3AL8A

Plexin a2 / semaphorin 6a complex
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
550
structure length
537
Chain Sequence
GFPEDSEPISITKQYPVFVGHRHRLDIQMIMIMNRTLYVAARDHIYTVDIDTSHTEEIYCSKKLTWKSRQADVDTCRMKGKHKDECHNFIKVLLKKNDDTLFVCGTNAFNPSCRNYRVDTLETFGDEFSGMARCPYDAKHANIALFADGKLYSATVTDFLAIDAVIYRSLGDSPTLRTVKHDSKWLKEPYFVQAVDYGDYIYFFFREIAVEYNTMGKVVFPRVAQVCKNDMGGSQRVLEKQWTSFLKARLNCSVPGDSHFYFNILQAVTDVIRINGRDVVLATFSTPYNSIPGSAVCAYDMLDIANVFTGRFKEQKSPDSTWTPVPDERVPKPRPGCCAGSSSLEKYATSNEFPDDTLNFIKTHPLMDEAVPSIINRPWFLRTMVRYRLTKIAVDNAAGPYQNHTVVFLGSEKGIILKFLARIGSSGFLNGSLFLEEMNVYNPEKCSYDGVEDKRIMGMQLDRASGSLYVAFSTCVIKVPLGRCERHGKCKKTCIASRDPYCGWVRESGSCAHLSPLSRLTFEQDIERGNTDGLGDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for semaphorin signalling through the plexin receptor.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Semaphorin-6A
total genus 111
structure length 537
sequence length 550
ec nomenclature
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01403 Sema Sema domain
A PF01437 PSI Plexin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3al8A01
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3al8A02
4QRJA 2VDOB 2VC2B 4J86A 2H68A 2IUQA 5EAMA 5H17A 2B4EA 3F3GA 4JSVC 2IUVA 1XIPA 1GXRA 2PM9B 3RFHA 3UKRC 5TEFA 3PSLA 4PSXB 5HQGA 1MG3A 4J81A 3B7FA 2HKRA 4J0XA 4Y7RA 2HYEA 2B5MA 4XEIC 3MZLA 2H47A 2AH0A 4G56B 2P26A 4GGDA 2VDMB 3EI2A 1YUKA 2XU7A 3PSCB 2W18A 2VDLB 1PGUA 3VI3B 5TEEA 5K19A 2HJ4A 3N0EA 4U1EI 2H13A 4ERQA 5IJ8E 1B9XA 2BBKH 3CFSB 4A0AA 2P28A 4L3GD 4WK2B 3IJCA 1S4UX 3HFQA 4O1QD 2VDKB 3VI4B 4CZYA 5TF2A 5KDOB 1R5MA 4GZ8A 5IT9g 3OL2B 3RRMC 2OJYA 3IKOA 4UI9R 3MKSB 2O9KA 2CN2A 3I2NA 2UZXB 5HYNB 4BL0A 2CE9A 3EG6A 3RLMD 3I7KA 3ODTA 3JZGA 5CXCA 3C9CA 3L4OD 5CXBA 4A09A 5FQDA 3SLED 4ZN4A 3CFVA 2Z2OA 4A7JA 3OKWA 5E6SB 2J56H 3V7DB 4EWRA 5AJAA 2HJBA 4BH6A 3AL9A 5B4WA 5A2Qg 3F3PA 3ZWLB 3FRXA 4PNKB 4CI2A 5EAPA 4HDJA 4UM9D 3MXXA 4WJKB 5EMMB 3C99A 4XYIA 1U8CB 4CZXA 3UVNA 3U4YA 3JB9L 4A0AB 1P22A 4YVDA 5HE1B 3BG1A 4FAND 2UZYB 1K32A 4GQBB 5H14A 4ZOZA 4A08B 4PXWA 4JD2C 3ZE2B 2Z2PA 4CI3A 3IJ0A 1FWXA 4PC0A 2P9LC 2P9PC 4E5ZA 4GM3A 4UM8B 5TDHB 4AEZA 2VDQB 5GSAA 4JSPC 1TBGA 5SXMA 3I8EA 3NVNA 5C2VB 2I0RA 3KRWB 3MKQA 3EI3B 5JWZA 4J82A 4J79A 3IIYA 4TZ4A 2PM9A 5IJ7E 5H1MA 2H9LA 3NVQA 5GXIA 4A0BB 4QT8A 5C9ZB 1JMZB 2QXVA 2MTAH 4A2LA 3DXMC 2OK6A 3SFZA 3AL8B 4PSWB 2H6KA 5IC7A 1JMXB 4GQ1A 5EMKB 4AOWA 4KFMB 5AFU3 1N6EA 4GQ2P 3GFCA 5EMLB 2IUPA 3RN0D 3AFCA 3EI1A 3EU7A 1SQJA 3SHFA 3VA6A 4OZUA 4CI1A 1N6FA 2I0SA 5AMSA 2P9KC 2Q7QA 3GREA 3PVUB 5I5IA 3ZE0B 2G99A 1NEXB 4Z7NB 3L4MD 3SN6B 4J87A 4FB1D 1GP2B 2EBSA 3SMRA 3N0DA 3F3FA 1GOTB 3UR4A 3J80g 2YMUA 5CYKB 4ZOXA 2XL2A 1QNIA 3UKUC 2OVPB 5CXBB 2G9AA 4LG8A 4OWRA 2IWKA 2OK4A 4K3ID 2AGZA 4A0BA 1U4CA 3RN1D 2GC4A 2AGWA 4L9OA 4L1QD 3FGBA 1MG2A 2YNOA 3K27A 2CO0C 4JT6C 4A11A 3SWSD 1SQ9A 1ERJA 2YNPA 3MZKA 5K1CC 3UVKA 4FA5D 2YBAA 4MK0B 1MDAH 4A2MA 4FAVD 4CY5A 2B5LA 3SBRA 2GC7A 1TYEB 3AH8B 4NSXA 3PE7A 1JJUB 4JSNC 2HESX 3I7PA 3SVWD 3NVXA 3EWEA 4WK4B 2YB8B 3ZDXB 1Q47A 2CN3A 2PM6B 3FM0A 5C2WB 2TRCB 4K3JB 2P9NC 1XKSA 3OW8A 4ERZA 3ZDZB 1SHYB 4FA1D 4D6VA 5FA5B 2IAAA 4PBYA 4O9DA 4FA9D 3UVOA 2H3XA 3DXKC 4J8GA 3EI3A 4GM8A 3I7HA 5FLXg 3DSMA 4JT5C 4J78A 2AGXA 1NR0A 3OKYA 2VDNB 2I0TA 2OIZA 3SJLD 4CY2A 1RI6A 3SCYA 3NIGB 4IA9A 4ESGA 5CXCB 3OL2A 2VDRB 1VYHC 3PVWB 4CZVA 3EI4A 4A09B 3JRPA 4O3TB 4GM9A 3ZE1B 5THAA 3DM0A 4Z7QB 4ZOYA 2Z2NA 2QC5A 4X60B 4WK0B 5FKSA 3T3MB 3JROA 3EI1B 3AL8A 5EM2A 4O45A 3C5MA 4H5IA 5FXYA 4GGCA 3NIFB 4IMMA 3VH0A 2PM7B 3I89A 3T3PB 4GMBA 1XHMA 3RFGA 2H14A 1YFQA 1B9YA 3OTTA 4FA4D 4CY1A 5I5MA 2IWFA 3E0CA 5EARA 1TYQC 4JXMA 1GG2B 3IIWA 3RMZD 2BCJB 2OVQB 1PI6A 3I7LA 4CI8A 2AH1A 