3J80g

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
324
structure length
318
Chain Sequence
SSNIMLVLRGTLEGHNGWVTSLSTSAAQPNLLVSGSRDKTLISWRLTENEQQFGVPVRSYKGHSHIVQDVVVSADGNYAVSASWDKTLRLWNLATGNSEARFVGHTGDVLSVAIDANSSKIISASRDKTIRVWNTVGDCAYVLLGHTDWVTKVRVAPKNLVDDGRITFVSAGMDKIVRSWSLNSYRIEADFIGHNNYINVVQPSPDGSLAASAGKDGQIYVWNLKHKSAFMNFDAKDEVFALAFSPSRFWLTAATASGIKIYDLENEVLIDELKPEFAGYTKAQDPHAVSLAWSADGQTLFAGYTDNVIRVWQVMTAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
molecule keywords 18S rRNA
total genus 45
structure length 318
sequence length 324
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
g PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3j80g01
3EI1A 3MZLA 4GQ2P 4O1QD 2J56H 4A11B 4AEZA 3IJCA 3DSMA 4A7JA 3UKRC 3PSLA 5CXCA 4BUJC 5C9ZB 3IJ0A 5FA5B 4L3GD 1MG2A 4L9OA 4PBYA 4JSPC 4E54B 3ZWLB 4L3HD 2H47A 1U2VC 3MMYA 4OZUA 4YVDA 2AGLA 2H3XA 3SN6B 4K3JB 5K1CC 5TEFA 3SBQA 2H68A 3RRMC 2IUPA 2UZXB 5AMSA 5JWZA 4CY2A 4CY5A 3C5MA 3UVNA 2H6QA 5CYKB 4XYIA 2HKMA 3PXTD 4CI8A 1GG2B 4J87A 1JMZB 3UR4A 4J73A 2CO0C 4EWRA 4GQBB 4ERYA 1U4CA 4CZXA 5EAMA 4LG9A 2Q7QA 3IJ1A 3N0EA 2AH1A 3V7DB 3MXXA 3SCYA 2B5MA 5IT9g 4GGAA 4O3TB 5I5IA 5EARA 2YNPA 4ERQA 3I8EA 5H14A 3RMZD 3I7OA 4A0AB 2HXCA 1GOTB 3W15A 4A09A 3OTTA 4J8BA 3IKOA 3RN1D 3OKYA 4E5ZA 4FA5D 2XYIA 3K26A 4O9DA 2XU7A 3N0DA 4XYHA 3SHFA 3FM0A 4J82A 2PM6B 5KDOB 1VYHC 2IURA 2OK6A 3L4MD 3OW8A 3KRXB 3EU7A 3AL9A 2B5NA 3BWSA 3EI1B 5CYKA 4KFMB 3BG1A 5I5JA 4CC9A 4TZ4A 4AOWA 3MKQA 2H14A 4GGCA 4JD2C 5EMLB 3KRWB 4NSXA 4CY1A 4IMMA 3CIKB 3IIWA 4IA9A 4QL1A 4QRJA 2I3TA 2I3SA 3SLED 4GM8A 3VGZA 3NVNA 3PXWD 1XKSA 2P9IC 2AQ5A 4JSXC 2YNNA 3SXTD 1XIPA 4GGDA 5SXMA 5TF2A 2H9NA 3I2NA 2AH0A 2OVRB 4A0AA 4GM3A 5AFU3 3I7LA 2GC7A 4H5IA 4GMBA 2XL2A 3E0CA 2PM9B 2CE9A 1MDAH 2YNOA 5HE3B 3K27A 2P9LC 3JRPA 4A08B 1GXRA 4J81A 2IAAA 2IWFA 3RN0D 4I79A 5EAPA 2BBKH 3EMHA 2IWKA 4ZOXA 2CE8A 3I89A 3RLMD 2HYEA 3RSEC 5EM2A 4FAVD 3PXSD 3IIYA 4D6VA 2P9NC 1K32A 4U1EI 4CZVA 5FKSA 2H6NA 1A0RB 4FAND 5THAA 4K3ID 5TEEA 4A2LA 1ERJA 5HYNB 4ES0A 4JSVC 2IUQA 4G56B 1TBGA 3HFQA 5EALA 4X60B 1PI6A 4CI2A 4PXWA 1JOFA 3ULEC 3CFVA 4ZOYA 3A0FA 3AL8A 2HJ4A 5FKTA 4A11A 3FRXA 4PSWB 2G99A 2HKRA 2H13A 3J80g 5GXIA 2PM9A 1JJUB 3FGBA 2B4EA 4U7AA 3PVWB 5IGOA 4FB1D 1SHYB 1L0QA 3UVOA 2HJBA 5TDHB 2AGWA 4FWWA 2OVQB 4A08A 4H5JA 2PBIB 1XHMA 3OKWA 5IJ7E 3EI2B 2W18A 4ESGA 3PVUB 1QNIA 5HE0B 1YFQA 2OIZA 2OJYA 3J81g 2H6KA 3SVWD 4PBZA 3C99A 5K19A 2GNQA 4J84A 5IC7A 5EMJB 2H9PA 3P4FA 1B9YA 5EMMB 3ORVD 4ZN4A 5I5MA 2J55H 2I0TA 3EI4A 4JSNC 5FQDA 1B9XA 4GQ1A 4LGNA 2BCJB 4CI1A 4O45A 4CI3A 2GC4A 4QT8A 4OWRA 5FLXg 3MKSB 3EI3B 3JZHA 2PM7B 3RFGA 3EI3A 5H17A 5IGQA 4FA1D 1GP2B 2AGXA 3V9FA 2I0SA 1P22A 2OK4A 1R5MA 2H9LA 5CXCB 4A0BA 2TRCB 2P9KC 3SFZA 4PSXB 4Z8LA 2Z2PA 3OL2A 3RFHA 2YBAA 2AGYA 2P9PC 4UI9R 1MG3A 3ODTA 2CNXA 3DXMC 5FXYA 3C75H 4QQEA 4L1QD 3MZKA 1NR0A 5C2WB 5A2Qg 4BL0A 4X3EA 2YMUA 4LG8A 4ZOZA 3NVXA 5EMKB 3OKYB 4E5ZB 1Q47A 4FA4D 5HQGA 4A09B 3CFSB 2Z2NA 3PE7A 4A2MA 4PNKB 5GXHA 4JT6C 3EI4B 2P9SC 2HESX 4E54A 3DXKC 1RI6A 3GREA 3UKUC 3UVMA 4Y7RA 3GFCA 3SBPA 4R7AB 2UZYB 3SJLD 5GMKn 4JT5C 4FA9D 3JAMg 3JZNA 4J79A 1SQJA 4XEIC 2IUVA 2I0RA 3JZGA 5EM2B 1SQ9A 3F3GA 5B4WA 4CZYA 3AFCA 2P9UC 5C2VB 1OMWB 3EWEA 3BG0A 1K8KC 1PEVA 2OVPB 4J0WA 3AH8B 2YB8B 3I8CA 4CY3A 3NVQA 5AJAA 4ERZA 2QC5A 4BH6A 5IJ8E 3DWLC 3PSCB 3JPXA 2MTAH 2G9AA 3AL8B 3SBRA 4J8GA 2H9MA 3C9CA 4X61B 2CN3A 3VA6A 3F3PA 4ZOVA 2QXVA 1N6FA 1NEXB 3F3FA 3I7HA 4D0KA 5H1MA 1N6DA 5CXBB 3OKTA 3I7KA 1PBYB 3L4OD 5FKQA 4N14A 3VH0A 2XL3A 3U4YA 4X63B 4PC0A 4FHLA 2B5LA 2EBSA 4O3UB 1S4UX 4J77A 1OLZA 3DM0A 3I7NA 2Z2OA 3I7PA 3JB9L 4J86A 5HE1B 2CN2A 1JMXB 2J57G 4JXMA 1FWXA 5FKRA 1TYQC 4Y5RD 1PGUA 4J0XA 4A0BB 3SMRA 2CO0A 3OL2B 3B7FA 5CXBA 3EG6A 4MK0B 3UVLA 5HE2B 2AGZA 2O9KA 1N6EA 3SWSD 3V5WB 5GSAA 3EI2A 4J78A 3JROA 4HDJA 4GM9A 3UVKA 4GZ8A
