3J80g

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
324
structure length
318
Chain Sequence
SSNIMLVLRGTLEGHNGWVTSLSTSAAQPNLLVSGSRDKTLISWRLTENEQQFGVPVRSYKGHSHIVQDVVVSADGNYAVSASWDKTLRLWNLATGNSEARFVGHTGDVLSVAIDANSSKIISASRDKTIRVWNTVGDCAYVLLGHTDWVTKVRVAPKNLVDDGRITFVSAGMDKIVRSWSLNSYRIEADFIGHNNYINVVQPSPDGSLAASAGKDGQIYVWNLKHKSAFMNFDAKDEVFALAFSPSRFWLTAATASGIKIYDLENEVLIDELKPEFAGYTKAQDPHAVSLAWSADGQTLFAGYTDNVIRVWQVMTAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 45
structure length 318
sequence length 324
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
g PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3j80g01
2B4EA 4A2MA 5TDHB 4OZUA 5AMSA 1TYQC 3EI2A 2HJ4A 4A11B 3P4FA 3I7PA 5CYKB 3RMZD 3BG1A 4O45A 4A08A 5H17A 4J0XA 2PM6B 2CO0A 3VGZA 4N14A 3SCYA 4JSXC 2H9PA 4J73A 2GC7A 4GGCA 1N6DA 4L3GD 3EI3B 3EI1A 3C99A 3MKQA 4K3ID 4J84A 4E5ZB 3B7FA 1A0RB 4J0WA 4X63B 5JWZA 3IIYA 4CY2A 2IURA 4A0BB 2YMUA 3KRXB 5CXBB 4BL0A 4LG8A 1XHMA 2XL3A 4GGDA 4KFMB 3U4YA 3OTTA 1OLZA 1FWXA 2Z2OA 4Z8LA 3EI4A 2XYIA 2J57G 3UVNA 4CZYA 1GG2B 2UZYB 2I0TA 2UZXB 1JMXB 3EU7A 5H1MA 3IKOA 5GSAA 1PI6A 3UKRC 4ZN4A 2PM9A 4ERYA 4GQBB 4L3HD 3N0EA 2TRCB 1B9YA 1GP2B 4XYHA 3EI2B 4JT5C 3J80g 4ESGA 1PBYB 4FB1D 4A2LA 3AFCA 1ERJA 5THAA 3BG0A 3UVMA 4CY5A 3JB9L 3OKYA 5AJAA 3I7LA 1S4UX 2P9PC 2YNPA 4LG9A 4GM9A 3F3GA 3I8EA 2H14A 3VH0A 4BH6A 4PNKB 3V7DB 4GMBA 3EG6A 2P9NC 3C9CA 4CI8A 5B4WA 5TF2A 1N6EA 3SXTD 3ORVD 5IGOA 5K1CC 2CE9A 4GGAA 3KRWB 4J8GA 4IMMA 2G9AA 4EWRA 1JOFA 2AGXA 5CXCA 2AQ5A 2MTAH 4ERQA 2AGZA 3BWSA 4E54A 4FAND 4D0KA 1SQJA 3UR4A 2I3TA 4H5IA 1B9XA 2CN3A 4Y5RD 2YB8B 4GZ8A 4PSWB 3EI4B 4O9DA 2AH1A 3OKWA 3K27A 5EM2B 5GMKn 3PSLA 3SBPA 1R5MA 3PVWB 2EBSA 2GNQA 3SJLD 1MG2A 2PM9B 4FWWA 2OK4A 4L1QD 5SXMA 3CFVA 1JMZB 4ERZA 1K32A 