4R7AB 4U7AA 2H6NA 3W15A 3OKYB 2XL3A 1L0QA 5HE0B 4O3UB 5E6RB 5GXHA 2CNXA 4D0KA 3EI2B 2P9UC 5IGOA 2VDPB 5CYKA 5E6UB 2B5NA 3ZDYB 2J55H 2AGYA 3EI4B 2I3SA 2J57G 1K8KC 3C75H 3SBQA 3ULEC 1SSLA 3KRXB 3JZHA 1PBYB 5HE3B 4CC9A 2P9SC 4E5ZB 2HKMA 4ES0A 2AGLA 4A11B 1A0RB 5EALA 4X3EA 3MMYA 4JSXC 5EM2B 4Z8LA 4PBZA 4QL1A 3JZNA 3NIDB 5HE2B 4J73A 2CE8A 4FHLA 2AQ5A 2CO0A 2YNNA 3V9FA 4QQEA 1JOFA 1U2VC 3ORVD 3V5WB 3JAMg 4X61B 3CIKB 4E54B 4Z7OB 2GNQA 3FCUB 5FKQA 2H9MA 4I79A 2XYIA 3RSEC 3OKTA 3PXSD 1PEVA 5FKRA 5EMJB 3I7NA 5FKTA 2H9PA 2I3TA 5IGQA 4Y5RD 3P4FA 4ERYA 5I5JA 3EMHA 4H5JA 4LGNA 4X63B 4GGAA 4UM9B 1N6DA 3SBPA 2HXCA 2PBIB 4A08A 1OLZA 4J8BA 3UVLA 3A0FA 4J84A 4BUJC 3IJ1A 3J81g 1OMWB 4ZOVA 4FWWA 4LG9A 3DWLC 2IURA 3BG0A 3PXWD 4L3HD 3I7OA 3BWSA 3I8CA 3K26A 4J0WA 3SXTD 4CY3A 5HDBB 2P9IC 2OVRB 3PXTD 4XYHA 2H9NA 3JPXA 5GMKn 3UVMA 4N14A 4J77A 4E54A 2H6QA 3VGZA
chains in the Genus database with same CATH superfamily
4QRJA 2VDOB 2BKLA 2VC2B 4J86A 2H68A 2IUQA 5EAMA 5H17A 2B4EA 3F3GA 4JSVC 2IUVA 2VZ3A 1XIPA 3NIFA 1GXRA 2PM9B 2XZGA 3RFHA 3UKRC 5TEFA 3PSLA 4PSXB 5HQGA 1MG3A 4J81A 3B7FA 2HKRA 4J0XA 1QFMA 4Y7RA 2HYEA 4L1MA 2B5MA 4XEIC 3MZLA 2H47A 2AH0A 4G56B 2P26A 4GGDA 2VDMB 1QFSA 1GOGA 3EI2A 1YUKA 2XU7A 3PSCB 2W18A 3MVDK 2VDLB 1PGUA 3VI3B 5TEEA 5K19A 2HJ4A 3N0EA 4U1EI 2H13A 4ERQA 5IJ8E 3EQ9A 1B9XA 4Z7NA 2BBKH 3CFSB 4A0AA 2P28A 4L3GD 3EQ7A 3IJCA 1S4UX 3HFQA 4O1QD 4WK2B 2VDKB 3VI4B 4CZYA 5TF2A 5KDOB 1R5MA 1K3IA 4GZ8A 5IT9g 4JHPC 2VDRA 3OL2B 3RRMC 2OJYA 5C86A 3IKOA 4G55A 4UI9R 2JWHA 3MKSB 1GOHA 2O9KA 4BP9A 2CN2A 3I2NA 3O4GA 2EICA 2UZXB 5HYNB 4D9SA 4BL0A 2CE9A 1M1XA 3EG6A 3RLMD 3I7KA 3IUMA 3ODTA 3JZGA 5CXCA 3C9CA 3L4OD 5CXBA 4IRZA 4A09A 4BCCA 5FQDA 4RE5A 3SLED 3IJEA 4ZN4A 3CFVA 2Z2OA 4A7JA 3OKWA 3K71A 2J56H 3V7DB 5E6SB 4EWRA 5AJAA 2HJBA 4BH6A 3T3MA 3AL9A 1H2WA 5B4WA 5A2Qg 3F3PA 5M5TA 3ZWLB 5M5SA 3FRXA 4PNKB 4CI2A 5EAPA 4HDJA 3QHYB 4UM9D 3MXXA 1H2XA 2XE4A 4BP8A 4WJKB 5M5RA 5EMMB 3O4HA 3C99A 3IUNA 4XYIA 1U8CB 4CZXA 3UVNA 3U4YA 3JB9L 4A0AB 1P22A 4YVDA 5HE1B 3BG1A 4FAND 4DNUA 2UZYB 1K32A 4GQBB 5H14A 4ZOZA 4A08B 3ZDXA 2VDPA 4PXWA 4JD2C 3ZE2B 2Z2PA 2QZPA 3IJ0A 4CI3A 1FWXA 4PC0A 1C9LA 5M5VA 2P9LC 2P9PC 2HU5A 4MMYA 4E5ZA 4GM3A 4UM8B 5TDHB 4AEZA 2VDQB 5GSAA 3DDUA 1TBGA 4JSPC 5SXMA 3I8EA 3NVNA 5C2VB 2I0RA 3KRWB 3MKQA 4G1EA 3EI3B 4AMZA 2JWGA 5JWZA 4J82A 4J79A 3IIYA 4TZ4A 2PM9A 5IJ7E 5H1MA 2H9LA 1I2MB 4Z7QA 3NVQA 5GXIA 4A0BB 4QT8A 5C9ZB 1JMZB 2QXVA 2MTAH 4A2LA 4Z7OA 3DXMC 2OK6A 3SFZA 3AL8B 4PSWB 2H6KA 5IC7A 1JMXB 4GQ1A 4WJKA 5EMKB 4AOWA 4KFMB 5AFU3 1N6EA 4GQ2P 3GFCA 5EMLB 3GD1I 2IUPA 3O4JA 3RN0D 3AFCA 1TYEA 1O6FA 3EI1A 1BPOA 3EU7A 1SQJA 3SHFA 3VA6A 3OF7A 4OZUA 4CI1A 1N6FA 3VI4A 5C92A 2I0SA 5AMSA 2EIEA 2P9KC 2Q7QA 3T3PA 4BCDA 3GREA 3PVUB 5I5IA 3ZE0B 2G99A 1NEXB 4Z7NB 3L4MD 3SN6B 4J87A 4FB1D 1GP2B 4UM8A 2EBSA 3SMRA 2VDKA 3V4VA 3N0DA 3F3FA 1GOTB 5E6RA 5FFOA 3UR4A 3J80g 2YMUA 5CYKB 4ZOXA 5E6UA 2XL2A 1QNIA 3UKUC 2OVPB 5CXBB 2G9AA 4LG8A 4OWRA 2IWKA 2OK4A 4K3ID 2AGZA 4A0BA 1U4CA 3RN1D 1UTCA 2GC4A 2AGWA 4L9OA 4L1QD 3EQ8A 3FGBA 1MG2A 2YNOA 3IUQA 2CO0C 3K27A 4JT6C 4A11A 3SWSD 1SQ9A 1ERJA 2YNPA 3MZKA 5HDBA 1VZ2A 5K1CC 3UVKA 4FA5D 1UOPA 2YBAA 4MK0B 2EIDA 1MDAH 1UOOA 4A2MA 4FAVD 4CY5A 2B5LA 3SBRA 2GC7A 1TYEB 2VDOA 3AH8B 4NSXA 3PE7A 1JJUB 4JSNC 2HESX 3I7PA 3SVWD 3NVXA 3EWEA 3V4PA 4WK4B 2YB8B 3ZDXB 1Q47A 4MMXA 1E5TA 2CN3A 1U8CA 2PM6B 3FM0A 3MUOA 5C2WB 3K6SA 1C9IA 5M5UA 3VI3A 2TRCB 4K3JB 2P9NC 1XKSA 3OW8A 4ERZA 3ZDZB 2WQ8A 1SHYB 4FA1D 4D6VA 1VE6A 4DNVA 5FA5B 2IAAA 4O02A 4PBYA 4O9DA 4FA9D 1O6GA 3UVOA 3K72A 2H3XA 4NAAA 3DXKC 3IURA 4J8GA 3EI3A 4GM8A 3I7HA 5FLXg 3DSMA 4JT5C 4J78A 2AGXA 1NR0A 3OKYA 2VDNB 2I0TA 2OIZA 3SJLD 4AX4A 4CY2A 1RI6A 3SCYA 3NIGB 4IA9A 