chains in the Genus database with same CATH superfamily
3EI1A 3MZLA 2XE4A 4GQ2P 4O1QD 2J56H 5M5VA 5M61A 4A11B 4AEZA 4DNWA 3IJCA 3DSMA 4A7JA 2QR5A 3UKRC 3PSLA 5CXCA 1M1XA 2XDWA 4BUJC 5C9ZB 3IJ0A 2VDLA 4L3GD 5FA5B 1MG2A 4L9OA 4PBYA 4JSPC 4E54B 3ZWLB 2H47A 1U2VC 4L3HD 3MMYA 4OZUA 4YVDA 2AGLA 2H3XA 3O4HA 4K3JB 3SN6B 5K1CC 5TEFA 1T2XA 3SBQA 2H68A 4JHNA 3RRMC 2IUPA 2UZXB 5AMSA 5JWZA 4CY2A 4CY5A 3C5MA 3UVNA 3ZE2A 2H6QA 5CYKB 4XYIA 2HKMA 3PXTD 4CI8A 1GG2B 4J87A 1JMZB 4G1EA 3UR4A 4J73A 2BKLA 2CO0C 4EWRA 4GQBB 4ERYA 1U4CA 2EICA 3EQ7A 4CZXA 5EAMA 4LG9A 2Q7QA 2HU7A 1C9IA 3IJ1A 3N0EA 2AH1A 3V7DB 3MXXA 3SCYA 5M5TA 3IVMA 2B5MA 4DNUA 5IT9g 2VDMA 2WQ8A 4GGAA 4O3TB 3ZDYA 5I5IA 5EARA 1UOOA 4Z7QA 2YNPA 4ERQA 3I8EA 5M5RA 2VZ3A 5H14A 3T3MA 3RMZD 3I7OA 4A0AB 1YR2A 3IULA 2HXCA 1GOTB 3W15A 2VDKA 1O6GA 4A09A 3OTTA 4J8BA 3IKOA 1GOGA 5HDBA 3RN1D 1E8NA 3OKYA 4E5ZA 4FA5D 2XYIA 3K26A 4O9DA 2XU7A 3N0DA 4BP8A 3NIDA 4XYHA 3SHFA 3FM0A 2JKXA 4J82A 2PM6B 5KDOB 1VYHC 2IURA 3V4PA 5E6SA 2OK6A 3L4MD 3OW8A 4D9SA 3KRXB 3EU7A 3AL9A 2B5NA 3BWSA 3EI1B 5CYKA 4KFMB 3BG1A 5I5JA 4CC9A 2VDRA 4TZ4A 3FCSA 3MKQA 4AOWA 2H14A 1TYEA 4GGCA 4JD2C 5EMLB 3KRWB 4NSXA 4CY1A 4IMMA 3CIKB 3IIWA 4IA9A 4NBMA 4QL1A 4QRJA 2I3TA 2I3SA 3SLED 4GM8A 3VGZA 3NVNA 3PXWD 1XKSA 4UM8A 2P9IC 2AQ5A 4JSXC 2YNNA 3SXTD 3MVDK 4MMYA 4MMZA 1VZ2A 4AX4A 1XIPA 4GGDA 5SXMA 5TF2A 2H9NA 3I2NA 2AH0A 2OVRB 4A0AA 4GM3A 5AFU3 3I7LA 2GC7A 1UOQA 4H5IA 4GMBA 2XL2A 3E0CA 4WK0A 2PM9B 3IUJA 5M5UA 2CE9A 1MDAH 4O02A 2YNOA 2QZPA 5HE3B 3K27A 2P9LC 3JRPA 4A08B 3IUMA 3QI0A 1GXRA 4J81A 2IAAA 2IWFA 3RN0D 4I79A 5EAPA 2BBKH 3EMHA 2IWKA 4ZOXA 1VE7A 2CE8A 3I89A 1GOHA 3RLMD 2HYEA 3RSEC 5EM2A 1UOPA 4FAVD 3PXSD 3IIYA 4D6VA 2P9NC 1K32A 4AMZA 3IUQA 4U1EI 4CZVA 5FKSA 2H6NA 1A0RB 3O4GA 4Z7OA 4FAND 5THAA 4K3ID 5TEEA 4A2LA 4L1MA 1ERJA 5HYNB 4ES0A 4JSVC 2IUQA 4G56B 3ZDZA 4G1MA 1TBGA 3OF7A 3HFQA 5EALA 4G55A 4X60B 1K3IA 1PI6A 4CI2A 1GOFA 4PXWA 1JOFA 3ULEC 3CFVA 4Z7NA 3K71A 4ZOYA 3A0FA 3AL8A 2HJ4A 5FKTA 4A11A 3FRXA 5C92A 3DDUA 1U8CA 4PSWB 2G99A 2HKRA 2H13A 3K6SA 1JV2A 3J80g 5GXIA 2PM9A 1JJUB 3FGBA 2B4EA 4U7AA 3NIFA 3PVWB 5IGOA 4FB1D 1SHYB 1L0QA 3UVOA 2HJBA 5TDHB 2AGWA 4FWWA 2OVQB 4A08A 4H5JA 2PBIB 1XHMA 3OKWA 5IJ7E 3QHYB 3EI2B 4AMYA 1E5TA 2W18A 4ESGA 3PVUB 1QNIA 4BCBA 5HE0B 1YFQA 2OIZA 2OJYA 1C9LA 3J81g 2H6KA 4IRZA 3SVWD 4PBZA 3NIGA 3C99A 3GD1I 5K19A 2GNQA 4J84A 5IC7A 5EMJB 3P4FA 2H9PA 1B9YA 2EIDA 5EMMB 3ORVD 2EIEA 1L5GA 1H2WA 4ZN4A 3V4VA 5I5MA 2J55H 1H2YA 1BPOA 2I0TA 2VDQA 3EI4A 4JSNC 5FFGA 5FQDA 4BCDA 1B9XA 4GQ1A 4LGNA 2BCJB 4CI1A 2VDOA 4O45A 4CI3A 1H2ZA 2GC4A 4QT8A 4OWRA 5FLXg 3MKSB 3EI3B 3JZHA 2PM7B 3RFGA 3ZE0A 3EI3A 5H17A 5IGQA 4FA1D 4NAAA 5E6RA 5M5SA 1GP2B 2AGXA 3V9FA 2I0SA 2VDPA 1P22A 2OK4A 1R5MA 2H9LA 1QFMA 5CXCB 4A0BA 2TRCB 2P9KC 3SFZA 4PSXB 4NENA 4Z8LA 2Z2PA 3OL2A 3RFHA 2YBAA 2AGYA 2P9PC 4UI9R 1MG3A 3ODTA 2CNXA 3DXMC 4AN0A 5FXYA 3C75H 4QQEA 3ZDXA 4L1QD 3MZKA 3O4JA 1NR0A 5C2WB 5A2Qg 