3NVXA 5FKTA 5EALA 3ODTA 3C5MA 4CY3A 1GXRA 2PBIB 4JSNC 2OVQB 5C9ZB 4FA9D 3AL9A 1TBGA 3OKYB 3MZKA 3PXWD 3AL8A 3JROA 4JSVC 3SFZA 2H6QA 2YNOA 2H3XA 2H9MA 2OVPB 3J81g 3L4OD 5A2Qg 4QRJA 5K19A 3SHFA 2HKMA 2O9KA 5EMKB 3UKUC 2P9SC 5CXCB 5KDOB 3SN6B 1PEVA 3FRXA 5EAPA 5EMLB 3L4MD 5I5IA 3V9FA 4BUJC 2AGWA 1P22A 3JRPA 4A09A 4UI9R 3JZHA 2CO0C 2P9IC 1QNIA 4MK0B 2YBAA 4K3JB 3SVWD 2H13A 3I7KA 4NSXA 3SLED 3C75H 4JD2C 3RLMD 2XU7A 5FKQA 5HQGA 4A08B 1XKSA 3PSCB 5IC7A 5FA5B 5HYNB 5IGQA 3SMRA 1PGUA 3HFQA 4QQEA 3EMHA 5C2WB 3UVKA 2W18A 4O1QD 1YFQA 3RN1D 5GXIA 4CI3A 4QL1A 4Y7RA 3EI1B 2H6NA 3I7NA 4IA9A 1MDAH 3I8CA 5HE2B 5FQDA 4L9OA 2H9NA 3IIWA 4HDJA 2IAAA 4OWRA 1VYHC 1GOTB 1Q47A 2B5MA 3DM0A 5EARA 3NVQA 4I79A 4PXWA 3FGBA 2OK6A 3MKSB 4O3UB 4J86A 4CI2A 2H6KA 4U7AA 3CFSB 1N6FA 2P9KC 3I7HA 4GQ2P 3UVOA 4YVDA 5TEEA 2CE8A 3K26A 5FLXg 2P9UC 3DSMA 4U1EI 3PXSD 4R7AB 3CIKB 3MMYA 2IUVA 3I7OA 5I5JA 4GM3A 1SQ9A 1JJUB 4AEZA 4LGNA 4ZOXA 4J87A 4GM8A 2I0SA 3F3FA 5HE3B 4J8BA 4A09B 2HYEA 2AGYA 5EMJB 4J81A 2G99A 4A0AA 1OMWB 3RSEC 3DWLC 2OIZA 2AGLA 2H68A 3GFCA 3OL2A 1K8KC 3JPXA 3A0FA 4JSPC 3SBQA 3RFGA 4H5JA 4X60B 5FXYA 3ZWLB 4J79A 3RRMC 2Q7QA 2IWFA 5AFU3 2QXVA 3F3PA 4A7JA 2H9LA 2XL2A 3ULEC 3VA6A 4X3EA 3V5WB 2J56H 2BCJB 4ZOVA 4FA5D 2OJYA 3PXTD 4XYIA 4XEIC 5FKSA 2I3SA 3N0DA 5H14A 1U4CA 3JAMg 4E54B 4GQ1A 4FAVD 2HJBA 4FA4D 4CC9A 4J77A 4PBYA 5HE0B 5IJ7E 2J55H 3DXKC 3I89A 5IT9g 2HXCA 2H47A 2P9LC 2AH0A 3OKTA 1SHYB 3UVLA 1XIPA 2YNNA 4A11A 4TZ4A 2HKRA 5CYKA 2HESX 4PBZA 5EM2A 4ZOZA 4ZOYA 4FHLA 4X61B 5EMMB 4ES0A 1L0QA 4CY1A 3DXMC 3OW8A 5IJ8E 3RN0D 4J78A 3SWSD 3AH8B 2B5NA 5GXHA 1NEXB 3GREA 4O3TB 4A0AB 3PVUB 3MXXA 3EWEA 2CNXA 2PM7B 2IUQA 2Z2NA 3EI3A 3PE7A 2IWKA 3OL2B 3IJ0A 4JXMA 5C2VB 3NVNA 3JZNA 4E5ZA 3AL8B 1RI6A 3RFHA 4PSXB 3FM0A 4A0BA 4QT8A 2Z2PA 4J82A 5CXBA 5I5MA 3E0CA 2B5LA 4D6VA 4FA1D 4JT6C 5HE1B 3IJCA 4CI1A 1NR0A 2BBKH 4PC0A 1U2VC 4G56B 4AOWA 3JZGA 2CN2A 3IJ1A 2GC4A 2IUPA 4CZXA 3I2NA 5FKRA 1MG3A 5TEFA 4CZVA 2I0RA 5EAMA 3SBRA 3W15A 3MZLA 2QC5A 2OVRB
