3AL8A

Plexin a2 / semaphorin 6a complex
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
550
structure length
537
Chain Sequence
GFPEDSEPISITKQYPVFVGHRHRLDIQMIMIMNRTLYVAARDHIYTVDIDTSHTEEIYCSKKLTWKSRQADVDTCRMKGKHKDECHNFIKVLLKKNDDTLFVCGTNAFNPSCRNYRVDTLETFGDEFSGMARCPYDAKHANIALFADGKLYSATVTDFLAIDAVIYRSLGDSPTLRTVKHDSKWLKEPYFVQAVDYGDYIYFFFREIAVEYNTMGKVVFPRVAQVCKNDMGGSQRVLEKQWTSFLKARLNCSVPGDSHFYFNILQAVTDVIRINGRDVVLATFSTPYNSIPGSAVCAYDMLDIANVFTGRFKEQKSPDSTWTPVPDERVPKPRPGCCAGSSSLEKYATSNEFPDDTLNFIKTHPLMDEAVPSIINRPWFLRTMVRYRLTKIAVDNAAGPYQNHTVVFLGSEKGIILKFLARIGSSGFLNGSLFLEEMNVYNPEKCSYDGVEDKRIMGMQLDRASGSLYVAFSTCVIKVPLGRCERHGKCKKTCIASRDPYCGWVRESGSCAHLSPLSRLTFEQDIERGNTDGLGDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for semaphorin signalling through the plexin receptor.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Semaphorin-6A
total genus 111
structure length 537
sequence length 550
ec nomenclature
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01403 Sema Sema domain
A PF01437 PSI Plexin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3al8A01
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3al8A02
4JT5C 1ERJA 2AGZA 3ZE0B 4J86A 5HYNB 3ZDYB 2CE9A 3C75H 4XYIA 1FWXA 1GP2B 4ERQA 3EI4A 2UZYB 4LG9A 4E5ZA 3I89A 4A09B 4A0BA 5C9ZB 4L3GD 4GM9A 4GQ2P 2B4EA 4J77A 2HXCA 3RMZD 1SQ9A 3CFVA 5CXCA 2VDQB 1JMXB 4FB1D 2AGLA 2Z2NA 3BWSA 4J8GA 5I5IA 2VDOB 2H13A 3SN6B 2XL2A 5C2VB 3L4OD 2H9LA 4R7AB 3DM0A 3FRXA 1K8KC 1SQJA 4J82A 3OTTA 2OVRB 2OJYA 5IC7A 5HE1B 3VI3B 3VH0A 3SWSD 4G56B 2I3TA 2YMUA 4A0BB 3EI2A 3AFCA 4CZXA 2H3XA 4H5IA 3KRWB 4E54B 2OK6A 3N0DA 3ORVD 5FQDA 2J57G 4A11B 2H9MA 3JPXA 5TF2A 3C5MA 4H5JA 3UKRC 3K26A 2XU7A 1TYQC 5FLXg 3SJLD 3PXSD 1U8CB 4ZOYA 2IWFA 3UVNA 4J8BA 4GQBB 3I2NA 2P26A 5IGQA 2GNQA 5EAMA 3MKQA 2VC2B 3UVKA 4JSXC 4NSXA 5THAA 3U4YA 2OVQB 1XHMA 2Z2PA 1YUKA 4A2MA 4FA1D 3MXXA 4FA9D 2P9UC 3J81g 2P9NC 3SHFA 2I3SA 3AH8B 4CZVA 1U2VC 5FXYA 2W18A 3IJCA 4J73A 4WK2B 3NVNA 5FKQA 5CXCB 4Z8LA 3OKWA 1MDAH 2AGWA 2Z2OA 2B5MA 4XEIC 4FA4D 3JROA 4J79A 3GREA 3IJ0A 2PM9A 3MZKA 2I0RA 3EI1B 3UR4A 4A08B 4K3ID 4CZYA 4D0KA 4A0AA 2H9PA 2H6QA 2GC7A 2B5NA 3PVUB 2J56H 4HDJA 4X3EA 1K32A 5HE0B 1JOFA 2G99A 3PXWD 5B4WA 1VYHC 2VDPB 5JWZA 2CO0C 3EI1A 4WJKB 4CI2A 4O3UB 4O3TB 1A0RB 5EMLB 2QC5A 2G9AA 4LG8A 4A2LA 5FKTA 4GMBA 4L3HD 3I7LA 3EI4B 3EG6A 3GFCA 4UM8B 3KRXB 4CY3A 3JZGA 4FAVD 3SLED 2IURA 3OL2B 4O45A 4QQEA 3PVWB 1XKSA 4UM9B 2OIZA 2VDLB 4FA5D 3ZE1B 2CN2A 4A7JA 5I5JA 4X61B 2IUVA 4ERZA 3C99A 4ZOXA 4J81A 3UKUC 2GC4A 2HJBA 3I7PA 4JSPC 4JSNC 5EMKB 3OW8A 3PSLA 5A2Qg 2O9KA 3AL9A 3RRMC 5HE3B 3I7KA 2PM9B 5TEFA 3EWEA 1GG2B 2H9NA 5FKRA 2VDRB 5KDOB 3ZE2B 4EWRA 4YVDA 5EAPA 4PXWA 1OLZA 2YNOA 4O9DA 4X63B 5HDBB 4JT6C 5GXHA 3DWLC 5E6RB 3K27A 3RFGA 2XL3A 3FGBA 3MKSB 2PM6B 3V9FA 4BL0A 4BH6A 3I7HA 1PBYB 2EBSA 4CY2A 2QXVA 2H68A 5IGOA 1PGUA 3DSMA 1YFQA 4N14A 5GXIA 3FCUB 1B9YA 5HQGA 4WK4B 3IJ1A 3I7OA 4GZ8A 2XYIA 3SXTD 1SSLA 5H1MA 3RFHA 1PEVA 4CI3A 3OKYA 4U7AA 3VI4B 3ZWLB 4D6VA 3VGZA 3CFSB 4QL1A 4XYHA 5I5MA 1TBGA 3P4FA 4QT8A 2OVPB 3OL2A 3T3PB 4X60B 3C9CA 2H14A 3IKOA 3OKYB 5EM2B 4J0WA 3HFQA 3V5WB 4A11A 3F3GA 4MK0B 4Y5RD 4CY1A 3JZHA 2B5LA 5EMJB 4ZN4A 3EI2B 3B7FA 4A09A 3SMRA 3SVWD 3V7DB 3NVXA 1MG2A 4WK0B 2BCJB 3UVMA 2YBAA 2I0SA 2J55H 5CYKB 4PSXB 2PBIB 3SBQA 4ES0A 1GOTB 3BG0A 1R5MA 5CXBB 3IIWA 5C2WB 3F3FA 3ULEC 3RSEC 2TRCB 4O1QD 1RI6A 5HE2B 2VDKB 4CI8A 2PM7B 3PSCB 4E54A 2CO0A 4PBZA 4CY5A 5E6UB 4QRJA 1NEXB 5EALA 5FKSA 5E6SB 4U1EI 2HKMA 4IA9A 5TEEA 1N6DA 2CE8A 5IJ8E 4PSWB 3IIYA 3RLMD 5H14A 4FAND 2HESX 3AL8B 2P28A 4JD2C 2P9PC 4Z7OB 2MTAH 2Q7QA 5EMMB 4PBYA 2P9KC 3CIKB 4E5ZB 2AQ5A 3EU7A 4IMMA 2P9IC 3J80g 2CNXA 2H47A 1OMWB 4TZ4A 3SFZA 3RN0D 