3AL8A

Plexin a2 / semaphorin 6a complex
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
550
structure length
537
Chain Sequence
b'GFPEDSEPISITKQYPVFVGHRHRLDIQMIMIMNRTLYVAARDHIYTVDIDTSHTEEIYCSKKLTWKSRQADVDTCRMKGKHKDECHNFIKVLLKKNDDTLFVCGTNAFNPSCRNYRVDTLETFGDEFSGMARCPYDAKHANIALFADGKLYSATVTDFLAIDAVIYRSLGDSPTLRTVKHDSKWLKEPYFVQAVDYGDYIYFFFREIAVEYNTMGKVVFPRVAQVCKNDMGGSQRVLEKQWTSFLKARLNCSVPGDSHFYFNILQAVTDVIRINGRDVVLATFSTPYNSIPGSAVCAYDMLDIANVFTGRFKEQKSPDSTWTPVPDERVPKPRPGCCAGSSSLEKYATSNEFPDDTLNFIKTHPLMDEAVPSIINRPWFLRTMVRYRLTKIAVDNAAGPYQNHTVVFLGSEKGIILKFLARIGSSGFLNGSLFLEEMNVYNPEKCSYDGVEDKRIMGMQLDRASGSLYVAFSTCVIKVPLGRCERHGKCKKTCIASRDPYCGWVRESGSCAHLSPLSRLTFEQDIERGNTDGLGDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Semaphorin-6A
molecule tags Signaling protein
source organism Mus musculus
publication title Structural basis for semaphorin signalling through the plexin receptor.
pubmed doi rcsb
total genus 111
structure length 537
sequence length 550
ec nomenclature
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01403 Sema Sema domain
A PF01437 PSI Plexin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3al8A01
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3al8A02
5K1CC 2QC5A 4JSNC 5CYKB 2CE9A 3I7HA 2AH0A 4PSWB 3EI3A 4J86A 3U4YA 2B5NA 4BH6A 5EARA 3UKUC 4ZOVA 4EWRA 4QRJA 3OKYB 3SBRA 4L9OA 3IIWA 2G9AA 3EI1B 3EI3B 4GGCA 4PC0A 5FA5B 2AGXA 4J82A 5E6SB 4UM8B 5FKQA 2GC7A 4O3UB 4J77A 2Z2NA 4A09B 2H9LA 3T3MB 4WJKB 1PGUA 4L3HD 1YFQA 2BCJB 5TDHB 2HJ4A 3OL2B 3E0CA 3MZKA 3I8EA 4R7AB 1S4UX 3RSEC 4GQ2P 3VGZA 2H9NA 1MG3A 3EI4B 3DWLC 4H5IA 1K32A 5FQDA 1GG2B 2CNXA 4A11B 5IJ7E 1SSLA 4G56B 3C99A 3UVKA 4O3TB 4AEZA 4FAVD 2XL3A 3MMYA 4GQBB 4L1QD 2HXCA 5IGOA 2I0TA 5FKRA 4ERZA 2VDQB 4O1QD 5EM2A 5HYNB 5C9ZB 2UZXB 4GM9A 5KDOB 1U2VC 2P9PC 4J79A 2P9LC 2H13A 4CY1A 4A2MA 5C2WB 2CO0A 4K3JB 2I0RA 2H14A 3PXWD 4A0AB 4FA9D 3BWSA 4J8GA 5A2Qg 4H5JA 3DSMA 3N0DA 3OKWA 2OVPB 3JRPA 5CXCB 1PBYB 1JMZB 4LG8A 4GGDA 3BG1A 5JWZA 4FHLA 3ODTA 3ORVD 2Z2PA 5FKTA 4LG9A 5I5MA 2H9PA 2Z2OA 2B5LA 3J80g 3RN1D 3SJLD 4ERQA 3L4MD 2HYEA 1N6EA 2J57G 3FRXA 5H17A 2AGWA 4JXMA 4ERYA 5HQGA 3NVXA 2P26A 5CXBA 3SVWD 3IKOA 4ZOYA 3CIKB 1JJUB 1TYEB 4FWWA 3FGBA 2I0SA 1JMXB 4Z7OB 4WK4B 4Z7QB 3EG6A 3P4FA 4XYIA 2AGYA 2J55H 3NIFB 2YBAA 3OKTA 2O9KA 2PM7B 4GGAA 4U7AA 4ESGA 2VDLB 3DXKC 4NSXA 2AGZA 2VDKB 3PVUB 4Y7RA 4GMBA 5EM2B 4FA4D 4CI3A 3AH8B 3I89A 3ZWLB 3IJ1A 1QNIA 4J87A 4PBZA 4FA1D 1A0RB 3F3PA 3F3FA 2P9KC 4JSVC 5EMKB 2XL2A 3I2NA 1OMWB 2B4EA 3EI4A 5K19A 3SCYA 3VH0A 5HE2B 4CZVA 5IJ8E 3EWEA 4ZOZA 1XKSA 3SLED 2HJBA 4WK0B 4J78A 5H1MA 4FAND 3I8CA 2H6QA 3FCUB 2G99A 2QXVA 1B9XA 2H68A 2HKRA 2UZYB 4A09A 2OVQB 3ZDYB 4LGNA 3NIDB 2H6NA 3SWSD 3PSLA 4X61B 3I7NA 1TBGA 5FKSA 1Q47A 2YNOA 3EI1A 4CI1A 4ES0A 4PBYA 4CY3A 3UVOA 3ZDXB 4X60B 3PXSD 3NVNA 3PE7A 3SBQA 5B4WA 2IUPA 3UVMA 3GFCA 5CYKA 2H47A 4JT6C 1PEVA 3VA6A 1MG2A 4A7JA 3ZE2B 2VDOB 2IUVA 2MTAH 2Q7QA 4QQEA 2TRCB 2VDMB 1JOFA 3RMZD 4YVDA 2HESX 5HE0B 4TZ4A 1XIPA 3C75H 3I7KA 4XEIC 2BBKH 4PNKB 2H9MA 3JROA 5I5JA 2P9SC 2W18A 2OIZA 4PXWA 2AGLA 5H14A 2VDPB 4UM9D 3C5MA 3PVWB 3MZLA 3L4OD 3ZE0B 3F3GA 3SN6B 5FLXg 4UM9B 4U1EI 3UR4A 5CXCA 2YNPA 4CY2A 3OW8A 5AFU3 4A0AA 3SXTD 5TEEA 3SHFA 1YUKA 1U8CB 1GOTB 4Z7NB 2IWFA 3JPXA 3IJ0A 4A0BA 1GXRA 2IWKA 1TYQC 4CZYA 4CZXA 2XYIA 5GMKn 3C9CA 5IC7A 1N6DA 4BL0A 4X63B 3UKRC 5E6UB 3J81g 5E6RB 5EAMA 5EMMB 2VDRB 2VDNB 2HKMA 3ZE1B 2EBSA 3RFGA 1PI6A 2OK6A 3BG0A 2B5MA 3OL2A 3EU7A 3KRWB 3JZHA 1FWXA 3NVQA 4K3ID 4J0WA 5HE1B 2OJYA 4IA9A 3N0EA 5IGQA 4L3GD 3OTTA 4Y5RD 1SQ9A 3RN0D 5GSAA 3I7LA 3JB9L 3ULEC 4MK0B 4PSXB 5FXYA 4A08A 5HE3B 3IJCA 3OKYA 2GNQA 3CFSB 1L0QA 3EI2A 3NIGB 2H3XA 3AFCA 1SHYB 2PM9B 5GXHA 5IT9g 1RI6A 