chains in the Genus database with same CATH superfamily
3IURA 2B4EA 4A2MA 5TDHB 3ZDXA 4OZUA 5AMSA 1TYQC 3EI2A 2HJ4A 4A11B 3P4FA 3I7PA 4DNUA 5CYKB 3RMZD 3BG1A 4O45A 4BCDA 4L1MA 2QR5A 3ZE1A 4A08A 1A12A 5H17A 1I2MB 4J0XA 2HU7A 2PM6B 2CO0A 3MUOA 3VGZA 4N14A 3SCYA 4JSXC 2H9PA 4J73A 2GC7A 4GGCA 1N6DA 3KCIA 4L3GD 3EI3B 4UM8A 3EI1A 3C99A 2VDOA 3MKQA 1M1XA 4K3ID 4J84A 1VE7A 4E5ZB 3B7FA 1A0RB 4J0WA 4X63B 4AN1A 3T3PA 5JWZA 1H2ZA 3EQ7A 3IIYA 4CY2A 1T2XA 3O4IA 2IURA 3IULA 4A0BB 5E6UA 2VDPA 2YMUA 3KRXB 3NIGA 2JKXA 4WK4A 5CXBB 4BL0A 4LG8A 1XHMA 2XL3A 4GGDA 4KFMB 3U4YA 3OTTA 1OLZA 3IVMA 3EQ9A 1FWXA 2Z2OA 4Z8LA 4WK0A 3EI4A 2XYIA 2WQ8A 2J57G 3O4JA 3UVNA 4CZYA 1GG2B 2UZYB 2I0TA 2UZXB 1JMXB 3EU7A 5H1MA 3IKOA 5GSAA 1PI6A 3UKRC 4ZN4A 2PM9A 4ERYA 4GQBB 4L3HD 3N0EA 2TRCB 1B9YA 1GP2B 4XYHA 3EI2B 5E6RA 4JT5C 3J80g 4ESGA 2VDRA 1PBYB 4FB1D 4A2LA 3AFCA 1QFSA 1ERJA 5THAA 3BG0A 3UVMA 4CY5A 3JB9L 3OKYA 5AJAA 3I7LA 1S4UX 2P9PC 2YNPA 1VE6A 4LG9A 4GM9A 3QI0A 3F3GA 3I8EA 2H14A 3VH0A 3T3MA 4BH6A 4PNKB 3V7DB 4GMBA 1GOGA 3EG6A 2P9NC 3QHYB 3C9CA 4CI8A 5B4WA 5TF2A 1N6EA 3SXTD 3ORVD 5IGOA 5K1CC 2CE9A 4GGAA 3KRWB 4J8GA 2VDKA 4IMMA 2G9AA 1UOOA 4EWRA 1JOFA 2AGXA 1C9LA 5CXCA 2AQ5A 2MTAH 4ERQA 3IUMA 2AGZA 3BWSA 4E54A 4FAND 4D0KA 2XDWA 1SQJA 3UR4A 2I3TA 4H5IA 1B9XA 2CN3A 4Y5RD 2YB8B 4GZ8A 3IUQA 4PSWB 3EI4B 4O9DA 2AH1A 3OKWA 3MVDK 3K27A 5EM2B 5GMKn 3PSLA 3SBPA 1R5MA 4DNWA 3PVWB 1O6FA 2EBSA 2GNQA 3SJLD 1MG2A 2PM9B 4FWWA 2OK4A 5FFOA 4L1QD 5SXMA 3CFVA 4MMYA 3K6SA 4IRZA 1JMZB 4NENA 4ERZA 1K32A 3FCSA 3NVXA 5FKTA 5EALA 3ODTA 3C5MA 