1TYEB 2IUPA 3SBRA 4I79A 4A0AB 1L0QA 4L9OA 3ZDXB 3A0FA 3PE7A 3NIFB 5H17A 1B9XA 3N0EA 2P9SC 3NVQA 4LGNA 1S4UX 2H6KA 4CC9A 3UVLA 4AOWA 2VDMB 3ZDZB 3DXKC 5K19A 4L1QD 2BBKH 2OK4A 1N6FA 2YB8B 3I7NA 3L4MD 3RN1D 5GMKn 3DXMC 3SCYA 1QNIA 5TDHB 5AFU3 2AH0A 3ODTA 1SHYB 3MZLA 2YNNA 3W15A 4J84A 4UM9D 2AGYA 4ZOZA 4J87A 2CN3A 3EI3B 3E0CA 5FA5B 3BG1A 4JSVC 4OWRA 4ERYA 3PXTD 2VDNB 3EMHA 4ESGA 2AGXA 3FM0A 5GSAA 2HKRA 3I8CA 2HYEA 4KFMB 2UZXB 3JZNA 2P9LC 4GGAA 4FWWA 4GGDA 3NIDB 3UVOA 5CXBA 3NIGB 3AL8A 4GQ1A 1PI6A 4Z7QB 4JXMA 5AMSA 4A08A 4BUJC 5K1CC 3MMYA 1U4CA 4CI1A 3OKTA 4FHLA 1MG3A 5AJAA 4GGCA 4UI9R 2IAAA 2YNPA 4J78A 3JRPA 1P22A 1JMZB 5EM2A 1Q47A 2H6NA 1JJUB 4ZOVA 4Y7RA 3T3MB 5CYKA 2IUQA 5IJ7E 5IT9g 2HJ4A 3VA6A 1GXRA 3JAMg 4GM3A 4OZUA 4PC0A 2IWKA 4AEZA 3F3PA 1N6EA 4J0XA 1NR0A 5SXMA 4GM8A 2I0TA 4PNKB 4Z7NB 1XIPA 3I8EA 3JB9L 4K3JB 2AH1A 3EI3A 5EARA 3SBPA
chains in the Genus database with same CATH superfamily
4JT5C 1ERJA 2AGZA 3MVDK 3ZE0B 4J86A 5HYNB 3NIDA 3ZDYB 2CE9A 3C75H 4XYIA 1FWXA 3IUQA 1GP2B 4ERQA 3EI4A 2UZYB 4LG9A 4E5ZA 3I89A 4A09B 4A0BA 5C9ZB 4L3GD 4GM9A 4GQ2P 2B4EA 4J77A 2HXCA 3KCIA 2HU8A 3RMZD 1SQ9A 3CFVA 5CXCA 3FCSA 2VDQB 1JMXB 4FB1D 5E6SA 2AGLA 2Z2NA 5M5UA 3BWSA 4J8GA 5I5IA 2VDOB 2H13A 3SN6B 5C92A 2XL2A 2EIDA 3DDUA 5C2VB 3L4OD 2H9LA 4R7AB 3DM0A 1L5GA 3FRXA 1K8KC 1H2ZA 1SQJA 4J82A 3OTTA 2OVRB 4BP8A 2OJYA 5IC7A 5HE1B 3VI3B 1QFSA 3VH0A 3SWSD 4D9SA 1VE6A 4G56B 2I3TA 2YMUA 4WK4A 4UM8A 4A0BB 4NAAA 3EI2A 3AFCA 4CZXA 2H3XA 4H5IA 3KRWB 4E54B 2OK6A 3N0DA 3ORVD 5FQDA 2QR5A 4WJKA 2J57G 4A11B 2H9MA 3JPXA 2XZGA 5TF2A 3C5MA 4H5JA 3UKRC 3K26A 5E6UA 2XU7A 1TYQC 5FLXg 1U8CA 3SJLD 3PXSD 1U8CB 4ZOYA 2IWFA 3UVNA 4J8BA 4GQBB 3I2NA 2P26A 5IGQA 2GNQA 5EAMA 3MKQA 2VC2B 3UVKA 4JSXC 4NSXA 5THAA 3U4YA 1VE7A 2OVQB 1XHMA 2Z2PA 3QHYB 1YUKA 4A2MA 4FA1D 3MXXA 4FA9D 2P9UC 3J81g 2P9NC 3IURA 4MMXA 3SHFA 2I3SA 3AH8B 4CZVA 3EQ8A 1U2VC 5FXYA 2W18A 3IJCA 4J73A 4WK2B 3NVNA 4UM9A 1UTCA 5FKQA 5CXCB 4Z8LA 3OKWA 1MDAH 2AGWA 5FFGA 4DNVA 3K6SA 2Z2OA 2B5MA 4XEIC 4FA4D 3JROA 4J79A 3GREA 1UOOA 3IJ0A 2PM9A 1UOPA 2I0RA 3MZKA 4BCCA 3EI1B 3UR4A 4A08B 4K3ID 1JV2A 5C86A 4CZYA 4D0KA 3O4JA 4A0AA 2H9PA 2H6QA 2GC7A 2B5NA 3PVUB 1I2MB 2J56H 3IVMA 4HDJA 4X3EA 1K32A 5M5SA 3ZE0A 5HE0B 1JOFA 2G99A 3PXWD 5B4WA 1VYHC 2VDPB 5JWZA 2CO0C 3EI1A 4WJKB 4CI2A 4O3UB 4O3TB 1A0RB 5EMLB 2QC5A 4AMYA 2G9AA 4LG8A 4A2LA 5FKTA 4GMBA 4L3HD 3I7LA 3EI4B 3EG6A 4AN0A 3NIFA 3GFCA 4UM8B 3KRXB 4CY3A 3JZGA 1O6FA 4FAVD 3SLED 2IURA 3OL2B 4O45A 4QQEA 3PVWB 2EIEA 1XKSA 4UM9B 2OIZA 2JKXA 3ZE1A 2VDLB 4FA5D 3ZE1B 4BCDA 2CN2A 4A7JA 5I5JA 4X61B 2VZ3A 2IUVA 4ERZA 3C99A 4ZOXA 4J81A 3UKUC 2GC4A 2HJBA 3IUMA 3I7PA 4JSPC 3OF7A 4JSNC 4AN1A 2XDWA 3QI0A 1H2YA 5EMKB 3OW8A 3PSLA 5A2Qg 2O9KA 5E6RA 4NBMA 2JWGA 3AL9A 3RRMC 5HE3B 4BCBA 3I7KA 2PM9B 5TEFA 3EWEA 1GG2B 2H9NA 1VZ3A 5FKRA 3IJEA 2VDRB 5KDOB 3ZE2B 4EWRA 2VDNA 4YVDA 5EAPA 4PXWA 1OLZA 2YNOA 4L1MA 4O9DA 4X63B 3ZDXA 5HDBB 4JT6C 5GXHA 3DWLC 5E6RB 3K27A 3RFGA 2XL3A 3FGBA 3MKSB 2PM6B 3V9FA 4BL0A 4BH6A 3I7HA 1PBYB 2EBSA 4CY2A 2HU5A 1H2WA 2QXVA 2H68A 5IGOA 1PGUA 3DSMA 1YFQA 4N14A 5GXIA 3IUJA 2WQ8A 3FCUB 1B9YA 5HQGA 4Z7OA 4WK4B 3IJ1A 3I7OA 4GZ8A 2XYIA 3SXTD 1SSLA 5H1MA 3RFHA 1PEVA 4CI3A 3EQ7A 3OKYA 5M5VA 4U7AA 4O2WA 3VI4B 3ZWLB 4D6VA 3VGZA 4JHNA 3CFSB 3FCUA 3V4PA 4DNWA 4QL1A 4XYHA 4QAMA 5I5MA 1TBGA 3P4FA 4QT8A 2OVPB 3OL2A 3T3PB 3T3MA 4X60B 3C9CA 2H14A 3IKOA 3OKYB 5EM2B 4J0WA 3HFQA 2VDQA 3V5WB 4A11A 3F3GA 4MK0B 4Y5RD 4CY1A 3ZE2A 1QFMA 3JZHA 2B5LA 5EMJB 4ZN4A 3EI2B 3B7FA 4A09A 3SMRA 3SVWD 3V7DB 3NVXA 1MG2A 4WK0B 2BCJB 1YR2A 3UVMA 2YBAA 2QZPA 2I0SA 2J55H 2XE4A 5CYKB 2HU7A 4PSXB 4O02A 2PBIB 3SBQA 4ES0A 4WK2A 1GOTB 3BG0A 1R5MA 5CXBB 3IIWA 5C2WB 3F3FA 3ULEC 3RSEC 2TRCB 