4BL0A 4X3EA 1H2XA 5C86A 2YMUA 4LG8A 4ZOZA 3VI3A 1VE6A 3NVXA 3OKYB 5EMKB 4E5ZB 1Q47A 4MMXA 4FA4D 4AN1A 3MUNA 5HQGA 3EQ9A 4A09B 3CFSB 2Z2NA 3PE7A 3T3PA 4A2MA 4PNKB 5GXHA 4JT6C 3EI4B 4RE5A 2P9SC 2HESX 4E54A 3DXKC 1RI6A 3GREA 3UKUC 3UVMA 4Y7RA 2VZ1A 2HU5A 3GFCA 3SBPA 4NC4A 4UM9A 4R7AB 2UZYB 3SJLD 5GMKn 4JT5C 4FA9D 3JAMg 3JZNA 4J79A 2VDNA 1SQJA 3O4IA 4XEIC 3GC3B 2IUVA 2I0RA 1O6FA 3JZGA 3K72A 3VI4A 1SQ9A 5EM2B 3F3GA 5B4WA 4CZYA 3AFCA 2P9UC 5C2VB 1OMWB 3FCUA 3EWEA 3BG0A 4BCCA 1K8KC 1PEVA 2OVPB 4J0WA 3AH8B 1QFSA 2YB8B 4RE6A 3I8CA 4CY3A 3NVQA 5AJAA 1A12A 4ERZA 2QC5A 4BH6A 1I2MB 2EIBA 2XZGA 5IJ8E 3DWLC 3PSCB 4QAMA 1JTDB 3JPXA 2MTAH 3IUNA 2G9AA 3AL8B 3SBRA 1E8MA 3MUOA 4BP9A 4J8GA 2H9MA 3C9CA 4WK4A 4X61B 3KCIA 1VZ3A 4WK2A 2CN3A 2HU8A 3VA6A 5E6UA 4DNVA 5FFOA 3F3PA 4O2WA 4ZOVA 2QXVA 1N6FA 3EQ8A 1NEXB 3IURA 3F3FA 3I7HA 4D0KA 5H1MA 1N6DA 5CXBB 3IJEA 3OKTA 3I7KA 1PBYB 3L4OD 5FKQA 4N14A 3VH0A 2XL3A 3ZE1A 3U4YA 4X63B 4PC0A 4FHLA 2B5LA 4JHPC 2EBSA 1S4UX 4O3UB 4J77A 1OLZA 3DM0A 3I7NA 2Z2OA 3I7PA 3JB9L 4J86A 5HE1B 2CN2A 1JMXB 2J57G 4JXMA 1FWXA 5FKRA 1TYQC 4Y5RD 1PGUA 4J0XA 4A0BB 3SMRA 2CO0A 3OL2B 3B7FA 5CXBA 3EG6A 4MK0B 3UVLA 2VC2A 5HE2B 2AGZA 2O9KA 1N6EA 3SWSD 4WJKA 3V5WB 5GSAA 3EI2A 4J78A 3JROA 4HDJA 4GM9A 1UTCA 3UVKA 4GZ8A
chains in the Genus database with same CATH topology
3EI1A 3MZLA 4GQ2P 4O1QD 2J56H 4A11B 4AEZA 3IJCA 3DSMA 4A7JA 3UKRC 3PSLA 5CXCA 4BUJC 5C9ZB 3IJ0A 5FA5B 4L3GD 1MG2A 4L9OA 4PBYA 4JSPC 4E54B 3ZWLB 4L3HD 2H47A 1U2VC 3MMYA 4OZUA 4YVDA 2AGLA 2H3XA 3SN6B 4K3JB 5K1CC 5TEFA 3SBQA 2H68A 3RRMC 2IUPA 2UZXB 5AMSA 5JWZA 4CY2A 4CY5A 3C5MA 3UVNA 2H6QA 5CYKB 4XYIA 2HKMA 3PXTD 4CI8A 1GG2B 4J87A 1JMZB 3UR4A 4J73A 2CO0C 4EWRA 4GQBB 4ERYA 1U4CA 4CZXA 5EAMA 4LG9A 2Q7QA 3IJ1A 3N0EA 2AH1A 3V7DB 3MXXA 3SCYA 2B5MA 5IT9g 4GGAA 4O3TB 5I5IA 5EARA 2YNPA 4ERQA 3I8EA 5H14A 3RMZD 3I7OA 4A0AB 2HXCA 1GOTB 3W15A 4A09A 3OTTA 4J8BA 3IKOA 3RN1D 3OKYA 4E5ZA 4FA5D 2XYIA 3K26A 4O9DA 2XU7A 3N0DA 4XYHA 3SHFA 3FM0A 4J82A 2PM6B 5KDOB 1VYHC 2IURA 2OK6A 3L4MD 3OW8A 3KRXB 3EU7A 3AL9A 2B5NA 3BWSA 3EI1B 5CYKA 4KFMB 3BG1A 5I5JA 4CC9A 4TZ4A 4AOWA 3MKQA 2H14A 4GGCA 4JD2C 5EMLB 3KRWB 4NSXA 4CY1A 4IMMA 3CIKB 3IIWA 4IA9A 4QL1A 4QRJA 2I3TA 2I3SA 3SLED 4GM8A 3VGZA 3NVNA 3PXWD 1XKSA 2P9IC 2AQ5A 4JSXC 2YNNA 3SXTD 1XIPA 4GGDA 5SXMA 5TF2A 2H9NA 3I2NA 2AH0A 2OVRB 4A0AA 4GM3A 5AFU3 3I7LA 2GC7A 4H5IA 4GMBA 2XL2A 3E0CA 2PM9B 2CE9A 1MDAH 2YNOA 5HE3B 3K27A 2P9LC 3JRPA 4A08B 1GXRA 4J81A 2IAAA 2IWFA 3RN0D 4I79A 5EAPA 2BBKH 3EMHA 2IWKA 4ZOXA 2CE8A 3I89A 3RLMD 2HYEA 3RSEC 5EM2A 4FAVD 3PXSD 3IIYA 4D6VA 2P9NC 1K32A 4U1EI 4CZVA 5FKSA 2H6NA 1A0RB 4FAND 5THAA 4K3ID 5TEEA 4A2LA 1ERJA 5HYNB 4ES0A 4JSVC 2IUQA 4G56B 1TBGA 3HFQA 5EALA 4X60B 1PI6A 4CI2A 4PXWA 1JOFA 3ULEC 3CFVA 4ZOYA 3A0FA 3AL8A 2HJ4A 5FKTA 4A11A 3FRXA 4PSWB 2G99A 2HKRA 2H13A 3J80g 5GXIA 2PM9A 1JJUB 3FGBA 2B4EA 4U7AA 3PVWB 5IGOA 4FB1D 1SHYB 1L0QA 3UVOA 2HJBA 5TDHB 2AGWA 4FWWA 2OVQB 4A08A 4H5JA 2PBIB 1XHMA 3OKWA 5IJ7E 3EI2B 2W18A 4ESGA 3PVUB 1QNIA 5HE0B 1YFQA 2OIZA 2OJYA 3J81g 2H6KA 3SVWD 4PBZA 3C99A 5K19A 2GNQA 4J84A 5IC7A 5EMJB 2H9PA 3P4FA 1B9YA 5EMMB 3ORVD 4ZN4A 5I5MA 2J55H 2I0TA 3EI4A 4JSNC 5FQDA 1B9XA 4GQ1A 4LGNA 2BCJB 4CI1A 4O45A 4CI3A 2GC4A 4QT8A 4OWRA 5FLXg 3MKSB 3EI3B 3JZHA 2PM7B 3RFGA 3EI3A 5H17A 5IGQA 4FA1D 1GP2B 2AGXA 3V9FA 2I0SA 1P22A 2OK4A 1R5MA 2H9LA 5CXCB 4A0BA 2TRCB 2P9KC 3SFZA 4PSXB 