3AL8A

Plexin a2 / semaphorin 6a complex
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
550
structure length
537
Chain Sequence
b'GFPEDSEPISITKQYPVFVGHRHRLDIQMIMIMNRTLYVAARDHIYTVDIDTSHTEEIYCSKKLTWKSRQADVDTCRMKGKHKDECHNFIKVLLKKNDDTLFVCGTNAFNPSCRNYRVDTLETFGDEFSGMARCPYDAKHANIALFADGKLYSATVTDFLAIDAVIYRSLGDSPTLRTVKHDSKWLKEPYFVQAVDYGDYIYFFFREIAVEYNTMGKVVFPRVAQVCKNDMGGSQRVLEKQWTSFLKARLNCSVPGDSHFYFNILQAVTDVIRINGRDVVLATFSTPYNSIPGSAVCAYDMLDIANVFTGRFKEQKSPDSTWTPVPDERVPKPRPGCCAGSSSLEKYATSNEFPDDTLNFIKTHPLMDEAVPSIINRPWFLRTMVRYRLTKIAVDNAAGPYQNHTVVFLGSEKGIILKFLARIGSSGFLNGSLFLEEMNVYNPEKCSYDGVEDKRIMGMQLDRASGSLYVAFSTCVIKVPLGRCERHGKCKKTCIASRDPYCGWVRESGSCAHLSPLSRLTFEQDIERGNTDGLGDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Semaphorin-6A
publication title Structural basis for semaphorin signalling through the plexin receptor.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 111
structure length 537
sequence length 550
ec nomenclature
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01403 Sema Sema domain
A PF01437 PSI Plexin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3al8A01
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3al8A02
3AL8A 3PVWB 4FA9D 3V5WB 2CNXA 4G56B 3A0FA 2YNPA 5GMKn 4YVDA 4CZVA 3IKOA 3NVQA 3BG1A 3V7DB 4QL1A 4CC9A 2UZYB 3EU7A 3ODTA 4JT5C 4PSXB 3I89A 3AL9A 5C2WB 3J80g 2P9SC 3UVKA 4U1EI 5FKQA 2XL3A 4J0XA 4LGNA 3JPXA 2P28A 5CXBB 3I7OA 4GQ2P 3SWSD 3ZE2B 2IAAA 5AMSA 2VDKB 2OK4A 2I3SA 2B5MA 3OKYA 5KDOB 4CI3A 2OVRB 3CFVA 3GREA 4ZOYA 5FLXg 5E6UB 3C9CA 3AL8B 2IUVA 1TBGA 2H9LA 3RFGA 1NEXB 2BCJB 4NSXA 3L4MD 3RN0D 3UVLA 4AOWA 5AJAA 1U4CA 2O9KA 1YFQA 1TYEB 3JZGA 2VDMB 2H6KA 2P9PC 5HE2B 3RFHA 3B7FA 4FB1D 3PSLA 3VI3B 5K1CC 2HKMA 3NIDB 5IJ7E 3AH8B 1S4UX 2Z2OA 4Z7NB 4FWWA 2CN3A 4PBYA 3N0DA 3SN6B 3JB9L 3OKTA 2H9MA 4I79A 2IWKA 1R5MA 2CO0A 4XYHA 1PGUA 2OIZA 3RN1D 4FA1D 5E6SB 5FKRA 4L1QD 2W18A 2AGWA 3MXXA 4JSNC 4K3ID 4J0WA 3ZDYB 3SLED 3ZWLB 5EMMB 4CZXA 2P9NC 2VDPB 4GMBA 1JMZB 4X60B 3UR4A 3OKYB 2AH1A 3OKWA 4Z7OB 1JJUB 2PM7B 3L4OD 2I0TA 3EWEA 3F3GA 3SVWD 4GM3A 4EWRA 2PM9A 4J82A 1PBYB 2HESX 2CE8A 2YBAA 2CE9A 1JMXB 2GNQA 3IJ0A 2CO0C 2YNNA 3I7HA 3EI2B 4AEZA 4CY3A 3RLMD 1PI6A 2YNOA 3JZNA 3EI3A 5TDHB 4Z8LA 4A0BA 3DWLC 4FHLA 4QT8A 3IJCA 4N14A 4UI9R 2I0RA 3GFCA 5TF2A 2IUQA 3UKUC 4E54A 2AGZA 4A11B 2H13A 4E5ZA 3IJ1A 3PE7A 1TYQC 4A0AB 1GOTB 4O45A 4J87A 2CN2A 4HDJA 2HJBA 2J57G 1ERJA 4TZ4A 4WK2B 2XL2A 3MKQA 3F3PA 3CIKB 2H3XA 2H6QA 1P22A 2PM9B 1N6DA 2VDRB 4D6VA 5IGQA 1VYHC 2AGLA 3VH0A 3SMRA 1QNIA 3DXMC 5FA5B 1K8KC 4X61B 1MDAH 3EI3B 2HKRA 2QXVA 3I7NA 4A0BB 3NIFB 4O9DA 4OZUA 3PSCB 3K27A 3V9FA 1OMWB 3AFCA 4L9OA 3CFSB 1SQ9A 3MZLA 3JZHA 2VDOB 2OVQB 1MG2A 4E54B 3I8EA 4Y5RD 2VC2B 3EI2A 4E5ZB 3FRXA 3SJLD 2HJ4A 3C99A 4GGCA 2H14A 3NIGB 3FCUB 3SXTD 4ERZA 2Q7QA 2H47A 4O3TB 4GM8A 1XIPA 2YB8B 2VDNB 3VA6A 5TEEA 4CY2A 4UM9B 4WK0B 5EM2B 3ZE1B 4A11A 4GGAA 4D0KA 3ZDXB 2EBSA 4ZN4A 3W15A 4A0AA 5E6RB 4XEIC 3K26A 3DM0A 5IT9g 5C9ZB 4J86A 2QC5A 2Z2PA 4A08B 5CYKA 4JT6C 2VDLB 5HYNB 2UZXB 4R7AB 1MG3A 2P9KC 5SXMA 3DXKC 5C2VB 4A09A 5A2Qg 4H5JA 2OK6A 3OL2A 3SCYA 4XYIA 4J8GA 4J79A 3EI4A 5AFU3 2AGXA 3C5MA 3P4FA 1FWXA 5H14A 2XU7A 4CI2A 3PXSD 4ERYA 4CI1A 5GXIA 3I8CA 3RRMC 5IJ8E 5H17A 2H9PA 4KFMB 4K3JB 4QQEA 2OVPB 4JSVC 3HFQA 3UVOA 1U2VC 4J81A 2YMUA 4J77A 1K32A 2Z2NA 4A2LA 1NR0A 4ERQA 4JD2C 3NVXA 3SFZA 4UM9D 4JSXC 2AGYA 5THAA 2AH0A 4GQBB 2J55H 5EAPA 1SQJA 4CI8A 5HQGA 5I5JA 4A7JA 1YUKA 5CYKB 4PC0A 3FGBA 4Z7QB 4WJKB 3JROA 4L3GD 4PNKB 4OWRA 3E0CA 2GC7A 3SBRA 3UVNA 1PEVA 3C75H 5FXYA 5EM2A 3EI1A 4A09B 2H68A 3IIYA 2B5LA 2B4EA 4ZOXA 3OL2B 4FA5D 3EI4B 3I7LA 5FQDA 5IGOA 2IWFA 5I5MA 2AQ5A 5H1MA 3PXWD 5FKSA 2IUPA 1GP2B 3ZE0B 3OW8A 4A08A 1OLZA 