2I3TA 5THAA 4N14A 3UVNA 4E5ZA 4OWRA 2P9IC 4JSXC 5CXBB 2IURA 3K26A 3DXMC 4I79A 4JD2C 3K27A 4GM8A 3V9FA 2AH1A 1SQJA 3UVLA 2PBIB 1XHMA 5EMJB 2YB8B 4OZUA 4XYHA 3ZDZB 3SFZA 4E5ZB 5I5IA 3GREA 1P22A 3B7FA 3MXXA 4FA5D 4KFMB 3KRXB 4IMMA 4D0KA 4HDJA 2VC2B 3EI2B 2IUQA 3SMRA 4J81A 4UI9R 3V5WB 3EMHA 2XU7A 5TEFA 2H6KA 2AQ5A 2CN2A 4CI8A 3JZNA 5AMSA 3AL8A 1VYHC 3I7OA 1B9YA 4ZN4A 1ERJA 5EALA 2I3SA 2YNNA 3I7PA 2PM9A 3RLMD 4E54B 4J8BA 2CO0C 2GC4A 3PSCB 4A2LA 1NR0A 4D6VA 2OK4A 4A08B 4GQ1A 4QT8A 4J0XA 2CN3A 2P9NC 3SBPA 1MDAH 4GM3A 3MKSB 4A0BB 3T3PB 4O45A 3RFHA 3VI3B 4X3EA 4BUJC 3A0FA 2IAAA 3RRMC 1GP2B 4ZOXA 1K8KC 2P9UC 3W15A 2OVRB 3VI4B 4CC9A 3AL8B 2YMUA 4GZ8A 3DM0A 4CI2A 5C2VB 3CFVA 5SXMA 3FM0A 3HFQA 4QL1A 5EAPA 4FB1D 4A11A 3MKQA 4JT5C 5AJAA 5HDBB 1U4CA 3IIYA 4O9DA 1OLZA 4AOWA 2CE8A 2J56H 4E54A 4Z8LA 1R5MA 4WK2B 3JAMg 4JSPC 4J84A 1N6FA 3AL9A 4J73A 5GXIA 4CY5A 1NEXB 5EMLB 2PM6B 3PXTD 5TF2A 2P28A 3JZGA 3V7DB
chains in the Genus database with same CATH superfamily
3ZE2A 5K1CC 3ZE0A 2QC5A 4JSNC 5CYKB 2CE9A 3I7HA 2AH0A 4PSWB 3EI3A 4J86A 3U4YA 2B5NA 4BH6A 1K3IA 5EARA 3UKUC 4ZOVA 4EWRA 4DNWA 4QRJA 3OKYB 3SBRA 4L9OA 3IIWA 2G9AA 4BCBA 2XE4A 3EI1B 3EI3B 4GGCA 4PC0A 5FA5B 2AGXA 4J82A 5E6SB 3ZDXA 4UM8B 5FKQA 2GC7A 4O3UB 4J77A 2Z2NA 4A09B 2H9LA 2VDMA 3T3MB 4WJKB 1PGUA 4L3HD 2VDOA 1YFQA 2BCJB 3NIGA 5TDHB 1C9LA 2HJ4A 3OL2B 4NC4A 3FCSA 3E0CA 3MZKA 1M1XA 3I8EA 4R7AB 1S4UX 3RSEC 4GQ2P 3VGZA 5E6RA 2H9NA 4NAAA 1MG3A 3EI4B 3DWLC 4H5IA 1K32A 5FQDA 4IRZA 1GG2B 2CNXA 4L1MA 4A11B 5IJ7E 1SSLA 4G56B 3C99A 3UVKA 4O3TB 4AEZA 4FAVD 4Z7NA 2XL3A 3MMYA 4GQBB 4L1QD 2HXCA 5IGOA 2I0TA 5FKRA 4ERZA 2HU7A 2VDQB 4O1QD 5EM2A 3DDUA 5HYNB 5C9ZB 3VI3A 2UZXB 4GM9A 5KDOB 1U2VC 2P9PC 4J79A 2P9LC 2H13A 4CY1A 4Z7QA 3GC3B 1QFMA 4A2MA 5C2WB 2CO0A 4K3JB 2I0RA 4AN1A 2H14A 3O4IA 3PXWD 3V4PA 4A0AB 4FA9D 1H2WA 3BWSA 4J8GA 1A12A 3O4JA 3OF7A 4H5JA 5A2Qg 3DSMA 1U8CA 3N0DA 3OKWA 2OVPB 3JRPA 5CXCB 1PBYB 1JMZB 5M5UA 4LG8A 1TYEA 2VC2A 4GGDA 3IUJA 3IJEA 3BG1A 3O4GA 5JWZA 4FHLA 3ORVD 3ODTA 2Z2PA 5FKTA 4LG9A 5I5MA 2H9PA 2Z2OA 3MUNA 2B5LA 3J80g 3RN1D 3SJLD 4ERQA 3L4MD 2HYEA 1N6EA 2J57G 3FRXA 4G1MA 5M5RA 5H17A 2AGWA 4JXMA 4ERYA 5HQGA 3NVXA 2P26A 5CXBA 3SVWD 3IKOA 4ZOYA 2VZ1A 3CIKB 5C92A 1JJUB 2HU5A 4AX4A 4BP9A 2HU8A 2EICA 1TYEB 4FWWA 3FGBA 2I0SA 1JMXB 4Z7OB 4WK4B 1YR2A 4Z7QB 3EG6A 3P4FA 4XYIA 2AGYA 2J55H 3NIFB 3OKTA 2YBAA 1UOPA 2O9KA 2PM7B 4GGAA 4U7AA 4DNUA 4ESGA 2VDLB 3DXKC 4NSXA 2AGZA 2VDKB 3PVUB 4Y7RA 2BKLA 1JTDB 4GMBA 3VI4A 5EM2B 3NIDA 4FA4D 4CI3A 3AH8B 3I89A 3ZWLB 3IJ1A 1QNIA 4J87A 4NENA 4PBZA 4FA1D 5M5SA 1A0RB 3F3PA 3F3FA 2P9KC 4JSVC 5EMKB 2XL2A 3I2NA 1OMWB 2B4EA 4WK0A 3EI4A 3ZDYA 1T2XA 5K19A 4NBMA 3MVDK 3SCYA 3VH0A 3FCUA 5HE2B 4CZVA 1VE7A 5IJ8E 1JV2A 3EWEA 4ZOZA 1XKSA 3EQ9A 2HJBA 3K72A 3SLED 4WK0B 1QFSA 3K6SA 1H2YA 4J78A 5H1MA 4FAND 3I8CA 2H6QA 3FCUB 2G99A 2QXVA 1B9XA 2H68A 2HKRA 2UZYB 3T3MA 4A09A 2OVQB 3ZDYB 1VZ3A 4LGNA 4DNVA 3NIDB 2H6NA 5FFGA 3SWSD 2EIDA 3PSLA 4X61B 5FFOA 3I7NA 1TBGA 5FKSA 1Q47A 2YNOA 4WJKA 3EI1A 4CI1A 4ES0A 4PBYA 4CY3A 3UVOA 3ZDXB 3PXSD 3PE7A 3NVNA 4X60B 3SBQA 5B4WA 2IUPA 3IUMA 3UVMA 3GFCA 4G1EA 2VDLA 5CYKA 2H47A 4JT6C 1PEVA 3VA6A 1MG2A 2VDPA 4A7JA 3ZE2B 4Z7OA 5M5VA 2VDOB 2IUVA 2MTAH 2Q7QA 1UTCA 4QQEA 2TRCB 2WQ8A 2VDMB 1JOFA 3IVMA 3RMZD 1E5TA 4UM8A 1VZ2A 4YVDA 2HESX 5HE0B 4TZ4A 1XIPA 1I2MB 3C75H 3I7KA 4XEIC 2BBKH 4PNKB 2H9MA 3JROA 5I5JA 2P9SC 2W18A 2OIZA 4PXWA 2AGLA 5H14A 2VDPB 4BCDA 4UM9D 3C5MA 3PVWB 3MZLA 3L4OD 3ZE0B 3F3GA 3SN6B 5FLXg 4UM9B 4U1EI 3UR4A 5HDBA 5CXCA 2YNPA 4RE5A 4CY2A 3K71A 3GD1I 3OW8A 5AFU3 4A0AA 3SXTD 1E8MA 5TEEA 3O4HA 3SHFA 4BP8A 1YUKA 4BCCA 1U8CB 1GOTB 4QAMA 4Z7NB 2IWFA 3JPXA 3IUNA 3IJ0A 3IUQA 4WK2A 4A0BA 1GXRA 2IWKA 1TYQC 4CZYA 5E6UA 4CZXA 