3KCIA 5CXCB 3OL2A 4ESGA 2VDRB 1VYHC 3PVWB 4CZVA 3EI4A 4A09B 5FFGA 3JRPA 4O3TB 4GM9A 3ZE1B 5THAA 3DM0A 4Z7QB 4ZOYA 2Z2NA 5E6SA 2HU8A 2QC5A 4X60B 4WK0B 5FKSA 3T3MB 3JROA 3EI1B 3AL8A 2VC2A 5EM2A 4O45A 4AMYA 3C5MA 4H5IA 5FXYA 4GGCA 3NIFB 4DNWA 4AN1A 4IMMA 3VH0A 2PM7B 3I89A 3T3PB 4GMBA 1XHMA 3RFGA 1YFQA 1B9YA 2H14A 3OTTA 4FA4D 4CY1A 5I5MA 2IWFA 3E0CA 5EARA 1TYQC 4JXMA 1GG2B 2VDMA 1H2ZA 3IIWA 3RMZD 2BCJB 2OVQB 1VE7A 1PI6A 3I7LA 4CI8A 1YR2A 2AH1A 4R7AB 4U7AA 2H6NA 3W15A 4JHNA 3OKYB 1E8NA 2XL3A 1L0QA 5HE0B 4O3UB 5E6RB 1GOFA 4WK2A 5GXHA 2CNXA 4D0KA 3EI2B 2P9UC 5IGOA 1JV2A 4UM9A 2VDPB 3IUJA 5CYKA 5E6UB 2B5NA 3ZDYB 2J55H 2VDLA 2AGYA 3EI4B 2I3SA 2J57G 1K8KC 3C75H 3SBQA 3ULEC 1SSLA 3KRXB 1E8MA 2JKXA 1PBYB 3JZHA 5HE3B 3ZE1A 4CC9A 2P9SC 4E5ZB 2VDQA 2HKMA 4ES0A 2AGLA 3MUNA 4A11B 4NC4A 2QR5A 1A0RB 5EALA 4X3EA 3MMYA 4JSXC 5EM2B 4Z8LA 3GC3B 4PBZA 4QL1A 3JZNA 3NIDB 5HE2B 4J73A 2CE8A 4FHLA 4BCBA 2AQ5A 2CO0A 2YNNA 3V9FA 4WK4A 4QQEA 1JOFA 1U2VC 3ORVD 4MMZA 3V5WB 3JAMg 4RE6A 1UOQA 4X61B 3CIKB 4E54B 4Z7OB 1JTDB 2GNQA 3FCUB 5FKQA 2H9MA 4I79A 2XYIA 3RSEC 3OKTA 4NENA 3PXSD 1PEVA 2VZ1A 5FKRA 1A12A 5EMJB 3I7NA 5FKTA 4AN0A 2H9PA 2I3TA 5IGQA 4Y5RD 3P4FA 3QI0A 3ZDZA 4ERYA 2EIBA 3ZE0A 5I5JA 5M61A 3EMHA 4H5JA 4LGNA 4X63B 2VDNA 4GGAA 4UM9B 1N6DA 3SBPA 2HXCA 1VZ3A 3ZDYA 2PBIB 2XDWA 4A08A 1OLZA 4J8BA 4NBMA 3UVLA 2HU7A 3A0FA 4J84A 4BUJC 3FCSA 3IJ1A 1H2YA 3J81g 1OMWB 4ZOVA 3IULA 4FWWA 1L5GA 4LG9A 3IVMA 4G1MA 3DWLC 3NIGA 2IURA 3BG0A 1T2XA 3PXWD 4QAMA 4WK0A 3ZE2A 4L3HD 3I7OA 3BWSA 3I8CA 3K26A 3NIDA 4J0WA 3SXTD 4CY3A 3O4IA 5HDBB 2P9IC 2OVRB 3PXTD 4XYHA 2H9NA 3JPXA 5GMKn 3UVMA 4N14A 4J77A 4E54A 2H6QA 3FCUA 4O2WA 3VGZA
chains in the Genus database with same CATH topology
4QRJA 2VDOB 2VC2B 4J86A 2H68A 2IUQA 5EAMA 5H17A 2B4EA 3F3GA 4JSVC 2IUVA 1XIPA 1GXRA 2PM9B 3RFHA 3UKRC 5TEFA 3PSLA 4PSXB 5HQGA 1MG3A 4J81A 3B7FA 2HKRA 4J0XA 4Y7RA 2HYEA 2B5MA 4XEIC 3MZLA 2H47A 2AH0A 4G56B 2P26A 4GGDA 2VDMB 3EI2A 1YUKA 2XU7A 3PSCB 2W18A 2VDLB 1PGUA 3VI3B 5TEEA 5K19A 2HJ4A 3N0EA 4U1EI 2H13A 4ERQA 5IJ8E 1B9XA 2BBKH 3CFSB 4A0AA 2P28A 4L3GD 4WK2B 3IJCA 1S4UX 3HFQA 4O1QD 2VDKB 3VI4B 4CZYA 5TF2A 5KDOB 1R5MA 4GZ8A 5IT9g 3OL2B 3RRMC 2OJYA 3IKOA 4UI9R 2JWHA 3MKSB 2O9KA 2CN2A 3I2NA 2UZXB 5HYNB 4BL0A 2CE9A 3EG6A 3RLMD 3I7KA 3ODTA 3JZGA 5CXCA 3C9CA 3L4OD 5CXBA 4A09A 5FQDA 3SLED 4ZN4A 3CFVA 2Z2OA 4A7JA 3OKWA 5E6SB 2J56H 3V7DB 4EWRA 5AJAA 2HJBA 4BH6A 3AL9A 5B4WA 5A2Qg 3F3PA 3ZWLB 3FRXA 4PNKB 4CI2A 5EAPA 4HDJA 4UM9D 3MXXA 4WJKB 5EMMB 3C99A 4XYIA 1U8CB 4CZXA 3UVNA 3U4YA 3JB9L 4A0AB 1P22A 4YVDA 5HE1B 3BG1A 4FAND 2UZYB 1K32A 4GQBB 5H14A 4ZOZA 4A08B 4PXWA 4JD2C 3ZE2B 2Z2PA 4CI3A 3IJ0A 1FWXA 4PC0A 2P9LC 2P9PC 4E5ZA 4GM3A 4UM8B 5TDHB 4AEZA 2VDQB 5GSAA 4JSPC 1TBGA 5SXMA 3I8EA 3NVNA 5C2VB 2I0RA 3KRWB 3MKQA 3EI3B 2JWGA 5JWZA 4J82A 4J79A 3IIYA 4TZ4A 2PM9A 5IJ7E 5H1MA 2H9LA 3NVQA 5GXIA 4A0BB 4QT8A 5C9ZB 1JMZB 2QXVA 2MTAH 4A2LA 3DXMC 2OK6A 3SFZA 3AL8B 4PSWB 2H6KA 5IC7A 1JMXB 4GQ1A 5EMKB 4AOWA 4KFMB 5AFU3 1N6EA 4GQ2P 3GFCA 5EMLB 2IUPA 3RN0D 3AFCA 3EI1A 3EU7A 1SQJA 3SHFA 3VA6A 4OZUA 4CI1A 1N6FA 2I0SA 5AMSA 2P9KC 2Q7QA 3GREA 3PVUB 5I5IA 3ZE0B 2G99A 1NEXB 4Z7NB 3L4MD 3SN6B 4J87A 4FB1D 1GP2B 2EBSA 3SMRA 3N0DA 3F3FA 1GOTB 3UR4A 3J80g 2YMUA 5CYKB 4ZOXA 2XL2A 1QNIA 3UKUC 2OVPB 5CXBB 2G9AA 4LG8A 4OWRA 2IWKA 2OK4A 4K3ID 2AGZA 4A0BA 1U4CA 3RN1D 2GC4A 2AGWA 4L9OA 4L1QD 3FGBA 1MG2A 2YNOA 3K27A 2CO0C 4JT6C 4A11A 3SWSD 1SQ9A 1ERJA 2YNPA 3MZKA 5K1CC 3UVKA 4FA5D 2YBAA 4MK0B 1MDAH 4A2MA 4FAVD 4CY5A 2B5LA 3SBRA 2GC7A 1TYEB 3AH8B 4NSXA 3PE7A 1JJUB 4JSNC 2HESX 3I7PA 3SVWD 3NVXA 3EWEA 4WK4B 2YB8B 3ZDXB 1Q47A 2CN3A 2PM6B 3FM0A 5C2WB 2TRCB 4K3JB 2P9NC 1XKSA 3OW8A 4ERZA 3ZDZB 1SHYB 4FA1D 4D6VA 5FA5B 2IAAA 