2VDRA 4O1QD 1RI6A 2VDPA 5M5RA 5HE2B 2VDKB 4CI8A 2PM7B 3PSCB 4E54A 2CO0A 4PBZA 3VI4A 4CY5A 5E6UB 4QRJA 1NEXB 5EALA 5FKSA 5E6SB 4U1EI 2HKMA 4IA9A 5TEEA 1N6DA 2CE8A 5IJ8E 4PSWB 3IIYA 3RLMD 5H14A 4FAND 5FFOA 4Z7QA 3K72A 2HESX 3AL8B 2P28A 4JD2C 2P9PC 4Z7OB 2MTAH 2Q7QA 5EMMB 4PBYA 2VC2A 2P9KC 3CIKB 4E5ZB 1M1XA 2AQ5A 3EU7A 2P9IC 4IMMA 3J80g 2VDLA 2CNXA 2H47A 1OMWB 2VZ1A 4TZ4A 3SFZA 4RE5A 3RN0D 2IUPA 3SBRA 1TYEB 4I79A 4A0AB 1L0QA 4L9OA 1K3IA 3ZDXB 3A0FA 1O6GA 3PE7A 3NIFB 5H17A 1B9XA 4WK0A 3IUNA 3N0EA 5M61A 4Z7NA 2P9SC 3NVQA 4JHPC 1T2XA 4LGNA 3VI3A 1BPOA 1S4UX 2H6KA 4G1EA 3UVLA 4CC9A 4AOWA 2VDMB 3ZDZB 3DXKC 5K19A 4L1QD 2BBKH 1E8MA 1N6FA 2OK4A 1GOGA 1UOQA 2YB8B 3I7NA 4MMYA 3L4MD 3RN1D 5GMKn 3DXMC 3SCYA 3GC3B 1QNIA 2BKLA 5TDHB 4IRZA 3EQ9A 5AFU3 2AH0A 3ODTA 3MUNA 1SHYB 2EIBA 3MZLA 3MUOA 2YNNA 3W15A 4J84A 4UM9D 2AGYA 4ZOZA 4J87A 2CN3A 5HDBA 3EI3B 3E0CA 5FA5B 4G1MA 3BG1A 4JSVC 4OWRA 4ERYA 3PXTD 2VDNB 3EMHA 4ESGA 4NC4A 2AGXA 3FM0A 5GSAA 4NENA 2HKRA 3I8CA 2HYEA 4KFMB 1H2XA 1E5TA 2UZXB 3JZNA 2P9LC 2VDKA 4GGAA 3V4VA 4FWWA 4GGDA 4RE6A 3NIDB 3UVOA 1TYEA 5CXBA 4AX4A 3NIGB 2EICA 3NIGA 3AL8A 4GQ1A 1PI6A 4Z7QB 5M5TA 4JXMA 5AMSA 4A08A 2JWHA 4BUJC 5K1CC 3MMYA 1U4CA 1C9IA 4CI1A 3IULA 3OKTA 4FHLA 3O4IA 3ZDYA 1MG3A 5AJAA 4GGCA 4UI9R 2IAAA 2YNPA 4J78A 3JRPA 3T3PA 1P22A 1JMZB 1JTDB 1Q47A 2H6NA 5EM2A 1JJUB 4ZOVA 4Y7RA 3T3MB 5CYKA 4DNUA 2IUQA 1E8NA 5IJ7E 5IT9g 2HJ4A 1GOFA 3VA6A 3O4HA 3O4GA 1GXRA 3GD1I 1GOHA 3JAMg 4GM3A 4G55A 2VDMA 4OZUA 3ZDZA 4BP9A 4PC0A 2IWKA 1C9LA 4AEZA 3F3PA 1N6EA 4J0XA 1NR0A 5SXMA 4GM8A 2I0TA 4PNKB 4Z7NB 1XIPA 3I8EA 3K71A 3JB9L 4K3JB 1A12A 1VZ2A 4MMZA 2AH1A 3EI3A 5EARA 2VDOA 3SBPA 4AMZA
chains in the Genus database with same CATH topology
4JT5C 1ERJA 2AGZA 3ZE0B 4J86A 5HYNB 3ZDYB 2CE9A 3C75H 4XYIA 1FWXA 1GP2B 4ERQA 3EI4A 2UZYB 4LG9A 4E5ZA 3I89A 4A09B 4A0BA 5C9ZB 4L3GD 4GM9A 4GQ2P 2B4EA 4J77A 2HXCA 3RMZD 1SQ9A 3CFVA 5CXCA 2VDQB 1JMXB 4FB1D 2AGLA 2Z2NA 3BWSA 4J8GA 5I5IA 2VDOB 2H13A 3SN6B 2XL2A 5C2VB 3L4OD 2H9LA 4R7AB 3DM0A 3FRXA 1K8KC 1SQJA 4J82A 3OTTA 2OVRB 2OJYA 5IC7A 5HE1B 3VI3B 3VH0A 3SWSD 4G56B 2I3TA 2YMUA 4A0BB 3EI2A 3AFCA 4CZXA 2H3XA 4H5IA 3KRWB 4E54B 2OK6A 3N0DA 3ORVD 5FQDA 2J57G 4A11B 2H9MA 3JPXA 5TF2A 3C5MA 4H5JA 3UKRC 3K26A 2XU7A 1TYQC 5FLXg 3SJLD 3PXSD 1U8CB 4ZOYA 2IWFA 3UVNA 4J8BA 4GQBB 3I2NA 2P26A 5IGQA 2GNQA 5EAMA 3MKQA 2VC2B 3UVKA 4JSXC 4NSXA 5THAA 3U4YA 2OVQB 1XHMA 2Z2PA 1YUKA 4A2MA 4FA1D 3MXXA 4FA9D 2P9UC 3J81g 2P9NC 3SHFA 2I3SA 3AH8B 4CZVA 1U2VC 5FXYA 2W18A 3IJCA 4J73A 4WK2B 3NVNA 5FKQA 5CXCB 4Z8LA 3OKWA 1MDAH 2AGWA 2Z2OA 2B5MA 4XEIC 4FA4D 3JROA 4J79A 3GREA 3IJ0A 2PM9A 3MZKA 2I0RA 3EI1B 3UR4A 4A08B 4K3ID 4CZYA 4D0KA 4A0AA 2H9PA 2H6QA 2GC7A 2B5NA 3PVUB 2J56H 4HDJA 4X3EA 1K32A 5HE0B 1JOFA 2G99A 3PXWD 5B4WA 1VYHC 2VDPB 5JWZA 2CO0C 3EI1A 4WJKB 4CI2A 4O3UB 4O3TB 1A0RB 5EMLB 2QC5A 2G9AA 4LG8A 4A2LA 5FKTA 4GMBA 4L3HD 3I7LA 3EI4B 3EG6A 3GFCA 4UM8B 3KRXB 4CY3A 3JZGA 4FAVD 3SLED 2IURA 3OL2B 4O45A 4QQEA 3PVWB 1XKSA 4UM9B 2OIZA 2VDLB 4FA5D 3ZE1B 2CN2A 4A7JA 5I5JA 4X61B 2IUVA 4ERZA 3C99A 4ZOXA 4J81A 3UKUC 2GC4A 2HJBA 3I7PA 4JSPC 4JSNC 5EMKB 3OW8A 3PSLA 5A2Qg 2O9KA 2JWGA 3AL9A 3RRMC 5HE3B 3I7KA 2PM9B 5TEFA 3EWEA 1GG2B 2H9NA 5FKRA 2VDRB 5KDOB 3ZE2B 4EWRA 4YVDA 5EAPA 4PXWA 1OLZA 2YNOA 4O9DA 4X63B 5HDBB 4JT6C 5GXHA 3DWLC 5E6RB 3K27A 3RFGA 2XL3A 3FGBA 3MKSB 2PM6B 3V9FA 4BL0A 4BH6A 3I7HA 1PBYB 2EBSA 4CY2A 2QXVA 2H68A 5IGOA 1PGUA 3DSMA 1YFQA 4N14A 5GXIA 3FCUB 1B9YA 5HQGA 4WK4B 3IJ1A 3I7OA 4GZ8A 2XYIA 3SXTD 1SSLA 5H1MA 3RFHA 1PEVA 4CI3A 3OKYA 4U7AA 3VI4B 3ZWLB 4D6VA 3VGZA 3CFSB 4QL1A 4XYHA 5I5MA 1TBGA 3P4FA 4QT8A 2OVPB 3OL2A 3T3PB 4X60B 3C9CA 2H14A 3IKOA 3OKYB 5EM2B 4J0WA 3HFQA 3V5WB 4A11A 3F3GA 4MK0B 4Y5RD 