2XYIA 5GMKn 3C9CA 5IC7A 1N6DA 4BL0A 4X63B 3UKRC 5E6UB 3J81g 2XDWA 5E6RB 5EAMA 5EMMB 2VDRB 2VDNB 2HKMA 2JWHA 3ZE1B 2EBSA 3RFGA 1PI6A 1UOQA 2OK6A 3BG0A 4D9SA 2B5MA 3OL2A 3EU7A 3IURA 3KRWB 3V4VA 3JZHA 1FWXA 2VDQA 1UOOA 2JWGA 3NVQA 4K3ID 4J0WA 5HE1B 2OJYA 4IA9A 3N0EA 5IGQA 4UM9A 2JKXA 4L3GD 3T3PA 2VDKA 3OTTA 4Y5RD 1SQ9A 3RN0D 5GSAA 1O6FA 3I7LA 3JB9L 3IULA 4MK0B 4PSXB 5FXYA 3ULEC 4A08A 4RE6A 4MMZA 5HE3B 3EQ7A 3IJCA 3OKYA 2GNQA 3CFSB 1L0QA 3EI2A 3NIGB 2H3XA 3AFCA 1SHYB 2PM9B 5GXHA 5IT9g 1RI6A 3QHYB 4O2WA 2I3TA 5THAA 4N14A 3UVNA 3EQ8A 4G55A 4E5ZA 4OWRA 2P9IC 4JSXC 5CXBB 5E6SA 2IURA 3K26A 3DXMC 4I79A 4JD2C 3K27A 4GM8A 3V9FA 2AH1A 2XZGA 1SQJA 3UVLA 2PBIB 1XHMA 5EMJB 1GOFA 2YB8B 3MUOA 4OZUA 4XYHA 3ZDZB 4MMYA 3SFZA 4E5ZB 5I5IA 3QI0A 3GREA 1P22A 3B7FA 3MXXA 4FA5D 4KFMB 3KRXB 4IMMA 4D0KA 4HDJA 2VC2B 3EI2B 3ZDZA 2IUQA 3SMRA 4J81A 4UI9R 3V5WB 3EMHA 2XU7A 5TEFA 1H2XA 2H6KA 2AQ5A 2CN2A 4CI8A 3JZNA 5AMSA 3AL8A 1VYHC 3I7OA 4JHPC 1B9YA 4ZN4A 1BPOA 3ZE1A 1ERJA 2QZPA 5EALA 2I3SA 2QR5A 2VDNA 2YNNA 3I7PA 2PM9A 5M61A 3RLMD 2VZ3A 4E54B 1GOGA 2CO0C 4J8BA 1O6GA 2GC4A 3PSCB 4A2LA 1NR0A 4D6VA 2OK4A 4A08B 4GQ1A 4QT8A 4J0XA 4AMYA 2CN3A 2P9NC 3SBPA 1MDAH 4GM3A 3MKSB 4AMZA 4A0BB 1H2ZA 3T3PB 4O45A 3RFHA 5M5TA 4AN0A 3VI3B 1E8NA 4X3EA 4BUJC 3A0FA 2IAAA 3RRMC 1GP2B 4ZOXA 1K8KC 2P9UC 3W15A 2OVRB 3VI4B 4CC9A 3AL8B 2YMUA 4GZ8A 3DM0A 4MMXA 4CI2A 3CFVA 5SXMA 5C2VB 4O02A 3FM0A 3HFQA 4QL1A 5EAPA 4FB1D 5C86A 4A11A 3MKQA 4JT5C 2VDRA 1VE6A 3NIFA 5AJAA 5HDBB 2EIBA 1U4CA 3IIYA 4O9DA 1L5GA 1OLZA 4WK4A 4AOWA 1C9IA 2CE8A 2J56H 4E54A 4Z8LA 1R5MA 4WK2B 3JAMg 3KCIA 4J84A 4JSPC 1N6FA 3AL9A 4J73A 5GXIA 4CY5A 1NEXB 5EMLB 1GOHA 2EIEA 2PM6B 4JHNA 3PXTD 5TF2A 2P28A 3JZGA 3V7DB
chains in the Genus database with same CATH topology
5K1CC 2QC5A 4JSNC 5CYKB 2CE9A 3I7HA 2AH0A 4PSWB 3EI3A 4J86A 3U4YA 2B5NA 4BH6A 5EARA 3UKUC 4ZOVA 4EWRA 4QRJA 3OKYB 3SBRA 4L9OA 3IIWA 2G9AA 3EI1B 3EI3B 4GGCA 4PC0A 5FA5B 2AGXA 4J82A 5E6SB 4UM8B 5FKQA 2GC7A 4O3UB 4J77A 2Z2NA 4A09B 2H9LA 3T3MB 4WJKB 1PGUA 4L3HD 1YFQA 2BCJB 5TDHB 2HJ4A 3OL2B 3E0CA 3MZKA 3I8EA 4R7AB 1S4UX 3RSEC 4GQ2P 3VGZA 2H9NA 1MG3A 3EI4B 3DWLC 4H5IA 1K32A 5FQDA 1GG2B 2CNXA 4A11B 5IJ7E 1SSLA 4G56B 3C99A 3UVKA 4O3TB 4AEZA 4FAVD 2XL3A 3MMYA 4GQBB 4L1QD 2HXCA 5IGOA 2I0TA 5FKRA 4ERZA 2VDQB 4O1QD 5EM2A 5HYNB 5C9ZB 2UZXB 4GM9A 5KDOB 1U2VC 2P9PC 4J79A 2P9LC 2H13A 4CY1A 4A2MA 5C2WB 2CO0A 4K3JB 2I0RA 2H14A 3PXWD 4A0AB 4FA9D 3BWSA 4J8GA 5A2Qg 4H5JA 3DSMA 3N0DA 3OKWA 2OVPB 3JRPA 5CXCB 1PBYB 1JMZB 4LG8A 4GGDA 3BG1A 5JWZA 4FHLA 3ODTA 3ORVD 2Z2PA 5FKTA 4LG9A 5I5MA 2H9PA 2Z2OA 2B5LA 3J80g 3RN1D 3SJLD 4ERQA 3L4MD 2HYEA 1N6EA 2J57G 3FRXA 5H17A 2AGWA 4JXMA 4ERYA 5HQGA 3NVXA 2P26A 5CXBA 3SVWD 3IKOA 4ZOYA 3CIKB 1JJUB 1TYEB 4FWWA 3FGBA 2I0SA 1JMXB 4Z7OB 4WK4B 4Z7QB 3EG6A 3P4FA 4XYIA 2AGYA 2J55H 3NIFB 2YBAA 3OKTA 2O9KA 2PM7B 4GGAA 4U7AA 4ESGA 2VDLB 3DXKC 4NSXA 2AGZA 2VDKB 3PVUB 4Y7RA 4GMBA 5EM2B 4FA4D 4CI3A 3AH8B 3I89A 3ZWLB 3IJ1A 1QNIA 4J87A 4PBZA 4FA1D 1A0RB 3F3PA 3F3FA 2P9KC 4JSVC 5EMKB 2XL2A 3I2NA 1OMWB 2B4EA 3EI4A 5K19A 3SCYA 3VH0A 5HE2B 4CZVA 5IJ8E 3EWEA 4ZOZA 1XKSA 3SLED 2HJBA 4WK0B 4J78A 5H1MA 4FAND 3I8CA 2H6QA 3FCUB 2G99A 2QXVA 1B9XA 2H68A 2HKRA 2UZYB 4A09A 2OVQB 3ZDYB 4LGNA 3NIDB 2H6NA 3SWSD 3PSLA 4X61B 3I7NA 1TBGA 5FKSA 1Q47A 2YNOA 3EI1A 4CI1A 4ES0A 4PBYA 4CY3A 3UVOA 3ZDXB 4X60B 3PXSD 3NVNA 3PE7A 3SBQA 5B4WA 2IUPA 3UVMA 3GFCA 5CYKA 2H47A 4JT6C 1PEVA 3VA6A 1MG2A 4A7JA 3ZE2B 2VDOB 2IUVA 2MTAH 2Q7QA 4QQEA 2TRCB 2VDMB 1JOFA 3RMZD 4YVDA 2HESX 5HE0B 4TZ4A 1XIPA 3C75H 3I7KA 4XEIC 2BBKH 4PNKB 2H9MA 3JROA 5I5JA 2P9SC 2W18A 2OIZA 4PXWA 2AGLA 5H14A 2VDPB 4UM9D 3C5MA 3PVWB 3MZLA 3L4OD 3ZE0B 3F3GA 3SN6B 5FLXg 4UM9B 4U1EI 3UR4A 5CXCA 2YNPA 4CY2A 