3J80g

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
324
structure length
318
Chain Sequence
SSNIMLVLRGTLEGHNGWVTSLSTSAAQPNLLVSGSRDKTLISWRLTENEQQFGVPVRSYKGHSHIVQDVVVSADGNYAVSASWDKTLRLWNLATGNSEARFVGHTGDVLSVAIDANSSKIISASRDKTIRVWNTVGDCAYVLLGHTDWVTKVRVAPKNLVDDGRITFVSAGMDKIVRSWSLNSYRIEADFIGHNNYINVVQPSPDGSLAASAGKDGQIYVWNLKHKSAFMNFDAKDEVFALAFSPSRFWLTAATASGIKIYDLENEVLIDELKPEFAGYTKAQDPHAVSLAWSADGQTLFAGYTDNVIRVWQVMTAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
molecule keywords 18S rRNA
total genus 45
structure length 318
sequence length 324
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
g PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3j80g01
5GXHA 4ESGA 1NEXB 3RFGA 4PNKB 4PSWB 4MK0B 5AJAA 2B5NA 3AL8B 1XIPA 2P9SC 4FA4D 3VH0A 2QXVA 3I7HA 4TZ4A 2H6KA 3SBQA 2GC7A 4K3ID 3PXTD 3BWSA 2H6QA 3P4FA 2YNNA 4J0WA 4GQ1A 1XHMA 4A11B 4O3TB 3AH8B 3NVXA 1JJUB 3SLED 1SQJA 5HE2B 3RSEC 2OK4A 5FKRA 2GNQA 3MZLA 5EALA 4E54B 2AGYA 4K3JB 3F3FA 2Z2NA 5CXBB 4U7AA 5EMKB 2J56H 4EWRA 2HXCA 2CO0A 4GM3A 3MZKA 5CXCA 4ES0A 1PEVA 3ULEC 2HYEA 4NSXA 3L4MD 2W18A 3I7PA 4E5ZA 4CY5A 3V5WB 3EI3B 2J57G 3EI1A 4N14A 1TBGA 4E5ZB 3UKRC 4GM8A 4J8GA 2XYIA 3SJLD 2H68A 5H1MA 4IMMA 4PSXB 5IC7A 4CI1A 3SN6B 1ERJA 5EMJB 4ERZA 5CYKB 3DXMC 2CN3A 2P9LC 1OLZA 5EMLB 2MTAH 4ZOXA 4CI3A 2IAAA 3OL2B 4BUJC 4GGCA 3JZHA 1N6DA 4CZVA 4XYIA 2G9AA 3JB9L 3IJ1A 4CI2A 4ZOYA 1GP2B 5GXIA 3VGZA 3RLMD 3OTTA 5HYNB 5HE3B 2HESX 3PVWB 2XU7A 3GREA 2IUQA 1U4CA 4X3EA 5FLXg 4GQBB 3E0CA 5TDHB 4ERYA 3IJCA 3BG0A 3CFVA 2H9MA 4GGDA 1FWXA 2YNPA 1L0QA 4J8BA 2H47A 4E54A 3FM0A 5FXYA 1OMWB 1RI6A 3ORVD 4LG9A 1N6FA 2BBKH 4CC9A 3SFZA 5FKQA 1K32A 1B9XA 3RFHA 5IGOA 5KDOB 4Z8LA 4CZXA 5C9ZB 2PM7B 3I2NA 1B9YA 4QRJA 3K26A 3RN0D 2CO0C 5I5IA 4BL0A 2TRCB 4J0XA 2OVRB 3U4YA 2H14A 4A7JA 3DSMA 1VYHC 2CN2A 4A0AA 4PBZA 1K8KC 2P9KC 2AGXA 4JD2C 2PM9B 3IKOA 3I8EA 3ODTA 2AQ5A 4J87A 2H9LA 4O1QD 4J78A 2PBIB 5EARA 5K1CC 3C99A 3EWEA 4FA9D 4CY1A 2HJBA 3MKQA 4CI8A 3UR4A 1QNIA 4J82A 4A08A 5FQDA 3DXKC 3BG1A 2OIZA 2H9PA 2IWKA 3PSCB 5FKTA 3W15A 4J77A 3DWLC 4A2LA 1PBYB 3N0DA 3JZGA 4QQEA 4FA5D 3PSLA 3SCYA 2UZYB 3OKYA 4YVDA 4Y7RA 4CY2A 2YBAA 4JXMA 3UVNA 4G56B 3GFCA 3OKYB 4FAVD 3FGBA 4XYHA 3EI3A 3SMRA 4PXWA 2P9IC 2I3SA 3EI2B 3JAMg 1PGUA 4L9OA 3OL2A 4JT6C 4D0KA 2I0SA 5CYKA 3DM0A 5JWZA 4FAND 4JSVC 3V7DB 4ERQA 3KRWB 3SBRA 1MG2A 4QL1A 3ZWLB 5K19A 3J80g 2HKMA 4GQ2P 3OKTA 3CFSB 4FWWA 4ZOVA 3I8CA 2BCJB 2HJ4A 4H5JA 3OKWA 3RN1D 1GOTB 2G99A 2O9KA 3K27A 5IJ7E 4FA1D 4A0BA 3NVNA 4J84A 3AL9A 3VA6A 3JZNA 4A0BB 4LGNA 5C2VB 2YB8B 3J81g 2P9PC 5EAPA 1YFQA 4ZOZA 5TEFA 2AH0A 1GXRA 3UKUC 3PVUB 2XL2A 3UVKA 5EMMB 2B5MA 3IIYA 4A2MA 2H9NA 3EI1B 3HFQA 2P9NC 5B4WA 2PM9A 1JOFA 2OK6A 2AGLA 3F3GA 2OVPB 2CE8A 5IJ8E 4L3HD 4L1QD 3N0EA 4OWRA 3UVOA 5IGQA 3L4OD 2Q7QA 5H14A 2P9UC 1GG2B 4GGAA 1S4UX 3F3PA 5AMSA 4ZN4A 4J73A 2YNOA 4HDJA 3SXTD 3A0FA 4A0AB 4O9DA 5HQGA 2H6NA 2IWFA 2I0RA 2OJYA 5GSAA 3B7FA 4AEZA 3EG6A 4JSXC 1JMZB 5EM2B 4IA9A 4O45A 2AH1A 5GMKn 2CNXA 4X61B 4BH6A 3EI4B 5CXBA 4JT5C 2AGWA 3UVLA 3EI4A 1Q47A 2B5LA 3JROA 5A2Qg 3FRXA 4A11A 3C9CA 2QC5A 4PC0A 5AFU3 1MG3A 2AGZA 5FA5B 3EMHA 3CIKB 4X63B 4A09B 4U1EI 4CZYA 2GC4A 4A09A 4I79A 3SBPA 4CY3A 3C5MA 5TF2A 3AL8A 3RRMC 1MDAH 3RMZD 2Z2OA 3SWSD 3JRPA 4GM9A 4AOWA 4J86A 2H13A 3MKSB 1PI6A 2I0TA 4GZ8A 4XEIC 3C75H 2PM6B 3IJ0A 3I89A 2IURA 4UI9R 3EU7A 4JSNC 4O3UB 5EM2A 3PE7A 4OZUA 2OVQB 3EI2A 3IIWA 3I7KA 3OW8A 1N6EA 3KRXB 2IUPA 3MXXA 2Z2PA 2IUVA 1R5MA 2CE9A 4J79A 1TYQC 2XL3A 1U2VC 5H17A 4H5IA 4PBYA 4FHLA 5I5MA 3MMYA 3SHFA 5HE0B 3JPXA 1XKSA 4R7AB 2UZXB 3I7LA 5EAMA 3I7OA 5FKSA 2YMUA 1SQ9A 5C2WB 3SVWD 5I5JA 4LG8A 5SXMA 3AFCA 1JMXB 2H3XA 4A08B 3PXSD 4L3GD 3I7NA 4KFMB 5THAA 4GMBA 1NR0A 5IT9g 4Y5RD 2I3TA 5HE1B 4J81A 5TEEA 2J55H 4JSPC 2B4EA 2HKRA 3V9FA 4FB1D 4X60B 4QT8A 5CXCB 2EBSA 1P22A 1SHYB 3NVQA 1A0RB 4D6VA 3UVMA 3PXWD