4CY3A 1GXRA 2PBIB 4JSNC 2OVQB 5C9ZB 4FA9D 1C9IA 1U8CA 3AL9A 1TBGA 3OKYB 4JHPC 3MZKA 1E8MA 3PXWD 2XE4A 4UM9A 3AL8A 1TYEA 2XZGA 3JROA 4JSVC 3SFZA 2H6QA 1GOHA 2YNOA 3K71A 2H3XA 2H9MA 2OVPB 4WJKA 3J81g 3L4OD 5A2Qg 4QRJA 5K19A 3SHFA 2HKMA 2O9KA 5EMKB 3UKUC 4AMYA 2P9SC 3GC3B 5E6SA 5CXCB 5KDOB 3SN6B 1PEVA 3FRXA 5EAPA 4RE5A 5EMLB 3L4MD 5I5IA 3V9FA 5M5TA 2EICA 4BUJC 2AGWA 1P22A 3JRPA 4A09A 4UI9R 3JZHA 2CO0C 2P9IC 1QNIA 4MK0B 2YBAA 4K3JB 3SVWD 2H13A 1K3IA 3I7KA 4NSXA 3SLED 3V4PA 3C75H 4JD2C 3RLMD 2XU7A 5FKQA 5HQGA 4A08B 1XKSA 5M5UA 3PSCB 4G1MA 5IC7A 5FA5B 1GOFA 2EIEA 5HYNB 2EIBA 4AMZA 5IGQA 3SMRA 1PGUA 5M5RA 3HFQA 3K72A 4QQEA 3EMHA 5C2WB 3UVKA 4BCCA 5M5VA 2W18A 4NAAA 4O1QD 3OF7A 1YFQA 3RN1D 5GXIA 4CI3A 4QL1A 4Y7RA 3EI1B 5M61A 2H6NA 3I7NA 4IA9A 1MDAH 3I8CA 4Z7OA 5HE2B 5FQDA 4L9OA 2H9NA 3IIWA 4MMXA 4NBMA 4HDJA 2IAAA 3EQ8A 4OWRA 1VYHC 4QAMA 1GOTB 2HU5A 3O4GA 3VI3A 1Q47A 2B5MA 3DM0A 4O2WA 5EARA 3NVQA 4I79A 1BPOA 4PXWA 3FGBA 2OK6A 3MKSB 4O3UB 4AN0A 4J86A 4CI2A 2H6KA 4U7AA 3CFSB 3FCUA 1N6FA 2P9KC 3I7HA 2VDNA 4GQ2P 3UVOA 4YVDA 5TEEA 2CE8A 3K26A 5FLXg 2P9UC 3DSMA 4U1EI 3PXSD 4R7AB 4BCBA 3CIKB 3MMYA 2IUVA 1UTCA 3I7OA 2HU8A 4GM3A 1SQ9A 1JJUB 5I5JA 4AEZA 4Z7QA 4LGNA 4ZOXA 4J87A 4GM8A 3IUJA 2I0SA 3F3FA 1JV2A 5HE3B 4RE6A 4J8BA 4A09B 4BP9A 1E8NA 2EIDA 2HYEA 2AGYA 5EMJB 4J81A 2G99A 4A0AA 2VDMA 1OMWB 3RSEC 3DWLC 4G1EA 5M5SA 2OIZA 2AGLA 2H68A 3GFCA 3OL2A 1K8KC 3JPXA 3VI4A 3A0FA 4JSPC 3SBQA 3DDUA 3IJEA 3RFGA 4AX4A 2VDQA 4WK2A 4H5JA 4JHNA 4X60B 3IUNA 5FXYA 3ZWLB 4J79A 3RRMC 1YR2A 4DNVA 4D9SA 2Q7QA 2IWFA 5AFU3 2QXVA 1VZ2A 3F3PA 4A7JA 2H9LA 2BKLA 2XL2A 1H2WA 3ULEC 4X3EA 3VA6A 3V5WB 1JTDB 2J56H 2BCJB 4ZOVA 4FA5D 2OJYA 3PXTD 4XYIA 1QFMA 4XEIC 5FKSA 2I3SA 3MUNA 3NIDA 3N0DA 5H14A 1U4CA 3JAMg 4E54B 4GQ1A 4FAVD 2HJBA 