3OW8A 5AFU3 4A0AA 3SXTD 5TEEA 3SHFA 1YUKA 1U8CB 1GOTB 4Z7NB 2IWFA 3JPXA 3IJ0A 4A0BA 1GXRA 2IWKA 1TYQC 4CZYA 4CZXA 2XYIA 5GMKn 3C9CA 5IC7A 1N6DA 4BL0A 4X63B 3UKRC 5E6UB 3J81g 5E6RB 5EAMA 5EMMB 2VDRB 2VDNB 2HKMA 2JWHA 3ZE1B 2EBSA 3RFGA 1PI6A 2OK6A 3BG0A 2B5MA 3OL2A 3EU7A 3KRWB 3JZHA 1FWXA 2JWGA 3NVQA 4K3ID 4J0WA 5HE1B 2OJYA 4IA9A 3N0EA 5IGQA 4L3GD 3OTTA 4Y5RD 1SQ9A 3RN0D 5GSAA 3I7LA 3JB9L 3ULEC 4MK0B 4PSXB 5FXYA 4A08A 5HE3B 3IJCA 3OKYA 2GNQA 3CFSB 1L0QA 3EI2A 3NIGB 2H3XA 3AFCA 1SHYB 2PM9B 5GXHA 5IT9g 1RI6A 2I3TA 5THAA 4N14A 3UVNA 4E5ZA 4OWRA 2P9IC 4JSXC 5CXBB 2IURA 3K26A 3DXMC 4I79A 4JD2C 3K27A 4GM8A 3V9FA 2AH1A 1SQJA 3UVLA 2PBIB 1XHMA 5EMJB 2YB8B 4OZUA 4XYHA 3ZDZB 3SFZA 4E5ZB 5I5IA 3GREA 1P22A 3B7FA 3MXXA 4FA5D 4KFMB 3KRXB 4IMMA 4D0KA 4HDJA 2VC2B 3EI2B 2IUQA 3SMRA 4J81A 4UI9R 3V5WB 3EMHA 2XU7A 5TEFA 2H6KA 2AQ5A 2CN2A 4CI8A 3JZNA 5AMSA 3AL8A 1VYHC 3I7OA 1B9YA 4ZN4A 1ERJA 5EALA 2I3SA 2YNNA 3I7PA 2PM9A 3RLMD 4E54B 4J8BA 2CO0C 2GC4A 3PSCB 4A2LA 1NR0A 4D6VA 2OK4A 4A08B 4GQ1A 4QT8A 4J0XA 2CN3A 2P9NC 3SBPA 1MDAH 4GM3A 3MKSB 4A0BB 3T3PB 4O45A 3RFHA 3VI3B 4X3EA 4BUJC 3A0FA 2IAAA 3RRMC 1GP2B 4ZOXA 1K8KC 2P9UC 3W15A 2OVRB 3VI4B 4CC9A 3AL8B 2YMUA 4GZ8A 3DM0A 4CI2A 5C2VB 3CFVA 5SXMA 3FM0A 3HFQA 4QL1A 5EAPA 4FB1D 4A11A 3MKQA 4JT5C 5AJAA 5HDBB 1U4CA 3IIYA 4O9DA 1OLZA 4AOWA 2CE8A 2J56H 4E54A 4Z8LA 1R5MA 4WK2B 3JAMg 4JSPC 4J84A 1N6FA 3AL9A 4J73A 5GXIA 4CY5A 1NEXB 5EMLB 2PM6B 3PXTD 5TF2A 2P28A 3JZGA 3V7DB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K1C C;  2QC5 A;  4JSN C;  5CYK B;  2CE9 A;  3I7H A;  2AH0 A;  4PSW B;  3EI3 A;  4J86 A;  3U4Y A;  2B5N A;  4BH6 A;  5EAR A;  3UKU C;  4ZOV A;  4EWR A;  4QRJ A;  3OKY B;  3SBR A;  4L9O A;  3IIW A;  2G9A A;  3EI1 B;  3EI3 B;  4GGC A;  4PC0 A;  5FA5 B;  2AGX A;  4J82 A;  5E6S B;  4UM8 B;  5FKQ A;  2GC7 A;  4O3U B;  4J77 A;  2Z2N A;  4A09 B;  2H9L A;  3T3M B;  4WJK B;  1PGU A;  4L3H D;  1YFQ A;  2BCJ B;  5TDH B;  2HJ4 A;  3OL2 B;  3E0C A;  3MZK A;  3I8E A;  4R7A B;  1S4U X;  3RSE C;  4GQ2 P;  3VGZ A;  2H9N A;  1MG3 A;  3EI4 B;  3DWL C;  4H5I A;  1K32 A;  5FQD A;  1GG2 B;  2CNX A;  4A11 B;  5IJ7 E;  1SSL A;  4G56 B;  3C99 A;  3UVK A;  4O3T B;  4AEZ A;  4FAV D;  2XL3 A;  3MMY A;  4GQB B;  4L1Q D;  2HXC A;  5IGO A;  2I0T A;  5FKR A;  4ERZ A;  2VDQ B;  4O1Q D;  5EM2 A;  5HYN B;  5C9Z B;  2UZX B;  4GM9 A;  5KDO B;  1U2V C;  2P9P C;  4J79 A;  2P9L C;  2H13 A;  4CY1 A;  4A2M A;  5C2W B;  2CO0 A;  4K3J B;  2I0R A;  2H14 A;  3PXW D;  4A0A B;  4FA9 D;  3BWS A;  4J8G A;  5A2Q g;  4H5J A;  3DSM A;  3N0D A;  3OKW A;  2OVP B;  3JRP A;  5CXC B;  1PBY B;  1JMZ B;  4LG8 A;  4GGD A;  3BG1 A;  5JWZ A;  4FHL A;  3ODT A;  3ORV D;  2Z2P A;  5FKT A;  4LG9 A;  5I5M A;  2H9P A;  2Z2O A;  2B5L A;  3J80 g;  3RN1 D;  3SJL D;  4ERQ A;  3L4M D;  2HYE A;  1N6E A;  2J57 G;  3FRX A;  5H17 A;  2AGW A;  4JXM A;  4ERY A;  5HQG A;  3NVX A;  2P26 A;  5CXB A;  3SVW D;  3IKO A;  4ZOY A;  3CIK B;  1JJU B;  1TYE B;  4FWW A;  3FGB A;  2I0S A;  1JMX B;  4Z7O B;  4WK4 B;  4Z7Q B;  3EG6 A;  3P4F A;  4XYI A;  2AGY A;  2J55 H;  3NIF B;  2YBA A;  3OKT A;  2O9K A;  2PM7 B;  4GGA A;  4U7A A;  4ESG A;  2VDL B;  3DXK C;  4NSX A;  2AGZ A;  2VDK B;  3PVU B;  4Y7R A;  4GMB A;  5EM2 B;  4FA4 D;  4CI3 A;  3AH8 B;  3I89 A;  3ZWL B;  3IJ1 A;  1QNI A;  4J87 A;  4PBZ A;  4FA1 D;  1A0R B;  3F3P A;  3F3F A;  2P9K C;  4JSV C;  5EMK B;  2XL2 A;  3I2N A;  1OMW B;  2B4E A;  3EI4 A;  5K19 A;  3SCY A;  3VH0 A;  5HE2 B;  4CZV A;  5IJ8 E;  3EWE A;  4ZOZ A;  1XKS A;  3SLE D;  2HJB A;  4WK0 B;  4J78 A;  5H1M A;  4FAN D;  3I8C A;  2H6Q A;  3FCU B;  2G99 A;  2QXV A;  1B9X A;  2H68 A;  2HKR A;  2UZY B;  4A09 A;  2OVQ B;  3ZDY B;  4LGN A;  3NID