;  3V9F A;  2G99 A;  4YVD A;  4QAM A;  5HE2 B;  1PI6 A;  3T3M A;  3RFH A;  5I5J A;  2I0S A;  5AJA A;  3MZL A;  2VDK B;  5B4W A;  5EMJ B;  4NC4 A;  4AEZ A;  5TEF A;  3J80 g;  3KRW B;  2HU5 A;  3OKY A;  5FQD A;  2H9M A;  2JWG A;  3I7H A;  4A7J A;  3NIF B;  4G56 B;  3DXK C;  4GGD A;  5AFU 3;  4JHN A;  3ZE0 B;  4CC9 A;  3EG6 A;  2CN2 A;  2B5N A;  4FAV D;  4GGC A;  5E6R A;  4WK2 B;  2H6Q A;  2H9L A;  4OWR A;  2HJ4 A;  1P22 A;  4ZN4 A;  2J57 G;  5FKQ A;  3VI4 B;  4Z7Q A;  1C9L A;  4O1Q D;  4N14 A;  4H5I A;  5EAM A;  2CO0 A;  5H1M A;  5HE3 B;  4J77 A;  3K71 A;  1I2M B;  5FFG A;  5CXC A;  3AFC A;  3KRX B;  4MK0 B;  4J8B A;  5M5R A;  2P28 A;  3UVM A;  3ZDX A;  3OKY B;  4DNW A;  3SWS D;  1U8C B;  1BPO A;  3SFZ A;  3RMZ D;  3FCU A;  4X3E A;  3AL9 A;  2IUP A;  4L3H D;  5THA A;  2VDN A;  1N6D A;  5K1C C;  3C75 H;  5IC7 A;  2VDQ A;  4AN0 A;  2CO0 C;  4Y7R A;  4ERQ A;  3JAM g;  3V5W B;  3UR4 A;  3P4F A;  1GOG A;  3DWL C;  1NEX B;  3NVN A;  1JMZ B;  4A09 A;  3VGZ A;  4GGA A;  5C86 A;  1PBY B;  5GMK n;  1K3I A;  3RFG A;  1VZ3 A;  4A0A A;  5CXC B;  1VE7 A;  4PBY A;  4BH6 A;  2W18 A;  4K3I D;  2YB8 B;  5E6S A;  2VDO A;  4GQB B;  3U4Y A;  2HES X;  1RI6 A;  5FKR A;  4XYH A;  4G55 A;  2YNN A;  3ZDX B;  3KCI A;  3EWE A;  4WK0 A;  1PEV A;  4PC0 A;  3UVK A;  1K8K C;  4UM9 A;  3I7N A;  3K6S A;  2PM6 B;  3CFS B;  2P9U C;  1MG3 A;  4UM8 A;  2VDN B;  4ZOZ A;  1SHY B;  2EIB A;  5JWZ A;  4A11 A;  5M5U A;  4BUJ C;  1H2W A;  3IUN A;  4X61 B;  3EI2 A;  1E8M A;  3V4P A;  1YR2 A;  3OKW A;  5FFO A;  4CI8 A;  5IJ7 E;  2EID A;  4WJK B;  2BCJ B;  1N6E A;  2AGX A;  2JWH A;  4X60 B;  2VZ3 A;  1U4C A;  2CN3 A;  3DSM A;  4UM9 D;  2I3T A;  4CI3 A;  3NID A;  5E6S B;  3O4J A;  1K32 A;  4G1E A;  2VDO B;  4FA9 D;  3OL2 B;  3O4H A;  3FCS A;  1QFS A;  3V4V A;  4NSX A;  2XE4 A;  4FHL A;  5AMS A;  4XYI A;  3EMH A;  4Z8L A;  4JSN C;  3B7F A;  4ZOY A;  4UM9 B;  2B5M A;  3IJE A;  3MKS B;  4GQ2 P;  1A0R B;  4CY2 A;  4UM8 B;  2H13 A;  3I7L A;  4O2W A;  1N6F A;  2H9P A;  2VDR A;  4J0X A;  1QNI A;  3PSC B;  4A11 B;  5M5V A;  4L9O A;  2QC5 A;  4CY3 A;  3EI2 B;  4FA5 D;  2HU8 A;  3SMR A;  1UTC A;  4GQ1 A;  2I3S A;  4MMX A;  