4PBYA 4O9DA 4FA9D 3UVOA 2H3XA 3DXKC 4J8GA 3EI3A 4GM8A 3I7HA 5FLXg 3DSMA 4JT5C 4J78A 2AGXA 1NR0A 3OKYA 2VDNB 2I0TA 2OIZA 3SJLD 4CY2A 1RI6A 3SCYA 3NIGB 4IA9A 4ESGA 5CXCB 3OL2A 2VDRB 1VYHC 3PVWB 4CZVA 3EI4A 4A09B 3JRPA 4O3TB 4GM9A 3ZE1B 5THAA 3DM0A 4Z7QB 4ZOYA 2Z2NA 2QC5A 4X60B 4WK0B 5FKSA 3T3MB 3JROA 3EI1B 3AL8A 5EM2A 4O45A 3C5MA 4H5IA 5FXYA 4GGCA 3NIFB 4IMMA 3VH0A 2PM7B 3I89A 3T3PB 4GMBA 1XHMA 3RFGA 2H14A 1YFQA 1B9YA 3OTTA 4FA4D 4CY1A 5I5MA 2IWFA 3E0CA 5EARA 1TYQC 4JXMA 1GG2B 3IIWA 3RMZD 2BCJB 2OVQB 1PI6A 3I7LA 4CI8A 2AH1A 4R7AB 4U7AA 2H6NA 3W15A 3OKYB 2XL3A 1L0QA 5HE0B 4O3UB 5E6RB 5GXHA 2CNXA 4D0KA 3EI2B 2P9UC 5IGOA 2VDPB 5CYKA 5E6UB 2B5NA 3ZDYB 2J55H 2AGYA 3EI4B 2I3SA 2J57G 1K8KC 3C75H 3SBQA 3ULEC 1SSLA 3KRXB 3JZHA 1PBYB 5HE3B 4CC9A 2P9SC 4E5ZB 2HKMA 4ES0A 2AGLA 4A11B 1A0RB 5EALA 4X3EA 3MMYA 4JSXC 5EM2B 4Z8LA 4PBZA 4QL1A 3JZNA 3NIDB 5HE2B 4J73A 2CE8A 4FHLA 2AQ5A 2CO0A 2YNNA 3V9FA 4QQEA 1JOFA 1U2VC 3ORVD 3V5WB 3JAMg 4X61B 3CIKB 4E54B 4Z7OB 2GNQA 3FCUB 5FKQA 2H9MA 4I79A 2XYIA 3RSEC 3OKTA 3PXSD 1PEVA 5FKRA 5EMJB 3I7NA 5FKTA 2H9PA 2I3TA 5IGQA 4Y5RD 3P4FA 4ERYA 5I5JA 3EMHA 4H5JA 4LGNA 4X63B 4GGAA 4UM9B 1N6DA 3SBPA 2HXCA 2PBIB 4A08A 1OLZA 4J8BA 3UVLA 3A0FA 4J84A 4BUJC 3IJ1A 3J81g 1OMWB 4ZOVA 4FWWA 4LG9A 3DWLC 2IURA 3BG0A 3PXWD 4L3HD 3I7OA 3BWSA 3I8CA 3K26A 4J0WA 3SXTD 4CY3A 5HDBB 2P9IC 2OVRB 3PXTD 4XYHA 2H9NA 3JPXA 5GMKn 3UVMA 4N14A 4J77A 4E54A 2H6QA 3VGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QRJ A;  2VDO B;  2VC2 B;  4J86 A;  2H68 A;  2IUQ A;  5EAM A;  5H17 A;  2B4E A;  3F3G A;  4JSV C;  2IUV A;  1XIP A;  1GXR A;  2PM9 B;  3RFH A;  3UKR C;  5TEF A;  3PSL A;  4PSX B;  5HQG A;  1MG3 A;  4J81 A;  3B7F A;  2HKR A;  4J0X A;  4Y7R A;  2HYE A;  2B5M A;  4XEI C;  3MZL A;  2H47 A;  2AH0 A;  4G56 B;  2P26 A;  4GGD A;  2VDM B;  3EI2 A;  1YUK A;  2XU7 A;  3PSC B;  2W18 A;  2VDL B;  1PGU A;  3VI3 B;  5TEE A;  5K19 A;  2HJ4 A;  3N0E A;  4U1E I;  2H13 A;  4ERQ A;  5IJ8 E;  1B9X A;  2BBK H;  3CFS B;  4A0A A;  2P28 A;  4L3G D;  4WK2 B;  3IJC A;  1S4U X;  3HFQ A;  4O1Q D;  2VDK B;  3VI4 B;  4CZY A;  5TF2 A;  5KDO B;  1R5M A;  4GZ8 A;  5IT9 g;  3OL2 B;  3RRM C;  2OJY A;  3IKO A;  4UI9 R;  3MKS B;  2O9K A;  2CN2 A;  3I2N A;  2UZX B;  5HYN B;  4BL0 A;  2CE9 A;  3EG6 A;  3RLM D;  3I7K A;  3ODT A;  3JZG A;  5CXC A;  3C9C A;  3L4O D;  5CXB A;  4A09 A;  5FQD A;  3SLE D;  4ZN4 A;  3CFV A;  2Z2O A;  4A7J A;  3OKW A;  5E6S B;  2J56 H;  3V7D B;  4EWR A;  5AJA A;  2HJB A;  4BH6 A;  3AL9 A;  5B4W A;  5A2Q g;  3F3P A;  3ZWL B;  3FRX A;  4PNK B;  4CI2 A;  5EAP A;  4HDJ A;  4UM9 D;  3MXX A;  4WJK B;  5EMM B;  3C99 A;  4XYI A;  1U8C B;  4CZX A;  3UVN A;  3U4Y A;  3JB9 L;  4A0A B;  1P22 A;  4YVD A;  5HE1 B;  3BG1 A;  4FAN D;  2UZY B;  1K32 A;  4GQB B;  5H14 A;  4ZOZ A;  4A08 B;  4PXW A;  4JD2 C;  3ZE2 B;  2Z2P A;  4CI3 A;  3IJ0 A;  1FWX A;  4PC0 A;  2P9L C;  2P9P C;  4E5Z A;  4GM3 A;  4UM8 B;  5TDH B;  4AEZ A;  2VDQ B;  5GSA A;  4JSP C;  1TBG A;  5SXM A;  3I8E A;  3NVN A;  5C2V B;  2I0R A;  3KRW B;  3MKQ A;  3EI3 B;  5JWZ A;  4J82 A;  4J79 A;  3IIY A;  4TZ4 A;  2PM9 A;  5IJ7 E;  5H1M A;  2H9L A;  3NVQ A;  5GXI A;  4A0B B;  4QT8 A;  5C9Z B;  1JMZ B;  2QXV A;  2MTA H;  4A2L A;  3DXM C;  2OK6 A;  3SFZ A;  3AL8 B;  4PSW B;  2H6K A;  5IC7 A;  1JMX B;  4GQ1 A;  5EMK B;  4AOW A;  4KFM B;  5AFU 3;  1N6E A;  4GQ2 P;  3GFC A;  5EML B;  2IUP A;  3RN0 D;  3AFC A;  3EI1 A;  3EU7 A;  1SQJ A;  3SHF A;  3VA6 A;  4OZU A;  4CI1 A;  1N6F A;  2I0S A;  5AMS A;  2P9K C;  2Q7Q A;  3GRE A;  3PVU B;  5I5I A;  3ZE0 B;  2G99 A;  1NEX B;  4Z7N B;  3L4M D;  3SN6 B;  4J87 A;  4FB1 D;  1GP2 B;  2EBS A;  3SMR A;  3N0D A;  3F3F A;  1GOT B;  3UR4 A;  