4Z8LA 2Z2PA 3OL2A 3RFHA 2YBAA 2AGYA 2P9PC 4UI9R 1MG3A 3ODTA 2CNXA 3DXMC 5FXYA 3C75H 4QQEA 4L1QD 3MZKA 1NR0A 5C2WB 5A2Qg 4BL0A 4X3EA 2YMUA 4LG8A 4ZOZA 3NVXA 5EMKB 3OKYB 4E5ZB 1Q47A 4FA4D 5HQGA 4A09B 3CFSB 2Z2NA 3PE7A 4A2MA 4PNKB 5GXHA 4JT6C 3EI4B 2P9SC 2HESX 4E54A 3DXKC 1RI6A 3GREA 3UKUC 3UVMA 4Y7RA 3GFCA 3SBPA 4R7AB 2UZYB 3SJLD 5GMKn 4JT5C 4FA9D 3JAMg 3JZNA 4J79A 1SQJA 4XEIC 2IUVA 2I0RA 3JZGA 5EM2B 1SQ9A 3F3GA 5B4WA 4CZYA 3AFCA 2P9UC 5C2VB 1OMWB 3EWEA 3BG0A 1K8KC 1PEVA 2OVPB 4J0WA 3AH8B 2YB8B 3I8CA 4CY3A 3NVQA 5AJAA 4ERZA 2QC5A 4BH6A 5IJ8E 3DWLC 3PSCB 3JPXA 2MTAH 2G9AA 3AL8B 3SBRA 4J8GA 2H9MA 3C9CA 4X61B 2CN3A 3VA6A 3F3PA 4ZOVA 2QXVA 1N6FA 1NEXB 3F3FA 3I7HA 4D0KA 5H1MA 1N6DA 5CXBB 3OKTA 3I7KA 1PBYB 3L4OD 5FKQA 4N14A 3VH0A 2XL3A 3U4YA 4X63B 4PC0A 4FHLA 2B5LA 2EBSA 4O3UB 1S4UX 4J77A 1OLZA 3DM0A 3I7NA 2Z2OA 3I7PA 3JB9L 4J86A 5HE1B 2CN2A 1JMXB 2J57G 4JXMA 1FWXA 5FKRA 1TYQC 4Y5RD 1PGUA 4J0XA 4A0BB 3SMRA 2CO0A 3OL2B 3B7FA 5CXBA 3EG6A 4MK0B 3UVLA 5HE2B 2AGZA 2O9KA 1N6EA 3SWSD 3V5WB 5GSAA 3EI2A 4J78A 3JROA 4HDJA 4GM9A 3UVKA 4GZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EI1 A;  3MZL A;  4GQ2 P;  4O1Q D;  2J56 H;  4A11 B;  4AEZ A;  3IJC A;  3DSM A;  4A7J A;  3UKR C;  3PSL A;  5CXC A;  4BUJ C;  5C9Z B;  3IJ0 A;  5FA5 B;  4L3G D;  1MG2 A;  4L9O A;  4PBY A;  4JSP C;  4E54 B;  3ZWL B;  4L3H D;  2H47 A;  1U2V C;  3MMY A;  4OZU A;  4YVD A;  2AGL A;  2H3X A;  3SN6 B;  4K3J B;  5K1C C;  5TEF A;  3SBQ A;  2H68 A;  3RRM C;  2IUP A;  2UZX B;  5AMS A;  5JWZ A;  4CY2 A;  4CY5 A;  3C5M A;  3UVN A;  2H6Q A;  5CYK B;  4XYI A;  2HKM A;  3PXT D;  4CI8 A;  1GG2 B;  4J87 A;  1JMZ B;  3UR4 A;  4J73 A;  2CO0 C;  4EWR A;  4GQB B;  4ERY A;  1U4C A;  4CZX A;  5EAM A;  4LG9 A;  2Q7Q A;  3IJ1 A;  3N0E A;  2AH1 A;  3V7D B;  3MXX A;  3SCY A;  2B5M A;  5IT9 g;  4GGA A;  4O3T B;  5I5I A;  5EAR A;  2YNP A;  4ERQ A;  3I8E A;  5H14 A;  3RMZ D;  3I7O A;  4A0A B;  2HXC A;  1GOT B;  3W15 A;  4A09 A;  3OTT A;  4J8B A;  3IKO A;  3RN1 D;  3OKY A;  4E5Z A;  4FA5 D;  2XYI A;  3K26 A;  4O9D A;  2XU7 A;  3N0D A;  4XYH A;  3SHF A;  3FM0 A;  4J82 A;  2PM6 B;  5KDO B;  1VYH C;  2IUR A;  2OK6 A;  3L4M D;  3OW8 A;  3KRX B;  3EU7 A;  3AL9 A;  2B5N A;  3BWS A;  3EI1 B;  5CYK A;  4KFM B;  3BG1 A;  5I5J A;  4CC9 A;  4TZ4 A;  4AOW A;  3MKQ A;  2H14 A;  4GGC A;  4JD2 C;  5EML B;  3KRW B;  4NSX A;  4CY1 A;  4IMM A;  3CIK B;  3IIW A;  4IA9 A;  4QL1 A;  4QRJ A;  2I3T A;  2I3S A;  3SLE D;  4GM8 A;  3VGZ A;  3NVN A;  3PXW D;  1XKS A;  2P9I C;  2AQ5 A;  4JSX C;  2YNN A;  3SXT D;  1XIP A;  4GGD A;  5SXM A;  5TF2 A;  2H9N A;  3I2N A;  2AH0 A;  2OVR B;  4A0A A;  4GM3 A;  5AFU 3;  3I7L A;  2GC7 A;  4H5I A;  4GMB A;  2XL2 A;  3E0C A;  2PM9 B;  2CE9 A;  1MDA H;  2YNO A;  5HE3 B;  3K27 A;  2P9L C;  3JRP A;  4A08 B;  1GXR A;  4J81 A;  2IAA A;  2IWF A;  3RN0 D;  4I79 A;  5EAP A;  2BBK H;  3EMH A;  2IWK A;  4ZOX A;  2CE8 A;  3I89 A;  3RLM D;  2HYE A;  3RSE C;  5EM2 A;  4FAV D;  3PXS D;  3IIY A;  4D6V A;  2P9N C;  1K32 A;  4U1E I;  4CZV A;  5FKS A;  2H6N A;  1A0R B;  4FAN D;  5THA A;  4K3I D;  5TEE A;  4A2L A;  1ERJ A;  5HYN B;  4ES0 A;  4JSV C;  2IUQ A;  4G56 B;  1TBG A;  3HFQ A;  5EAL A;  4X60 B;  1PI6 A;  4CI2 A;  4PXW A;  1JOF A;  3ULE C;  3CFV A;  4ZOY A;  3A0F A;  3AL8 A;  2HJ4 A;  5FKT A;  4A11 A;  3FRX A;  4PSW B;  2G99 A;  2HKR A;  2H13 A;  3J80 g;  5GXI