1Q47 A;  2H6K A;  3IUJ A;  1SQ9 A;  4RE6 A;  2GC7 A;  2I0R A;  3NID B;  1TBG A;  5EAP A;  2VC2 A;  3MZK A;  4Z7N A;  4E54 A;  2IUQ A;  5CYK B;  2IUV A;  4J81 A;  2G9A A;  4LG9 A;  2Z2O A;  4A0B B;  3RN0 D;  2CE9 A;  1GXR A;  4IMM A;  1S4U X;  4AOW A;  2H6N A;  3CIK B;  2H3X A;  1UOQ A;  2PM9 B;  4EWR A;  1TYQ C;  4ZOV A;  2GC4 A;  2TRC B;  4AMZ A;  2VDR B;  4G1M A;  3DXM C;  2XL2 A;  3IIW A;  1NR0 A;  2P9K C;  2EIE A;  4HDJ A;  4CY1 A;  3PE7 A;  4AMY A;  1T2X A;  5H17 A;  2OVQ B;  3T3M B;  2I0T A;  3VA6 A;  4Z7N B;  3J81 g;  2GNQ A;  2YNP A;  1XKS A;  4BP9 A;  3W15 A;  2CE8 A;  4J8G A;  2QXV A;  5IGQ A;  4H5J A;  4Z7O A;  5KDO B;  2AGY A;  4PNK B;  2AGZ A;  2HYE A;  3ZDY A;  4O45 A;  3IJ0 A;  5I5I A;  1OLZ A;  4J79 A;  2AGL A;  4Y5R D;  2OJY A;  3NIG A;  2HJB A;  4MMY A;  4GMB A;  5E6R B;  1E5T A;  5HE0 B;  3RLM D;  3BWS A;  4U7A A;  3BG0 A;  1A12 A;  2XZG A;  4O3U B;  4D9S A;  3JB9 L;  4LG8 A;  3GRE A;  4AN1 A;  4Z7Q B;  4FB1 D;  4WK4 A;  2AGW A;  5EMM B;  4JXM A;  3L4O D;  2IWF A;  2MTA H;  1MDA H;  2P9I C;  4GM8 A;  3IUQ A;  3EI1 A;  4QT8 A;  3F3F A;  4JT5 C;  4CI2 A;  3F3P A;  1R5M A;  1VYH C;  1SQJ A;  1JMX B;  4L3G D;  3K26 A;  3SN6 B;  4BCC A;  3T3P A;  1GP2 B;  5C2V B;  4E5Z A;  2AH1 A;  1MG2 A;  5M5S A;  4R7A B;  3O4G A;  3FCU B;  2H14 A;  2P9S C;  2EBS A;  3L4M D;  3BG1 A;  2IUR A;  1H2X A;  3CFV A;  5I5M A;  2AH0 A;  5HYN B;  2VDQ B;  1PGU A;  3N0D A;  5A2Q g;  3NIG B;  3ZDZ A;  4A08 A;  3SBP A;  4ES0 A;  4OZU A;  4GM9 A;  2WQ8 A;  4D6V A;  1M1X A;  4I79 A;  4A09 B;  3UVL A;  5GSA A;  4ERY A;  3NVX A;  4JT6 C;  4A0A B;  4K3J B;  3O4I A;  2B4E A;  3I89 A;  3EI1 B;  3MUO A;  3PXW D;  3DDU A;  3SBQ A;  2UZY B;  5EML B;  1UOP A;  3T3P B;  5HDB A;  1O6G A;  4WK0 B;  4E5Z B;  2VDL A;  2PM7 B;  1JTD B;  4FWW A;  4O9D A;  3IUM A;  2JKX A;  2VZ1 A;  1L0Q A;  4DNU A;  3MXX A;  3I7P A;  4BL0 A;  3IUR A;  3IJ1 A;  3AH8 B;  4L1Q D;  5K19 A;  1QFM A;  1C9I A;  3ZDZ B;  4A08 B;  2J55 H;  1B9X A;  1GOF A;  3OF7 A;  1XHM A;  5EAR A;  4MMZ A;  3A0F A;  3MKQ A;  3FRX A;  3MMY A;  2YMU A;  3ZE1 A;  2VDP A;  5C92 A;  2HU7 A;  2B5L A;  2OIZ A;  3FM0 A;  1XIP A;  4J84 A;  4DNV