3J80 g;  2YMU A;  5CYK B;  4ZOX A;  2XL2 A;  1QNI A;  3UKU C;  2OVP B;  5CXB B;  2G9A A;  4LG8 A;  4OWR A;  2IWK A;  2OK4 A;  4K3I D;  2AGZ A;  4A0B A;  1U4C A;  3RN1 D;  2GC4 A;  2AGW A;  4L9O A;  4L1Q D;  3FGB A;  1MG2 A;  2YNO A;  3K27 A;  2CO0 C;  4JT6 C;  4A11 A;  3SWS D;  1SQ9 A;  1ERJ A;  2YNP A;  3MZK A;  5K1C C;  3UVK A;  4FA5 D;  2YBA A;  4MK0 B;  1MDA H;  4A2M A;  4FAV D;  4CY5 A;  2B5L A;  3SBR A;  2GC7 A;  1TYE B;  3AH8 B;  4NSX A;  3PE7 A;  1JJU B;  4JSN C;  2HES X;  3I7P A;  3SVW D;  3NVX A;  3EWE A;  4WK4 B;  2YB8 B;  3ZDX B;  1Q47 A;  2CN3 A;  2PM6 B;  3FM0 A;  5C2W B;  2TRC B;  4K3J B;  2P9N C;  1XKS A;  3OW8 A;  4ERZ A;  3ZDZ B;  1SHY B;  4FA1 D;  4D6V A;  5FA5 B;  2IAA A;  4PBY A;  4O9D A;  4FA9 D;  3UVO A;  2H3X A;  3DXK C;  4J8G A;  3EI3 A;  4GM8 A;  3I7H A;  5FLX g;  3DSM A;  4JT5 C;  4J78 A;  2AGX A;  1NR0 A;  3OKY A;  2VDN B;  2I0T A;  2OIZ A;  3SJL D;  4CY2 A;  1RI6 A;  3SCY A;  3NIG B;  4IA9 A;  4ESG A;  5CXC B;  3OL2 A;  2VDR B;  1VYH C;  3PVW B;  4CZV A;  3EI4 A;  4A09 B;  3JRP A;  4O3T B;  4GM9 A;  3ZE1 B;  5THA A;  3DM0 A;  4Z7Q B;  4ZOY A;  2Z2N A;  2QC5 A;  4X60 B;  4WK0 B;  5FKS A;  3T3M B;  3JRO A;  3EI1 B;  3AL8 A;  5EM2 A;  4O45 A;  3C5M A;  4H5I A;  5FXY A;  4GGC A;  3NIF B;  4IMM A;  3VH0 A;  2PM7 B;  3I89 A;  3T3P B;  4GMB A;  1XHM A;  3RFG A;  2H14 A;  1YFQ A;  1B9Y A;  3OTT A;  4FA4 D;  4CY1 A;  5I5M A;  2IWF A;  3E0C A;  5EAR A;  1TYQ C;  4JXM A;  1GG2 B;  3IIW A;  3RMZ D;  2BCJ B;  2OVQ B;  1PI6 A;  3I7L A;  4CI8 A;  2AH1 A;  4R7A B;  4U7A A;  2H6N A;  3W15 A;  3OKY B;  2XL3 A;  1L0Q A;  5HE0 B;  4O3U B;  5E6R B;  5GXH A;  2CNX A;  4D0K A;  3EI2 B;  2P9U C;  5IGO A;  2VDP B;  5CYK A;  5E6U B;  2B5N A;  3ZDY B;  2J55 H;  2AGY A;  3EI4 B;  2I3S A;  2J57 G;  1K8K C;  3C75 H;  3SBQ A;  3ULE C;  1SSL A;  3KRX B;  3JZH A;  1PBY B;  5HE3 B;  4CC9 A;  2P9S C;  4E5Z B;  2HKM A;  4ES0 A;  2AGL A;  4A11 B;  1A0R B;  5EAL A;  4X3E A;  3MMY A;  4JSX C;  5EM2 B;  4Z8L A;  4PBZ A;  4QL1 A;  3JZN A;  3NID B;  5HE2 B;  4J73 A;  2CE8 A;  4FHL A;  2AQ5 A;  2CO0 A;  2YNN A;  3V9F A;  4QQE A;  1JOF A;  1U2V C;  3ORV D;  3V5W B;  3JAM g;  4X61 B;  3CIK B;  4E54 B;  4Z7O B;  2GNQ A;  3FCU B;  5FKQ A;  2H9M A;  4I79 A;  2XYI A;  3RSE C;  3OKT A;  3PXS D;  1PEV A;  5FKR A;  5EMJ B;  3I7N A;  5FKT A;  2H9P A;  2I3T A;  5IGQ A;  4Y5R D;  3P4F A;  4ERY A;  5I5J A;  3EMH A;  4H5J A;  4LGN A;  4X63 B;  4GGA A;  4UM9 B;  1N6D A;  3SBP A;  2HXC A;  2PBI B;  4A08 A;  1OLZ A;  4J8B A;  3UVL A;  3A0F A;  4J84 A;  4BUJ C;  3IJ1 A;  3J81 g;  1OMW B;  4ZOV A;  4FWW A;  4LG9 A;  3DWL C;  2IUR A;  3BG0 A;  3PXW D;  4L3H D;  3I7O A;  3BWS A;  3I8C A;  3K26 A;  4J0W A;  3SXT D;  4CY3 A;  5HDB B;  2P9I C;  2OVR B;  3PXT D;  4XYH A;  2H9N A;  3JPX A;  5GMK n;  3UVM A;  4N14 A;  4J77 A;  4E54 A;  2H6Q A;  3VGZ A; 
#chains in the Genus database with same CATH topology
 4QRJ A;  2VDO B;  2BKL A;  2VC2 B;  4J86 A;  2H68 A;  2IUQ A;  5EAM A;  5H17 A;  2B4E A;  3F3G A;  4JSV C;  2IUV A;  2VZ3 A;  1XIP A;  3NIF A;  1GXR A;  2PM9 B;  2XZG A;  3RFH A;  3UKR C;  5TEF A;  3PSL A;  4PSX B;  5HQG A;  1MG3 A;  4J81 A;  3B7F A;  2HKR A;  4J0X A;  1QFM A;  4Y7R A;  2HYE A;  4L1M A;  2B5M A;  4XEI C;  3MZL A;  2H47 A;  2AH0 A;  4G56 B;  2P26 A;  4GGD A;  2VDM B;  1QFS A;  1GOG A;  3EI2 A;  1YUK A;  2XU7 A;  3PSC B;  2W18 A;  3MVD K;  2VDL B;  1PGU A;  3VI3 B;  5TEE A;  5K19 A;  2HJ4 A;  3N0E A;  4U1E I;  2H13 A;  4ERQ A;  5IJ8 E;  3EQ9 A;  1B9X A;  4Z7N A;  2BBK H;  3CFS B;  4A0A A;  2P28 A;  4L3G D;  3EQ7 A;  3IJC A;  1S4U X;  3HFQ A;  4O1Q D;  4WK2 B;  2VDK B;  3VI4 B;  4CZY A;  5TF2 A;  5KDO B;  1R5M