chains in the Genus database with same CATH superfamily
5GXHA 4AN1A 4ESGA 1NEXB 3RFGA 5HDBA 4PNKB 4PSWB 4MK0B 4DNWA 5AJAA 2B5NA 3AL8B 1XIPA 1E5TA 2P9SC 4FA4D 3VH0A 2QXVA 3I7HA 4TZ4A 2H6KA 4NBMA 3SBQA 4MMYA 2EICA 2GC7A 4K3ID 3PXTD 3BWSA 3ZE1A 2H6QA 3P4FA 2YNNA 4J0WA 4GQ1A 1XHMA 4A11B 4O3TB 3AH8B 3NVXA 3T3MA 1JJUB 4WK2A 3SLED 4MMXA 1SQJA 1H2XA 5HE2B 3RSEC 2OK4A 5FKRA 2GNQA 3MZLA 5EALA 4E54B 2AGYA 1GOFA 1T2XA 4K3JB 3F3FA 3O4IA 2Z2NA 5CXBB 4U7AA 1TYEA 5EMKB 2J56H 4EWRA 2HXCA 2CO0A 4GM3A 3MZKA 5CXCA 4ES0A 1PEVA 3ULEC 2HYEA 4NSXA 2WQ8A 2W18A 3I7PA 3L4MD 4E5ZA 1A12A 4CY5A 3V5WB 3EI3B 2J57G 3EI1A 4N14A 1TBGA 4E5ZB 3UKRC 4GM8A 4J8GA 5M5UA 3O4HA 2XYIA 1UOPA 3SJLD 2H68A 5H1MA 4IMMA 4PSXB 5IC7A 4CI1A 3SN6B 2VDMA 1ERJA 5EMJB 4ERZA 3DXMC 5CYKB 2CN3A 2P9LC 1OLZA 5EMLB 2MTAH 4ZOXA 4CI3A 4AX4A 2IAAA 2QZPA 3OL2B 5E6RA 5E6UA 2VDOA 4BUJC 1E8MA 4GGCA 3JZHA 1QFMA 1N6DA 3ZDXA 4CZVA 4XYIA 2G9AA 1BPOA 3JB9L 3IJ1A 4CI2A 4ZOYA 3EQ8A 1GP2B 5GXIA 1GOGA 1YR2A 3VGZA 1VZ2A 3RLMD 3OTTA 5HYNB 5HE3B 2HESX 3PVWB 3ZDZA 2XU7A 2IUQA 3GREA 1U4CA 4X3EA 1JV2A 2HU8A 2VDRA 5FLXg 4GQBB 5FFGA 3E0CA 3QI0A 5TDHB 4ERYA 4DNUA 3IJCA 3DDUA 4NAAA 3BG0A 3CFVA 4BCCA 2H9MA 4GGDA 1FWXA 2YNPA 4MMZA 1L0QA 4J8BA 2H47A 4RE5A 4E54A 3FM0A 5FXYA 1OMWB 1RI6A 3ORVD 4LG9A 1N6FA 2BBKH 4CC9A 3SFZA 5FKQA 1K32A 1B9XA 3RFHA 2EIEA 3IULA 5IGOA 5KDOB 1H2ZA 4Z8LA 4CZXA 5C9ZB 4BP8A 2PM7B 3I2NA 1B9YA 3IUJA 2BKLA 4QRJA 2HU5A 3K26A 3RN0D 2CO0C 5I5IA 4BL0A 2TRCB 4J0XA 2OVRB 3U4YA 2H14A 4A7JA 3DSMA 1U8CA 1VYHC 2CN2A 4A0AA 3IVMA 4PBZA 1K8KC 2P9KC 2AGXA 4JD2C 3I8EA 2PM9B 3IKOA 3NIDA 3ODTA 2AQ5A 4Z7NA 2VDQA 2VDNA 4J87A 2H9LA 4O1QD 3K6SA 3MUNA 4J78A 3KCIA 2PBIB 5EARA 3O4JA 5K1CC 3C99A 4WJKA 3EWEA 4AMZA 4FA9D 4CY1A 1K3IA 2HJBA 3MKQA 4CI8A 3UR4A 1QNIA 4J82A 4A08A 5FQDA 3DXKC 1JTDB 3BG1A 3QHYB 1H2WA 2OIZA 2H9PA 2IWKA 3PSCB 5FKTA 3W15A 4J77A 3DWLC 3K71A 4A2LA 1PBYB 3N0DA 3JZGA 4QQEA 4FA5D 3PSLA 3SCYA 4NC4A 2UZYB 4BP9A 3OKYA 4YVDA 4Y7RA 4L1MA 4CY2A 1GOHA 3IUQA 1QFSA 2YBAA 4JXMA 3UVNA 4G56B 3GFCA 3OKYB 4AMYA 4FAVD 3FGBA 2EIBA 5C92A 4XYHA 3EI3A 3SMRA 4PXWA 4G1MA 3NIFA 2P9IC 2I3SA 4JHPC 2XE4A 3EI2B 3JAMg 1PGUA 4L9OA 3OL2A 4JT6C 1VZ3A 4D0KA 2I0SA 5CYKA 4Z7OA 5M5VA 3DM0A 5JWZA 1I2MB 4FAND 1C9LA 4JSVC 3V7DB 4ERQA 3KRWB 3SBRA 4Z7QA 1MG2A 4QL1A 3ZWLB 5K19A 3GD1I 5FFOA 3J80g 2HKMA 4GQ2P 4QAMA 4WK0A 3OKTA 3CFSB 4FWWA 4ZOVA 3I8CA 2BCJB 2HJ4A 4H5JA 1C9IA 3OKWA 3RN1D 1GOTB 2G99A 3OF7A 2O9KA 3K27A 5IJ7E 4FA1D 4A0BA 3NVNA 4O02A 4J84A 4AN0A 3AL9A 3VA6A 3JZNA 3IJEA 4A0BB 1O6GA 4LGNA 5C2VB 2YB8B 4IRZA 3J81g 2P9PC 1E8NA 5EAPA 1YFQA 4ZOZA 5TEFA 2AH0A 1GXRA 3UKUC 3PVUB 2XL2A 3UVKA 3NIGA 2B5MA 5EMMB 3IIYA 4A2MA 2H9NA 3EI1B 3HFQA 2P9NC 5B4WA 2PM9A 1JOFA 2OK6A 2AGLA 3F3GA 2OVPB 2CE8A 5IJ8E 4L3HD 4L1QD 3N0EA 4OWRA 3UVOA 5IGQA 3L4OD 2Q7QA 5H14A 2P9UC 1GG2B 4GGAA 1S4UX 3F3PA 5AMSA 4BCBA 4ZN4A 4J73A 2YNOA 4HDJA 3SXTD 3A0FA 1O6FA 4A0AB 4O9DA 5HQGA 2H6NA 2IWFA 2I0RA 2OJYA 5GSAA 3K72A 