4CY1A 3JZHA 2B5LA 5EMJB 4ZN4A 3EI2B 3B7FA 4A09A 3SMRA 3SVWD 3V7DB 3NVXA 1MG2A 4WK0B 2BCJB 3UVMA 2YBAA 2I0SA 2J55H 5CYKB 4PSXB 2PBIB 3SBQA 4ES0A 1GOTB 3BG0A 1R5MA 5CXBB 3IIWA 5C2WB 3F3FA 3ULEC 3RSEC 2TRCB 4O1QD 1RI6A 5HE2B 2VDKB 4CI8A 2PM7B 3PSCB 4E54A 2CO0A 4PBZA 4CY5A 5E6UB 4QRJA 1NEXB 5EALA 5FKSA 5E6SB 4U1EI 2HKMA 4IA9A 5TEEA 1N6DA 2CE8A 5IJ8E 4PSWB 3IIYA 3RLMD 5H14A 4FAND 2HESX 3AL8B 2P28A 4JD2C 2P9PC 4Z7OB 2MTAH 2Q7QA 5EMMB 4PBYA 2P9KC 3CIKB 4E5ZB 2AQ5A 3EU7A 4IMMA 2P9IC 3J80g 2CNXA 2H47A 1OMWB 4TZ4A 3SFZA 3RN0D 1TYEB 2IUPA 3SBRA 4I79A 4A0AB 1L0QA 4L9OA 3ZDXB 3A0FA 3PE7A 3NIFB 5H17A 1B9XA 3N0EA 2P9SC 3NVQA 4LGNA 1S4UX 2H6KA 4CC9A 3UVLA 4AOWA 2VDMB 3ZDZB 3DXKC 5K19A 4L1QD 2BBKH 2OK4A 1N6FA 2YB8B 3I7NA 3L4MD 3RN1D 5GMKn 3DXMC 3SCYA 1QNIA 5TDHB 5AFU3 2AH0A 3ODTA 1SHYB 3MZLA 2YNNA 3W15A 4J84A 4UM9D 2AGYA 4ZOZA 4J87A 2CN3A 3EI3B 3E0CA 5FA5B 3BG1A 4JSVC 4OWRA 4ERYA 3PXTD 2VDNB 3EMHA 4ESGA 2AGXA 3FM0A 5GSAA 2HKRA 3I8CA 2HYEA 4KFMB 2UZXB 3JZNA 2P9LC 4GGAA 4FWWA 4GGDA 3NIDB 3UVOA 5CXBA 3NIGB 3AL8A 4GQ1A 1PI6A 4Z7QB 4JXMA 5AMSA 4A08A 2JWHA 4BUJC 5K1CC 3MMYA 1U4CA 4CI1A 3OKTA 4FHLA 1MG3A 5AJAA 4GGCA 4UI9R 2IAAA 2YNPA 4J78A 3JRPA 1P22A 1JMZB 5EM2A 1Q47A 2H6NA 1JJUB 4ZOVA 4Y7RA 3T3MB 5CYKA 2IUQA 5IJ7E 5IT9g 2HJ4A 3VA6A 1GXRA 3JAMg 4GM3A 4OZUA 4PC0A 2IWKA 4AEZA 3F3PA 1N6EA 4J0XA 1NR0A 5SXMA 4GM8A 2I0TA 4PNKB 4Z7NB 1XIPA 3I8EA 3JB9L 4K3JB 2AH1A 3EI3A 5EARA 3SBPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JT5 C;  1ERJ A;  2AGZ A;  3ZE0 B;  4J86 A;  5HYN B;  3ZDY B;  2CE9 A;  3C75 H;  4XYI A;  1FWX A;  1GP2 B;  4ERQ A;  3EI4 A;  2UZY B;  4LG9 A;  4E5Z A;  3I89 A;  4A09 B;  4A0B A;  5C9Z B;  4L3G D;  4GM9 A;  4GQ2 P;  2B4E A;  4J77 A;  2HXC A;  3RMZ D;  1SQ9 A;  3CFV A;  5CXC A;  2VDQ B;  1JMX B;  4FB1 D;  2AGL A;  2Z2N A;  3BWS A;  4J8G A;  5I5I A;  2VDO B;  2H13 A;  3SN6 B;  2XL2 A;  5C2V B;  3L4O D;  2H9L A;  4R7A B;  3DM0 A;  3FRX A;  1K8K C;  1SQJ A;  4J82 A;  3OTT A;  2OVR B;  2OJY A;  5IC7 A;  5HE1 B;  3VI3 B;  3VH0 A;  3SWS D;  4G56 B;  2I3T A;  2YMU A;  4A0B B;  3EI2 A;  3AFC A;  4CZX A;  2H3X A;  4H5I A;  3KRW B;  4E54 B;  2OK6 A;  3N0D A;  3ORV D;  5FQD A;  2J57 G;  4A11 B;  2H9M A;  3JPX A;  5TF2 A;  3C5M A;  4H5J A;  3UKR C;  3K26 A;  2XU7 A;  1TYQ C;  5FLX g;  3SJL D;  3PXS D;  1U8C B;  4ZOY A;  2IWF A;  3UVN A;  4J8B A;  4GQB B;  3I2N A;  2P26 A;  5IGQ A;  2GNQ A;  5EAM A;  3MKQ A;  2VC2 B;  3UVK A;  4JSX C;  4NSX A;  5THA A;  3U4Y A;  2OVQ B;  1XHM A;  2Z2P A;  1YUK A;  4A2M A;  4FA1 D;  3MXX A;  4FA9 D;  2P9U C;  3J81 g;  2P9N C;  3SHF A;  2I3S A;  3AH8 B;  4CZV A;  1U2V C;  5FXY A;  2W18 A;  3IJC A;  4J73 A;  4WK2 B;  3NVN A;  5FKQ A;  5CXC B;  4Z8L A;  3OKW A;  1MDA H;  2AGW A;  2Z2O A;  2B5M A;  4XEI C;  4FA4 D;  3JRO A;  4J79 A;  3GRE A;  3IJ0 A;  2PM9 A;  3MZK A;  2I0R A;  3EI1 B;  3UR4 A;  4A08 B;  4K3I D;  4CZY A;  4D0K A;  4A0A A;  2H9P A;  2H6Q A;  2GC7 A;  2B5N A;  3PVU B;  2J56 H;  4HDJ A;  4X3E A;  1K32 A;  5HE0 B;  1JOF A;  2G99 A;  3PXW D;  5B4W A;  1VYH C;  2VDP B;  5JWZ A;  2CO0 C;  3EI1 A;  4WJK B;  4CI2 A;  4O3U B;  4O3T B;  1A0R B;  5EML B;  2QC5 A;  2G9A A;  4LG8 A;  4A2L A;  5FKT A;  4GMB A;  4L3H D;  3I7L A;  3EI4 B;  3EG6 A;  3GFC A;  4UM8 B;  3KRX B;  4CY3 A;  3JZG A;  4FAV D;  3SLE D;  2IUR A;  3OL2 B;  4O45 A;  4QQE A;  3PVW B;  1XKS A;  4UM9 B;  2OIZ A;  2VDL B;  4FA5 D;  3ZE1 B;  2CN2 A;  4A7J A;  5I5J A;  4X61 B;  2IUV A;  4ERZ A;  3C99 A;  4ZOX A;  4J81 A;  3UKU C;  2GC4 A;  2HJB A;  3I7P A;  4JSP C;  4JSN C;  5EMK B;  3OW8 A;  3PSL A;  5A2Q g;  2O9K A;  3AL9 A;  3RRM C;  5HE3 B;  3I7K A;  2PM9 B;  5TEF A;  3EWE A;  1GG2 B;  2H9N A;  5FKR A;  2VDR B;  