A;  1K3I A;  4GZ8 A;  5IT9 g;  4JHP C;  2VDR A;  3OL2 B;  3RRM C;  2OJY A;  5C86 A;  3IKO A;  4G55 A;  4UI9 R;  2JWH A;  3MKS B;  1GOH A;  2O9K A;  4BP9 A;  2CN2 A;  3I2N A;  3O4G A;  2EIC A;  2UZX B;  5HYN B;  4D9S A;  4BL0 A;  2CE9 A;  1M1X A;  3EG6 A;  3RLM D;  3I7K A;  3IUM A;  3ODT A;  3JZG A;  5CXC A;  3C9C A;  3L4O D;  5CXB A;  4IRZ A;  4A09 A;  4BCC A;  5FQD A;  4RE5 A;  3SLE D;  3IJE A;  4ZN4 A;  3CFV A;  2Z2O A;  4A7J A;  3OKW A;  3K71 A;  2J56 H;  3V7D B;  5E6S B;  4EWR A;  5AJA A;  2HJB A;  4BH6 A;  3T3M A;  3AL9 A;  1H2W A;  5B4W A;  5A2Q g;  3F3P A;  5M5T A;  3ZWL B;  5M5S A;  3FRX A;  4PNK B;  4CI2 A;  5EAP A;  4HDJ A;  3QHY B;  4UM9 D;  3MXX A;  1H2X A;  2XE4 A;  4BP8 A;  4WJK B;  5M5R A;  5EMM B;  3O4H A;  3C99 A;  3IUN A;  4XYI A;  1U8C B;  4CZX A;  3UVN A;  3U4Y A;  3JB9 L;  4A0A B;  1P22 A;  4YVD A;  5HE1 B;  3BG1 A;  4FAN D;  4DNU A;  2UZY B;  1K32 A;  4GQB B;  5H14 A;  4ZOZ A;  4A08 B;  3ZDX A;  2VDP A;  4PXW A;  4JD2 C;  3ZE2 B;  2Z2P A;  2QZP A;  3IJ0 A;  4CI3 A;  1FWX A;  4PC0 A;  1C9L A;  5M5V A;  2P9L C;  2P9P C;  2HU5 A;  4MMY A;  4E5Z A;  4GM3 A;  4UM8 B;  5TDH B;  4AEZ A;  2VDQ B;  5GSA A;  3DDU A;  1TBG A;  4JSP C;  5SXM A;  3I8E A;  3NVN A;  5C2V B;  2I0R A;  3KRW B;  3MKQ A;  4G1E A;  3EI3 B;  4AMZ A;  2JWG A;  5JWZ A;  4J82 A;  4J79 A;  3IIY A;  4TZ4 A;  2PM9 A;  5IJ7 E;  5H1M A;  2H9L A;  1I2M B;  4Z7Q A;  3NVQ A;  5GXI A;  4A0B B;  4QT8 A;  5C9Z B;  1JMZ B;  2QXV A;  2MTA H;  4A2L A;  4Z7O A;  3DXM C;  2OK6 A;  3SFZ A;  3AL8 B;  4PSW B;  2H6K A;  5IC7 A;  1JMX B;  4GQ1 A;  4WJK A;  5EMK B;  4AOW A;  4KFM B;  5AFU 3;  1N6E A;  4GQ2 P;  3GFC A;  5EML B;  3GD1 I;  2IUP A;  3O4J A;  3RN0 D;  3AFC A;  1TYE A;  1O6F A;  3EI1 A;  1BPO A;  3EU7 A;  1SQJ A;  3SHF A;  3VA6 A;  3OF7 A;  4OZU A;  4CI1 A;  1N6F A;  3VI4 A;  5C92 A;  2I0S A;  5AMS A;  2EIE A;  2P9K C;  2Q7Q A;  3T3P A;  4BCD A;  3GRE A;  3PVU B;  5I5I A;  3ZE0 B;  2G99 A;  1NEX B;  4Z7N B;  3L4M D;  3SN6 B;  4J87 A;  4FB1 D;  1GP2 B;  4UM8 A;  2EBS A;  3SMR A;  2VDK A;  3V4V A;  3N0D A;  3F3F A;  1GOT B;  5E6R A;  5FFO A;  3UR4 A;  3J80 g;  2YMU A;  5CYK B;  4ZOX A;  5E6U A;  2XL2 A;  1QNI A;  3UKU C;  2OVP B;  5CXB B;  2G9A A;  4LG8 A;  4OWR A;  2IWK A;  2OK4 A;  4K3I D;  2AGZ A;  4A0B A;  1U4C A;  3RN1 D;  1UTC A;  2GC4 A;  2AGW A;  4L9O A;  4L1Q D;  3EQ8 A;  3FGB A;  1MG2 A;  2YNO A;  3IUQ A;  2CO0 C;  3K27 A;  4JT6 C;  4A11 A;  3SWS D;  1SQ9 A;  1ERJ A;  2YNP A;  3MZK A;  5HDB A;  1VZ2 A;  5K1C C;  3UVK A;  4FA5 D;  1UOP A;  2YBA A;  4MK0 B;  2EID A;  1MDA H;  1UOO A;  4A2M A;  4FAV D;  4CY5 A;  2B5L A;  3SBR A;  2GC7 A;  1TYE B;  2VDO A;  3AH8 B;  4NSX A;  3PE7 A;  1JJU B;  4JSN C;  2HES X;  3I7P A;  3SVW D;  3NVX A;  3EWE A;  3V4P A;  4WK4 B;  2YB8 B;  3ZDX B;  1Q47 A;  4MMX A;  1E5T A;  2CN3 A;  1U8C A;  2PM6 B;  3FM0 A;  3MUO A;  5C2W B;  3K6S A;  1C9I A;  5M5U A;  3VI3 A;  2TRC B;  4K3J B;  2P9N C;  1XKS A;  3OW8 A;  4ERZ A;  3ZDZ B;  2WQ8 A;  1SHY B;  4FA1 D;  4D6V A;  1VE6 A;  4DNV A;  5FA5 B;  2IAA A;  4O02 A;  4PBY A;  4O9D A;  4FA9 D;  1O6G A;  3UVO A;  3K72 A;  2H3X A;  4NAA A;  3DXK C;  3IUR A;  4J8G A;  3EI3 A;  4GM8 A;  3I7H A;  5FLX g;  3DSM A;  4JT5 C;  4J78 A;  2AGX A;  1NR0 A;  3OKY A;  2VDN B;  2I0T A;  2OIZ A;  3SJL D;  4AX4 A;  4CY2 A;  1RI6 A;  3SCY A;  3NIG B;  4IA9 A;  3KCI A;  5CXC B;  3OL2 A;  4ESG A;  2VDR B;  1VYH C;  3PVW B;  4CZV A;  3EI4 A;  4A09 B;  5FFG A;  3JRP A;  4O3T B;  4GM9 A;  3ZE1 B;  5THA A;  3DM0 A;  4Z7Q B;  4ZOY A;  2Z2N A;  5E6S A;  2HU8 A;  2QC5 A;  4X60 B;  4WK0 B;  5FKS A;  3T3M B;  3JRO A;  3EI1 B;  3AL8 A;  2VC2 A;  5EM2 A;  4O45 A;  4AMY A;  3C5M