2PBIB 3IIWA 5TEFA 4X63B 1XHMA 1B9YA 3SHFA 2TRCB 3ZDZB 4L3HD 3NVNA 4JXMA 4CZYA 3PVUB 4CY5A 1L0QA 2G99A 2PM6B 3BWSA 3T3PB 3U4YA 4LG8A 3ORVD 4H5IA 2I0SA 4PSWB 3SBPA 4JSPC 3SBQA 5HE1B 2BBKH 1A0RB 5CXCB 4O1QD 3KRWB 5EALA 5HE0B 3JRPA 5EARA 3RSEC 3EG6A 1XKSA 3OTTA 5IC7A 4J84A 5B4WA 3MZKA 5K19A 3MMYA 5JWZA 3RMZD 4PBZA 4PXWA 4UM8B 2P9UC 3I7KA 1RI6A 2P26A 3EMHA 3JAMg 3EI1B 4GQ1A 5EMKB 5I5IA 4U7AA 4GM9A 4Y7RA 1SHYB 2GC4A 2H6NA 4J78A 3FM0A 3I7PA 3MKSB 3UVMA 4ESGA 1U8CB 4FA4D 5GSAA 3J81g 2H9NA 1GG2B 4J73A 5EMLB 2VDQB 4ES0A 4A2MA 3ULEC 4CY1A 2MTAH 3PXTD 3BG0A 5FKTA 4QRJA 4BUJC 5EAMA 1N6EA 1JOFA 1B9XA 3I2NA 2P9IC 4IA9A 4FAVD 4FAND 1Q47A 2J56H 4ZOVA 4WK4B 4BH6A 3VI4B 2IURA 3DSMA 4GGDA 4X3EA 2XYIA 4GZ8A 5CXBA 3T3MB 4J8BA 3UKRC 5HDBB 2I3TA 3F3FA 1SSLA 1GXRA 4MK0B 2B5NA 4BL0A 3VGZA 2G9AA 1N6FA 5HE3B 2OJYA 3KRXB 2HYEA 4O3UB 5EMJB 5CXCA 2P9LC 3N0EA 4LG9A 5GXHA 2HXCA 4ZOZA 4IMMA
chains in the Genus database with same CATH superfamily
3AL8A 3PVWB 4FA9D 3V5WB 2CNXA 4G55A 4G56B 3A0FA 1BPOA 2YNPA 4NC4A 4UM8A 5GMKn 4YVDA 1TYEA 4CZVA 3IKOA 3NVQA 2WQ8A 4MMYA 3BG1A 3V7DB 2VDMA 4QL1A 4CC9A 2UZYB 3EU7A 3ODTA 4JT5C 4MMZA 4PSXB 3VI3A 4AX4A 5C92A 3I89A 3NIDA 3AL9A 4AMYA 5C2WB 3IJEA 3J80g 2P9SC 1GOFA 4Z7NA 3UVKA 4U1EI 5FKQA 2XL3A 4NENA 4J0XA 4LGNA 3JPXA 2P28A 5CXBB 3I7OA 4GQ2P 3SWSD 2EICA 3ZE2B 2IAAA 5AMSA 2VDKB 2VDPA 2OK4A 2I3SA 2B5MA 3OKYA 4Z7OA 5KDOB 4CI3A 2OVRB 3CFVA 3GREA 4ZOYA 4NBMA 5FLXg 4WK4A 1E5TA 3VI4A 3C9CA 5E6UB 3AL8B 2IUVA 4O02A 1TBGA 4BCCA 5HDBA 2H9LA 3RFGA 1NEXB 2BCJB 4NSXA 3L4MD 3RN0D 5M5UA 3OF7A 3UVLA 4AOWA 5AJAA 1U4CA 2O9KA 1YFQA 1TYEB 3JZGA 3MUNA 2XDWA 2VDMB 2H6KA 2P9PC 5HE2B 3RFHA 1K3IA 3B7FA 1O6FA 4FB1D 3QI0A 1E8MA 3PSLA 3VI3B 5K1CC 2HKMA 3NIDB 3KCIA 3GD1I 5IJ7E 3AH8B 1S4UX 2Z2OA 4MMXA 4FWWA 4Z7NB 2CN3A 4PBYA 3N0DA 3SN6B 3JB9L 3OKTA 2H9MA 4I79A 2IWKA 1R5MA 2CO0A 4XYHA 1QFSA 3K72A 1PGUA 1I2MB 2OIZA 3RN1D 4FA1D 5E6SB 5FKRA 4L1QD 2W18A 2AGWA 3MXXA 4JSNC 4K3ID 4J0WA 4O2WA 3SLED 3ZDYB 5M5TA 3ZWLB 5EMMB 4CZXA 2P9NC 2VDPB 4GMBA 1JMZB 4X60B 3UR4A 2QZPA 2AH1A 3OKWA 3OKYB 1UOOA 1JJUB 4Z7OB 2PM7B 3L4OD 2I0TA 3EWEA 3F3GA 5C86A 3SVWD 4GM3A 4EWRA 1H2YA 2PM9A 1PBYB 4J82A 2HESX 2BKLA 2CE8A 3ZE2A 4AN0A 1YR2A 1T2XA 2YBAA 2CE9A 1JMXB 2GNQA 2VDKA 3IJ0A 2CO0C 2YNNA 3I7HA 3EI2B 4AEZA 4CY3A 3RLMD 1PI6A 2YNOA 3JZNA 3EI3A 2JWGA 1L5GA 4NAAA 5TDHB 1C9IA 4Z8LA 4A0BA 3DWLC 2XZGA 4FHLA 1H2WA 4QT8A 3IJCA 4N14A 2QR5A 4UI9R 2I0RA 3GFCA 5TF2A 2VDOA 2IUQA 3UKUC 4E54A 2AGZA 1UTCA 2JWHA 4A11B 2H13A 4E5ZA 3IJ1A 3PE7A 1TYQC 4A0AB 1GOTB 4O45A 4J87A 3FCUA 2CN2A 4HDJA 1JTDB 2HJBA 2J57G 5M5SA 1ERJA 4TZ4A 4WK2B 2XL2A 3MKQA 5M5RA 3F3PA 3DDUA 4AN1A 3CIKB 2H3XA 2H6QA 1P22A 5E6SA 2PM9B 3ZE1A 1N6DA 2VDRB 4D6VA 3ZDXA 3ZDYA 5IGQA 1VYHC 2AGLA 3VH0A 1O6GA 4D9SA 3SMRA 1QNIA 3DXMC 4RE6A 5FA5B 2VDLA 4JHNA 1K8KC 4X61B 1MDAH 3EI3B 2HKRA 2QXVA 3I7NA 4A0BB 3NIFB 4O9DA 3PSCB 4OZUA 3K27A 3V9FA 1OMWB 3AFCA 4L9OA 3CFSB 1SQ9A 3MZLA 4G1EA 3IURA 3JZHA 2VDOB 2OVQB 3O4GA 1MG2A 4E54B 3I8EA 4Y5RD 2VC2B 3MVDK 3EI2A 4E5ZB 3FRXA 3SJLD 2HJ4A 3C99A 3IUMA 4GGCA 2H14A 3NIGB 5M61A 3FCUB 3SXTD 4ERZA 2Q7QA 2H47A 2HU7A 4O3TB 2JKXA 4GM8A 1XIPA 2YB8B 2VDNB 3VA6A 5TEEA 3EQ8A 4CY2A 4UM9B 4WK0B 5EM2B 3ZE1B 4A11A 4GGAA 4D0KA 3ZDXB 2EBSA 4ZN4A 3W15A 4A0AA 5E6RB 4XEIC 3K26A 3DM0A 5IT9g 5C9ZB 4J86A 2QC5A 2Z2PA 4A08B 4G1MA 5CYKA 4JT6C 2VDLB 4Z7QA 4WJKA 5HYNB 2UZXB 4R7AB 4WK2A 1JV2A 1MG3A 1A12A 2P9KC 5SXMA 3DXKC 4DNWA 3EQ9A 5C2VB 4A09A 2VDRA 5A2Qg 4H5JA 2OK6A 3OL2A 3SCYA 4XYIA 4J8GA 4J79A 3EI4A 5AFU3 2AGXA 3C5MA 3P4FA 1H2ZA 3ZE0A 1FWXA 2VZ1A 5H14A 2XU7A 4CI2A 3PXSD 4BP8A 4ERYA 3IULA 4CI1A 5GXIA 3EQ7A 3I8CA 3RRMC 5IJ8E 3O4HA 5H17A 2H9PA 4KFMB 3NIFA 4K3JB 4QQEA 2OVPB 4JSVC 3HFQA 3T3PA 3UVOA 4RE5A 1U2VC 