5KDO B;  3ZE2 B;  4EWR A;  4YVD A;  5EAP A;  4PXW A;  1OLZ A;  2YNO A;  4O9D A;  4X63 B;  5HDB B;  4JT6 C;  5GXH A;  3DWL C;  5E6R B;  3K27 A;  3RFG A;  2XL3 A;  3FGB A;  3MKS B;  2PM6 B;  3V9F A;  4BL0 A;  4BH6 A;  3I7H A;  1PBY B;  2EBS A;  4CY2 A;  2QXV A;  2H68 A;  5IGO A;  1PGU A;  3DSM A;  1YFQ A;  4N14 A;  5GXI A;  3FCU B;  1B9Y A;  5HQG A;  4WK4 B;  3IJ1 A;  3I7O A;  4GZ8 A;  2XYI A;  3SXT D;  1SSL A;  5H1M A;  3RFH A;  1PEV A;  4CI3 A;  3OKY A;  4U7A A;  3VI4 B;  3ZWL B;  4D6V A;  3VGZ A;  3CFS B;  4QL1 A;  4XYH A;  5I5M A;  1TBG A;  3P4F A;  4QT8 A;  2OVP B;  3OL2 A;  3T3P B;  4X60 B;  3C9C A;  2H14 A;  3IKO A;  3OKY B;  5EM2 B;  4J0W A;  3HFQ A;  3V5W B;  4A11 A;  3F3G A;  4MK0 B;  4Y5R D;  4CY1 A;  3JZH A;  2B5L A;  5EMJ B;  4ZN4 A;  3EI2 B;  3B7F A;  4A09 A;  3SMR A;  3SVW D;  3V7D B;  3NVX A;  1MG2 A;  4WK0 B;  2BCJ B;  3UVM A;  2YBA A;  2I0S A;  2J55 H;  5CYK B;  4PSX B;  2PBI B;  3SBQ A;  4ES0 A;  1GOT B;  3BG0 A;  1R5M A;  5CXB B;  3IIW A;  5C2W B;  3F3F A;  3ULE C;  3RSE C;  2TRC B;  4O1Q D;  1RI6 A;  5HE2 B;  2VDK B;  4CI8 A;  2PM7 B;  3PSC B;  4E54 A;  2CO0 A;  4PBZ A;  4CY5 A;  5E6U B;  4QRJ A;  1NEX B;  5EAL A;  5FKS A;  5E6S B;  4U1E I;  2HKM A;  4IA9 A;  5TEE A;  1N6D A;  2CE8 A;  5IJ8 E;  4PSW B;  3IIY A;  3RLM D;  5H14 A;  4FAN D;  2HES X;  3AL8 B;  2P28 A;  4JD2 C;  2P9P C;  4Z7O B;  2MTA H;  2Q7Q A;  5EMM B;  4PBY A;  2P9K C;  3CIK B;  4E5Z B;  2AQ5 A;  3EU7 A;  4IMM A;  2P9I C;  3J80 g;  2CNX A;  2H47 A;  1OMW B;  4TZ4 A;  3SFZ A;  3RN0 D;  1TYE B;  2IUP A;  3SBR A;  4I79 A;  4A0A B;  1L0Q A;  4L9O A;  3ZDX B;  3A0F A;  3PE7 A;  3NIF B;  5H17 A;  1B9X A;  3N0E A;  2P9S C;  3NVQ A;  4LGN A;  1S4U X;  2H6K A;  4CC9 A;  3UVL A;  4AOW A;  2VDM B;  3ZDZ B;  3DXK C;  5K19 A;  4L1Q D;  2BBK H;  2OK4 A;  1N6F A;  2YB8 B;  3I7N A;  3L4M D;  3RN1 D;  5GMK n;  3DXM C;  3SCY A;  1QNI A;  5TDH B;  5AFU 3;  2AH0 A;  3ODT A;  1SHY B;  3MZL A;  2YNN A;  3W15 A;  4J84 A;  4UM9 D;  2AGY A;  4ZOZ A;  4J87 A;  2CN3 A;  3EI3 B;  3E0C A;  5FA5 B;  3BG1 A;  4JSV C;  4OWR A;  4ERY A;  3PXT D;  2VDN B;  3EMH A;  4ESG A;  2AGX A;  3FM0 A;  5GSA A;  2HKR A;  3I8C A;  2HYE A;  4KFM B;  2UZX B;  3JZN A;  2P9L C;  4GGA A;  4FWW A;  4GGD A;  3NID B;  3UVO A;  5CXB A;  3NIG B;  3AL8 A;  4GQ1 A;  1PI6 A;  4Z7Q B;  4JXM A;  5AMS A;  4A08 A;  4BUJ C;  5K1C C;  3MMY A;  1U4C A;  4CI1 A;  3OKT A;  4FHL A;  1MG3 A;  5AJA A;  4GGC A;  4UI9 R;  2IAA A;  2YNP A;  4J78 A;  3JRP A;  1P22 A;  1JMZ B;  5EM2 A;  1Q47 A;  2H6N A;  1JJU B;  4ZOV A;  4Y7R A;  3T3M B;  5CYK A;  2IUQ A;  5IJ7 E;  5IT9 g;  2HJ4 A;  3VA6 A;  1GXR A;  3JAM g;  4GM3 A;  4OZU A;  4PC0 A;  2IWK A;  4AEZ A;  3F3P A;  1N6E A;  4J0X A;  1NR0 A;  5SXM A;  4GM8 A;  2I0T A;  4PNK B;  4Z7N B;  1XIP A;  3I8E A;  3JB9 L;  4K3J B;  2AH1 A;  3EI3 A;  5EAR A;  3SBP A; 
#chains in the Genus database with same CATH topology
 4JT5 C;  1ERJ A;  2AGZ A;  3MVD K;  3ZE0 B;  4J86 A;  5HYN B;  3NID A;  3ZDY B;  2CE9 A;  3C75 H;  4XYI A;  1FWX A;  3IUQ A;  1GP2 B;  4ERQ A;  3EI4 A;  2UZY B;  4LG9 A;  4E5Z A;  3I89 A;  4A09 B;  4A0B A;  5C9Z B;  4L3G D;  4GM9 A;  4GQ2 P;  2B4E A;  4J77 A;  2HXC A;  3KCI A;  2HU8 A;  3RMZ D;  1SQ9 A;  3CFV A;  5CXC A;  3FCS A;  2VDQ B;  1JMX B;  4FB1 D;  5E6S A;  2AGL A;  2Z2N A;  5M5U A;  3BWS A;  4J8G A;  5I5I A;  2VDO B;  2H13 A;  3SN6 B;  5C92 A;  2XL2 A;  2EID A;  3DDU A;  5C2V B;  3L4O D;  2H9L A;  4R7A B;  3DM0 A;  1L5G A;  3FRX A;  1K8K C;  1H2Z A;  1SQJ A;  4J82 A;  3OTT A;  2OVR B;  4BP8 A;  2OJY A;  5IC7 A;  5HE1 B;  3VI3 B;  1QFS A;  3VH0 A;  3SWS D;  4D9S A;  1VE6 A;  4G56 B;  2I3T A;  2YMU A;  4WK4 A;  4UM8 