B;  2H6N A;  3SWS D;  3PSL A;  4X61 B;  3I7N A;  1TBG A;  5FKS A;  1Q47 A;  2YNO A;  3EI1 A;  4CI1 A;  4ES0 A;  4PBY A;  4CY3 A;  3UVO A;  3ZDX B;  4X60 B;  3PXS D;  3NVN A;  3PE7 A;  3SBQ A;  5B4W A;  2IUP A;  3UVM A;  3GFC A;  5CYK A;  2H47 A;  4JT6 C;  1PEV A;  3VA6 A;  1MG2 A;  4A7J A;  3ZE2 B;  2VDO B;  2IUV A;  2MTA H;  2Q7Q A;  4QQE A;  2TRC B;  2VDM B;  1JOF A;  3RMZ D;  4YVD A;  2HES X;  5HE0 B;  4TZ4 A;  1XIP A;  3C75 H;  3I7K A;  4XEI C;  2BBK H;  4PNK B;  2H9M A;  3JRO A;  5I5J A;  2P9S C;  2W18 A;  2OIZ A;  4PXW A;  2AGL A;  5H14 A;  2VDP B;  4UM9 D;  3C5M A;  3PVW B;  3MZL A;  3L4O D;  3ZE0 B;  3F3G A;  3SN6 B;  5FLX g;  4UM9 B;  4U1E I;  3UR4 A;  5CXC A;  2YNP A;  4CY2 A;  3OW8 A;  5AFU 3;  4A0A A;  3SXT D;  5TEE A;  3SHF A;  1YUK A;  1U8C B;  1GOT B;  4Z7N B;  2IWF A;  3JPX A;  3IJ0 A;  4A0B A;  1GXR A;  2IWK A;  1TYQ C;  4CZY A;  4CZX A;  2XYI A;  5GMK n;  3C9C A;  5IC7 A;  1N6D A;  4BL0 A;  4X63 B;  3UKR C;  5E6U B;  3J81 g;  5E6R B;  5EAM A;  5EMM B;  2VDR B;  2VDN B;  2HKM A;  3ZE1 B;  2EBS A;  3RFG A;  1PI6 A;  2OK6 A;  3BG0 A;  2B5M A;  3OL2 A;  3EU7 A;  3KRW B;  3JZH A;  1FWX A;  3NVQ A;  4K3I D;  4J0W A;  5HE1 B;  2OJY A;  4IA9 A;  3N0E A;  5IGQ A;  4L3G D;  3OTT A;  4Y5R D;  1SQ9 A;  3RN0 D;  5GSA A;  3I7L A;  3JB9 L;  3ULE C;  4MK0 B;  4PSX B;  5FXY A;  4A08 A;  5HE3 B;  3IJC A;  3OKY A;  2GNQ A;  3CFS B;  1L0Q A;  3EI2 A;  3NIG B;  2H3X A;  3AFC A;  1SHY B;  2PM9 B;  5GXH A;  5IT9 g;  1RI6 A;  2I3T A;  5THA A;  4N14 A;  3UVN A;  4E5Z A;  4OWR A;  2P9I C;  4JSX C;  5CXB B;  2IUR A;  3K26 A;  3DXM C;  4I79 A;  4JD2 C;  3K27 A;  4GM8 A;  3V9F A;  2AH1 A;  1SQJ A;  3UVL A;  2PBI B;  1XHM A;  5EMJ B;  2YB8 B;  4OZU A;  4XYH A;  3ZDZ B;  3SFZ A;  4E5Z B;  5I5I A;  3GRE A;  1P22 A;  3B7F A;  3MXX A;  4FA5 D;  4KFM B;  3KRX B;  4IMM A;  4D0K A;  4HDJ A;  2VC2 B;  3EI2 B;  2IUQ A;  3SMR A;  4J81 A;  4UI9 R;  3V5W B;  3EMH A;  2XU7 A;  5TEF A;  2H6K A;  2AQ5 A;  2CN2 A;  4CI8 A;  3JZN A;  5AMS A;  3AL8 A;  1VYH C;  3I7O A;  1B9Y A;  4ZN4 A;  1ERJ A;  5EAL A;  2I3S A;  2YNN A;  3I7P A;  2PM9 A;  3RLM D;  4E54 B;  4J8B A;  2CO0 C;  2GC4 A;  3PSC B;  4A2L A;  1NR0 A;  4D6V A;  2OK4 A;  4A08 B;  4GQ1 A;  4QT8 A;  4J0X A;  2CN3 A;  2P9N C;  3SBP A;  1MDA H;  4GM3 A;  3MKS B;  4A0B B;  3T3P B;  4O45 A;  3RFH A;  3VI3 B;  4X3E A;  4BUJ C;  3A0F A;  2IAA A;  3RRM C;  1GP2 B;  4ZOX A;  1K8K C;  2P9U C;  3W15 A;  2OVR B;  3VI4 B;  4CC9 A;  3AL8 B;  2YMU A;  4GZ8 A;  3DM0 A;  4CI2 A;  5C2V B;  3CFV A;  5SXM A;  3FM0 A;  3HFQ A;  4QL1 A;  5EAP A;  4FB1 D;  4A11 A;  3MKQ A;  4JT5 C;  5AJA A;  5HDB B;  1U4C A;  3IIY A;  4O9D A;  1OLZ A;  4AOW A;  2CE8 A;  2J56 H;  4E54 A;  4Z8L A;  1R5M A;  4WK2 B;  3JAM g;  4JSP C;  4J84 A;  1N6F A;  3AL9 A;  4J73 A;  5GXI A;  4CY5 A;  1NEX B;  5EML B;  2PM6 B;  3PXT D;  5TF2 A;  2P28 A;  3JZG A;  3V7D B; 
#chains in the Genus database with same CATH topology
 3ZE2 A;  5K1C C;  3ZE0 A;  2QC5 A;  4JSN C;  5CYK B;  2CE9 A;  3I7H A;  2AH0 A;  4PSW B;  3EI3 A;  4J86 A;  3U4Y A;  2B5N A;  4BH6 A;  1K3I A;  5EAR A;  3UKU C;  4ZOV A;  4EWR A;  4DNW A;  4QRJ A;  3OKY B;  3SBR A;  4L9O A;  3IIW A;  2G9A A;  4BCB A;  2XE4 A;  3EI1 B;  3EI3 B;  4GGC A;  4PC0 A;  5FA5 B;  2AGX A;  4J82 A;  5E6S B;  3ZDX A;  4UM8 B;  5FKQ A;  2GC7 A;  4O3U B;  4J77 A;  2Z2N A;  4A09 B;  2H9L A;  2VDM A;  3T3M B;  4WJK B;  1PGU A;  4L3H D;  2VDO A;  1YFQ A;  2BCJ B;  3NIG A;  5TDH B;  1C9L A;  2HJ4 A;  3OL2 B;  4NC4 A;  3FCS A;  3E0C A;  3MZK A;  1M1X A;  3I8E A;  4R7A B;  1S4U X;  3RSE C;  4GQ2 P;  3VGZ A;  5E6R A;  2H9N A;  4NAA A;  1MG3 A;  3EI4 B;  3DWL C;  4H5I A;  1K32 A;  5FQD A;  