4J81A 2YMUA 4J77A 1K32A 2Z2NA 4JHPC 1NR0A 4A2LA 4ERQA 4JD2C 3NVXA 3SFZA 4AMZA 4UM9D 4JSXC 1E8NA 2VC2A 2AGYA 5THAA 2AH0A 4GQBB 2J55H 5EAPA 1SQJA 3NIGA 4DNUA 3QHYB 4CI8A 5HQGA 5I5JA 4A7JA 1M1XA 1VZ3A 1YUKA 5CYKB 4PC0A 3FGBA 4Z7QB 5M5VA 4WJKB 1GOHA 3JROA 4L3GD 4PNKB 2VDNA 3K71A 3E0CA 4OWRA 2GC7A 3SBRA 3UVNA 1PEVA 3C75H 5FXYA 4UM9A 4WK0A 5EM2A 3EI1A 4A09B 2H68A 3IIYA 2B5LA 2B4EA 4ZOXA 1GOGA 3OL2B 3O4JA 4FA5D 2VZ3A 5E6RA 1U8CA 3GC3B 3EI4B 3I7LA 5FQDA 5IGOA 2IWFA 5I5MA 2AQ5A 5H1MA 3PXWD 5FKSA 2IUPA 1GP2B 2EIDA 3IUQA 4BCBA 3ZE0B 3OW8A 4A08A 1OLZA 2PBIB 3IIWA 5TEFA 4X63B 1XHMA 1B9YA 3SHFA 2TRCB 3ZDZB 4L3HD 2VDQA 3NVNA 4JXMA 4CZYA 3PVUB 4CY5A 4BP9A 1QFMA 1L0QA 2G99A 2PM6B 3BWSA 3T3PB 3U4YA 4LG8A 3ORVD 4H5IA 2I0SA 4PSWB 3SBPA 4JSPC 3SBQA 2HU5A 5HE1B 2BBKH 3IUJA 1A0RB 3O4IA 5CXCB 2HU8A 4O1QD 3KRWB 5EALA 5HE0B 3JRPA 5EARA 3RSEC 3EG6A 1XKSA 3OTTA 5IC7A 4J84A 5B4WA 3T3MA 3MZKA 3V4PA 5K19A 3MMYA 5JWZA 3RMZD 4PBZA 4PXWA 4UM8B 2P9UC 3I7KA 1RI6A 2P26A 3EMHA 4IRZA 4DNVA 3JAMg 3EI1B 4GQ1A 5EMKB 5I5IA 4U7AA 4GM9A 4Y7RA 1SHYB 2GC4A 2H6NA 1VZ2A 3FM0A 3I7PA 3MKSB 4J78A 3MUOA 3UVMA 4ESGA 1U8CB 4FA4D 5GSAA 3J81g 2H9NA 5FFOA 1GG2B 2XE4A 3FCSA 4J73A 4QAMA 5EMLB 3K6SA 2VDQB 4ES0A 4A2MA 3ULEC 4CY1A 2MTAH 3PXTD 3V4VA 4BCDA 3BG0A 1UOQA 3IVMA 5FKTA 4QRJA 1VE6A 4BUJC 5EAMA 1N6EA 1JOFA 1B9XA 1UOPA 3I2NA 2P9IC 4IA9A 4FAVD 4FAND 1Q47A 2J56H 3IUNA 1C9LA 4ZOVA 4L1MA 4WK4B 4BH6A 3VI4B 2IURA 3DSMA 1H2XA 4GGDA 4X3EA 3ZDZA 2XYIA 4GZ8A 5CXBA 3T3MB 4J8BA 3UKRC 5HDBB 2EIEA 2I3TA 3F3FA 1SSLA 1GXRA 4MK0B 2B5NA 4BL0A 3VGZA 2EIBA 2G9AA 1N6FA 5HE3B 2OJYA 3KRXB 2HYEA 4O3UB 5EMJB 5CXCA 2P9LC 3N0EA 1VE7A 4LG9A 5GXHA 2HXCA 4ZOZA 4IMMA 5FFGA 5E6UA
chains in the Genus database with same CATH topology
3AL8A 3PVWB 4FA9D 3V5WB 2CNXA 4G56B 3A0FA 2YNPA 5GMKn 4YVDA 4CZVA 3IKOA 3NVQA 3BG1A 3V7DB 4QL1A 4CC9A 2UZYB 3EU7A 3ODTA 4JT5C 4PSXB 3I89A 3AL9A 5C2WB 3J80g 2P9SC 3UVKA 4U1EI 5FKQA 2XL3A 4J0XA 4LGNA 3JPXA 2P28A 5CXBB 3I7OA 4GQ2P 3SWSD 3ZE2B 2IAAA 5AMSA 2VDKB 2OK4A 2I3SA 2B5MA 3OKYA 5KDOB 4CI3A 2OVRB 3CFVA 3GREA 4ZOYA 5FLXg 5E6UB 3C9CA 3AL8B 2IUVA 1TBGA 2H9LA 3RFGA 1NEXB 2BCJB 4NSXA 3L4MD 3RN0D 3UVLA 4AOWA 5AJAA 1U4CA 2O9KA 1YFQA 1TYEB 3JZGA 2VDMB 2H6KA 2P9PC 5HE2B 3RFHA 3B7FA 4FB1D 3PSLA 3VI3B 5K1CC 2HKMA 3NIDB 5IJ7E 3AH8B 1S4UX 2Z2OA 4Z7NB 4FWWA 2CN3A 4PBYA 3N0DA 3SN6B 3JB9L 3OKTA 2H9MA 4I79A 2IWKA 1R5MA 2CO0A 4XYHA 1PGUA 2OIZA 3RN1D 4FA1D 5E6SB 5FKRA 4L1QD 2W18A 2AGWA 3MXXA 4JSNC 4K3ID 4J0WA 3ZDYB 3SLED 3ZWLB 5EMMB 4CZXA 2P9NC 2VDPB 4GMBA 1JMZB 4X60B 3UR4A 3OKYB 2AH1A 3OKWA 4Z7OB 1JJUB 2PM7B 3L4OD 2I0TA 3EWEA 3F3GA 3SVWD 4GM3A 4EWRA 2PM9A 4J82A 1PBYB 2HESX 2CE8A 2YBAA 2CE9A 1JMXB 2GNQA 3IJ0A 2CO0C 2YNNA 3I7HA 3EI2B 4AEZA 4CY3A 3RLMD 1PI6A 2YNOA 3JZNA 3EI3A 2JWGA 5TDHB 4Z8LA 4A0BA 3DWLC 4FHLA 4QT8A 3IJCA 4N14A 4UI9R 2I0RA 3GFCA 5TF2A 2IUQA 3UKUC 4E54A 2AGZA 2JWHA 4A11B 2H13A 4E5ZA 3IJ1A 3PE7A 1TYQC 4A0AB 1GOTB 4O45A 4J87A 2CN2A 4HDJA 2HJBA 2J57G 1ERJA 4TZ4A 4WK2B 2XL2A 3MKQA 3F3PA 3CIKB 2H3XA 2H6QA 1P22A 2PM9B 1N6DA 2VDRB 4D6VA 5IGQA 1VYHC 2AGLA 3VH0A 3SMRA 1QNIA 3DXMC 5FA5B 1K8KC 4X61B 1MDAH 3EI3B 2HKRA 2QXVA 3I7NA 4A0BB 3NIFB 4O9DA 4OZUA 3PSCB 3K27A 3V9FA 1OMWB 3AFCA 4L9OA 3CFSB 1SQ9A 3MZLA 3JZHA 2VDOB 2OVQB 1MG2A 4E54B 3I8EA 4Y5RD 2VC2B 3EI2A 4E5ZB 3FRXA 3SJLD 2HJ4A 3C99A 4GGCA 2H14A 3NIGB 3FCUB 3SXTD 4ERZA 2Q7QA 2H47A 4O3TB 4GM8A 1XIPA 2YB8B 2VDNB 3VA6A 5TEEA 4CY2A 4UM9B 4WK0B 5EM2B 3ZE1B 4A11A 4GGAA 4D0KA 3ZDXB 2EBSA 4ZN4A 3W15A 4A0AA 5E6RB 4XEIC 3K26A 3DM0A 5IT9g 5C9ZB 4J86A 2QC5A 2Z2PA 4A08B 5CYKA 4JT6C 2VDLB 5HYNB 2UZXB 4R7AB 1MG3A 2P9KC 5SXMA 3DXKC 5C2VB 4A09A 5A2Qg 4H5JA 2OK6A 3OL2A 3SCYA 4XYIA 4J8GA 4J79A 3EI4A 5AFU3 2AGXA 3C5MA 3P4FA 1FWXA 