A;  4A0B B;  4NAA A;  3EI2 A;  3AFC A;  4CZX A;  2H3X A;  4H5I A;  3KRW B;  4E54 B;  2OK6 A;  3N0D A;  3ORV D;  5FQD A;  2QR5 A;  4WJK A;  2J57 G;  4A11 B;  2H9M A;  3JPX A;  2XZG A;  5TF2 A;  3C5M A;  4H5J A;  3UKR C;  3K26 A;  5E6U A;  2XU7 A;  1TYQ C;  5FLX g;  1U8C A;  3SJL D;  3PXS D;  1U8C B;  4ZOY A;  2IWF A;  3UVN A;  4J8B A;  4GQB B;  3I2N A;  2P26 A;  5IGQ A;  2GNQ A;  5EAM A;  3MKQ A;  2VC2 B;  3UVK A;  4JSX C;  4NSX A;  5THA A;  3U4Y A;  1VE7 A;  2OVQ B;  1XHM A;  2Z2P A;  3QHY B;  1YUK A;  4A2M A;  4FA1 D;  3MXX A;  4FA9 D;  2P9U C;  3J81 g;  2P9N C;  3IUR A;  4MMX A;  3SHF A;  2I3S A;  3AH8 B;  4CZV A;  3EQ8 A;  1U2V C;  5FXY A;  2W18 A;  3IJC A;  4J73 A;  4WK2 B;  3NVN A;  4UM9 A;  1UTC A;  5FKQ A;  5CXC B;  4Z8L A;  3OKW A;  1MDA H;  2AGW A;  5FFG A;  4DNV A;  3K6S A;  2Z2O A;  2B5M A;  4XEI C;  4FA4 D;  3JRO A;  4J79 A;  3GRE A;  1UOO A;  3IJ0 A;  2PM9 A;  1UOP A;  2I0R A;  3MZK A;  4BCC A;  3EI1 B;  3UR4 A;  4A08 B;  4K3I D;  1JV2 A;  5C86 A;  4CZY A;  4D0K A;  3O4J A;  4A0A A;  2H9P A;  2H6Q A;  2GC7 A;  2B5N A;  3PVU B;  1I2M B;  2J56 H;  3IVM A;  4HDJ A;  4X3E A;  1K32 A;  5M5S A;  3ZE0 A;  5HE0 B;  1JOF A;  2G99 A;  3PXW D;  5B4W A;  1VYH C;  2VDP B;  5JWZ A;  2CO0 C;  3EI1 A;  4WJK B;  4CI2 A;  4O3U B;  4O3T B;  1A0R B;  5EML B;  2QC5 A;  4AMY A;  2G9A A;  4LG8 A;  4A2L A;  5FKT A;  4GMB A;  4L3H D;  3I7L A;  3EI4 B;  3EG6 A;  4AN0 A;  3NIF A;  3GFC A;  4UM8 B;  3KRX B;  4CY3 A;  3JZG A;  1O6F A;  4FAV D;  3SLE D;  2IUR A;  3OL2 B;  4O45 A;  4QQE A;  3PVW B;  2EIE A;  1XKS A;  4UM9 B;  2OIZ A;  2JKX A;  3ZE1 A;  2VDL B;  4FA5 D;  3ZE1 B;  4BCD A;  2CN2 A;  4A7J A;  5I5J A;  4X61 B;  2VZ3 A;  2IUV A;  4ERZ A;  3C99 A;  4ZOX A;  4J81 A;  3UKU C;  2GC4 A;  2HJB A;  3IUM A;  3I7P A;  4JSP C;  3OF7 A;  4JSN C;  4AN1 A;  2XDW A;  3QI0 A;  1H2Y A;  5EMK B;  3OW8 A;  3PSL A;  5A2Q g;  2O9K A;  5E6R A;  4NBM A;  2JWG A;  3AL9 A;  3RRM C;  5HE3 B;  4BCB A;  3I7K A;  2PM9 B;  5TEF A;  3EWE A;  1GG2 B;  2H9N A;  1VZ3 A;  5FKR A;  3IJE A;  2VDR B;  5KDO B;  3ZE2 B;  4EWR A;  2VDN A;  4YVD A;  5EAP A;  4PXW A;  1OLZ A;  2YNO A;  4L1M A;  4O9D A;  4X63 B;  3ZDX A;  5HDB B;  4JT6 C;  5GXH A;  3DWL C;  5E6R B;  3K27 A;  3RFG A;  2XL3 A;  3FGB A;  3MKS B;  2PM6 B;  3V9F A;  4BL0 A;  4BH6 A;  3I7H A;  1PBY B;  2EBS A;  4CY2 A;  2HU5 A;  1H2W A;  2QXV A;  2H68 A;  5IGO A;  1PGU A;  3DSM A;  1YFQ A;  4N14 A;  5GXI A;  3IUJ A;  2WQ8 A;  3FCU B;  1B9Y A;  5HQG A;  4Z7O A;  4WK4 B;  3IJ1 A;  3I7O A;  4GZ8 A;  2XYI A;  3SXT D;  1SSL A;  5H1M A;  3RFH A;  1PEV A;  4CI3 A;  3EQ7 A;  3OKY A;  5M5V A;  4U7A A;  4O2W A;  3VI4 B;  3ZWL B;  4D6V A;  3VGZ A;  4JHN A;  3CFS B;  3FCU A;  3V4P A;  4DNW A;  4QL1 A;  4XYH A;  4QAM A;  5I5M A;  1TBG A;  3P4F A;  4QT8 A;  2OVP B;  3OL2 A;  3T3P B;  3T3M A;  4X60 B;  3C9C A;  2H14 A;  3IKO A;  3OKY B;  5EM2 B;  4J0W A;  3HFQ A;  2VDQ A;  3V5W B;  4A11 A;  3F3G A;  4MK0 B;  4Y5R D;  4CY1 A;  3ZE2 A;  1QFM A;  3JZH A;  2B5L A;  5EMJ B;  4ZN4 A;  3EI2 B;  3B7F A;  4A09 A;  3SMR A;  3SVW D;  3V7D B;  3NVX A;  1MG2 A;  4WK0 B;  2BCJ B;  1YR2 A;  3UVM A;  2YBA A;  2QZP A;  2I0S A;  2J55 H;  2XE4 A;  5CYK B;  2HU7 A;  4PSX B;  4O02 A;  2PBI B;  3SBQ A;  4ES0 A;  4WK2 A;  1GOT B;  3BG0 A;  1R5M A;  5CXB B;  3IIW A;  5C2W B;  3F3F A;  3ULE C;  3RSE C;  2TRC B;  2VDR A;  4O1Q D;  1RI6 A;  2VDP A;  5M5R A;  5HE2 B;  2VDK B;  4CI8 A;  2PM7 B;  3PSC B;  4E54 A;  2CO0 A;  4PBZ A;  3VI4 A;  4CY5 A;  5E6U B;  4QRJ A;  1NEX B;  5EAL A;  5FKS A;  5E6S B;  4U1E I;  2HKM A;  4IA9 A;  5TEE A;  1N6D A;  2CE8 A;  5IJ8 E;  4PSW B;  3IIY A;  3RLM D;  5H14 A;  4FAN D;  5FFO A;  4Z7Q