A;  2PM9 A;  1JJU B;  3FGB A;  2B4E A;  4U7A A;  3PVW B;  5IGO A;  4FB1 D;  1SHY B;  1L0Q A;  3UVO A;  2HJB A;  5TDH B;  2AGW A;  4FWW A;  2OVQ B;  4A08 A;  4H5J A;  2PBI B;  1XHM A;  3OKW A;  5IJ7 E;  3EI2 B;  2W18 A;  4ESG A;  3PVU B;  1QNI A;  5HE0 B;  1YFQ A;  2OIZ A;  2OJY A;  3J81 g;  2H6K A;  3SVW D;  4PBZ A;  3C99 A;  5K19 A;  2GNQ A;  4J84 A;  5IC7 A;  5EMJ B;  2H9P A;  3P4F A;  1B9Y A;  5EMM B;  3ORV D;  4ZN4 A;  5I5M A;  2J55 H;  2I0T A;  3EI4 A;  4JSN C;  5FQD A;  1B9X A;  4GQ1 A;  4LGN A;  2BCJ B;  4CI1 A;  4O45 A;  4CI3 A;  2GC4 A;  4QT8 A;  4OWR A;  5FLX g;  3MKS B;  3EI3 B;  3JZH A;  2PM7 B;  3RFG A;  3EI3 A;  5H17 A;  5IGQ A;  4FA1 D;  1GP2 B;  2AGX A;  3V9F A;  2I0S A;  1P22 A;  2OK4 A;  1R5M A;  2H9L A;  5CXC B;  4A0B A;  2TRC B;  2P9K C;  3SFZ A;  4PSX B;  4Z8L A;  2Z2P A;  3OL2 A;  3RFH A;  2YBA A;  2AGY A;  2P9P C;  4UI9 R;  1MG3 A;  3ODT A;  2CNX A;  3DXM C;  5FXY A;  3C75 H;  4QQE A;  4L1Q D;  3MZK A;  1NR0 A;  5C2W B;  5A2Q g;  4BL0 A;  4X3E A;  2YMU A;  4LG8 A;  4ZOZ A;  3NVX A;  5EMK B;  3OKY B;  4E5Z B;  1Q47 A;  4FA4 D;  5HQG A;  4A09 B;  3CFS B;  2Z2N A;  3PE7 A;  4A2M A;  4PNK B;  5GXH A;  4JT6 C;  3EI4 B;  2P9S C;  2HES X;  4E54 A;  3DXK C;  1RI6 A;  3GRE A;  3UKU C;  3UVM A;  4Y7R A;  3GFC A;  3SBP A;  4R7A B;  2UZY B;  3SJL D;  5GMK n;  4JT5 C;  4FA9 D;  3JAM g;  3JZN A;  4J79 A;  1SQJ A;  4XEI C;  2IUV A;  2I0R A;  3JZG A;  5EM2 B;  1SQ9 A;  3F3G A;  5B4W A;  4CZY A;  3AFC A;  2P9U C;  5C2V B;  1OMW B;  3EWE A;  3BG0 A;  1K8K C;  1PEV A;  2OVP B;  4J0W A;  3AH8 B;  2YB8 B;  3I8C A;  4CY3 A;  3NVQ A;  5AJA A;  4ERZ A;  2QC5 A;  4BH6 A;  5IJ8 E;  3DWL C;  3PSC B;  3JPX A;  2MTA H;  2G9A A;  3AL8 B;  3SBR A;  4J8G A;  2H9M A;  3C9C A;  4X61 B;  2CN3 A;  3VA6 A;  3F3P A;  4ZOV A;  2QXV A;  1N6F A;  1NEX B;  3F3F A;  3I7H A;  4D0K A;  5H1M A;  1N6D A;  5CXB B;  3OKT A;  3I7K A;  1PBY B;  3L4O D;  5FKQ A;  4N14 A;  3VH0 A;  2XL3 A;  3U4Y A;  4X63 B;  4PC0 A;  4FHL A;  2B5L A;  2EBS A;  4O3U B;  1S4U X;  4J77 A;  1OLZ A;  3DM0 A;  3I7N A;  2Z2O A;  3I7P A;  3JB9 L;  4J86 A;  5HE1 B;  2CN2 A;  1JMX B;  2J57 G;  4JXM A;  1FWX A;  5FKR A;  1TYQ C;  4Y5R D;  1PGU A;  4J0X A;  4A0B B;  3SMR A;  2CO0 A;  3OL2 B;  3B7F A;  5CXB A;  3EG6 A;  4MK0 B;  3UVL A;  5HE2 B;  2AGZ A;  2O9K A;  1N6E A;  3SWS D;  3V5W B;  5GSA A;  3EI2 A;  4J78 A;  3JRO A;  4HDJ A;  4GM9 A;  3UVK A;  4GZ8 A; 
#chains in the Genus database with same CATH topology
 3EI1 A;  3MZL A;  2XE4 A;  4GQ2 P;  4O1Q D;  2J56 H;  5M5V A;  5M61 A;  4A11 B;  4AEZ A;  4DNW A;  3IJC A;  3DSM A;  4A7J A;  2QR5 A;  3UKR C;  3PSL A;  5CXC A;  1M1X A;  2XDW A;  4BUJ C;  5C9Z B;  3IJ0 A;  2VDL A;  4L3G D;  5FA5 B;  1MG2 A;  4L9O A;  4PBY A;  4JSP C;  4E54 B;  3ZWL B;  2H47 A;  1U2V C;  4L3H D;  3MMY A;  4OZU A;  4YVD A;  2AGL A;  2H3X A;  3O4H A;  4K3J B;  3SN6 B;  5K1C C;  5TEF A;  1T2X A;  3SBQ A;  2H68 A;  4JHN A;  3RRM C;  2IUP A;  2UZX B;  5AMS A;  5JWZ A;  4CY2 A;  4CY5 A;  3C5M A;  3UVN A;  3ZE2 A;  2H6Q A;  5CYK B;  4XYI A;  2HKM A;  3PXT D;  4CI8 A;  1GG2 B;  4J87 A;  1JMZ B;  4G1E A;  3UR4 A;  4J73 A;  2BKL A;  2CO0 C;  4EWR A;  4GQB B;  4ERY A;  1U4C A;  2EIC A;  3EQ7 A;  4CZX A;  5EAM A;  4LG9 A;  2Q7Q A;  2HU7 A;  1C9I A;  3IJ1 A;  3N0E A;  2AH1 A;  3V7D B;  3MXX A;  3SCY A;  5M5T A;  3IVM A;  2B5M A;  