5H14A 2XU7A 4CI2A 3PXSD 4ERYA 4CI1A 5GXIA 3I8CA 3RRMC 5IJ8E 5H17A 2H9PA 4KFMB 4K3JB 4QQEA 2OVPB 4JSVC 3HFQA 3UVOA 1U2VC 4J81A 2YMUA 4J77A 1K32A 2Z2NA 4A2LA 1NR0A 4ERQA 4JD2C 3NVXA 3SFZA 4UM9D 4JSXC 2AGYA 5THAA 2AH0A 4GQBB 2J55H 5EAPA 1SQJA 4CI8A 5HQGA 5I5JA 4A7JA 1YUKA 5CYKB 4PC0A 3FGBA 4Z7QB 4WJKB 3JROA 4L3GD 4PNKB 4OWRA 3E0CA 2GC7A 3SBRA 3UVNA 1PEVA 3C75H 5FXYA 5EM2A 3EI1A 4A09B 2H68A 3IIYA 2B5LA 2B4EA 4ZOXA 3OL2B 4FA5D 3EI4B 3I7LA 5FQDA 5IGOA 2IWFA 5I5MA 2AQ5A 5H1MA 3PXWD 5FKSA 2IUPA 1GP2B 3ZE0B 3OW8A 4A08A 1OLZA 2PBIB 3IIWA 5TEFA 4X63B 1XHMA 1B9YA 3SHFA 2TRCB 3ZDZB 4L3HD 3NVNA 4JXMA 4CZYA 3PVUB 4CY5A 1L0QA 2G99A 2PM6B 3BWSA 3T3PB 3U4YA 4LG8A 3ORVD 4H5IA 2I0SA 4PSWB 3SBPA 4JSPC 3SBQA 5HE1B 2BBKH 1A0RB 5CXCB 4O1QD 3KRWB 5EALA 5HE0B 3JRPA 5EARA 3RSEC 3EG6A 1XKSA 3OTTA 5IC7A 4J84A 5B4WA 3MZKA 5K19A 3MMYA 5JWZA 3RMZD 4PBZA 4PXWA 4UM8B 2P9UC 3I7KA 1RI6A 2P26A 3EMHA 3JAMg 3EI1B 4GQ1A 5EMKB 5I5IA 4U7AA 4GM9A 4Y7RA 1SHYB 2GC4A 2H6NA 4J78A 3FM0A 3I7PA 3MKSB 3UVMA 4ESGA 1U8CB 4FA4D 5GSAA 3J81g 2H9NA 1GG2B 4J73A 5EMLB 2VDQB 4ES0A 4A2MA 3ULEC 4CY1A 2MTAH 3PXTD 3BG0A 5FKTA 4QRJA 4BUJC 5EAMA 1N6EA 1JOFA 1B9XA 3I2NA 2P9IC 4IA9A 4FAVD 4FAND 1Q47A 2J56H 4ZOVA 4WK4B 4BH6A 3VI4B 2IURA 3DSMA 4GGDA 4X3EA 2XYIA 4GZ8A 5CXBA 3T3MB 4J8BA 3UKRC 5HDBB 2I3TA 3F3FA 1SSLA 1GXRA 4MK0B 2B5NA 4BL0A 3VGZA 2G9AA 1N6FA 5HE3B 2OJYA 3KRXB 2HYEA 4O3UB 5EMJB 5CXCA 2P9LC 3N0EA 4LG9A 5GXHA 2HXCA 4ZOZA 4IMMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AL8 A;  3PVW B;  4FA9 D;  3V5W B;  2CNX A;  4G56 B;  3A0F A;  2YNP A;  5GMK n;  4YVD A;  4CZV A;  3IKO A;  3NVQ A;  3BG1 A;  3V7D B;  4QL1 A;  4CC9 A;  2UZY B;  3EU7 A;  3ODT A;  4JT5 C;  4PSX B;  3I89 A;  3AL9 A;  5C2W B;  3J80 g;  2P9S C;  3UVK A;  4U1E I;  5FKQ A;  2XL3 A;  4J0X A;  4LGN A;  3JPX A;  2P28 A;  5CXB B;  3I7O A;  4GQ2 P;  3SWS D;  3ZE2 B;  2IAA A;  5AMS A;  2VDK B;  2OK4 A;  2I3S A;  2B5M A;  3OKY A;  5KDO B;  4CI3 A;  2OVR B;  3CFV A;  3GRE A;  4ZOY A;  5FLX g;  5E6U B;  3C9C A;  3AL8 B;  2IUV A;  1TBG A;  2H9L A;  3RFG A;  1NEX B;  2BCJ B;  4NSX A;  3L4M D;  3RN0 D;  3UVL A;  4AOW A;  5AJA A;  1U4C A;  2O9K A;  1YFQ A;  1TYE B;  3JZG A;  2VDM B;  2H6K A;  2P9P C;  5HE2 B;  3RFH A;  3B7F A;  4FB1 D;  3PSL A;  3VI3 B;  5K1C C;  2HKM A;  3NID B;  5IJ7 E;  3AH8 B;  1S4U X;  2Z2O A;  4Z7N B;  4FWW A;  2CN3 A;  4PBY A;  3N0D A;  3SN6 B;  3JB9 L;  3OKT A;  2H9M A;  4I79 A;  2IWK A;  1R5M A;  2CO0 A;  4XYH A;  1PGU A;  2OIZ A;  3RN1 D;  4FA1 D;  5E6S B;  5FKR A;  4L1Q D;  2W18 A;  2AGW A;  3MXX A;  4JSN C;  4K3I D;  4J0W A;  3ZDY B;  3SLE D;  3ZWL B;  5EMM B;  4CZX A;  2P9N C;  2VDP B;  4GMB A;  1JMZ B;  4X60 B;  3UR4 A;  3OKY B;  2AH1 A;  3OKW A;  4Z7O B;  1JJU B;  2PM7 B;  3L4O D;  2I0T A;  3EWE A;  3F3G A;  3SVW D;  4GM3 A;  4EWR A;  2PM9 A;  4J82 A;  1PBY B;  2HES X;  2CE8 A;  2YBA A;  2CE9 A;  1JMX B;  2GNQ A;  3IJ0 A;  2CO0 C;  2YNN A;  3I7H A;  3EI2 B;  4AEZ A;  4CY3 A;  3RLM D;  1PI6 A;  2YNO A;  3JZN A;  3EI3 A;  5TDH B;  4Z8L A;  4A0B A;  3DWL C;  4FHL A;  4QT8 A;  3IJC A;  4N14 A;  4UI9 R;  2I0R A;  3GFC A;  5TF2 A;  2IUQ A;  3UKU C;  4E54 A;  2AGZ A;  4A11 B;  2H13 A;  4E5Z A;  3IJ1 A;  3PE7 A;  1TYQ C;  4A0A B;  1GOT B;  4O45 A;  4J87 A;  2CN2 A;  4HDJ A;  2HJB A;  2J57 G;  1ERJ A;  4TZ4 A;  4WK2 B;  2XL2 A;  3MKQ A;  3F3P A;  3CIK B;  2H3X A;  2H6Q A;  1P22 A;  2PM9 B;  1N6D A;  2VDR B;  4D6V A;  5IGQ A;  1VYH C;  2AGL A;  3VH0 A;  3SMR A;  1QNI A;  3DXM C;  5FA5 B;  1K8K C;  4X61 B;  1MDA H;  3EI3 B;  2HKR A;  2QXV A;  3I7N A;  4A0B B;  3NIF B;  4O9D A;  4OZU A;  3PSC B;  3K27 A;  3V9F A;  1OMW B;  3AFC A;  4L9O A;  3CFS B;  1SQ9 A;  3MZL A;  3JZH A;  2VDO