A;  3K72 A;  2HES X;  3AL8 B;  2P28 A;  4JD2 C;  2P9P C;  4Z7O B;  2MTA H;  2Q7Q A;  5EMM B;  4PBY A;  2VC2 A;  2P9K C;  3CIK B;  4E5Z B;  1M1X A;  2AQ5 A;  3EU7 A;  2P9I C;  4IMM A;  3J80 g;  2VDL A;  2CNX A;  2H47 A;  1OMW B;  2VZ1 A;  4TZ4 A;  3SFZ A;  4RE5 A;  3RN0 D;  2IUP A;  3SBR A;  1TYE B;  4I79 A;  4A0A B;  1L0Q A;  4L9O A;  1K3I A;  3ZDX B;  3A0F A;  1O6G A;  3PE7 A;  3NIF B;  5H17 A;  1B9X A;  4WK0 A;  3IUN A;  3N0E A;  5M61 A;  4Z7N A;  2P9S C;  3NVQ A;  4JHP C;  1T2X A;  4LGN A;  3VI3 A;  1BPO A;  1S4U X;  2H6K A;  4G1E A;  3UVL A;  4CC9 A;  4AOW A;  2VDM B;  3ZDZ B;  3DXK C;  5K19 A;  4L1Q D;  2BBK H;  1E8M A;  1N6F A;  2OK4 A;  1GOG A;  1UOQ A;  2YB8 B;  3I7N A;  4MMY A;  3L4M D;  3RN1 D;  5GMK n;  3DXM C;  3SCY A;  3GC3 B;  1QNI A;  2BKL A;  5TDH B;  4IRZ A;  3EQ9 A;  5AFU 3;  2AH0 A;  3ODT A;  3MUN A;  1SHY B;  2EIB A;  3MZL A;  3MUO A;  2YNN A;  3W15 A;  4J84 A;  4UM9 D;  2AGY A;  4ZOZ A;  4J87 A;  2CN3 A;  5HDB A;  3EI3 B;  3E0C A;  5FA5 B;  4G1M A;  3BG1 A;  4JSV C;  4OWR A;  4ERY A;  3PXT D;  2VDN B;  3EMH A;  4ESG A;  4NC4 A;  2AGX A;  3FM0 A;  5GSA A;  4NEN A;  2HKR A;  3I8C A;  2HYE A;  4KFM B;  1H2X A;  1E5T A;  2UZX B;  3JZN A;  2P9L C;  2VDK A;  4GGA A;  3V4V A;  4FWW A;  4GGD A;  4RE6 A;  3NID B;  3UVO A;  1TYE A;  5CXB A;  4AX4 A;  3NIG B;  2EIC A;  3NIG A;  3AL8 A;  4GQ1 A;  1PI6 A;  4Z7Q B;  5M5T A;  4JXM A;  5AMS A;  4A08 A;  2JWH A;  4BUJ C;  5K1C C;  3MMY A;  1U4C A;  1C9I A;  4CI1 A;  3IUL A;  3OKT A;  4FHL A;  3O4I A;  3ZDY A;  1MG3 A;  5AJA A;  4GGC A;  4UI9 R;  2IAA A;  2YNP A;  4J78 A;  3JRP A;  3T3P A;  1P22 A;  1JMZ B;  1JTD B;  1Q47 A;  2H6N A;  5EM2 A;  1JJU B;  4ZOV A;  4Y7R A;  3T3M B;  5CYK A;  4DNU A;  2IUQ A;  1E8N A;  5IJ7 E;  5IT9 g;  2HJ4 A;  1GOF A;  3VA6 A;  3O4H A;  3O4G A;  1GXR A;  3GD1 I;  1GOH A;  3JAM g;  4GM3 A;  4G55 A;  2VDM A;  4OZU A;  3ZDZ A;  4BP9 A;  4PC0 A;  2IWK A;  1C9L A;  4AEZ A;  3F3P A;  1N6E A;  4J0X A;  1NR0 A;  5SXM A;  4GM8 A;  2I0T A;  4PNK B;  4Z7N B;  1XIP A;  3I8E A;  3K71 A;  3JB9 L;  4K3J B;  1A12 A;  1VZ2 A;  4MMZ A;  2AH1 A;  3EI3 A;  5EAR A;  2VDO A;  3SBP A;  4AMZ A; 
#chains in the Genus database with same CATH homology
 4JT5 C;  1ERJ A;  2AGZ A;  3ZE0 B;  4J86 A;  5HYN B;  3ZDY B;  2CE9 A;  3C75 H;  4XYI A;  1FWX A;  1GP2 B;  4ERQ A;  3EI4 A;  2UZY B;  4LG9 A;  4E5Z A;  3I89 A;  4A09 B;  4A0B A;  5C9Z B;  4L3G D;  4GM9 A;  4GQ2 P;  2B4E A;  4J77 A;  2HXC A;  3RMZ D;  1SQ9 A;  3CFV A;  5CXC A;  2VDQ B;  1JMX B;  4FB1 D;  2AGL A;  2Z2N A;  3BWS A;  4J8G A;  5I5I A;  2VDO B;  2H13 A;  3SN6 B;  2XL2 A;  5C2V B;  3L4O D;  2H9L A;  4R7A B;  3DM0 A;  3FRX A;  1K8K C;  1SQJ A;  4J82 A;  3OTT A;  2OVR B;  2OJY A;  5IC7 A;  5HE1 B;  3VI3 B;  3VH0 A;  3SWS D;  4G56 B;  2I3T A;  2YMU A;  4A0B B;  3EI2 A;  3AFC A;  4CZX A;  2H3X A;  4H5I A;  3KRW B;  4E54 B;  2OK6 A;  3N0D A;  3ORV D;  5FQD A;  2J57 G;  4A11 B;  2H9M A;  3JPX A;  5TF2 A;  3C5M A;  4H5J A;  3UKR C;  3K26 A;  2XU7 A;  1TYQ C;  5FLX g;  3SJL D;  3PXS D;  1U8C B;  4ZOY A;  2IWF A;  3UVN A;  4J8B A;  4GQB B;  3I2N A;  2P26 A;  5IGQ A;  2GNQ A;  5EAM A;  3MKQ A;  2VC2 B;  3UVK A;  4JSX C;  4NSX A;  5THA A;  3U4Y A;  2OVQ B;  1XHM A;  2Z2P A;  1YUK A;  4A2M A;  4FA1 D;  3MXX A;  4FA9 D;  2P9U C;  3J81 g;  2P9N C;  3SHF A;  2I3S A;  3AH8 B;  4CZV A;  1U2V C;  5FXY A;  2W18 A;  3IJC A;  4J73 A;  4WK2 B;  3NVN A;  5FKQ A;  5CXC B;  4Z8L A;  3OKW A;  1MDA H;  2AGW A;  2Z2O A;  2B5M A;  4XEI C;  4FA4 D;  3JRO A;  4J79 A;  3GRE A;  3IJ0 A;  2PM9 A;  3MZK A;  2I0R A;  3EI1 B;  3UR4 A;  4A08 B;  4K3I D;  4CZY A;  4D0K A;  4A0A A;  2H9P A;  2H6Q A;  2GC7 A;  2B5N