4JHNA 3B7FA 4AEZA 1UOOA 3EG6A 4JSXC 1JMZB 5EM2B 4IA9A 4O45A 2AH1A 5GMKn 3FCUA 5C86A 2CNXA 5M5RA 4X61B 4BH6A 3EI4B 5CXBA 3EQ7A 1UTCA 4JT5C 3ZE2A 2AGWA 5M61A 3UVLA 1H2YA 3EI4A 1Q47A 2B5LA 2XZGA 3JROA 2VDKA 3FRXA 3GC3B 4G1EA 5A2Qg 4A11A 3C9CA 2QC5A 2VZ1A 4PC0A 5AFU3 1MG3A 2AGZA 5FA5B 3EMHA 3IUMA 3CIKB 2VC2A 4X63B 4A09B 4G55A 3IUNA 4U1EI 4CZYA 3ZDYA 2GC4A 4A09A 4I79A 3SBPA 4CY3A 4DNVA 3C5MA 5TF2A 5M5SA 3ZE0A 3AL8A 3RRMC 3T3PA 4D9SA 1MDAH 3RMZD 4UM9A 2Z2OA 3V4PA 3SWSD 3JRPA 4GM9A 3IURA 4AOWA 3FCSA 4RE6A 3MVDK 3V4VA 4J86A 2H13A 3MKSB 1PI6A 2I0TA 4GZ8A 4XEIC 3C75H 2PM6B 3IJ0A 3I89A 2IURA 2VDLA 4UI9R 3EU7A 2JKXA 1VE7A 4JSNC 2QR5A 4O3UB 5EM2A 3PE7A 4OZUA 2OVQB 3EI2A 3IIWA 3I7KA 3OW8A 1N6EA 1L5GA 3KRXB 5M5TA 2IUPA 3MXXA 2Z2PA 4BCDA 2IUVA 1R5MA 5E6SA 2CE9A 3MUOA 4J79A 1TYQC 2XL3A 3O4GA 1U2VC 5H17A 4H5IA 4PBYA 4FHLA 5I5MA 3MMYA 3SHFA 4WK4A 5HE0B 3JPXA 4O2WA 1XKSA 4R7AB 2UZXB 3I7LA 5EAMA 3I7OA 5FKSA 2YMUA 3VI4A 1SQ9A 5C2WB 3SVWD 5I5JA 4LG8A 2EIDA 3VI3A 5SXMA 3AFCA 1JMXB 2H3XA 4NENA 4A08B 1M1XA 2XDWA 4UM8A 3PXSD 4L3GD 3I7NA 4KFMB 5THAA 4GMBA 2HU7A 1NR0A 5IT9g 4Y5RD 2I3TA 5HE1B 4J81A 1VE6A 5TEEA 2J55H 2VZ3A 4JSPC 2B4EA 2HKRA 3V9FA 4FB1D 1UOQA 4X60B 4QT8A 5CXCB 3EQ9A 2EBSA 1P22A 1SHYB 3NVQA 1A0RB 2VDPA 4D6VA 3UVMA 3PXWD
chains in the Genus database with same CATH topology
5GXHA 4ESGA 1NEXB 3RFGA 4PNKB 4PSWB 4MK0B 5AJAA 2B5NA 3AL8B 1XIPA 2P9SC 4FA4D 3VH0A 2QXVA 3I7HA 4TZ4A 2H6KA 3SBQA 2GC7A 4K3ID 3PXTD 3BWSA 2H6QA 3P4FA 2YNNA 4J0WA 4GQ1A 1XHMA 4A11B 4O3TB 3AH8B 3NVXA 1JJUB 3SLED 1SQJA 5HE2B 3RSEC 2OK4A 5FKRA 2GNQA 3MZLA 5EALA 4E54B 2AGYA 4K3JB 3F3FA 2Z2NA 5CXBB 4U7AA 5EMKB 2J56H 4EWRA 2HXCA 2CO0A 4GM3A 3MZKA 5CXCA 4ES0A 1PEVA 3ULEC 2HYEA 4NSXA 3L4MD 2W18A 3I7PA 4E5ZA 4CY5A 3V5WB 3EI3B 2J57G 3EI1A 4N14A 1TBGA 4E5ZB 3UKRC 4GM8A 4J8GA 2XYIA 3SJLD 2H68A 5H1MA 4IMMA 4PSXB 5IC7A 4CI1A 3SN6B 1ERJA 5EMJB 4ERZA 5CYKB 3DXMC 2CN3A 2P9LC 1OLZA 5EMLB 2MTAH 4ZOXA 4CI3A 2IAAA 3OL2B 4BUJC 4GGCA 3JZHA 1N6DA 4CZVA 4XYIA 2G9AA 3JB9L 3IJ1A 4CI2A 4ZOYA 1GP2B 5GXIA 3VGZA 3RLMD 3OTTA 5HYNB 5HE3B 2HESX 3PVWB 2XU7A 3GREA 2IUQA 1U4CA 4X3EA 5FLXg 4GQBB 3E0CA 5TDHB 4ERYA 3IJCA 3BG0A 3CFVA 2H9MA 4GGDA 1FWXA 2YNPA 1L0QA 4J8BA 2H47A 4E54A 3FM0A 5FXYA 1OMWB 1RI6A 3ORVD 4LG9A 1N6FA 2BBKH 4CC9A 3SFZA 5FKQA 1K32A 1B9XA 3RFHA 5IGOA 5KDOB 4Z8LA 4CZXA 5C9ZB 2PM7B 3I2NA 1B9YA 4QRJA 3K26A 3RN0D 2CO0C 5I5IA 4BL0A 2TRCB 4J0XA 2OVRB 3U4YA 2H14A 4A7JA 3DSMA 1VYHC 2CN2A 4A0AA 4PBZA 1K8KC 2P9KC 2AGXA 4JD2C 2PM9B 3IKOA 3I8EA 3ODTA 2AQ5A 4J87A 2H9LA 4O1QD 4J78A 2PBIB 5EARA 5K1CC 3C99A 3EWEA 4FA9D 4CY1A 2HJBA 3MKQA 4CI8A 3UR4A 1QNIA 4J82A 4A08A 5FQDA 3DXKC 3BG1A 2OIZA 2H9PA 2IWKA 3PSCB 5FKTA 3W15A 4J77A 3DWLC 4A2LA 1PBYB 3N0DA 3JZGA 4QQEA 4FA5D 3PSLA 3SCYA 2UZYB 3OKYA 4YVDA 4Y7RA 4CY2A 2YBAA 4JXMA 3UVNA 4G56B 3GFCA 3OKYB 4FAVD 3FGBA 4XYHA 3EI3A 3SMRA 4PXWA 2P9IC 2I3SA 3EI2B 3JAMg 1PGUA 4L9OA 3OL2A 4JT6C 4D0KA 2I0SA 5CYKA 3DM0A 5JWZA 4FAND 4JSVC 3V7DB 4ERQA 3KRWB 3SBRA 1MG2A 4QL1A 3ZWLB 5K19A 3J80g 2HKMA 4GQ2P 3OKTA 3CFSB 4FWWA 4ZOVA 3I8CA 2BCJB 2HJ4A 4H5JA 3OKWA 3RN1D 1GOTB 2G99A 2O9KA 3K27A 5IJ7E 4FA1D 4A0BA 3NVNA 4J84A 3AL9A 3VA6A 3JZNA 4A0BB 4LGNA 5C2VB 2YB8B 3J81g 2P9PC 5EAPA 1YFQA 4ZOZA 5TEFA 2AH0A 1GXRA 3UKUC 3PVUB 2XL2A 3UVKA 5EMMB 2B5MA 3IIYA 4A2MA 2H9NA 3EI1B 3HFQA 2P9NC 5B4WA 2PM9A 1JOFA 2OK6A 2AGLA 3F3GA 2OVPB 2CE8A 5IJ8E 4L3HD 4L1QD 3N0EA 4OWRA 