B;  2OVQ B;  1MG2 A;  4E54 B;  3I8E A;  4Y5R D;  2VC2 B;  3EI2 A;  4E5Z B;  3FRX A;  3SJL D;  2HJ4 A;  3C99 A;  4GGC A;  2H14 A;  3NIG B;  3FCU B;  3SXT D;  4ERZ A;  2Q7Q A;  2H47 A;  4O3T B;  4GM8 A;  1XIP A;  2YB8 B;  2VDN B;  3VA6 A;  5TEE A;  4CY2 A;  4UM9 B;  4WK0 B;  5EM2 B;  3ZE1 B;  4A11 A;  4GGA A;  4D0K A;  3ZDX B;  2EBS A;  4ZN4 A;  3W15 A;  4A0A A;  5E6R B;  4XEI C;  3K26 A;  3DM0 A;  5IT9 g;  5C9Z B;  4J86 A;  2QC5 A;  2Z2P A;  4A08 B;  5CYK A;  4JT6 C;  2VDL B;  5HYN B;  2UZX B;  4R7A B;  1MG3 A;  2P9K C;  5SXM A;  3DXK C;  5C2V B;  4A09 A;  5A2Q g;  4H5J A;  2OK6 A;  3OL2 A;  3SCY A;  4XYI A;  4J8G A;  4J79 A;  3EI4 A;  5AFU 3;  2AGX A;  3C5M A;  3P4F A;  1FWX A;  5H14 A;  2XU7 A;  4CI2 A;  3PXS D;  4ERY A;  4CI1 A;  5GXI A;  3I8C A;  3RRM C;  5IJ8 E;  5H17 A;  2H9P A;  4KFM B;  4K3J B;  4QQE A;  2OVP B;  4JSV C;  3HFQ A;  3UVO A;  1U2V C;  4J81 A;  2YMU A;  4J77 A;  1K32 A;  2Z2N A;  4A2L A;  1NR0 A;  4ERQ A;  4JD2 C;  3NVX A;  3SFZ A;  4UM9 D;  4JSX C;  2AGY A;  5THA A;  2AH0 A;  4GQB B;  2J55 H;  5EAP A;  1SQJ A;  4CI8 A;  5HQG A;  5I5J A;  4A7J A;  1YUK A;  5CYK B;  4PC0 A;  3FGB A;  4Z7Q B;  4WJK B;  3JRO A;  4L3G D;  4PNK B;  4OWR A;  3E0C A;  2GC7 A;  3SBR A;  3UVN A;  1PEV A;  3C75 H;  5FXY A;  5EM2 A;  3EI1 A;  4A09 B;  2H68 A;  3IIY A;  2B5L A;  2B4E A;  4ZOX A;  3OL2 B;  4FA5 D;  3EI4 B;  3I7L A;  5FQD A;  5IGO A;  2IWF A;  5I5M A;  2AQ5 A;  5H1M A;  3PXW D;  5FKS A;  2IUP A;  1GP2 B;  3ZE0 B;  3OW8 A;  4A08 A;  1OLZ A;  2PBI B;  3IIW A;  5TEF A;  4X63 B;  1XHM A;  1B9Y A;  3SHF A;  2TRC B;  3ZDZ B;  4L3H D;  3NVN A;  4JXM A;  4CZY A;  3PVU B;  4CY5 A;  1L0Q A;  2G99 A;  2PM6 B;  3BWS A;  3T3P B;  3U4Y A;  4LG8 A;  3ORV D;  4H5I A;  2I0S A;  4PSW B;  3SBP A;  4JSP C;  3SBQ A;  5HE1 B;  2BBK H;  1A0R B;  5CXC B;  4O1Q D;  3KRW B;  5EAL A;  5HE0 B;  3JRP A;  5EAR A;  3RSE C;  3EG6 A;  1XKS A;  3OTT A;  5IC7 A;  4J84 A;  5B4W A;  3MZK A;  5K19 A;  3MMY A;  5JWZ A;  3RMZ D;  4PBZ A;  4PXW A;  4UM8 B;  2P9U C;  3I7K A;  1RI6 A;  2P26 A;  3EMH A;  3JAM g;  3EI1 B;  4GQ1 A;  5EMK B;  5I5I A;  4U7A A;  4GM9 A;  4Y7R A;  1SHY B;  2GC4 A;  2H6N A;  4J78 A;  3FM0 A;  3I7P A;  3MKS B;  3UVM A;  4ESG A;  1U8C B;  4FA4 D;  5GSA A;  3J81 g;  2H9N A;  1GG2 B;  4J73 A;  5EML B;  2VDQ B;  4ES0 A;  4A2M A;  3ULE C;  4CY1 A;  2MTA H;  3PXT D;  3BG0 A;  5FKT A;  4QRJ A;  4BUJ C;  5EAM A;  1N6E A;  1JOF A;  1B9X A;  3I2N A;  2P9I C;  4IA9 A;  4FAV D;  4FAN D;  1Q47 A;  2J56 H;  4ZOV A;  4WK4 B;  4BH6 A;  3VI4 B;  2IUR A;  3DSM A;  4GGD A;  4X3E A;  2XYI A;  4GZ8 A;  5CXB A;  3T3M B;  4J8B A;  3UKR C;  5HDB B;  2I3T A;  3F3F A;  1SSL A;  1GXR A;  4MK0 B;  2B5N A;  4BL0 A;  3VGZ A;  2G9A A;  1N6F A;  5HE3 B;  2OJY A;  3KRX B;  2HYE A;  4O3U B;  5EMJ B;  5CXC A;  2P9L C;  3N0E A;  4LG9 A;  5GXH A;  2HXC A;  4ZOZ A;  4IMM A; 
#chains in the Genus database with same CATH topology
 3AL8 A;  3PVW B;  4FA9 D;  3V5W B;  2CNX A;  4G55 A;  4G56 B;  3A0F A;  1BPO A;  2YNP A;  4NC4 A;  4UM8 A;  5GMK n;  4YVD A;  1TYE A;  4CZV A;  3IKO A;  3NVQ A;  2WQ8 A;  4MMY A;  3BG1 A;  3V7D B;  2VDM A;  4QL1 A;  4CC9 A;  2UZY B;  3EU7 A;  3ODT A;  4JT5 C;  4MMZ A;  4PSX B;  3VI3 A;  4AX4 A;  5C92 A;  3I89 A;  3NID A;  3AL9 A;  4AMY A;  5C2W B;  3IJE A;  3J80 g;  2P9S C;  1GOF A;  4Z7N A;  3UVK A;  4U1E I;  5FKQ A;  2XL3 A;  4NEN A;  4J0X A;  4LGN A;  3JPX A;  2P28 A;  5CXB B;  3I7O A;  4GQ2 P;  3SWS D;  2EIC A;  3ZE2 B;  2IAA A;  5AMS A;  2VDK B;  2VDP A;  2OK4 A;  2I3S A;  2B5M A;  3OKY A;  4Z7O A;  5KDO B;  4CI3 A;  2OVR B;  3CFV A;  3GRE A;  4ZOY A;  4NBM A;  5FLX g;  4WK4 A;  1E5T A;  3VI4 A;  3C9C A;  5E6U