A;  4H5I A;  5FXY A;  4GGC A;  3NIF B;  4DNW A;  4AN1 A;  4IMM A;  3VH0 A;  2PM7 B;  3I89 A;  3T3P B;  4GMB A;  1XHM A;  3RFG A;  1YFQ A;  1B9Y A;  2H14 A;  3OTT A;  4FA4 D;  4CY1 A;  5I5M A;  2IWF A;  3E0C A;  5EAR A;  1TYQ C;  4JXM A;  1GG2 B;  2VDM A;  1H2Z A;  3IIW A;  3RMZ D;  2BCJ B;  2OVQ B;  1VE7 A;  1PI6 A;  3I7L A;  4CI8 A;  1YR2 A;  2AH1 A;  4R7A B;  4U7A A;  2H6N A;  3W15 A;  4JHN A;  3OKY B;  1E8N A;  2XL3 A;  1L0Q A;  5HE0 B;  4O3U B;  5E6R B;  1GOF A;  4WK2 A;  5GXH A;  2CNX A;  4D0K A;  3EI2 B;  2P9U C;  5IGO A;  1JV2 A;  4UM9 A;  2VDP B;  3IUJ A;  5CYK A;  5E6U B;  2B5N A;  3ZDY B;  2J55 H;  2VDL A;  2AGY A;  3EI4 B;  2I3S A;  2J57 G;  1K8K C;  3C75 H;  3SBQ A;  3ULE C;  1SSL A;  3KRX B;  1E8M A;  2JKX A;  1PBY B;  3JZH A;  5HE3 B;  3ZE1 A;  4CC9 A;  2P9S C;  4E5Z B;  2VDQ A;  2HKM A;  4ES0 A;  2AGL A;  3MUN A;  4A11 B;  4NC4 A;  2QR5 A;  1A0R B;  5EAL A;  4X3E A;  3MMY A;  4JSX C;  5EM2 B;  4Z8L A;  3GC3 B;  4PBZ A;  4QL1 A;  3JZN A;  3NID B;  5HE2 B;  4J73 A;  2CE8 A;  4FHL A;  4BCB A;  2AQ5 A;  2CO0 A;  2YNN A;  3V9F A;  4WK4 A;  4QQE A;  1JOF A;  1U2V C;  3ORV D;  4MMZ A;  3V5W B;  3JAM g;  4RE6 A;  1UOQ A;  4X61 B;  3CIK B;  4E54 B;  4Z7O B;  1JTD B;  2GNQ A;  3FCU B;  5FKQ A;  2H9M A;  4I79 A;  2XYI A;  3RSE C;  3OKT A;  4NEN A;  3PXS D;  1PEV A;  2VZ1 A;  5FKR A;  1A12 A;  5EMJ B;  3I7N A;  5FKT A;  4AN0 A;  2H9P A;  2I3T A;  5IGQ A;  4Y5R D;  3P4F A;  3QI0 A;  3ZDZ A;  4ERY A;  2EIB A;  3ZE0 A;  5I5J A;  5M61 A;  3EMH A;  4H5J A;  4LGN A;  4X63 B;  2VDN A;  4GGA A;  4UM9 B;  1N6D A;  3SBP A;  2HXC A;  1VZ3 A;  3ZDY A;  2PBI B;  2XDW A;  4A08 A;  1OLZ A;  4J8B A;  4NBM A;  3UVL A;  2HU7 A;  3A0F A;  4J84 A;  4BUJ C;  3FCS A;  3IJ1 A;  1H2Y A;  3J81 g;  1OMW B;  4ZOV A;  3IUL A;  4FWW A;  1L5G A;  4LG9 A;  3IVM A;  4G1M A;  3DWL C;  3NIG A;  2IUR A;  3BG0 A;  1T2X A;  3PXW D;  4QAM A;  4WK0 A;  3ZE2 A;  4L3H D;  3I7O A;  3BWS A;  3I8C A;  3K26 A;  3NID A;  4J0W A;  3SXT D;  4CY3 A;  3O4I A;  5HDB B;  2P9I C;  2OVR B;  3PXT D;  4XYH A;  2H9N A;  3JPX A;  5GMK n;  3UVM A;  4N14 A;  4J77 A;  4E54 A;  2H6Q A;  3FCU A;  4O2W A;  3VGZ A; 
#chains in the Genus database with same CATH homology
 4QRJ A;  2VDO B;  2VC2 B;  4J86 A;  2H68 A;  2IUQ A;  5EAM A;  5H17 A;  2B4E A;  3F3G A;  4JSV C;  2IUV A;  1XIP A;  1GXR A;  2PM9 B;  3RFH A;  3UKR C;  5TEF A;  3PSL A;  4PSX B;  5HQG A;  1MG3 A;  4J81 A;  3B7F A;  2HKR A;  4J0X A;  4Y7R A;  2HYE A;  2B5M A;  4XEI C;  3MZL A;  2H47 A;  2AH0 A;  4G56 B;  2P26 A;  4GGD A;  2VDM B;  3EI2 A;  1YUK A;  2XU7 A;  3PSC B;  2W18 A;  2VDL B;  1PGU A;  3VI3 B;  5TEE A;  5K19 A;  2HJ4 A;  3N0E A;  4U1E I;  2H13 A;  4ERQ A;  5IJ8 E;  1B9X A;  2BBK H;  3CFS B;  4A0A A;  2P28 A;  4L3G D;  4WK2 B;  3IJC A;  1S4U X;  3HFQ A;  4O1Q D;  2VDK B;  3VI4 B;  4CZY A;  5TF2 A;  5KDO B;  1R5M A;  4GZ8 A;  5IT9 g;  3OL2 B;  3RRM C;  2OJY A;  3IKO A;  4UI9 R;  2JWH A;  3MKS B;  2O9K A;  2CN2 A;  3I2N A;  2UZX B;  5HYN B;  4BL0 A;  2CE9 A;  3EG6 A;  3RLM D;  3I7K A;  3ODT A;  3JZG A;  5CXC A;  3C9C A;  3L4O D;  5CXB A;  4A09 A;  5FQD A;  3SLE D;  4ZN4 A;  3CFV A;  2Z2O A;  4A7J A;  3OKW A;  5E6S B;  2J56 H;  3V7D B;  4EWR A;  5AJA A;  2HJB A;  4BH6 A;  3AL9 A;  5B4W A;  5A2Q g;  3F3P A;  3ZWL B;  3FRX A;  4PNK B;  4CI2 A;  5EAP A;  4HDJ A;  4UM9 D;  3MXX A;  4WJK B;  5EMM B;  3C99 A;  4XYI A;  1U8C B;  4CZX A;  3UVN A;  3U4Y A;  3JB9 L;  4A0A B;  1P22 A;  4YVD A;  5HE1 B;  3BG1 A;  4FAN D;  2UZY B;  1K32 A;  4GQB B;  5H14 A;  4ZOZ A;  4A08 B;  4PXW A;  4JD2 C;  3ZE2 B;  2Z2P A;  4CI3 A;  3IJ0 A;  1FWX A;  4PC0 A;  2P9L C;  2P9P C;  4E5Z A;  4GM3 A;  4UM8 B;  5TDH