4IRZ A;  1GG2 B;  2CNX A;  4L1M A;  4A11 B;  5IJ7 E;  1SSL A;  4G56 B;  3C99 A;  3UVK A;  4O3T B;  4AEZ A;  4FAV D;  4Z7N A;  2XL3 A;  3MMY A;  4GQB B;  4L1Q D;  2HXC A;  5IGO A;  2I0T A;  5FKR A;  4ERZ A;  2HU7 A;  2VDQ B;  4O1Q D;  5EM2 A;  3DDU A;  5HYN B;  5C9Z B;  3VI3 A;  2UZX B;  4GM9 A;  5KDO B;  1U2V C;  2P9P C;  4J79 A;  2P9L C;  2H13 A;  4CY1 A;  4Z7Q A;  3GC3 B;  1QFM A;  4A2M A;  5C2W B;  2CO0 A;  4K3J B;  2I0R A;  4AN1 A;  2H14 A;  3O4I A;  3PXW D;  3V4P A;  4A0A B;  4FA9 D;  1H2W A;  3BWS A;  4J8G A;  1A12 A;  3O4J A;  3OF7 A;  4H5J A;  5A2Q g;  3DSM A;  1U8C A;  3N0D A;  3OKW A;  2OVP B;  3JRP A;  5CXC B;  1PBY B;  1JMZ B;  5M5U A;  4LG8 A;  1TYE A;  2VC2 A;  4GGD A;  3IUJ A;  3IJE A;  3BG1 A;  3O4G A;  5JWZ A;  4FHL A;  3ORV D;  3ODT A;  2Z2P A;  5FKT A;  4LG9 A;  5I5M A;  2H9P A;  2Z2O A;  3MUN A;  2B5L A;  3J80 g;  3RN1 D;  3SJL D;  4ERQ A;  3L4M D;  2HYE A;  1N6E A;  2J57 G;  3FRX A;  4G1M A;  5M5R A;  5H17 A;  2AGW A;  4JXM A;  4ERY A;  5HQG A;  3NVX A;  2P26 A;  5CXB A;  3SVW D;  3IKO A;  4ZOY A;  2VZ1 A;  3CIK B;  5C92 A;  1JJU B;  2HU5 A;  4AX4 A;  4BP9 A;  2HU8 A;  2EIC A;  1TYE B;  4FWW A;  3FGB A;  2I0S A;  1JMX B;  4Z7O B;  4WK4 B;  1YR2 A;  4Z7Q B;  3EG6 A;  3P4F A;  4XYI A;  2AGY A;  2J55 H;  3NIF B;  3OKT A;  2YBA A;  1UOP A;  2O9K A;  2PM7 B;  4GGA A;  4U7A A;  4DNU A;  4ESG A;  2VDL B;  3DXK C;  4NSX A;  2AGZ A;  2VDK B;  3PVU B;  4Y7R A;  2BKL A;  1JTD B;  4GMB A;  3VI4 A;  5EM2 B;  3NID A;  4FA4 D;  4CI3 A;  3AH8 B;  3I89 A;  3ZWL B;  3IJ1 A;  1QNI A;  4J87 A;  4NEN A;  4PBZ A;  4FA1 D;  5M5S A;  1A0R B;  3F3P A;  3F3F A;  2P9K C;  4JSV C;  5EMK B;  2XL2 A;  3I2N A;  1OMW B;  2B4E A;  4WK0 A;  3EI4 A;  3ZDY A;  1T2X A;  5K19 A;  4NBM A;  3MVD K;  3SCY A;  3VH0 A;  3FCU A;  5HE2 B;  4CZV A;  1VE7 A;  5IJ8 E;  1JV2 A;  3EWE A;  4ZOZ A;  1XKS A;  3EQ9 A;  2HJB A;  3K72 A;  3SLE D;  4WK0 B;  1QFS A;  3K6S A;  1H2Y A;  4J78 A;  5H1M A;  4FAN D;  3I8C A;  2H6Q A;  3FCU B;  2G99 A;  2QXV A;  1B9X A;  2H68 A;  2HKR A;  2UZY B;  3T3M A;  4A09 A;  2OVQ B;  3ZDY B;  1VZ3 A;  4LGN A;  4DNV A;  3NID B;  2H6N A;  5FFG A;  3SWS D;  2EID A;  3PSL A;  4X61 B;  5FFO A;  3I7N A;  1TBG A;  5FKS A;  1Q47 A;  2YNO A;  4WJK A;  3EI1 A;  4CI1 A;  4ES0 A;  4PBY A;  4CY3 A;  3UVO A;  3ZDX B;  3PXS D;  3PE7 A;  3NVN A;  4X60 B;  3SBQ A;  5B4W A;  2IUP A;  3IUM A;  3UVM A;  3GFC A;  4G1E A;  2VDL A;  5CYK A;  2H47 A;  4JT6 C;  1PEV A;  3VA6 A;  1MG2 A;  2VDP A;  4A7J A;  3ZE2 B;  4Z7O A;  5M5V A;  2VDO B;  2IUV A;  2MTA H;  2Q7Q A;  1UTC A;  4QQE A;  2TRC B;  2WQ8 A;  2VDM B;  1JOF A;  3IVM A;  3RMZ D;  1E5T A;  4UM8 A;  1VZ2 A;  4YVD A;  2HES X;  5HE0 B;  4TZ4 A;  1XIP A;  1I2M B;  3C75 H;  3I7K A;  4XEI C;  2BBK H;  4PNK B;  2H9M A;  3JRO A;  5I5J A;  2P9S C;  2W18 A;  2OIZ A;  4PXW A;  2AGL A;  5H14 A;  2VDP B;  4BCD A;  4UM9 D;  3C5M A;  3PVW B;  3MZL A;  3L4O D;  3ZE0 B;  3F3G A;  3SN6 B;  5FLX g;  4UM9 B;  4U1E I;  3UR4 A;  5HDB A;  5CXC A;  2YNP A;  4RE5 A;  4CY2 A;  3K71 A;  3GD1 I;  3OW8 A;  5AFU 3;  4A0A A;  3SXT D;  1E8M A;  5TEE A;  3O4H A;  3SHF A;  4BP8 A;  1YUK A;  4BCC A;  1U8C B;  1GOT B;  4QAM A;  4Z7N B;  2IWF A;  3JPX A;  3IUN A;  3IJ0 A;  3IUQ A;  4WK2 A;  4A0B A;  1GXR A;  2IWK A;  1TYQ C;  4CZY A;  5E6U A;  4CZX A;  2XYI A;  5GMK n;  3C9C A;  5IC7 A;  1N6D A;  4BL0 A;  4X63 B;  3UKR C;  5E6U B;  3J81 g;  2XDW A;  5E6R B;  5EAM A;  5EMM B;  2VDR B;  2VDN B;  2HKM A;  2JWH A;  3ZE1 B;  2EBS A;  3RFG A;  1PI6 A;  1UOQ A;  2OK6 A;  3BG0 A;  4D9S A;  2B5M A;  3OL2 A;  3EU7 A;  3IUR A;  3KRW B;  3V4V A;  3JZH A;  1FWX A;  2VDQ A;  1UOO A;  2JWG A;  3NVQ A;  4K3I D;  4J0W A;  