3UVOA 5IGQA 3L4OD 2Q7QA 5H14A 2P9UC 1GG2B 4GGAA 1S4UX 3F3PA 5AMSA 4ZN4A 4J73A 2YNOA 4HDJA 3SXTD 3A0FA 4A0AB 4O9DA 5HQGA 2H6NA 2IWFA 2I0RA 2OJYA 5GSAA 3B7FA 4AEZA 3EG6A 4JSXC 1JMZB 5EM2B 4IA9A 4O45A 2AH1A 5GMKn 2CNXA 4X61B 4BH6A 3EI4B 5CXBA 4JT5C 2AGWA 3UVLA 3EI4A 1Q47A 2B5LA 3JROA 5A2Qg 3FRXA 4A11A 3C9CA 2QC5A 4PC0A 5AFU3 1MG3A 2AGZA 5FA5B 3EMHA 3CIKB 4X63B 4A09B 4U1EI 4CZYA 2GC4A 4A09A 4I79A 3SBPA 4CY3A 3C5MA 5TF2A 3AL8A 3RRMC 1MDAH 3RMZD 2Z2OA 3SWSD 3JRPA 4GM9A 4AOWA 4J86A 2H13A 3MKSB 1PI6A 2I0TA 4GZ8A 4XEIC 3C75H 2PM6B 3IJ0A 3I89A 2IURA 4UI9R 3EU7A 4JSNC 4O3UB 5EM2A 3PE7A 4OZUA 2OVQB 3EI2A 3IIWA 3I7KA 3OW8A 1N6EA 3KRXB 2IUPA 3MXXA 2Z2PA 2IUVA 1R5MA 2CE9A 4J79A 1TYQC 2XL3A 1U2VC 5H17A 4H5IA 4PBYA 4FHLA 5I5MA 3MMYA 3SHFA 5HE0B 3JPXA 1XKSA 4R7AB 2UZXB 3I7LA 5EAMA 3I7OA 5FKSA 2YMUA 1SQ9A 5C2WB 3SVWD 5I5JA 4LG8A 5SXMA 3AFCA 1JMXB 2H3XA 4A08B 3PXSD 4L3GD 3I7NA 4KFMB 5THAA 4GMBA 1NR0A 5IT9g 4Y5RD 2I3TA 5HE1B 4J81A 5TEEA 2J55H 4JSPC 2B4EA 2HKRA 3V9FA 4FB1D 4X60B 4QT8A 5CXCB 2EBSA 1P22A 1SHYB 3NVQA 1A0RB 4D6VA 3UVMA 3PXWD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GXH A;  4ESG A;  1NEX B;  3RFG A;  4PNK B;  4PSW B;  4MK0 B;  5AJA A;  2B5N A;  3AL8 B;  1XIP A;  2P9S C;  4FA4 D;  3VH0 A;  2QXV A;  3I7H A;  4TZ4 A;  2H6K A;  3SBQ A;  2GC7 A;  4K3I D;  3PXT D;  3BWS A;  2H6Q A;  3P4F A;  2YNN A;  4J0W A;  4GQ1 A;  1XHM A;  4A11 B;  4O3T B;  3AH8 B;  3NVX A;  1JJU B;  3SLE D;  1SQJ A;  5HE2 B;  3RSE C;  2OK4 A;  5FKR A;  2GNQ A;  3MZL A;  5EAL A;  4E54 B;  2AGY A;  4K3J B;  3F3F A;  2Z2N A;  5CXB B;  4U7A A;  5EMK B;  2J56 H;  4EWR A;  2HXC A;  2CO0 A;  4GM3 A;  3MZK A;  5CXC A;  4ES0 A;  1PEV A;  3ULE C;  2HYE A;  4NSX A;  3L4M D;  2W18 A;  3I7P A;  4E5Z A;  4CY5 A;  3V5W B;  3EI3 B;  2J57 G;  3EI1 A;  4N14 A;  1TBG A;  4E5Z B;  3UKR C;  4GM8 A;  4J8G A;  2XYI A;  3SJL D;  2H68 A;  5H1M A;  4IMM A;  4PSX B;  5IC7 A;  4CI1 A;  3SN6 B;  1ERJ A;  5EMJ B;  4ERZ A;  5CYK B;  3DXM C;  2CN3 A;  2P9L C;  1OLZ A;  5EML B;  2MTA H;  4ZOX A;  4CI3 A;  2IAA A;  3OL2 B;  4BUJ C;  4GGC A;  3JZH A;  1N6D A;  4CZV A;  4XYI A;  2G9A A;  3JB9 L;  3IJ1 A;  4CI2 A;  4ZOY A;  1GP2 B;  5GXI A;  3VGZ A;  3RLM D;  3OTT A;  5HYN B;  5HE3 B;  2HES X;  3PVW B;  2XU7 A;  3GRE A;  2IUQ A;  1U4C A;  4X3E A;  5FLX g;  4GQB B;  3E0C A;  5TDH B;  4ERY A;  3IJC A;  3BG0 A;  3CFV A;  2H9M A;  4GGD A;  1FWX A;  2YNP A;  1L0Q A;  4J8B A;  2H47 A;  4E54 A;  3FM0 A;  5FXY A;  1OMW B;  1RI6 A;  3ORV D;  4LG9 A;  1N6F A;  2BBK H;  4CC9 A;  3SFZ A;  5FKQ A;  1K32 A;  1B9X A;  3RFH A;  5IGO A;  5KDO B;  4Z8L A;  4CZX A;  5C9Z B;  2PM7 B;  3I2N A;  1B9Y A;  4QRJ A;  3K26 A;  3RN0 D;  2CO0 C;  5I5I A;  4BL0 A;  2TRC B;  4J0X A;  2OVR B;  3U4Y A;  2H14 A;  4A7J A;  3DSM A;  1VYH C;  2CN2 A;  4A0A A;  4PBZ A;  1K8K C;  2P9K C;  2AGX A;  4JD2 C;  2PM9 B;  3IKO A;  3I8E A;  3ODT A;  2AQ5 A;  4J87 A;  2H9L A;  4O1Q D;  4J78 A;  2PBI B;  5EAR A;  5K1C C;  3C99 A;  3EWE A;  4FA9 D;  4CY1 A;  2HJB A;  3MKQ A;  4CI8 A;  3UR4 A;  1QNI A;  4J82 A;  4A08 A;  5FQD A;  3DXK C;  3BG1 A;  2OIZ A;  2H9P A;  2IWK A;  3PSC B;  5FKT A;  3W15 A;  4J77 A;  3DWL C;  4A2L A;  1PBY B;  3N0D A;  3JZG A;  4QQE A;  4FA5 D;  3PSL A;  3SCY A;  2UZY B;  3OKY A;  4YVD A;  4Y7R A;  4CY2 A;  2YBA A;  4JXM A;  3UVN A;  4G56 B;  3GFC A;  3OKY B;  4FAV D;  3FGB A;  4XYH