B;  3AL8 B;  2IUV A;  4O02 A;  1TBG A;  4BCC A;  5HDB A;  2H9L A;  3RFG A;  1NEX B;  2BCJ B;  4NSX A;  3L4M D;  3RN0 D;  5M5U A;  3OF7 A;  3UVL A;  4AOW A;  5AJA A;  1U4C A;  2O9K A;  1YFQ A;  1TYE B;  3JZG A;  3MUN A;  2XDW A;  2VDM B;  2H6K A;  2P9P C;  5HE2 B;  3RFH A;  1K3I A;  3B7F A;  1O6F A;  4FB1 D;  3QI0 A;  1E8M A;  3PSL A;  3VI3 B;  5K1C C;  2HKM A;  3NID B;  3KCI A;  3GD1 I;  5IJ7 E;  3AH8 B;  1S4U X;  2Z2O A;  4MMX A;  4FWW A;  4Z7N B;  2CN3 A;  4PBY A;  3N0D A;  3SN6 B;  3JB9 L;  3OKT A;  2H9M A;  4I79 A;  2IWK A;  1R5M A;  2CO0 A;  4XYH A;  1QFS A;  3K72 A;  1PGU A;  1I2M B;  2OIZ A;  3RN1 D;  4FA1 D;  5E6S B;  5FKR A;  4L1Q D;  2W18 A;  2AGW A;  3MXX A;  4JSN C;  4K3I D;  4J0W A;  4O2W A;  3SLE D;  3ZDY B;  5M5T A;  3ZWL B;  5EMM B;  4CZX A;  2P9N C;  2VDP B;  4GMB A;  1JMZ B;  4X60 B;  3UR4 A;  2QZP A;  2AH1 A;  3OKW A;  3OKY B;  1UOO A;  1JJU B;  4Z7O B;  2PM7 B;  3L4O D;  2I0T A;  3EWE A;  3F3G A;  5C86 A;  3SVW D;  4GM3 A;  4EWR A;  1H2Y A;  2PM9 A;  1PBY B;  4J82 A;  2HES X;  2BKL A;  2CE8 A;  3ZE2 A;  4AN0 A;  1YR2 A;  1T2X A;  2YBA A;  2CE9 A;  1JMX B;  2GNQ A;  2VDK A;  3IJ0 A;  2CO0 C;  2YNN A;  3I7H A;  3EI2 B;  4AEZ A;  4CY3 A;  3RLM D;  1PI6 A;  2YNO A;  3JZN A;  3EI3 A;  2JWG A;  1L5G A;  4NAA A;  5TDH B;  1C9I A;  4Z8L A;  4A0B A;  3DWL C;  2XZG A;  4FHL A;  1H2W A;  4QT8 A;  3IJC A;  4N14 A;  2QR5 A;  4UI9 R;  2I0R A;  3GFC A;  5TF2 A;  2VDO A;  2IUQ A;  3UKU C;  4E54 A;  2AGZ A;  1UTC A;  2JWH A;  4A11 B;  2H13 A;  4E5Z A;  3IJ1 A;  3PE7 A;  1TYQ C;  4A0A B;  1GOT B;  4O45 A;  4J87 A;  3FCU A;  2CN2 A;  4HDJ A;  1JTD B;  2HJB A;  2J57 G;  5M5S A;  1ERJ A;  4TZ4 A;  4WK2 B;  2XL2 A;  3MKQ A;  5M5R A;  3F3P A;  3DDU A;  4AN1 A;  3CIK B;  2H3X A;  2H6Q A;  1P22 A;  5E6S A;  2PM9 B;  3ZE1 A;  1N6D A;  2VDR B;  4D6V A;  3ZDX A;  3ZDY A;  5IGQ A;  1VYH C;  2AGL A;  3VH0 A;  1O6G A;  4D9S A;  3SMR A;  1QNI A;  3DXM C;  4RE6 A;  5FA5 B;  2VDL A;  4JHN A;  1K8K C;  4X61 B;  1MDA H;  3EI3 B;  2HKR A;  2QXV A;  3I7N A;  4A0B B;  3NIF B;  4O9D A;  3PSC B;  4OZU A;  3K27 A;  3V9F A;  1OMW B;  3AFC A;  4L9O A;  3CFS B;  1SQ9 A;  3MZL A;  4G1E A;  3IUR A;  3JZH A;  2VDO B;  2OVQ B;  3O4G A;  1MG2 A;  4E54 B;  3I8E A;  4Y5R D;  2VC2 B;  3MVD K;  3EI2 A;  4E5Z B;  3FRX A;  3SJL D;  2HJ4 A;  3C99 A;  3IUM A;  4GGC A;  2H14 A;  3NIG B;  5M61 A;  3FCU B;  3SXT D;  4ERZ A;  2Q7Q A;  2H47 A;  2HU7 A;  4O3T B;  2JKX A;  4GM8 A;  1XIP A;  2YB8 B;  2VDN B;  3VA6 A;  5TEE A;  3EQ8 A;  4CY2 A;  4UM9 B;  4WK0 B;  5EM2 B;  3ZE1 B;  4A11 A;  4GGA A;  4D0K A;  3ZDX B;  2EBS A;  4ZN4 A;  3W15 A;  4A0A A;  5E6R B;  4XEI C;  3K26 A;  3DM0 A;  5IT9 g;  5C9Z B;  4J86 A;  2QC5 A;  2Z2P A;  4A08 B;  4G1M A;  5CYK A;  4JT6 C;  2VDL B;  4Z7Q A;  4WJK A;  5HYN B;  2UZX B;  4R7A B;  4WK2 A;  1JV2 A;  1MG3 A;  1A12 A;  2P9K C;  5SXM A;  3DXK C;  4DNW A;  3EQ9 A;  5C2V B;  4A09 A;  2VDR A;  5A2Q g;  4H5J A;  2OK6 A;  3OL2 A;  3SCY A;  4XYI A;  4J8G A;  4J79 A;  3EI4 A;  5AFU 3;  2AGX A;  3C5M A;  3P4F A;  1H2Z A;  3ZE0 A;  1FWX A;  2VZ1 A;  5H14 A;  2XU7 A;  4CI2 A;  3PXS D;  4BP8 A;  4ERY A;  3IUL A;  4CI1 A;  5GXI A;  3EQ7 A;  3I8C A;  3RRM C;  5IJ8 E;  3O4H A;  5H17 A;  2H9P A;  4KFM B;  3NIF A;  4K3J B;  4QQE A;  2OVP B;  4JSV C;  3HFQ A;  3T3P A;  3UVO A;  4RE5 A;  1U2V C;  4J81 A;  2YMU A;  4J77 A;  1K32 A;  2Z2N A;  4JHP C;  1NR0 A;  4A2L A;  4ERQ A;  4JD2 C;  3NVX A;  3SFZ A;  4AMZ A;  4UM9 D;  4JSX C;  1E8N A;  2VC2 A;  2AGY A;  5THA A;  2AH0 A;  4GQB B;  2J55 H;  5EAP A;  1SQJ A;  3NIG A;  4DNU A;  3QHY B;  4CI8 A;  5HQG A;  5I5J A;  4A7J A;  1M1X A;  1VZ3 A;  1YUK A;  5CYK B;  4PC0 A;  3FGB A;  