2VZ3A 4FA4D 4CC9A 4J77A 4PBYA 5HE0B 1UOPA 5IJ7E 2J55H 3DXKC 3I89A 5IT9g 3NIFA 2HXCA 2H47A 1UOQA 2P9LC 2AH0A 3OKTA 1SHYB 3UVLA 1XIPA 2YNNA 4A11A 4TZ4A 2HKRA 5CYKA 2HESX 4PBZA 5EM2A 4ZOZA 5HDBA 4ZOYA 4FHLA 3ZDYA 4X61B 5EMMB 4ES0A 4Z7NA 2VC2A 1L0QA 4CY1A 1E5TA 3DXMC 3OW8A 5IJ8E 3RN0D 4J78A 3SWSD 3AH8B 3O4HA 2B5NA 5GXHA 1L5GA 1NEXB 3GREA 4O3TB 4A0AB 3PVUB 3MXXA 3EWEA 2CNXA 2PM7B 2IUQA 2Z2NA 5C92A 4G55A 3EI3A 3PE7A 2IWKA 3GD1I 3OL2B 2QZPA 1H2YA 3IJ0A 2VDLA 4JXMA 5C2VB 3NVNA 3JZNA 4E5ZA 3ZE2A 3AL8B 1RI6A 3RFHA 4PSXB 3ZDZA 1VZ3A 3FM0A 4NC4A 3V4VA 4A0BA 2VZ1A 4QT8A 2Z2PA 3ZE0A 4J82A 5CXBA 4BP8A 5I5MA 3E0CA 2B5LA 4D6VA 4FA1D 4JT6C 5HE1B 3IJCA 4CI1A 1NR0A 2BBKH 4PC0A 1U2VC 4G56B 4AOWA 3JZGA 2CN2A 3IJ1A 2GC4A 2IUPA 4CZXA 1O6GA 3I2NA 4MMZA 4O02A 5FKRA 1MG3A 5TEFA 4CZVA 2I0RA 5C86A 5FFGA 5EAMA 3SBRA 3W15A 3MZLA 1H2XA 2QC5A 2OVRB
chains in the Genus database with same CATH topology
2B4EA 4A2MA 5TDHB 4OZUA 5AMSA 1TYQC 3EI2A 2HJ4A 4A11B 3P4FA 3I7PA 5CYKB 3RMZD 3BG1A 4O45A 4A08A 5H17A 4J0XA 2PM6B 2CO0A 3VGZA 4N14A 3SCYA 4JSXC 2H9PA 4J73A 2GC7A 4GGCA 1N6DA 4L3GD 3EI3B 3EI1A 3C99A 3MKQA 4K3ID 4J84A 4E5ZB 3B7FA 1A0RB 4J0WA 4X63B 5JWZA 3IIYA 4CY2A 2IURA 4A0BB 2YMUA 3KRXB 5CXBB 4BL0A 4LG8A 1XHMA 2XL3A 4GGDA 4KFMB 3U4YA 3OTTA 1OLZA 1FWXA 2Z2OA 4Z8LA 3EI4A 2XYIA 2J57G 3UVNA 4CZYA 1GG2B 2UZYB 2I0TA 2UZXB 1JMXB 3EU7A 5H1MA 3IKOA 5GSAA 1PI6A 3UKRC 4ZN4A 2PM9A 4ERYA 4GQBB 4L3HD 3N0EA 2TRCB 1B9YA 1GP2B 4XYHA 3EI2B 4JT5C 3J80g 4ESGA 1PBYB 4FB1D 4A2LA 3AFCA 1ERJA 5THAA 3BG0A 3UVMA 4CY5A 3JB9L 3OKYA 5AJAA 3I7LA 1S4UX 2P9PC 2YNPA 4LG9A 4GM9A 3F3GA 3I8EA 2H14A 3VH0A 4BH6A 4PNKB 3V7DB 4GMBA 3EG6A 2P9NC 3C9CA 4CI8A 5B4WA 5TF2A 1N6EA 3SXTD 3ORVD 5IGOA 5K1CC 2CE9A 4GGAA 3KRWB 4J8GA 4IMMA 2G9AA 4EWRA 1JOFA 2AGXA 5CXCA 2AQ5A 