A;  3EI3 A;  3SMR A;  4PXW A;  2P9I C;  2I3S A;  3EI2 B;  3JAM g;  1PGU A;  4L9O A;  3OL2 A;  4JT6 C;  4D0K A;  2I0S A;  5CYK A;  3DM0 A;  5JWZ A;  4FAN D;  4JSV C;  3V7D B;  4ERQ A;  3KRW B;  3SBR A;  1MG2 A;  4QL1 A;  3ZWL B;  5K19 A;  3J80 g;  2HKM A;  4GQ2 P;  3OKT A;  3CFS B;  4FWW A;  4ZOV A;  3I8C A;  2BCJ B;  2HJ4 A;  4H5J A;  3OKW A;  3RN1 D;  1GOT B;  2G99 A;  2O9K A;  3K27 A;  5IJ7 E;  4FA1 D;  4A0B A;  3NVN A;  4J84 A;  3AL9 A;  3VA6 A;  3JZN A;  4A0B B;  4LGN A;  5C2V B;  2YB8 B;  3J81 g;  2P9P C;  5EAP A;  1YFQ A;  4ZOZ A;  5TEF A;  2AH0 A;  1GXR A;  3UKU C;  3PVU B;  2XL2 A;  3UVK A;  5EMM B;  2B5M A;  3IIY A;  4A2M A;  2H9N A;  3EI1 B;  3HFQ A;  2P9N C;  5B4W A;  2PM9 A;  1JOF A;  2OK6 A;  2AGL A;  3F3G A;  2OVP B;  2CE8 A;  5IJ8 E;  4L3H D;  4L1Q D;  3N0E A;  4OWR A;  3UVO A;  5IGQ A;  3L4O D;  2Q7Q A;  5H14 A;  2P9U C;  1GG2 B;  4GGA A;  1S4U X;  3F3P A;  5AMS A;  4ZN4 A;  4J73 A;  2YNO A;  4HDJ A;  3SXT D;  3A0F A;  4A0A B;  4O9D A;  5HQG A;  2H6N A;  2IWF A;  2I0R A;  2OJY A;  5GSA A;  3B7F A;  4AEZ A;  3EG6 A;  4JSX C;  1JMZ B;  5EM2 B;  4IA9 A;  4O45 A;  2AH1 A;  5GMK n;  2CNX A;  4X61 B;  4BH6 A;  3EI4 B;  5CXB A;  4JT5 C;  2AGW A;  3UVL A;  3EI4 A;  1Q47 A;  2B5L A;  3JRO A;  5A2Q g;  3FRX A;  4A11 A;  3C9C A;  2QC5 A;  4PC0 A;  5AFU 3;  1MG3 A;  2AGZ A;  5FA5 B;  3EMH A;  3CIK B;  4X63 B;  4A09 B;  4U1E I;  4CZY A;  2GC4 A;  4A09 A;  4I79 A;  3SBP A;  4CY3 A;  3C5M A;  5TF2 A;  3AL8 A;  3RRM C;  1MDA H;  3RMZ D;  2Z2O A;  3SWS D;  3JRP A;  4GM9 A;  4AOW A;  4J86 A;  2H13 A;  3MKS B;  1PI6 A;  2I0T A;  4GZ8 A;  4XEI C;  3C75 H;  2PM6 B;  3IJ0 A;  3I89 A;  2IUR A;  4UI9 R;  3EU7 A;  4JSN C;  4O3U B;  5EM2 A;  3PE7 A;  4OZU A;  2OVQ B;  3EI2 A;  3IIW A;  3I7K A;  3OW8 A;  1N6E A;  3KRX B;  2IUP A;  3MXX A;  2Z2P A;  2IUV A;  1R5M A;  2CE9 A;  4J79 A;  1TYQ C;  2XL3 A;  1U2V C;  5H17 A;  4H5I A;  4PBY A;  4FHL A;  5I5M A;  3MMY A;  3SHF A;  5HE0 B;  3JPX A;  1XKS A;  4R7A B;  2UZX B;  3I7L A;  5EAM A;  3I7O A;  5FKS A;  2YMU A;  1SQ9 A;  5C2W B;  3SVW D;  5I5J A;  4LG8 A;  5SXM A;  3AFC A;  1JMX B;  2H3X A;  4A08 B;  3PXS D;  4L3G D;  3I7N A;  4KFM B;  5THA A;  4GMB A;  1NR0 A;  5IT9 g;  4Y5R D;  2I3T A;  5HE1 B;  4J81 A;  5TEE A;  2J55 H;  4JSP C;  2B4E A;  2HKR A;  3V9F A;  4FB1 D;  4X60 B;  4QT8 A;  5CXC B;  2EBS A;  1P22 A;  1SHY B;  3NVQ A;  1A0R B;  4D6V A;  3UVM A;  3PXW D; 
#chains in the Genus database with same CATH topology
 5GXH A;  4AN1 A;  4ESG A;  1NEX B;  3RFG A;  5HDB A;  4PNK B;  4PSW B;  4MK0 B;  4DNW A;  5AJA A;  2B5N A;  3AL8 B;  1XIP A;  1E5T A;  2P9S C;  4FA4 D;  3VH0 A;  2QXV A;  3I7H A;  4TZ4 A;  2H6K A;  4NBM A;  3SBQ A;  4MMY A;  2EIC A;  2GC7 A;  4K3I D;  3PXT D;  3BWS A;  3ZE1 A;  2H6Q A;  3P4F A;  2YNN A;  4J0W A;  4GQ1 A;  1XHM A;  4A11 B;  4O3T B;  3AH8 B;  3NVX A;  3T3M A;  1JJU B;  4WK2 A;  3SLE D;  4MMX A;  1SQJ A;  1H2X A;  5HE2 B;  3RSE C;  2OK4 A;  5FKR A;  2GNQ A;  3MZL A;  5EAL A;  4E54 B;  2AGY A;  1GOF A;  1T2X A;  4K3J B;  3F3F A;  3O4I A;  2Z2N A;  5CXB B;  4U7A A;  1TYE A;  5EMK B;  2J56 H;  4EWR A;  2HXC A;  2CO0 A;  4GM3 A;  3MZK A;  5CXC A;  4ES0 A;  1PEV A;  3ULE C;  2HYE A;  4NSX A;  2WQ8 A;  2W18 A;  3I7P A;  3L4M D;  4E5Z A;  1A12 A;  4CY5 A;  3V5W B;  3EI3 B;  2J57 G;  3EI1 A;  4N14 A;  1TBG A;  4E5Z B;  3UKR C;  