4DNU A;  5IT9 g;  2VDM A;  2WQ8 A;  4GGA A;  4O3T B;  3ZDY A;  5I5I A;  5EAR A;  1UOO A;  4Z7Q A;  2YNP A;  4ERQ A;  3I8E A;  5M5R A;  2VZ3 A;  5H14 A;  3T3M A;  3RMZ D;  3I7O A;  4A0A B;  1YR2 A;  3IUL A;  2HXC A;  1GOT B;  3W15 A;  2VDK A;  1O6G A;  4A09 A;  3OTT A;  4J8B A;  3IKO A;  1GOG A;  5HDB A;  3RN1 D;  1E8N A;  3OKY A;  4E5Z A;  4FA5 D;  2XYI A;  3K26 A;  4O9D A;  2XU7 A;  3N0D A;  4BP8 A;  3NID A;  4XYH A;  3SHF A;  3FM0 A;  2JKX A;  4J82 A;  2PM6 B;  5KDO B;  1VYH C;  2IUR A;  3V4P A;  5E6S A;  2OK6 A;  3L4M D;  3OW8 A;  4D9S A;  3KRX B;  3EU7 A;  3AL9 A;  2B5N A;  3BWS A;  3EI1 B;  5CYK A;  4KFM B;  3BG1 A;  5I5J A;  4CC9 A;  2VDR A;  4TZ4 A;  3FCS A;  3MKQ A;  4AOW A;  2H14 A;  1TYE A;  4GGC A;  4JD2 C;  5EML B;  3KRW B;  4NSX A;  4CY1 A;  4IMM A;  3CIK B;  3IIW A;  4IA9 A;  4NBM A;  4QL1 A;  4QRJ A;  2I3T A;  2I3S A;  3SLE D;  4GM8 A;  3VGZ A;  3NVN A;  3PXW D;  1XKS A;  4UM8 A;  2P9I C;  2AQ5 A;  4JSX C;  2YNN A;  3SXT D;  3MVD K;  4MMY A;  4MMZ A;  1VZ2 A;  4AX4 A;  1XIP A;  4GGD A;  5SXM A;  5TF2 A;  2H9N A;  3I2N A;  2AH0 A;  2OVR B;  4A0A A;  4GM3 A;  5AFU 3;  3I7L A;  2GC7 A;  1UOQ A;  4H5I A;  4GMB A;  2XL2 A;  3E0C A;  4WK0 A;  2PM9 B;  3IUJ A;  5M5U A;  2CE9 A;  1MDA H;  4O02 A;  2YNO A;  2QZP A;  5HE3 B;  3K27 A;  2P9L C;  3JRP A;  4A08 B;  3IUM A;  3QI0 A;  1GXR A;  4J81 A;  2IAA A;  2IWF A;  3RN0 D;  4I79 A;  5EAP A;  2BBK H;  3EMH A;  2IWK A;  4ZOX A;  1VE7 A;  2CE8 A;  3I89 A;  1GOH A;  3RLM D;  2HYE A;  3RSE C;  5EM2 A;  1UOP A;  4FAV D;  3PXS D;  3IIY A;  4D6V A;  2P9N C;  1K32 A;  4AMZ A;  3IUQ A;  4U1E I;  4CZV A;  5FKS A;  2H6N A;  1A0R B;  3O4G A;  4Z7O A;  4FAN D;  5THA A;  4K3I D;  5TEE A;  4A2L A;  4L1M A;  1ERJ A;  5HYN B;  4ES0 A;  4JSV C;  2IUQ A;  4G56 B;  3ZDZ A;  4G1M A;  1TBG A;  3OF7 A;  3HFQ A;  5EAL A;  4G55 A;  4X60 B;  1K3I A;  1PI6 A;  4CI2 A;  1GOF A;  4PXW A;  1JOF A;  3ULE C;  3CFV A;  4Z7N A;  3K71 A;  4ZOY A;  3A0F A;  3AL8 A;  2HJ4 A;  5FKT A;  4A11 A;  3FRX A;  5C92 A;  3DDU A;  1U8C A;  4PSW B;  2G99 A;  2HKR A;  2H13 A;  3K6S A;  1JV2 A;  3J80 g;  5GXI A;  2PM9 A;  1JJU B;  3FGB A;  2B4E A;  4U7A A;  3NIF A;  3PVW B;  5IGO A;  4FB1 D;  1SHY B;  1L0Q A;  3UVO A;  2HJB A;  5TDH B;  2AGW A;  4FWW A;  2OVQ B;  4A08 A;  4H5J A;  2PBI B;  1XHM A;  3OKW A;  5IJ7 E;  3QHY B;  3EI2 B;  4AMY A;  1E5T A;  2W18 A;  4ESG A;  3PVU B;  1QNI A;  4BCB A;  5HE0 B;  1YFQ A;  2OIZ A;  2OJY A;  1C9L A;  3J81 g;  2H6K A;  4IRZ A;  3SVW D;  4PBZ A;  3NIG A;  3C99 A;  3GD1 I;  5K19 A;  2GNQ A;  4J84 A;  5IC7 A;  5EMJ B;  3P4F A;  2H9P A;  1B9Y A;  2EID A;  5EMM B;  3ORV D;  2EIE A;  1L5G A;  1H2W A;  4ZN4 A;  3V4V A;  5I5M A;  2J55 H;  1H2Y A;  1BPO A;  2I0T A;  2VDQ A;  3EI4 A;  4JSN C;  5FFG A;  5FQD A;  4BCD A;  1B9X A;  4GQ1 A;  4LGN A;  2BCJ B;  4CI1 A;  2VDO A;  4O45 A;  4CI3 A;  1H2Z A;  2GC4 A;  4QT8 A;  4OWR A;  5FLX g;  3MKS B;  3EI3 B;  3JZH A;  2PM7 B;  3RFG A;  3ZE0 A;  3EI3 A;  5H17 A;  5IGQ A;  4FA1 D;  4NAA A;  5E6R A;  5M5S A;  1GP2 B;  2AGX A;  3V9F A;  2I0S A;  2VDP A;  1P22 A;  2OK4 A;  1R5M A;  2H9L A;  1QFM A;  5CXC B;  4A0B A;  2TRC B;  2P9K C;  3SFZ A;  4PSX B;  4NEN A;  4Z8L A;  2Z2P A;  3OL2 A;  3RFH A;  2YBA A;  2AGY A;  2P9P C;  4UI9 R;  1MG3 A;  3ODT A;  2CNX A;  3DXM C;  4AN0 A;  5FXY A;  3C75 H;  4QQE A;  3ZDX A;  4L1Q D;  