B;  4AEZ A;  2VDQ B;  5GSA A;  4JSP C;  1TBG A;  5SXM A;  3I8E A;  3NVN A;  5C2V B;  2I0R A;  3KRW B;  3MKQ A;  3EI3 B;  2JWG A;  5JWZ A;  4J82 A;  4J79 A;  3IIY A;  4TZ4 A;  2PM9 A;  5IJ7 E;  5H1M A;  2H9L A;  3NVQ A;  5GXI A;  4A0B B;  4QT8 A;  5C9Z B;  1JMZ B;  2QXV A;  2MTA H;  4A2L A;  3DXM C;  2OK6 A;  3SFZ A;  3AL8 B;  4PSW B;  2H6K A;  5IC7 A;  1JMX B;  4GQ1 A;  5EMK B;  4AOW A;  4KFM B;  5AFU 3;  1N6E A;  4GQ2 P;  3GFC A;  5EML B;  2IUP A;  3RN0 D;  3AFC A;  3EI1 A;  3EU7 A;  1SQJ A;  3SHF A;  3VA6 A;  4OZU A;  4CI1 A;  1N6F A;  2I0S A;  5AMS A;  2P9K C;  2Q7Q A;  3GRE A;  3PVU B;  5I5I A;  3ZE0 B;  2G99 A;  1NEX B;  4Z7N B;  3L4M D;  3SN6 B;  4J87 A;  4FB1 D;  1GP2 B;  2EBS A;  3SMR A;  3N0D A;  3F3F A;  1GOT B;  3UR4 A;  3J80 g;  2YMU A;  5CYK B;  4ZOX A;  2XL2 A;  1QNI A;  3UKU C;  2OVP B;  5CXB B;  2G9A A;  4LG8 A;  4OWR A;  2IWK A;  2OK4 A;  4K3I D;  2AGZ A;  4A0B A;  1U4C A;  3RN1 D;  2GC4 A;  2AGW A;  4L9O A;  4L1Q D;  3FGB A;  1MG2 A;  2YNO A;  3K27 A;  2CO0 C;  4JT6 C;  4A11 A;  3SWS D;  1SQ9 A;  1ERJ A;  2YNP A;  3MZK A;  5K1C C;  3UVK A;  4FA5 D;  2YBA A;  4MK0 B;  1MDA H;  4A2M A;  4FAV D;  4CY5 A;  2B5L A;  3SBR A;  2GC7 A;  1TYE B;  3AH8 B;  4NSX A;  3PE7 A;  1JJU B;  4JSN C;  2HES X;  3I7P A;  3SVW D;  3NVX A;  3EWE A;  4WK4 B;  2YB8 B;  3ZDX B;  1Q47 A;  2CN3 A;  2PM6 B;  3FM0 A;  5C2W B;  2TRC B;  4K3J B;  2P9N C;  1XKS A;  3OW8 A;  4ERZ A;  3ZDZ B;  1SHY B;  4FA1 D;  4D6V A;  5FA5 B;  2IAA A;  4PBY A;  4O9D A;  4FA9 D;  3UVO A;  2H3X A;  3DXK C;  4J8G A;  3EI3 A;  4GM8 A;  3I7H A;  5FLX g;  3DSM A;  4JT5 C;  4J78 A;  2AGX A;  1NR0 A;  3OKY A;  2VDN B;  2I0T A;  2OIZ A;  3SJL D;  4CY2 A;  1RI6 A;  3SCY A;  3NIG B;  4IA9 A;  4ESG A;  5CXC B;  3OL2 A;  2VDR B;  1VYH C;  3PVW B;  4CZV A;  3EI4 A;  4A09 B;  3JRP A;  4O3T B;  4GM9 A;  3ZE1 B;  5THA A;  3DM0 A;  4Z7Q B;  4ZOY A;  2Z2N A;  2QC5 A;  4X60 B;  4WK0 B;  5FKS A;  3T3M B;  3JRO A;  3EI1 B;  3AL8 A;  5EM2 A;  4O45 A;  3C5M A;  4H5I A;  5FXY A;  4GGC A;  3NIF B;  4IMM A;  3VH0 A;  2PM7 B;  3I89 A;  3T3P B;  4GMB A;  1XHM A;  3RFG A;  2H14 A;  1YFQ A;  1B9Y A;  3OTT A;  4FA4 D;  4CY1 A;  5I5M A;  2IWF A;  3E0C A;  5EAR A;  1TYQ C;  4JXM A;  1GG2 B;  3IIW A;  3RMZ D;  2BCJ B;  2OVQ B;  1PI6 A;  3I7L A;  4CI8 A;  2AH1 A;  4R7A B;  4U7A A;  2H6N A;  3W15 A;  3OKY B;  2XL3 A;  1L0Q A;  5HE0 B;  4O3U B;  5E6R B;  5GXH A;  2CNX A;  4D0K A;  3EI2 B;  2P9U C;  5IGO A;  2VDP B;  5CYK A;  5E6U B;  2B5N A;  3ZDY B;  2J55 H;  2AGY A;  3EI4 B;  2I3S A;  2J57 G;  1K8K C;  3C75 H;  3SBQ A;  3ULE C;  1SSL A;  3KRX B;  3JZH A;  1PBY B;  5HE3 B;  4CC9 A;  2P9S C;  4E5Z B;  2HKM A;  4ES0 A;  2AGL A;  4A11 B;  1A0R B;  5EAL A;  4X3E A;  3MMY A;  4JSX C;  5EM2 B;  4Z8L A;  4PBZ A;  4QL1 A;  3JZN A;  3NID B;  5HE2 B;  4J73 A;  2CE8 A;  4FHL A;  2AQ5 A;  2CO0 A;  2YNN A;  3V9F A;  4QQE A;  1JOF A;  1U2V C;  3ORV D;  3V5W B;  3JAM g;  4X61 B;  3CIK B;  4E54 B;  4Z7O B;  2GNQ A;  3FCU B;  5FKQ A;  2H9M A;  4I79 A;  2XYI A;  3RSE C;  3OKT A;  3PXS D;  1PEV A;  5FKR A;  5EMJ B;  3I7N A;  5FKT A;  2H9P A;  2I3T A;  5IGQ A;  4Y5R D;  3P4F A;  4ERY A;  5I5J A;  3EMH A;  4H5J A;  4LGN A;  4X63 B;  4GGA A;  4UM9 B;  1N6D A;  3SBP A;  2HXC A;  2PBI B;  4A08 A;  1OLZ A;  4J8B A;  3UVL A;  3A0F A;  4J84 A;  4BUJ C;  3IJ1 A;  3J81 g;  1OMW B;  4ZOV A;  4FWW A;  4LG9 A;  3DWL C;  2IUR A;  3BG0 A;  3PXW D;  4L3H D;  3I7O A;  3BWS A;  3I8C A;  3K26 A;  4J0W A;  3SXT D;  4CY3 A;  5HDB B;  2P9I C;  2OVR B;  3PXT D;  4XYH A;  2H9N A;  3JPX A;  5GMK n;  3UVM A;  4N14 A;  4J77 A;  4E54 A;  2H6Q A;  3VGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...