4GM8 A;  4J8G A;  5M5U A;  3O4H A;  2XYI A;  1UOP A;  3SJL D;  2H68 A;  5H1M A;  4IMM A;  4PSX B;  5IC7 A;  4CI1 A;  3SN6 B;  2VDM A;  1ERJ A;  5EMJ B;  4ERZ A;  3DXM C;  5CYK B;  2CN3 A;  2P9L C;  1OLZ A;  5EML B;  2MTA H;  4ZOX A;  4CI3 A;  4AX4 A;  2IAA A;  2QZP A;  3OL2 B;  5E6R A;  5E6U A;  2VDO A;  4BUJ C;  1E8M A;  4GGC A;  3JZH A;  1QFM A;  1N6D A;  3ZDX A;  4CZV A;  4XYI A;  2G9A A;  1BPO A;  3JB9 L;  3IJ1 A;  4CI2 A;  4ZOY A;  3EQ8 A;  1GP2 B;  5GXI A;  1GOG A;  1YR2 A;  3VGZ A;  1VZ2 A;  3RLM D;  3OTT A;  5HYN B;  5HE3 B;  2HES X;  3PVW B;  3ZDZ A;  2XU7 A;  2IUQ A;  3GRE A;  1U4C A;  4X3E A;  1JV2 A;  2HU8 A;  2VDR A;  5FLX g;  4GQB B;  5FFG A;  3E0C A;  3QI0 A;  5TDH B;  4ERY A;  4DNU A;  3IJC A;  3DDU A;  4NAA A;  3BG0 A;  3CFV A;  4BCC A;  2H9M A;  4GGD A;  1FWX A;  2YNP A;  4MMZ A;  1L0Q A;  4J8B A;  2H47 A;  4RE5 A;  4E54 A;  3FM0 A;  5FXY A;  1OMW B;  1RI6 A;  3ORV D;  4LG9 A;  1N6F A;  2BBK H;  4CC9 A;  3SFZ A;  5FKQ A;  1K32 A;  1B9X A;  3RFH A;  2EIE A;  3IUL A;  5IGO A;  5KDO B;  1H2Z A;  4Z8L A;  4CZX A;  5C9Z B;  4BP8 A;  2PM7 B;  3I2N A;  1B9Y A;  3IUJ A;  2BKL A;  4QRJ A;  2HU5 A;  3K26 A;  3RN0 D;  2CO0 C;  5I5I A;  4BL0 A;  2TRC B;  4J0X A;  2OVR B;  3U4Y A;  2H14 A;  4A7J A;  3DSM A;  1U8C A;  1VYH C;  2CN2 A;  4A0A A;  3IVM A;  4PBZ A;  1K8K C;  2P9K C;  2AGX A;  4JD2 C;  3I8E A;  2PM9 B;  3IKO A;  3NID A;  3ODT A;  2AQ5 A;  4Z7N A;  2VDQ A;  2VDN A;  4J87 A;  2H9L A;  4O1Q D;  3K6S A;  3MUN A;  4J78 A;  3KCI A;  2PBI B;  5EAR A;  3O4J A;  5K1C C;  3C99 A;  4WJK A;  3EWE A;  4AMZ A;  4FA9 D;  4CY1 A;  1K3I A;  2HJB A;  3MKQ A;  4CI8 A;  3UR4 A;  1QNI A;  4J82 A;  4A08 A;  5FQD A;  3DXK C;  1JTD B;  3BG1 A;  3QHY B;  1H2W A;  2OIZ A;  2H9P A;  2IWK A;  3PSC B;  5FKT A;  3W15 A;  4J77 A;  3DWL C;  3K71 A;  4A2L A;  1PBY B;  3N0D A;  3JZG A;  4QQE A;  4FA5 D;  3PSL A;  3SCY A;  4NC4 A;  2UZY B;  4BP9 A;  3OKY A;  4YVD A;  4Y7R A;  4L1M A;  4CY2 A;  1GOH A;  3IUQ A;  1QFS A;  2YBA A;  4JXM A;  3UVN A;  4G56 B;  3GFC A;  3OKY B;  4AMY A;  4FAV D;  3FGB A;  2EIB A;  5C92 A;  4XYH A;  3EI3 A;  3SMR A;  4PXW A;  4G1M A;  3NIF A;  2P9I C;  2I3S A;  4JHP C;  2XE4 A;  3EI2 B;  3JAM g;  1PGU A;  4L9O A;  3OL2 A;  4JT6 C;  1VZ3 A;  4D0K A;  2I0S A;  5CYK A;  4Z7O A;  5M5V A;  3DM0 A;  5JWZ A;  1I2M B;  4FAN D;  1C9L A;  4JSV C;  3V7D B;  4ERQ A;  3KRW B;  3SBR A;  4Z7Q A;  1MG2 A;  4QL1 A;  3ZWL B;  5K19 A;  3GD1 I;  5FFO A;  3J80 g;  2HKM A;  4GQ2 P;  4QAM A;  4WK0 A;  3OKT A;  3CFS B;  4FWW A;  4ZOV A;  3I8C A;  2BCJ B;  2HJ4 A;  4H5J A;  1C9I A;  3OKW A;  3RN1 D;  1GOT B;  2G99 A;  3OF7 A;  2O9K A;  3K27 A;  5IJ7 E;  4FA1 D;  4A0B A;  3NVN A;  4O02 A;  4J84 A;  4AN0 A;  3AL9 A;  3VA6 A;  3JZN A;  3IJE A;  4A0B B;  1O6G A;  4LGN A;  5C2V B;  2YB8 B;  4IRZ A;  3J81 g;  2P9P C;  1E8N A;  5EAP A;  1YFQ A;  4ZOZ A;  5TEF A;  2AH0 A;  1GXR A;  3UKU C;  3PVU B;  2XL2 A;  3UVK A;  3NIG A;  2B5M A;  5EMM B;  3IIY A;  4A2M A;  2H9N A;  3EI1 B;  3HFQ A;  2P9N C;  5B4W A;  2PM9 A;  1JOF A;  2OK6 A;  2AGL A;  3F3G A;  2OVP B;  2CE8 A;  5IJ8 E;  4L3H D;  4L1Q D;  3N0E A;  4OWR A;  3UVO A;  5IGQ A;  3L4O D;  2Q7Q A;  5H14 A;  2P9U C;  1GG2 B;  4GGA A;  1S4U X;  3F3P A;  5AMS A;  4BCB A;  4ZN4 A;  4J73 A;  2YNO A;  4HDJ A;  3SXT D;  3A0F A;  1O6F A;  4A0A B;  4O9D A;  5HQG A;  2H6N A;  