A;  3PVU B;  2J56 H;  4HDJ A;  4X3E A;  1K32 A;  5HE0 B;  1JOF A;  2G99 A;  3PXW D;  5B4W A;  1VYH C;  2VDP B;  5JWZ A;  2CO0 C;  3EI1 A;  4WJK B;  4CI2 A;  4O3U B;  4O3T B;  1A0R B;  5EML B;  2QC5 A;  2G9A A;  4LG8 A;  4A2L A;  5FKT A;  4GMB A;  4L3H D;  3I7L A;  3EI4 B;  3EG6 A;  3GFC A;  4UM8 B;  3KRX B;  4CY3 A;  3JZG A;  4FAV D;  3SLE D;  2IUR A;  3OL2 B;  4O45 A;  4QQE A;  3PVW B;  1XKS A;  4UM9 B;  2OIZ A;  2VDL B;  4FA5 D;  3ZE1 B;  2CN2 A;  4A7J A;  5I5J A;  4X61 B;  2IUV A;  4ERZ A;  3C99 A;  4ZOX A;  4J81 A;  3UKU C;  2GC4 A;  2HJB A;  3I7P A;  4JSP C;  4JSN C;  5EMK B;  3OW8 A;  3PSL A;  5A2Q g;  2O9K A;  2JWG A;  3AL9 A;  3RRM C;  5HE3 B;  3I7K A;  2PM9 B;  5TEF A;  3EWE A;  1GG2 B;  2H9N A;  5FKR A;  2VDR B;  5KDO B;  3ZE2 B;  4EWR A;  4YVD A;  5EAP A;  4PXW A;  1OLZ A;  2YNO A;  4O9D A;  4X63 B;  5HDB B;  4JT6 C;  5GXH A;  3DWL C;  5E6R B;  3K27 A;  3RFG A;  2XL3 A;  3FGB A;  3MKS B;  2PM6 B;  3V9F A;  4BL0 A;  4BH6 A;  3I7H A;  1PBY B;  2EBS A;  4CY2 A;  2QXV A;  2H68 A;  5IGO A;  1PGU A;  3DSM A;  1YFQ A;  4N14 A;  5GXI A;  3FCU B;  1B9Y A;  5HQG A;  4WK4 B;  3IJ1 A;  3I7O A;  4GZ8 A;  2XYI A;  3SXT D;  1SSL A;  5H1M A;  3RFH A;  1PEV A;  4CI3 A;  3OKY A;  4U7A A;  3VI4 B;  3ZWL B;  4D6V A;  3VGZ A;  3CFS B;  4QL1 A;  4XYH A;  5I5M A;  1TBG A;  3P4F A;  4QT8 A;  2OVP B;  3OL2 A;  3T3P B;  4X60 B;  3C9C A;  2H14 A;  3IKO A;  3OKY B;  5EM2 B;  4J0W A;  3HFQ A;  3V5W B;  4A11 A;  3F3G A;  4MK0 B;  4Y5R D;  4CY1 A;  3JZH A;  2B5L A;  5EMJ B;  4ZN4 A;  3EI2 B;  3B7F A;  4A09 A;  3SMR A;  3SVW D;  3V7D B;  3NVX A;  1MG2 A;  4WK0 B;  2BCJ B;  3UVM A;  2YBA A;  2I0S A;  2J55 H;  5CYK B;  4PSX B;  2PBI B;  3SBQ A;  4ES0 A;  1GOT B;  3BG0 A;  1R5M A;  5CXB B;  3IIW A;  5C2W B;  3F3F A;  3ULE C;  3RSE C;  2TRC B;  4O1Q D;  1RI6 A;  5HE2 B;  2VDK B;  4CI8 A;  2PM7 B;  3PSC B;  4E54 A;  2CO0 A;  4PBZ A;  4CY5 A;  5E6U B;  4QRJ A;  1NEX B;  5EAL A;  5FKS A;  5E6S B;  4U1E I;  2HKM A;  4IA9 A;  5TEE A;  1N6D A;  2CE8 A;  5IJ8 E;  4PSW B;  3IIY A;  3RLM D;  5H14 A;  4FAN D;  2HES X;  3AL8 B;  2P28 A;  4JD2 C;  2P9P C;  4Z7O B;  2MTA H;  2Q7Q A;  5EMM B;  4PBY A;  2P9K C;  3CIK B;  4E5Z B;  2AQ5 A;  3EU7 A;  4IMM A;  2P9I C;  3J80 g;  2CNX A;  2H47 A;  1OMW B;  4TZ4 A;  3SFZ A;  3RN0 D;  1TYE B;  2IUP A;  3SBR A;  4I79 A;  4A0A B;  1L0Q A;  4L9O A;  3ZDX B;  3A0F A;  3PE7 A;  3NIF B;  5H17 A;  1B9X A;  3N0E A;  2P9S C;  3NVQ A;  4LGN A;  1S4U X;  2H6K A;  4CC9 A;  3UVL A;  4AOW A;  2VDM B;  3ZDZ B;  3DXK C;  5K19 A;  4L1Q D;  2BBK H;  2OK4 A;  1N6F A;  2YB8 B;  3I7N A;  3L4M D;  3RN1 D;  5GMK n;  3DXM C;  3SCY A;  1QNI A;  5TDH B;  5AFU 3;  2AH0 A;  3ODT A;  1SHY B;  3MZL A;  2YNN A;  3W15 A;  4J84 A;  4UM9 D;  2AGY A;  4ZOZ A;  4J87 A;  2CN3 A;  3EI3 B;  3E0C A;  5FA5 B;  3BG1 A;  4JSV C;  4OWR A;  4ERY A;  3PXT D;  2VDN B;  3EMH A;  4ESG A;  2AGX A;  3FM0 A;  5GSA A;  2HKR A;  3I8C A;  2HYE A;  4KFM B;  2UZX B;  3JZN A;  2P9L C;  4GGA A;  4FWW A;  4GGD A;  3NID B;  3UVO A;  5CXB A;  3NIG B;  3AL8 A;  4GQ1 A;  1PI6 A;  4Z7Q B;  4JXM A;  5AMS A;  4A08 A;  2JWH A;  4BUJ C;  5K1C C;  3MMY A;  1U4C A;  4CI1 A;  3OKT A;  4FHL A;  1MG3 A;  5AJA A;  4GGC A;  4UI9 R;  2IAA A;  2YNP A;  4J78 A;  3JRP A;  1P22 A;  1JMZ B;  5EM2 A;  1Q47 A;  2H6N A;  1JJU B;  4ZOV A;  4Y7R A;  3T3M B;  5CYK A;  2IUQ A;  5IJ7 E;  5IT9 g;  2HJ4 A;  3VA6 A;  1GXR A;  3JAM g;  4GM3 A;  4OZU A;  4PC0 A;  2IWK A;  4AEZ A;  3F3P A;  1N6E A;  4J0X A;  1NR0 A;  5SXM A;  4GM8 A;  2I0T A;  4PNK B;  4Z7N B;  1XIP A;  3I8E A;  3JB9 L;  4K3J B;  2AH1 A;  3EI3 A;  5EAR A;  3SBP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...