3MZK A;  3O4J A;  1NR0 A;  5C2W B;  5A2Q g;  4BL0 A;  4X3E A;  1H2X A;  5C86 A;  2YMU A;  4LG8 A;  4ZOZ A;  3VI3 A;  1VE6 A;  3NVX A;  3OKY B;  5EMK B;  4E5Z B;  1Q47 A;  4MMX A;  4FA4 D;  4AN1 A;  3MUN A;  5HQG A;  3EQ9 A;  4A09 B;  3CFS B;  2Z2N A;  3PE7 A;  3T3P A;  4A2M A;  4PNK B;  5GXH A;  4JT6 C;  3EI4 B;  4RE5 A;  2P9S C;  2HES X;  4E54 A;  3DXK C;  1RI6 A;  3GRE A;  3UKU C;  3UVM A;  4Y7R A;  2VZ1 A;  2HU5 A;  3GFC A;  3SBP A;  4NC4 A;  4UM9 A;  4R7A B;  2UZY B;  3SJL D;  5GMK n;  4JT5 C;  4FA9 D;  3JAM g;  3JZN A;  4J79 A;  2VDN A;  1SQJ A;  3O4I A;  4XEI C;  3GC3 B;  2IUV A;  2I0R A;  1O6F A;  3JZG A;  3K72 A;  3VI4 A;  1SQ9 A;  5EM2 B;  3F3G A;  5B4W A;  4CZY A;  3AFC A;  2P9U C;  5C2V B;  1OMW B;  3FCU A;  3EWE A;  3BG0 A;  4BCC A;  1K8K C;  1PEV A;  2OVP B;  4J0W A;  3AH8 B;  1QFS A;  2YB8 B;  4RE6 A;  3I8C A;  4CY3 A;  3NVQ A;  5AJA A;  1A12 A;  4ERZ A;  2QC5 A;  4BH6 A;  1I2M B;  2EIB A;  2XZG A;  5IJ8 E;  3DWL C;  3PSC B;  4QAM A;  1JTD B;  3JPX A;  2MTA H;  3IUN A;  2G9A A;  3AL8 B;  3SBR A;  1E8M A;  3MUO A;  4BP9 A;  4J8G A;  2H9M A;  3C9C A;  4WK4 A;  4X61 B;  3KCI A;  1VZ3 A;  4WK2 A;  2CN3 A;  2HU8 A;  3VA6 A;  5E6U A;  4DNV A;  5FFO A;  3F3P A;  4O2W A;  4ZOV A;  2QXV A;  1N6F A;  3EQ8 A;  1NEX B;  3IUR A;  3F3F A;  3I7H A;  4D0K A;  5H1M A;  1N6D A;  5CXB B;  3IJE A;  3OKT A;  3I7K A;  1PBY B;  3L4O D;  5FKQ A;  4N14 A;  3VH0 A;  2XL3 A;  3ZE1 A;  3U4Y A;  4X63 B;  4PC0 A;  4FHL A;  2B5L A;  4JHP C;  2EBS A;  1S4U X;  4O3U B;  4J77 A;  1OLZ A;  3DM0 A;  3I7N A;  2Z2O A;  3I7P A;  3JB9 L;  4J86 A;  5HE1 B;  2CN2 A;  1JMX B;  2J57 G;  4JXM A;  1FWX A;  5FKR A;  1TYQ C;  4Y5R D;  1PGU A;  4J0X A;  4A0B B;  3SMR A;  2CO0 A;  3OL2 B;  3B7F A;  5CXB A;  3EG6 A;  4MK0 B;  3UVL A;  2VC2 A;  5HE2 B;  2AGZ A;  2O9K A;  1N6E A;  3SWS D;  4WJK A;  3V5W B;  5GSA A;  3EI2 A;  4J78 A;  3JRO A;  4HDJ A;  4GM9 A;  1UTC A;  3UVK A;  4GZ8 A; 
#chains in the Genus database with same CATH homology
 3EI1 A;  3MZL A;  4GQ2 P;  4O1Q D;  2J56 H;  4A11 B;  4AEZ A;  3IJC A;  3DSM A;  4A7J A;  3UKR C;  3PSL A;  5CXC A;  4BUJ C;  5C9Z B;  3IJ0 A;  5FA5 B;  4L3G D;  1MG2 A;  4L9O A;  4PBY A;  4JSP C;  4E54 B;  3ZWL B;  4L3H D;  2H47 A;  1U2V C;  3MMY A;  4OZU A;  4YVD A;  2AGL A;  2H3X A;  3SN6 B;  4K3J B;  5K1C C;  5TEF A;  3SBQ A;  2H68 A;  3RRM C;  2IUP A;  2UZX B;  5AMS A;  5JWZ A;  4CY2 A;  4CY5 A;  3C5M A;  3UVN A;  2H6Q A;  5CYK B;  4XYI A;  2HKM A;  3PXT D;  4CI8 A;  1GG2 B;  4J87 A;  1JMZ B;  3UR4 A;  4J73 A;  2CO0 C;  4EWR A;  4GQB B;  4ERY A;  1U4C A;  4CZX A;  5EAM A;  4LG9 A;  2Q7Q A;  3IJ1 A;  3N0E A;  2AH1 A;  3V7D B;  3MXX A;  3SCY A;  2B5M A;  5IT9 g;  4GGA A;  4O3T B;  5I5I A;  5EAR A;  2YNP A;  4ERQ A;  3I8E A;  5H14 A;  3RMZ D;  3I7O A;  4A0A B;  2HXC A;  1GOT B;  3W15 A;  4A09 A;  3OTT A;  4J8B A;  3IKO A;  3RN1 D;  3OKY A;  4E5Z A;  4FA5 D;  2XYI A;  3K26 A;  4O9D A;  2XU7 A;  3N0D A;  4XYH A;  3SHF A;  3FM0 A;  4J82 A;  2PM6 B;  5KDO B;  1VYH C;  2IUR A;  2OK6 A;  3L4M D;  3OW8 A;  3KRX B;  3EU7 A;  3AL9 A;  2B5N A;  3BWS A;  3EI1 B;  5CYK A;  4KFM B;  3BG1 A;  5I5J A;  4CC9 A;  4TZ4 A;  4AOW A;  3MKQ A;  2H14 A;  4GGC A;  4JD2 C;  5EML B;  3KRW B;  4NSX A;  4CY1 A;  4IMM A;  3CIK B;  3IIW A;  4IA9 A;  4QL1 A;  4QRJ A;  2I3T A;  2I3S A;  3SLE D;  4GM8 A;  3VGZ A;  3NVN