A;  2OVR B;  4BCB A;  4KFM B;  5EMK B;  4CZY A;  3DM0 A;  5HDB B;  5EM2 A;  2P9P C;  1VE6 A;  3VI3 A;  3JZN A;  4WK2 A;  2VDL B;  5TF2 A;  2OK6 A;  2XU7 A;  4TZ4 A;  2PBI B;  3ODT A;  3SXT D;  3OW8 A;  3SLE D;  2H47 A;  5GXI A;  4FAN D;  3EI4 A;  1SSL A;  4PSX B;  5SXM A;  3SCY A;  4J0W A;  3IVM A;  3SHF A;  4JSX C;  5TEE A;  3ZE1 B;  3C99 A;  2VDP B;  1U8C A;  4PXW A;  3EQ9 A;  3JPX A;  5FKT A;  1YUK A;  5FLX g;  2XYI A;  3I8C A;  3E0C A;  2OK4 A;  3GFC A;  2VC2 B;  3JRP A;  4E54 B;  1JOF A;  5M5T A;  2AQ5 A;  3UKU C;  4NAA A;  2H9N A;  2EIC A;  3EU7 A;  5EM2 B;  4FA1 D;  5TDH B;  3VI3 B;  4J78 A;  5IT9 g;  3EI3 A;  4PSW B;  3V7D B;  2CNX A;  5C2W B;  3C9C A;  3FGB A;  3MVD K;  3I2N A;  4J86 A;  1U2V C;  1OMW B;  1YFQ A;  4O02 A;  2J56 H;  3IUL A;  4RE5 A;  5FKS A;  3RSE C;  4BP8 A;  4FA4 D;  3GC3 B;  4CY5 A;  3EI4 B;  4QL1 A;  2HKM A;  3AL8 A;  3SJL D;  3UKR C;  5GXH A;  4QRJ A;  1JV2 A;  4JSP C;  5CXB A;  4PBZ A;  5M61 A;  2BKL A;  4J87 A;  3OKT A;  4LGN A;  4QQE A;  2XL3 A;  3SVW D;  2Z2P A;  4ZOX A;  4GM3 A;  5IJ8 E;  2XDW A;  2HKR A;  2H68 A;  3N0E A;  5E6U A;  4IA9 A;  3MUN A;  4Z7O B;  4CZV A;  3F3G A;  4X63 B;  3UVN A;  3EI3 B;  2P9N C;  2IAA A;  4J73 A;  3ZDY B;  3JZH A;  3JRO A;  4NBM A;  4WJK A;  3ZWL B;  3ZE2 A;  2Z2N A;  3QI0 A;  2HXC A;  3I8E A; 
#chains in the Genus database with same CATH homology
 5FA5 B;  4ERZ A;  3AL8 B;  3SBR A;  3OL2 A;  4WK4 B;  5CXB B;  3I7O A;  3JZG A;  3OTT A;  3PVU B;  5C9Z B;  2P26 A;  4A2L A;  3PVW B;  3I7K A;  5E6U B;  4A2M A;  3NVQ A;  3C5M A;  2BBK H;  2YNO A;  4CZX A;  3IJC A;  2UZX B;  5IGO A;  3ZE2 B;  4ESG A;  2IWK A;  3ULE C;  3PXT D;  4O3T B;  5FXY A;  2Q7Q A;  3HFQ A;  3PXS D;  5HE1 B;  3ORV D;  4D0K A;  3IIY A;  4CI1 A;  5CYK A;  1B9Y A;  4A0B A;  5H14 A;  1ERJ A;  2OVP B;  4UI9 R;  3RN1 D;  2O9K A;  4JSV C;  3RRM C;  1GG2 B;  2PM9 A;  1JJU B;  4XEI C;  4JD2 C;  3PSL A;  4U1E I;  4J82 A;  2P9L C;  4GZ8 A;  1FWX A;  3K27 A;  5HQG A;  3UVO A;  1TYE B;  2VDM B;  5EAL A;  1GOT B;  2YBA A;  3VH0 A;  3IKO A;  3V9F A;  2G99 A;  4YVD A;  5HE2 B;  1PI6 A;  3RFH A;  5I5J A;  2I0S A;  5AJA A;  3MZL A;  2VDK B;  5B4W