2IWF A;  2I0R A;  2OJY A;  5GSA A;  3K72 A;  4JHN A;  3B7F A;  4AEZ A;  1UOO A;  3EG6 A;  4JSX C;  1JMZ B;  5EM2 B;  4IA9 A;  4O45 A;  2AH1 A;  5GMK n;  3FCU A;  5C86 A;  2CNX A;  5M5R A;  4X61 B;  4BH6 A;  3EI4 B;  5CXB A;  3EQ7 A;  1UTC A;  4JT5 C;  3ZE2 A;  2AGW A;  5M61 A;  3UVL A;  1H2Y A;  3EI4 A;  1Q47 A;  2B5L A;  2XZG A;  3JRO A;  2VDK A;  3FRX A;  3GC3 B;  4G1E A;  5A2Q g;  4A11 A;  3C9C A;  2QC5 A;  2VZ1 A;  4PC0 A;  5AFU 3;  1MG3 A;  2AGZ A;  5FA5 B;  3EMH A;  3IUM A;  3CIK B;  2VC2 A;  4X63 B;  4A09 B;  4G55 A;  3IUN A;  4U1E I;  4CZY A;  3ZDY A;  2GC4 A;  4A09 A;  4I79 A;  3SBP A;  4CY3 A;  4DNV A;  3C5M A;  5TF2 A;  5M5S A;  3ZE0 A;  3AL8 A;  3RRM C;  3T3P A;  4D9S A;  1MDA H;  3RMZ D;  4UM9 A;  2Z2O A;  3V4P A;  3SWS D;  3JRP A;  4GM9 A;  3IUR A;  4AOW A;  3FCS A;  4RE6 A;  3MVD K;  3V4V A;  4J86 A;  2H13 A;  3MKS B;  1PI6 A;  2I0T A;  4GZ8 A;  4XEI C;  3C75 H;  2PM6 B;  3IJ0 A;  3I89 A;  2IUR A;  2VDL A;  4UI9 R;  3EU7 A;  2JKX A;  1VE7 A;  4JSN C;  2QR5 A;  4O3U B;  5EM2 A;  3PE7 A;  4OZU A;  2OVQ B;  3EI2 A;  3IIW A;  3I7K A;  3OW8 A;  1N6E A;  1L5G A;  3KRX B;  5M5T A;  2IUP A;  3MXX A;  2Z2P A;  4BCD A;  2IUV A;  1R5M A;  5E6S A;  2CE9 A;  3MUO A;  4J79 A;  1TYQ C;  2XL3 A;  3O4G A;  1U2V C;  5H17 A;  4H5I A;  4PBY A;  4FHL A;  5I5M A;  3MMY A;  3SHF A;  4WK4 A;  5HE0 B;  3JPX A;  4O2W A;  1XKS A;  4R7A B;  2UZX B;  3I7L A;  5EAM A;  3I7O A;  5FKS A;  2YMU A;  3VI4 A;  1SQ9 A;  5C2W B;  3SVW D;  5I5J A;  4LG8 A;  2EID A;  3VI3 A;  5SXM A;  3AFC A;  1JMX B;  2H3X A;  4NEN A;  4A08 B;  1M1X A;  2XDW A;  4UM8 A;  3PXS D;  4L3G D;  3I7N A;  4KFM B;  5THA A;  4GMB A;  2HU7 A;  1NR0 A;  5IT9 g;  4Y5R D;  2I3T A;  5HE1 B;  4J81 A;  1VE6 A;  5TEE A;  2J55 H;  2VZ3 A;  4JSP C;  2B4E A;  2HKR A;  3V9F A;  4FB1 D;  1UOQ A;  4X60 B;  4QT8 A;  5CXC B;  3EQ9 A;  2EBS A;  1P22 A;  1SHY B;  3NVQ A;  1A0R B;  2VDP A;  4D6V A;  3UVM A;  3PXW D; 
#chains in the Genus database with same CATH homology
 5GXH A;  4ESG A;  1NEX B;  3RFG A;  4PNK B;  4PSW B;  4MK0 B;  5AJA A;  2B5N A;  3AL8 B;  1XIP A;  2P9S C;  4FA4 D;  3VH0 A;  2QXV A;  3I7H A;  4TZ4 A;  2H6K A;  3SBQ A;  2GC7 A;  4K3I D;  3PXT D;  3BWS A;  2H6Q A;  3P4F A;  2YNN A;  4J0W A;  4GQ1 A;  1XHM A;  4A11 B;  4O3T B;  3AH8 B;  3NVX A;  1JJU B;  3SLE D;  1SQJ A;  5HE2 B;  3RSE C;  2OK4 A;  5FKR A;  2GNQ A;  3MZL A;  5EAL A;  4E54 B;  2AGY A;  4K3J B;  3F3F A;  2Z2N A;  5CXB B;  4U7A A;  5EMK B;  2J56 H;  4EWR A;  2HXC A;  2CO0 A;  4GM3 A;  3MZK A;  5CXC A;  4ES0 A;  1PEV A;  3ULE C;  2HYE A;  4NSX A;  3L4M D;  2W18 A;  3I7P A;  4E5Z A;  4CY5 A;  3V5W B;  3EI3 B;  2J57 G;  3EI1 A;  4N14 A;  1TBG A;  4E5Z B;  3UKR C;  4GM8 A;  4J8G A;  2XYI A;  3SJL D;  2H68 A;  5H1M A;  4IMM A;  4PSX B;  5IC7 A;  4CI1 A;  3SN6 B;  1ERJ A;  5EMJ B;  4ERZ A;  5CYK B;  3DXM C;  2CN3 A;  2P9L C;  1OLZ A;  5EML B;  2MTA H;  4ZOX A;  4CI3 A;  2IAA A;  3OL2 B;  4BUJ C;  4GGC A;  3JZH A;  1N6D A;  4CZV A;  4XYI A;  2G9A A;  3JB9 L;  3IJ1 A;  4CI2 A;  4ZOY A;  1GP2 B;  5GXI A;  3VGZ A;  3RLM D;  3OTT A;  5HYN B;  5HE3 B;  2HES X;  3PVW B;  2XU7 A;  3GRE A;  2IUQ A;  1U4C A;  4X3E A;  5FLX g;  4GQB B;  3E0C A;  5TDH B;  4ERY A;  3IJC A;  3BG0 A;  3CFV A;  2H9M A;  4GGD A;  1FWX A;  2YNP A;  1L0Q A;  4J8B A;  2H47 A;  4E54 A;  3FM0 A;  5FXY A;  1OMW B;  1RI6 A;  