A;  3PXW D;  1XKS A;  2P9I C;  2AQ5 A;  4JSX C;  2YNN A;  3SXT D;  1XIP A;  4GGD A;  5SXM A;  5TF2 A;  2H9N A;  3I2N A;  2AH0 A;  2OVR B;  4A0A A;  4GM3 A;  5AFU 3;  3I7L A;  2GC7 A;  4H5I A;  4GMB A;  2XL2 A;  3E0C A;  2PM9 B;  2CE9 A;  1MDA H;  2YNO A;  5HE3 B;  3K27 A;  2P9L C;  3JRP A;  4A08 B;  1GXR A;  4J81 A;  2IAA A;  2IWF A;  3RN0 D;  4I79 A;  5EAP A;  2BBK H;  3EMH A;  2IWK A;  4ZOX A;  2CE8 A;  3I89 A;  3RLM D;  2HYE A;  3RSE C;  5EM2 A;  4FAV D;  3PXS D;  3IIY A;  4D6V A;  2P9N C;  1K32 A;  4U1E I;  4CZV A;  5FKS A;  2H6N A;  1A0R B;  4FAN D;  5THA A;  4K3I D;  5TEE A;  4A2L A;  1ERJ A;  5HYN B;  4ES0 A;  4JSV C;  2IUQ A;  4G56 B;  1TBG A;  3HFQ A;  5EAL A;  4X60 B;  1PI6 A;  4CI2 A;  4PXW A;  1JOF A;  3ULE C;  3CFV A;  4ZOY A;  3A0F A;  3AL8 A;  2HJ4 A;  5FKT A;  4A11 A;  3FRX A;  4PSW B;  2G99 A;  2HKR A;  2H13 A;  3J80 g;  5GXI A;  2PM9 A;  1JJU B;  3FGB A;  2B4E A;  4U7A A;  3PVW B;  5IGO A;  4FB1 D;  1SHY B;  1L0Q A;  3UVO A;  2HJB A;  5TDH B;  2AGW A;  4FWW A;  2OVQ B;  4A08 A;  4H5J A;  2PBI B;  1XHM A;  3OKW A;  5IJ7 E;  3EI2 B;  2W18 A;  4ESG A;  3PVU B;  1QNI A;  5HE0 B;  1YFQ A;  2OIZ A;  2OJY A;  3J81 g;  2H6K A;  3SVW D;  4PBZ A;  3C99 A;  5K19 A;  2GNQ A;  4J84 A;  5IC7 A;  5EMJ B;  2H9P A;  3P4F A;  1B9Y A;  5EMM B;  3ORV D;  4ZN4 A;  5I5M A;  2J55 H;  2I0T A;  3EI4 A;  4JSN C;  5FQD A;  1B9X A;  4GQ1 A;  4LGN A;  2BCJ B;  4CI1 A;  4O45 A;  4CI3 A;  2GC4 A;  4QT8 A;  4OWR A;  5FLX g;  3MKS B;  3EI3 B;  3JZH A;  2PM7 B;  3RFG A;  3EI3 A;  5H17 A;  5IGQ A;  4FA1 D;  1GP2 B;  2AGX A;  3V9F A;  2I0S A;  1P22 A;  2OK4 A;  1R5M A;  2H9L A;  5CXC B;  4A0B A;  2TRC B;  2P9K C;  3SFZ A;  4PSX B;  4Z8L A;  2Z2P A;  3OL2 A;  3RFH A;  2YBA A;  2AGY A;  2P9P C;  4UI9 R;  1MG3 A;  3ODT A;  2CNX A;  3DXM C;  5FXY A;  3C75 H;  4QQE A;  4L1Q D;  3MZK A;  1NR0 A;  5C2W B;  5A2Q g;  4BL0 A;  4X3E A;  2YMU A;  4LG8 A;  4ZOZ A;  3NVX A;  5EMK B;  3OKY B;  4E5Z B;  1Q47 A;  4FA4 D;  5HQG A;  4A09 B;  3CFS B;  2Z2N A;  3PE7 A;  4A2M A;  4PNK B;  5GXH A;  4JT6 C;  3EI4 B;  2P9S C;  2HES X;  4E54 A;  3DXK C;  1RI6 A;  3GRE A;  3UKU C;  3UVM A;  4Y7R A;  3GFC A;  3SBP A;  4R7A B;  2UZY B;  3SJL D;  5GMK n;  4JT5 C;  4FA9 D;  3JAM g;  3JZN A;  4J79 A;  1SQJ A;  4XEI C;  2IUV A;  2I0R A;  3JZG A;  5EM2 B;  1SQ9 A;  3F3G A;  5B4W A;  4CZY A;  3AFC A;  2P9U C;  5C2V B;  1OMW B;  3EWE A;  3BG0 A;  1K8K C;  1PEV A;  2OVP B;  4J0W A;  3AH8 B;  2YB8 B;  3I8C A;  4CY3 A;  3NVQ A;  5AJA A;  4ERZ A;  2QC5 A;  4BH6 A;  5IJ8 E;  3DWL C;  3PSC B;  3JPX A;  2MTA H;  2G9A A;  3AL8 B;  3SBR A;  4J8G A;  2H9M A;  3C9C A;  4X61 B;  2CN3 A;  3VA6 A;  3F3P A;  4ZOV A;  2QXV A;  1N6F A;  1NEX B;  3F3F A;  3I7H A;  4D0K A;  5H1M A;  1N6D A;  5CXB B;  3OKT A;  3I7K A;  1PBY B;  3L4O D;  5FKQ A;  4N14 A;  3VH0 A;  2XL3 A;  3U4Y A;  4X63 B;  4PC0 A;  4FHL A;  2B5L A;  2EBS A;  4O3U B;  1S4U X;  4J77 A;  1OLZ A;  3DM0 A;  3I7N A;  2Z2O A;  3I7P A;  3JB9 L;  4J86 A;  5HE1 B;  2CN2 A;  1JMX B;  2J57 G;  4JXM A;  1FWX A;  5FKR A;  1TYQ C;  4Y5R D;  1PGU A;  4J0X A;  4A0B B;  3SMR A;  2CO0 A;  3OL2 B;  3B7F A;  5CXB A;  3EG6 A;  4MK0 B;  3UVL A;  5HE2 B;  2AGZ A;  2O9K A;  1N6E A;  3SWS D;  3V5W B;  5GSA A;  3EI2 A;  4J78 A;  3JRO A;  4HDJ A;  4GM9 A;  3UVK A;  4GZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...