5HE1 B;  2OJY A;  4IA9 A;  3N0E A;  5IGQ A;  4UM9 A;  2JKX A;  4L3G D;  3T3P A;  2VDK A;  3OTT A;  4Y5R D;  1SQ9 A;  3RN0 D;  5GSA A;  1O6F A;  3I7L A;  3JB9 L;  3IUL A;  4MK0 B;  4PSX B;  5FXY A;  3ULE C;  4A08 A;  4RE6 A;  4MMZ A;  5HE3 B;  3EQ7 A;  3IJC A;  3OKY A;  2GNQ A;  3CFS B;  1L0Q A;  3EI2 A;  3NIG B;  2H3X A;  3AFC A;  1SHY B;  2PM9 B;  5GXH A;  5IT9 g;  1RI6 A;  3QHY B;  4O2W A;  2I3T A;  5THA A;  4N14 A;  3UVN A;  3EQ8 A;  4G55 A;  4E5Z A;  4OWR A;  2P9I C;  4JSX C;  5CXB B;  5E6S A;  2IUR A;  3K26 A;  3DXM C;  4I79 A;  4JD2 C;  3K27 A;  4GM8 A;  3V9F A;  2AH1 A;  2XZG A;  1SQJ A;  3UVL A;  2PBI B;  1XHM A;  5EMJ B;  1GOF A;  2YB8 B;  3MUO A;  4OZU A;  4XYH A;  3ZDZ B;  4MMY A;  3SFZ A;  4E5Z B;  5I5I A;  3QI0 A;  3GRE A;  1P22 A;  3B7F A;  3MXX A;  4FA5 D;  4KFM B;  3KRX B;  4IMM A;  4D0K A;  4HDJ A;  2VC2 B;  3EI2 B;  3ZDZ A;  2IUQ A;  3SMR A;  4J81 A;  4UI9 R;  3V5W B;  3EMH A;  2XU7 A;  5TEF A;  1H2X A;  2H6K A;  2AQ5 A;  2CN2 A;  4CI8 A;  3JZN A;  5AMS A;  3AL8 A;  1VYH C;  3I7O A;  4JHP C;  1B9Y A;  4ZN4 A;  1BPO A;  3ZE1 A;  1ERJ A;  2QZP A;  5EAL A;  2I3S A;  2QR5 A;  2VDN A;  2YNN A;  3I7P A;  2PM9 A;  5M61 A;  3RLM D;  2VZ3 A;  4E54 B;  1GOG A;  2CO0 C;  4J8B A;  1O6G A;  2GC4 A;  3PSC B;  4A2L A;  1NR0 A;  4D6V A;  2OK4 A;  4A08 B;  4GQ1 A;  4QT8 A;  4J0X A;  4AMY A;  2CN3 A;  2P9N C;  3SBP A;  1MDA H;  4GM3 A;  3MKS B;  4AMZ A;  4A0B B;  1H2Z A;  3T3P B;  4O45 A;  3RFH A;  5M5T A;  4AN0 A;  3VI3 B;  1E8N A;  4X3E A;  4BUJ C;  3A0F A;  2IAA A;  3RRM C;  1GP2 B;  4ZOX A;  1K8K C;  2P9U C;  3W15 A;  2OVR B;  3VI4 B;  4CC9 A;  3AL8 B;  2YMU A;  4GZ8 A;  3DM0 A;  4MMX A;  4CI2 A;  3CFV A;  5SXM A;  5C2V B;  4O02 A;  3FM0 A;  3HFQ A;  4QL1 A;  5EAP A;  4FB1 D;  5C86 A;  4A11 A;  3MKQ A;  4JT5 C;  2VDR A;  1VE6 A;  3NIF A;  5AJA A;  5HDB B;  2EIB A;  1U4C A;  3IIY A;  4O9D A;  1L5G A;  1OLZ A;  4WK4 A;  4AOW A;  1C9I A;  2CE8 A;  2J56 H;  4E54 A;  4Z8L A;  1R5M A;  4WK2 B;  3JAM g;  3KCI A;  4J84 A;  4JSP C;  1N6F A;  3AL9 A;  4J73 A;  5GXI A;  4CY5 A;  1NEX B;  5EML B;  1GOH A;  2EIE A;  2PM6 B;  4JHN A;  3PXT D;  5TF2 A;  2P28 A;  3JZG A;  3V7D B; 
#chains in the Genus database with same CATH homology
 5K1C C;  2QC5 A;  4JSN C;  5CYK B;  2CE9 A;  3I7H A;  2AH0 A;  4PSW B;  3EI3 A;  4J86 A;  3U4Y A;  2B5N A;  4BH6 A;  5EAR A;  3UKU C;  4ZOV A;  4EWR A;  4QRJ A;  3OKY B;  3SBR A;  4L9O A;  3IIW A;  2G9A A;  3EI1 B;  3EI3 B;  4GGC A;  4PC0 A;  5FA5 B;  2AGX A;  4J82 A;  5E6S B;  4UM8 B;  5FKQ A;  2GC7 A;  4O3U B;  4J77 A;  2Z2N A;  4A09 B;  2H9L A;  3T3M B;  4WJK B;  1PGU A;  4L3H D;  1YFQ A;  2BCJ B;  5TDH B;  2HJ4 A;  3OL2 B;  3E0C A;  3MZK A;  3I8E A;  4R7A B;  1S4U X;  3RSE C;  4GQ2 P;  3VGZ A;  2H9N A;  1MG3 A;  3EI4 B;  3DWL C;  4H5I A;  1K32 A;  5FQD A;  1GG2 B;  2CNX A;  4A11 B;  5IJ7 E;  1SSL A;  4G56 B;  3C99 A;  3UVK A;  4O3T B;  4AEZ A;  4FAV D;  2XL3 A;  3MMY A;  4GQB B;  4L1Q D;  2HXC A;  5IGO A;  2I0T A;  5FKR A;  4ERZ A;  2VDQ B;  4O1Q D;  5EM2 A;  5HYN B;  5C9Z B;  2UZX B;  4GM9 A;  5KDO B;  1U2V C;  2P9P C;  4J79 A;  2P9L C;  2H13 A;  4CY1 A;  4A2M A;  5C2W B;  2CO0 A;  4K3J B;  2I0R A;  2H14 A;  3PXW D;  4A0A B;  4FA9 D;  3BWS A;  4J8G A;  5A2Q g;  4H5J A;  3DSM A;  3N0D A;  3OKW A;  2OVP B;  3JRP A;  5CXC B;  1PBY B;  1JMZ B;  4LG8 A;  4GGD A;  3BG1 A;  5JWZ A;  4FHL A;  3ODT A;  3ORV D;  2Z2P A;  5FKT A;  4LG9 A;  5I5M A;  2H9P A;  2Z2O A;  2B5L A;  3J80 g;  3RN1 D;  3SJL D;  4ERQ A;  3L4M D;  2HYE A;  1N6E A;  2J57 G;  3FRX A;  5H17 A;  2AGW A;  4JXM A;  4ERY A;  5HQG A;  3NVX A;  2P26 A;  5CXB A;  3SVW D;  3IKO A;  4ZOY A;  3CIK B;  1JJU B;  1TYE B;  4FWW A;  