4Z7Q B;  5M5V A;  4WJK B;  1GOH A;  3JRO A;  4L3G D;  4PNK B;  2VDN A;  3K71 A;  3E0C A;  4OWR A;  2GC7 A;  3SBR A;  3UVN A;  1PEV A;  3C75 H;  5FXY A;  4UM9 A;  4WK0 A;  5EM2 A;  3EI1 A;  4A09 B;  2H68 A;  3IIY A;  2B5L A;  2B4E A;  4ZOX A;  1GOG A;  3OL2 B;  3O4J A;  4FA5 D;  2VZ3 A;  5E6R A;  1U8C A;  3GC3 B;  3EI4 B;  3I7L A;  5FQD A;  5IGO A;  2IWF A;  5I5M A;  2AQ5 A;  5H1M A;  3PXW D;  5FKS A;  2IUP A;  1GP2 B;  2EID A;  3IUQ A;  4BCB A;  3ZE0 B;  3OW8 A;  4A08 A;  1OLZ A;  2PBI B;  3IIW A;  5TEF A;  4X63 B;  1XHM A;  1B9Y A;  3SHF A;  2TRC B;  3ZDZ B;  4L3H D;  2VDQ A;  3NVN A;  4JXM A;  4CZY A;  3PVU B;  4CY5 A;  4BP9 A;  1QFM A;  1L0Q A;  2G99 A;  2PM6 B;  3BWS A;  3T3P B;  3U4Y A;  4LG8 A;  3ORV D;  4H5I A;  2I0S A;  4PSW B;  3SBP A;  4JSP C;  3SBQ A;  2HU5 A;  5HE1 B;  2BBK H;  3IUJ A;  1A0R B;  3O4I A;  5CXC B;  2HU8 A;  4O1Q D;  3KRW B;  5EAL A;  5HE0 B;  3JRP A;  5EAR A;  3RSE C;  3EG6 A;  1XKS A;  3OTT A;  5IC7 A;  4J84 A;  5B4W A;  3T3M A;  3MZK A;  3V4P A;  5K19 A;  3MMY A;  5JWZ A;  3RMZ D;  4PBZ A;  4PXW A;  4UM8 B;  2P9U C;  3I7K A;  1RI6 A;  2P26 A;  3EMH A;  4IRZ A;  4DNV A;  3JAM g;  3EI1 B;  4GQ1 A;  5EMK B;  5I5I A;  4U7A A;  4GM9 A;  4Y7R A;  1SHY B;  2GC4 A;  2H6N A;  1VZ2 A;  3FM0 A;  3I7P A;  3MKS B;  4J78 A;  3MUO A;  3UVM A;  4ESG A;  1U8C B;  4FA4 D;  5GSA A;  3J81 g;  2H9N A;  5FFO A;  1GG2 B;  2XE4 A;  3FCS A;  4J73 A;  4QAM A;  5EML B;  3K6S A;  2VDQ B;  4ES0 A;  4A2M A;  3ULE C;  4CY1 A;  2MTA H;  3PXT D;  3V4V A;  4BCD A;  3BG0 A;  1UOQ A;  3IVM A;  5FKT A;  4QRJ A;  1VE6 A;  4BUJ C;  5EAM A;  1N6E A;  1JOF A;  1B9X A;  1UOP A;  3I2N A;  2P9I C;  4IA9 A;  4FAV D;  4FAN D;  1Q47 A;  2J56 H;  3IUN A;  1C9L A;  4ZOV A;  4L1M A;  4WK4 B;  4BH6 A;  3VI4 B;  2IUR A;  3DSM A;  1H2X A;  4GGD A;  4X3E A;  3ZDZ A;  2XYI A;  4GZ8 A;  5CXB A;  3T3M B;  4J8B A;  3UKR C;  5HDB B;  2EIE A;  2I3T A;  3F3F A;  1SSL A;  1GXR A;  4MK0 B;  2B5N A;  4BL0 A;  3VGZ A;  2EIB A;  2G9A A;  1N6F A;  5HE3 B;  2OJY A;  3KRX B;  2HYE A;  4O3U B;  5EMJ B;  5CXC A;  2P9L C;  3N0E A;  1VE7 A;  4LG9 A;  5GXH A;  2HXC A;  4ZOZ A;  4IMM A;  5FFG A;  5E6U A; 
#chains in the Genus database with same CATH homology
 3AL8 A;  3PVW B;  4FA9 D;  3V5W B;  2CNX A;  4G56 B;  3A0F A;  2YNP A;  5GMK n;  4YVD A;  4CZV A;  3IKO A;  3NVQ A;  3BG1 A;  3V7D B;  4QL1 A;  4CC9 A;  2UZY B;  3EU7 A;  3ODT A;  4JT5 C;  4PSX B;  3I89 A;  3AL9 A;  5C2W B;  3J80 g;  2P9S C;  3UVK A;  4U1E I;  5FKQ A;  2XL3 A;  4J0X A;  4LGN A;  3JPX A;  2P28 A;  5CXB B;  3I7O A;  4GQ2 P;  3SWS D;  3ZE2 B;  2IAA A;  5AMS A;  2VDK B;  2OK4 A;  2I3S A;  2B5M A;  3OKY A;  5KDO B;  4CI3 A;  2OVR B;  3CFV A;  3GRE A;  4ZOY A;  5FLX g;  5E6U B;  3C9C A;  3AL8 B;  2IUV A;  1TBG A;  2H9L A;  3RFG A;  1NEX B;  2BCJ B;  4NSX A;  3L4M D;  3RN0 D;  3UVL A;  4AOW A;  5AJA A;  1U4C A;  2O9K A;  1YFQ A;  1TYE B;  3JZG A;  2VDM B;  2H6K A;  2P9P C;  5HE2 B;  3RFH A;  3B7F A;  4FB1 D;  3PSL A;  3VI3 B;  5K1C C;  2HKM A;  3NID B;  5IJ7 E;  3AH8 B;  1S4U X;  2Z2O A;  4Z7N B;  4FWW A;  2CN3 A;  4PBY A;  3N0D A;  3SN6 B;  3JB9 L;  3OKT A;  2H9M A;  4I79 A;  2IWK A;  1R5M A;  2CO0 A;  4XYH A;  1PGU A;  2OIZ A;  3RN1 D;  4FA1 D;  5E6S B;  5FKR A;  4L1Q D;  2W18 A;  2AGW A;  3MXX A;  4JSN C;  4K3I D;  4J0W A;  3ZDY B;  3SLE D;  3ZWL B;  5EMM B;  4CZX A;  2P9N C;  2VDP B;  4GMB A;  1JMZ B;  4X60 B;  3UR4 A;  3OKY B;  2AH1 A;  3OKW A;  4Z7O B;  1JJU B;  2PM7 B;  3L4O D;  2I0T A;  3EWE A;  3F3G A;  3SVW D;  4GM3 A;  4EWR A;  2PM9 A;  4J82 A;  1PBY B;  2HES X;  2CE8 A;  2YBA A;  2CE9 A;  1JMX B;  2GNQ A;  3IJ0 A;  2CO0 C;  2YNN A;  3I7H A;  3EI2 B;  4AEZ A;  4CY3 