3ORV D;  4LG9 A;  1N6F A;  2BBK H;  4CC9 A;  3SFZ A;  5FKQ A;  1K32 A;  1B9X A;  3RFH A;  5IGO A;  5KDO B;  4Z8L A;  4CZX A;  5C9Z B;  2PM7 B;  3I2N A;  1B9Y A;  4QRJ A;  3K26 A;  3RN0 D;  2CO0 C;  5I5I A;  4BL0 A;  2TRC B;  4J0X A;  2OVR B;  3U4Y A;  2H14 A;  4A7J A;  3DSM A;  1VYH C;  2CN2 A;  4A0A A;  4PBZ A;  1K8K C;  2P9K C;  2AGX A;  4JD2 C;  2PM9 B;  3IKO A;  3I8E A;  3ODT A;  2AQ5 A;  4J87 A;  2H9L A;  4O1Q D;  4J78 A;  2PBI B;  5EAR A;  5K1C C;  3C99 A;  3EWE A;  4FA9 D;  4CY1 A;  2HJB A;  3MKQ A;  4CI8 A;  3UR4 A;  1QNI A;  4J82 A;  4A08 A;  5FQD A;  3DXK C;  3BG1 A;  2OIZ A;  2H9P A;  2IWK A;  3PSC B;  5FKT A;  3W15 A;  4J77 A;  3DWL C;  4A2L A;  1PBY B;  3N0D A;  3JZG A;  4QQE A;  4FA5 D;  3PSL A;  3SCY A;  2UZY B;  3OKY A;  4YVD A;  4Y7R A;  4CY2 A;  2YBA A;  4JXM A;  3UVN A;  4G56 B;  3GFC A;  3OKY B;  4FAV D;  3FGB A;  4XYH A;  3EI3 A;  3SMR A;  4PXW A;  2P9I C;  2I3S A;  3EI2 B;  3JAM g;  1PGU A;  4L9O A;  3OL2 A;  4JT6 C;  4D0K A;  2I0S A;  5CYK A;  3DM0 A;  5JWZ A;  4FAN D;  4JSV C;  3V7D B;  4ERQ A;  3KRW B;  3SBR A;  1MG2 A;  4QL1 A;  3ZWL B;  5K19 A;  3J80 g;  2HKM A;  4GQ2 P;  3OKT A;  3CFS B;  4FWW A;  4ZOV A;  3I8C A;  2BCJ B;  2HJ4 A;  4H5J A;  3OKW A;  3RN1 D;  1GOT B;  2G99 A;  2O9K A;  3K27 A;  5IJ7 E;  4FA1 D;  4A0B A;  3NVN A;  4J84 A;  3AL9 A;  3VA6 A;  3JZN A;  4A0B B;  4LGN A;  5C2V B;  2YB8 B;  3J81 g;  2P9P C;  5EAP A;  1YFQ A;  4ZOZ A;  5TEF A;  2AH0 A;  1GXR A;  3UKU C;  3PVU B;  2XL2 A;  3UVK A;  5EMM B;  2B5M A;  3IIY A;  4A2M A;  2H9N A;  3EI1 B;  3HFQ A;  2P9N C;  5B4W A;  2PM9 A;  1JOF A;  2OK6 A;  2AGL A;  3F3G A;  2OVP B;  2CE8 A;  5IJ8 E;  4L3H D;  4L1Q D;  3N0E A;  4OWR A;  3UVO A;  5IGQ A;  3L4O D;  2Q7Q A;  5H14 A;  2P9U C;  1GG2 B;  4GGA A;  1S4U X;  3F3P A;  5AMS A;  4ZN4 A;  4J73 A;  2YNO A;  4HDJ A;  3SXT D;  3A0F A;  4A0A B;  4O9D A;  5HQG A;  2H6N A;  2IWF A;  2I0R A;  2OJY A;  5GSA A;  3B7F A;  4AEZ A;  3EG6 A;  4JSX C;  1JMZ B;  5EM2 B;  4IA9 A;  4O45 A;  2AH1 A;  5GMK n;  2CNX A;  4X61 B;  4BH6 A;  3EI4 B;  5CXB A;  4JT5 C;  2AGW A;  3UVL A;  3EI4 A;  1Q47 A;  2B5L A;  3JRO A;  5A2Q g;  3FRX A;  4A11 A;  3C9C A;  2QC5 A;  4PC0 A;  5AFU 3;  1MG3 A;  2AGZ A;  5FA5 B;  3EMH A;  3CIK B;  4X63 B;  4A09 B;  4U1E I;  4CZY A;  2GC4 A;  4A09 A;  4I79 A;  3SBP A;  4CY3 A;  3C5M A;  5TF2 A;  3AL8 A;  3RRM C;  1MDA H;  3RMZ D;  2Z2O A;  3SWS D;  3JRP A;  4GM9 A;  4AOW A;  4J86 A;  2H13 A;  3MKS B;  1PI6 A;  2I0T A;  4GZ8 A;  4XEI C;  3C75 H;  2PM6 B;  3IJ0 A;  3I89 A;  2IUR A;  4UI9 R;  3EU7 A;  4JSN C;  4O3U B;  5EM2 A;  3PE7 A;  4OZU A;  2OVQ B;  3EI2 A;  3IIW A;  3I7K A;  3OW8 A;  1N6E A;  3KRX B;  2IUP A;  3MXX A;  2Z2P A;  2IUV A;  1R5M A;  2CE9 A;  4J79 A;  1TYQ C;  2XL3 A;  1U2V C;  5H17 A;  4H5I A;  4PBY A;  4FHL A;  5I5M A;  3MMY A;  3SHF A;  5HE0 B;  3JPX A;  1XKS A;  4R7A B;  2UZX B;  3I7L A;  5EAM A;  3I7O A;  5FKS A;  2YMU A;  1SQ9 A;  5C2W B;  3SVW D;  5I5J A;  4LG8 A;  5SXM A;  3AFC A;  1JMX B;  2H3X A;  4A08 B;  3PXS D;  4L3G D;  3I7N A;  4KFM B;  5THA A;  4GMB A;  1NR0 A;  5IT9 g;  4Y5R D;  2I3T A;  5HE1 B;  4J81 A;  5TEE A;  2J55 H;  4JSP C;  2B4E A;  2HKR A;  3V9F A;  4FB1 D;  4X60 B;  4QT8 A;  5CXC B;  2EBS A;  1P22 A;  1SHY B;  3NVQ A;  1A0R B;  4D6V A;  3UVM A;  3PXW D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...