A;  5EMJ B;  4AEZ A;  5TEF A;  3J80 g;  3KRW B;  3OKY A;  5FQD A;  2H9M A;  2JWG A;  3I7H A;  4A7J A;  3NIF B;  4G56 B;  3DXK C;  4GGD A;  5AFU 3;  3ZE0 B;  4CC9 A;  3EG6 A;  2CN2 A;  2B5N A;  4FAV D;  4GGC A;  4WK2 B;  2H6Q A;  2H9L A;  4OWR A;  2HJ4 A;  1P22 A;  4ZN4 A;  2J57 G;  5FKQ A;  3VI4 B;  4O1Q D;  4N14 A;  4H5I A;  5EAM A;  2CO0 A;  5H1M A;  5HE3 B;  4J77 A;  5CXC A;  3AFC A;  3KRX B;  4MK0 B;  4J8B A;  2P28 A;  3UVM A;  3OKY B;  3SWS D;  1U8C B;  3SFZ A;  3RMZ D;  4X3E A;  3AL9 A;  2IUP A;  4L3H D;  5THA A;  1N6D A;  5K1C C;  3C75 H;  5IC7 A;  2CO0 C;  4Y7R A;  4ERQ A;  3JAM g;  3V5W B;  3UR4 A;  3P4F A;  3DWL C;  1NEX B;  3NVN A;  1JMZ B;  4A09 A;  3VGZ A;  4GGA A;  1PBY B;  5GMK n;  3RFG A;  4A0A A;  5CXC B;  4BH6 A;  4PBY A;  2W18 A;  4K3I D;  2YB8 B;  4GQB B;  3U4Y A;  2HES X;  1RI6 A;  5FKR A;  4XYH A;  2YNN A;  3ZDX B;  3EWE A;  1PEV A;  4PC0 A;  3UVK A;  1K8K C;  3I7N A;  2PM6 B;  3CFS B;  2P9U C;  1MG3 A;  2VDN B;  4ZOZ A;  1SHY B;  5JWZ A;  4A11 A;  4BUJ C;  4X61 B;  3EI2 A;  3OKW A;  4CI8 A;  5IJ7 E;  4WJK B;  2BCJ B;  1N6E A;  2AGX A;  2JWH A;  4X60 B;  1U4C A;  2CN3 A;  3DSM A;  4UM9 D;  2I3T A;  4CI3 A;  5E6S B;  1K32 A;  2VDO B;  4FA9 D;  3OL2 B;  4NSX A;  4FHL A;  5AMS A;  4XYI A;  3EMH A;  4Z8L A;  4JSN C;  3B7F A;  4ZOY A;  4UM9 B;  2B5M A;  3MKS B;  4GQ2 P;  1A0R B;  4CY2 A;  4UM8 B;  2H13 A;  3I7L A;  1N6F A;  2H9P A;  4J0X A;  1QNI A;  3PSC B;  4A11 B;  4L9O A;  2QC5 A;  4CY3 A;  3EI2 B;  4FA5 D;  3SMR A;  4GQ1 A;  2I3S A;  1Q47 A;  2H6K A;  1SQ9 A;  2GC7 A;  2I0R A;  3NID B;  1TBG A;  5EAP A;  3MZK A;  4E54 A;  2IUQ A;  5CYK B;  2IUV A;  4J81 A;  2G9A A;  4LG9 A;  2Z2O A;  4A0B B;  3RN0 D;  1GXR A;  2CE9 A;  4IMM A;  1S4U X;  4AOW A;  2H6N A;  3CIK B;  2H3X A;  2PM9 B;  4EWR A;  1TYQ C;  4ZOV A;  2GC4 A;  2TRC B;  2VDR B;  3DXM C;  2XL2 A;  3IIW A;  1NR0 A;  2P9K C;  4HDJ A;  4CY1 A;  3PE7 A;  5H17 A;  2OVQ B;  3T3M B;  2I0T A;  3VA6 A;  4Z7N B;  3J81 g;  2GNQ A;  2YNP A;  1XKS A;  3W15 A;  2CE8 A;  4J8G A;  2QXV A;  5IGQ A;  4H5J A;  5KDO B;  2AGY A;  4PNK B;  2AGZ A;  2HYE A;  4O45 A;  3IJ0 A;  5I5I A;  1OLZ A;  4J79 A;  2AGL A;  