A;  3RLM D;  1PI6 A;  2YNO A;  3JZN A;  3EI3 A;  2JWG A;  5TDH B;  4Z8L A;  4A0B A;  3DWL C;  4FHL A;  4QT8 A;  3IJC A;  4N14 A;  4UI9 R;  2I0R A;  3GFC A;  5TF2 A;  2IUQ A;  3UKU C;  4E54 A;  2AGZ A;  2JWH A;  4A11 B;  2H13 A;  4E5Z A;  3IJ1 A;  3PE7 A;  1TYQ C;  4A0A B;  1GOT B;  4O45 A;  4J87 A;  2CN2 A;  4HDJ A;  2HJB A;  2J57 G;  1ERJ A;  4TZ4 A;  4WK2 B;  2XL2 A;  3MKQ A;  3F3P A;  3CIK B;  2H3X A;  2H6Q A;  1P22 A;  2PM9 B;  1N6D A;  2VDR B;  4D6V A;  5IGQ A;  1VYH C;  2AGL A;  3VH0 A;  3SMR A;  1QNI A;  3DXM C;  5FA5 B;  1K8K C;  4X61 B;  1MDA H;  3EI3 B;  2HKR A;  2QXV A;  3I7N A;  4A0B B;  3NIF B;  4O9D A;  4OZU A;  3PSC B;  3K27 A;  3V9F A;  1OMW B;  3AFC A;  4L9O A;  3CFS B;  1SQ9 A;  3MZL A;  3JZH A;  2VDO B;  2OVQ B;  1MG2 A;  4E54 B;  3I8E A;  4Y5R D;  2VC2 B;  3EI2 A;  4E5Z B;  3FRX A;  3SJL D;  2HJ4 A;  3C99 A;  4GGC A;  2H14 A;  3NIG B;  3FCU B;  3SXT D;  4ERZ A;  2Q7Q A;  2H47 A;  4O3T B;  4GM8 A;  1XIP A;  2YB8 B;  2VDN B;  3VA6 A;  5TEE A;  4CY2 A;  4UM9 B;  4WK0 B;  5EM2 B;  3ZE1 B;  4A11 A;  4GGA A;  4D0K A;  3ZDX B;  2EBS A;  4ZN4 A;  3W15 A;  4A0A A;  5E6R B;  4XEI C;  3K26 A;  3DM0 A;  5IT9 g;  5C9Z B;  4J86 A;  2QC5 A;  2Z2P A;  4A08 B;  5CYK A;  4JT6 C;  2VDL B;  5HYN B;  2UZX B;  4R7A B;  1MG3 A;  2P9K C;  5SXM A;  3DXK C;  5C2V B;  4A09 A;  5A2Q g;  4H5J A;  2OK6 A;  3OL2 A;  3SCY A;  4XYI A;  4J8G A;  4J79 A;  3EI4 A;  5AFU 3;  2AGX A;  3C5M A;  3P4F A;  1FWX A;  5H14 A;  2XU7 A;  4CI2 A;  3PXS D;  4ERY A;  4CI1 A;  5GXI A;  3I8C A;  3RRM C;  5IJ8 E;  5H17 A;  2H9P A;  4KFM B;  4K3J B;  4QQE A;  2OVP B;  4JSV C;  3HFQ A;  3UVO A;  1U2V C;  4J81 A;  2YMU A;  4J77 A;  1K32 A;  2Z2N A;  4A2L A;  1NR0 A;  4ERQ A;  4JD2 C;  3NVX A;  3SFZ A;  4UM9 D;  4JSX C;  2AGY A;  5THA A;  2AH0 A;  4GQB B;  2J55 H;  5EAP A;  1SQJ A;  4CI8 A;  5HQG A;  5I5J A;  4A7J A;  1YUK A;  5CYK B;  4PC0 A;  3FGB A;  4Z7Q B;  4WJK B;  3JRO A;  4L3G D;  4PNK B;  4OWR A;  3E0C A;  2GC7 A;  3SBR A;  3UVN A;  1PEV A;  3C75 H;  5FXY A;  5EM2 A;  3EI1 A;  4A09 B;  2H68 A;  3IIY A;  2B5L A;  2B4E A;  4ZOX A;  3OL2 B;  4FA5 D;  3EI4 B;  3I7L A;  5FQD A;  5IGO A;  2IWF A;  5I5M A;  2AQ5 A;  5H1M A;  3PXW D;  5FKS A;  2IUP A;  1GP2 B;  3ZE0 B;  3OW8 A;  4A08 A;  1OLZ A;  2PBI B;  3IIW A;  5TEF A;  4X63 B;  1XHM A;  1B9Y A;  3SHF A;  2TRC B;  3ZDZ B;  4L3H D;  3NVN A;  4JXM A;  4CZY A;  3PVU B;  4CY5 A;  1L0Q A;  2G99 A;  2PM6 B;  3BWS A;  3T3P B;  3U4Y A;  4LG8 A;  3ORV D;  4H5I A;  2I0S A;  4PSW B;  3SBP A;  4JSP C;  3SBQ A;  5HE1 B;  2BBK H;  1A0R B;  5CXC B;  4O1Q D;  3KRW B;  5EAL A;  5HE0 B;  3JRP A;  5EAR A;  3RSE C;  3EG6 A;  1XKS A;  3OTT A;  5IC7 A;  4J84 A;  5B4W A;  3MZK A;  5K19 A;  3MMY A;  5JWZ A;  3RMZ D;  4PBZ A;  4PXW A;  4UM8 B;  2P9U C;  3I7K A;  1RI6 A;  2P26 A;  3EMH A;  3JAM g;  3EI1 B;  4GQ1 A;  5EMK B;  5I5I A;  4U7A A;  4GM9 A;  4Y7R A;  1SHY B;  2GC4 A;  2H6N A;  4J78 A;  3FM0 A;  3I7P A;  3MKS B;  3UVM A;  4ESG A;  1U8C B;  4FA4 D;  5GSA A;  3J81 g;  2H9N A;  1GG2 B;  4J73 A;  5EML B;  2VDQ B;  4ES0 A;  4A2M A;  3ULE C;  4CY1 A;  2MTA H;  3PXT D;  3BG0 A;  5FKT A;  4QRJ A;  4BUJ C;  5EAM A;  1N6E A;  1JOF A;  1B9X A;  3I2N A;  2P9I C;  4IA9 A;  4FAV D;  4FAN D;  1Q47 A;  2J56 H;  4ZOV A;  4WK4 B;  4BH6 A;  3VI4 B;  2IUR A;  3DSM A;  4GGD A;  4X3E A;  2XYI A;  4GZ8 A;  5CXB A;  3T3M B;  4J8B A;  3UKR C;  5HDB B;  2I3T A;  3F3F A;  1SSL A;  1GXR A;  4MK0 B;  2B5N A;  4BL0 A;  3VGZ A;  2G9A A;  1N6F A;  5HE3 B;  2OJY A;  3KRX B;  2HYE A;  4O3U B;  5EMJ B;  5CXC A;  2P9L C;  3N0E A;  4LG9 A;  5GXH A;  2HXC A;  4ZOZ A;  4IMM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...