3FGB A;  2I0S A;  1JMX B;  4Z7O B;  4WK4 B;  4Z7Q B;  3EG6 A;  3P4F A;  4XYI A;  2AGY A;  2J55 H;  3NIF B;  2YBA A;  3OKT A;  2O9K A;  2PM7 B;  4GGA A;  4U7A A;  4ESG A;  2VDL B;  3DXK C;  4NSX A;  2AGZ A;  2VDK B;  3PVU B;  4Y7R A;  4GMB A;  5EM2 B;  4FA4 D;  4CI3 A;  3AH8 B;  3I89 A;  3ZWL B;  3IJ1 A;  1QNI A;  4J87 A;  4PBZ A;  4FA1 D;  1A0R B;  3F3P A;  3F3F A;  2P9K C;  4JSV C;  5EMK B;  2XL2 A;  3I2N A;  1OMW B;  2B4E A;  3EI4 A;  5K19 A;  3SCY A;  3VH0 A;  5HE2 B;  4CZV A;  5IJ8 E;  3EWE A;  4ZOZ A;  1XKS A;  3SLE D;  2HJB A;  4WK0 B;  4J78 A;  5H1M A;  4FAN D;  3I8C A;  2H6Q A;  3FCU B;  2G99 A;  2QXV A;  1B9X A;  2H68 A;  2HKR A;  2UZY B;  4A09 A;  2OVQ B;  3ZDY B;  4LGN A;  3NID B;  2H6N A;  3SWS D;  3PSL A;  4X61 B;  3I7N A;  1TBG A;  5FKS A;  1Q47 A;  2YNO A;  3EI1 A;  4CI1 A;  4ES0 A;  4PBY A;  4CY3 A;  3UVO A;  3ZDX B;  4X60 B;  3PXS D;  3NVN A;  3PE7 A;  3SBQ A;  5B4W A;  2IUP A;  3UVM A;  3GFC A;  5CYK A;  2H47 A;  4JT6 C;  1PEV A;  3VA6 A;  1MG2 A;  4A7J A;  3ZE2 B;  2VDO B;  2IUV A;  2MTA H;  2Q7Q A;  4QQE A;  2TRC B;  2VDM B;  1JOF A;  3RMZ D;  4YVD A;  2HES X;  5HE0 B;  4TZ4 A;  1XIP A;  3C75 H;  3I7K A;  4XEI C;  2BBK H;  4PNK B;  2H9M A;  3JRO A;  5I5J A;  2P9S C;  2W18 A;  2OIZ A;  4PXW A;  2AGL A;  5H14 A;  2VDP B;  4UM9 D;  3C5M A;  3PVW B;  3MZL A;  3L4O D;  3ZE0 B;  3F3G A;  3SN6 B;  5FLX g;  4UM9 B;  4U1E I;  3UR4 A;  5CXC A;  2YNP A;  4CY2 A;  3OW8 A;  5AFU 3;  4A0A A;  3SXT D;  5TEE A;  3SHF A;  1YUK A;  1U8C B;  1GOT B;  4Z7N B;  2IWF A;  3JPX A;  3IJ0 A;  4A0B A;  1GXR A;  2IWK A;  1TYQ C;  4CZY A;  4CZX A;  2XYI A;  5GMK n;  3C9C A;  5IC7 A;  1N6D A;  4BL0 A;  4X63 B;  3UKR C;  5E6U B;  3J81 g;  5E6R B;  5EAM A;  5EMM B;  2VDR B;  2VDN B;  2HKM A;  2JWH A;  3ZE1 B;  2EBS A;  3RFG A;  1PI6 A;  2OK6 A;  3BG0 A;  2B5M A;  3OL2 A;  3EU7 A;  3KRW B;  3JZH A;  1FWX A;  2JWG A;  3NVQ A;  4K3I D;  4J0W A;  5HE1 B;  2OJY A;  4IA9 A;  3N0E A;  5IGQ A;  4L3G D;  3OTT A;  4Y5R D;  1SQ9 A;  3RN0 D;  5GSA A;  3I7L A;  3JB9 L;  3ULE C;  4MK0 B;  4PSX B;  5FXY A;  4A08 A;  5HE3 B;  3IJC A;  3OKY A;  2GNQ A;  3CFS B;  1L0Q A;  3EI2 A;  3NIG B;  2H3X A;  3AFC A;  1SHY B;  2PM9 B;  5GXH A;  5IT9 g;  1RI6 A;  2I3T A;  5THA A;  4N14 A;  3UVN A;  4E5Z A;  4OWR A;  2P9I C;  4JSX C;  5CXB B;  2IUR A;  3K26 A;  3DXM C;  4I79 A;  4JD2 C;  3K27 A;  4GM8 A;  3V9F A;  2AH1 A;  1SQJ A;  3UVL A;  2PBI B;  1XHM A;  5EMJ B;  2YB8 B;  4OZU A;  4XYH A;  3ZDZ B;  3SFZ A;  4E5Z B;  5I5I A;  3GRE A;  1P22 A;  3B7F A;  3MXX A;  4FA5 D;  4KFM B;  3KRX B;  4IMM A;  4D0K A;  4HDJ A;  2VC2 B;  3EI2 B;  2IUQ A;  3SMR A;  4J81 A;  4UI9 R;  3V5W B;  3EMH A;  2XU7 A;  5TEF A;  2H6K A;  2AQ5 A;  2CN2 A;  4CI8 A;  3JZN A;  5AMS A;  3AL8 A;  1VYH C;  3I7O A;  1B9Y A;  4ZN4 A;  1ERJ A;  5EAL A;  2I3S A;  2YNN A;  3I7P A;  2PM9 A;  3RLM D;  4E54 B;  4J8B A;  2CO0 C;  2GC4 A;  3PSC B;  4A2L A;  1NR0 A;  4D6V A;  2OK4 A;  4A08 B;  4GQ1 A;  4QT8 A;  4J0X A;  2CN3 A;  2P9N C;  3SBP A;  1MDA H;  4GM3 A;  3MKS B;  4A0B B;  3T3P B;  4O45 A;  3RFH A;  3VI3 B;  4X3E A;  4BUJ C;  3A0F A;  2IAA A;  3RRM C;  1GP2 B;  4ZOX A;  1K8K C;  2P9U C;  3W15 A;  2OVR B;  3VI4 B;  4CC9 A;  3AL8 B;  2YMU A;  4GZ8 A;  3DM0 A;  4CI2 A;  5C2V B;  3CFV A;  5SXM A;  3FM0 A;  3HFQ A;  4QL1 A;  5EAP A;  4FB1 D;  4A11 A;  3MKQ A;  4JT5 C;  5AJA A;  5HDB B;  1U4C A;  3IIY A;  4O9D A;  1OLZ A;  4AOW A;  2CE8 A;  2J56 H;  4E54 A;  4Z8L A;  1R5M A;  4WK2 B;  3JAM g;  4JSP C;  4J84 A;  1N6F A;  3AL9 A;  4J73 A;  5GXI A;  4CY5 A;  1NEX B;  5EML B;  2PM6 B;  3PXT D;  5TF2 A;  2P28 A;  3JZG A;  3V7D B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...