4Y5R D;  2OJY A;  2HJB A;  5E6R B;  4GMB A;  5HE0 B;  3RLM D;  3BWS A;  4U7A A;  3BG0 A;  4O3U B;  3JB9 L;  4LG8 A;  3GRE A;  4Z7Q B;  4FB1 D;  2AGW A;  5EMM B;  4JXM A;  3L4O D;  2IWF A;  2MTA H;  1MDA H;  2P9I C;  4GM8 A;  3EI1 A;  4QT8 A;  3F3F A;  4JT5 C;  4CI2 A;  3F3P A;  1R5M A;  1VYH C;  1SQJ A;  1JMX B;  4L3G D;  3K26 A;  3SN6 B;  1GP2 B;  5C2V B;  4E5Z A;  2AH1 A;  1MG2 A;  4R7A B;  3FCU B;  2H14 A;  2P9S C;  2EBS A;  3L4M D;  3BG1 A;  2IUR A;  3CFV A;  5I5M A;  2AH0 A;  5HYN B;  2VDQ B;  1PGU A;  3N0D A;  5A2Q g;  3NIG B;  4A08 A;  3SBP A;  4ES0 A;  4OZU A;  4GM9 A;  4D6V A;  4I79 A;  4A09 B;  3UVL A;  5GSA A;  4ERY A;  3NVX A;  4JT6 C;  4A0A B;  4K3J B;  2B4E A;  3I89 A;  3EI1 B;  3PXW D;  3SBQ A;  2UZY B;  5EML B;  3T3P B;  4WK0 B;  4E5Z B;  2PM7 B;  4FWW A;  4O9D A;  1L0Q A;  3MXX A;  3I7P A;  4BL0 A;  3IJ1 A;  3AH8 B;  4L1Q D;  5K19 A;  3ZDZ B;  4A08 B;  2J55 H;  1B9X A;  1XHM A;  5EAR A;  3A0F A;  3MKQ A;  3FRX A;  3MMY A;  2YMU A;  2B5L A;  2OIZ A;  3FM0 A;  1XIP A;  4J84 A;  2OVR B;  4KFM B;  5EMK B;  4CZY A;  3DM0 A;  5HDB B;  5EM2 A;  2P9P C;  3JZN A;  2VDL B;  5TF2 A;  2OK6 A;  2XU7 A;  4TZ4 A;  2PBI B;  3ODT A;  3SXT D;  3OW8 A;  3SLE D;  2H47 A;  5GXI A;  4FAN D;  3EI4 A;  1SSL A;  4PSX B;  5SXM A;  3SCY A;  4J0W A;  3SHF A;  4JSX C;  5TEE A;  3ZE1 B;  3C99 A;  2VDP B;  4PXW A;  3JPX A;  5FKT A;  1YUK A;  5FLX g;  2XYI A;  3I8C A;  3E0C A;  2OK4 A;  3GFC A;  2VC2 B;  3JRP A;  4E54 B;  1JOF A;  2AQ5 A;  3UKU C;  2H9N A;  3EU7 A;  5EM2 B;  4FA1 D;  5TDH B;  3VI3 B;  4J78 A;  5IT9 g;  3EI3 A;  4PSW B;  3V7D B;  2CNX A;  5C2W B;  3C9C A;  3FGB A;  3I2N A;  4J86 A;  1U2V C;  1OMW B;  1YFQ A;  5FKS A;  2J56 H;  4FA4 D;  3RSE C;  4CY5 A;  3EI4 B;  4QL1 A;  2HKM A;  3AL8 A;  3SJL D;  3UKR C;  5GXH A;  4QRJ A;  4JSP C;  5CXB A;  4PBZ A;  4J87 A;  3OKT A;  4LGN A;  4QQE A;  2XL3 A;  3SVW D;  2Z2P A;  4ZOX A;  4GM3 A;  5IJ8 E;  2HKR A;  2H68 A;  3N0E A;  4IA9 A;  4Z7O B;  4CZV A;  3F3G A;  4X63 B;  3UVN A;  3EI3 B;  2P9N C;  2IAA A;  4J73 A;  3ZDY B;  3JZH A;  3JRO A;  3ZWL B;  2Z2N A;  2HXC A;  3I8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...