2MTAH 4ERQA 2AGZA 3BWSA 4E54A 4FAND 4D0KA 1SQJA 3UR4A 2I3TA 4H5IA 1B9XA 2CN3A 4Y5RD 2YB8B 4GZ8A 4PSWB 3EI4B 4O9DA 2AH1A 3OKWA 3K27A 5EM2B 5GMKn 3PSLA 3SBPA 1R5MA 3PVWB 2EBSA 2GNQA 3SJLD 1MG2A 2PM9B 4FWWA 2OK4A 4L1QD 5SXMA 3CFVA 1JMZB 4ERZA 1K32A 3NVXA 5FKTA 5EALA 3ODTA 3C5MA 4CY3A 1GXRA 2PBIB 4JSNC 2OVQB 5C9ZB 4FA9D 3AL9A 1TBGA 3OKYB 3MZKA 3PXWD 3AL8A 3JROA 4JSVC 3SFZA 2H6QA 2YNOA 2H3XA 2H9MA 2OVPB 3J81g 3L4OD 5A2Qg 4QRJA 5K19A 3SHFA 2HKMA 2O9KA 5EMKB 3UKUC 2P9SC 5CXCB 5KDOB 3SN6B 1PEVA 3FRXA 5EAPA 5EMLB 3L4MD 5I5IA 3V9FA 4BUJC 2AGWA 1P22A 3JRPA 4A09A 4UI9R 3JZHA 2CO0C 2P9IC 1QNIA 4MK0B 2YBAA 4K3JB 3SVWD 2H13A 3I7KA 4NSXA 3SLED 3C75H 4JD2C 3RLMD 2XU7A 5FKQA 5HQGA 4A08B 1XKSA 3PSCB 5IC7A 5FA5B 5HYNB 5IGQA 3SMRA 1PGUA 3HFQA 4QQEA 3EMHA 5C2WB 3UVKA 2W18A 4O1QD 1YFQA 3RN1D 5GXIA 4CI3A 4QL1A 4Y7RA 3EI1B 2H6NA 3I7NA 4IA9A 1MDAH 3I8CA 5HE2B 5FQDA 4L9OA 2H9NA 3IIWA 4HDJA 2IAAA 4OWRA 1VYHC 1GOTB 1Q47A 2B5MA 3DM0A 5EARA 3NVQA 4I79A 4PXWA 3FGBA 2OK6A 3MKSB 4O3UB 4J86A 4CI2A 2H6KA 4U7AA 3CFSB 1N6FA 2P9KC 3I7HA 4GQ2P 3UVOA 4YVDA 5TEEA 2CE8A 3K26A 5FLXg 2P9UC 3DSMA 4U1EI 3PXSD 4R7AB 3CIKB 3MMYA 2IUVA 3I7OA 5I5JA 4GM3A 1SQ9A 1JJUB 4AEZA 4LGNA 4ZOXA 4J87A 4GM8A 2I0SA 3F3FA 5HE3B 4J8BA 4A09B 2HYEA 2AGYA 5EMJB 4J81A 2G99A 4A0AA 1OMWB 3RSEC 3DWLC 2OIZA 2AGLA 2H68A 3GFCA 3OL2A 1K8KC 3JPXA 3A0FA 4JSPC 3SBQA 3RFGA 4H5JA 4X60B 5FXYA 3ZWLB 4J79A 3RRMC 2Q7QA 2IWFA 5AFU3 2QXVA 3F3PA 4A7JA 2H9LA 2XL2A 3ULEC 3VA6A 4X3EA 3V5WB 2J56H 2BCJB 4ZOVA 4FA5D 2OJYA 3PXTD 4XYIA 4XEIC 5FKSA 2I3SA 3N0DA 5H14A 1U4CA 3JAMg 4E54B 4GQ1A 4FAVD 2HJBA 4FA4D 4CC9A 4J77A 4PBYA 5HE0B 5IJ7E 2J55H 3DXKC 3I89A 5IT9g 2HXCA 2H47A 2P9LC 2AH0A 3OKTA 1SHYB 3UVLA 1XIPA 2YNNA 4A11A 4TZ4A 2HKRA 5CYKA 2HESX 4PBZA 5EM2A 4ZOZA 4ZOYA 4FHLA 4X61B 5EMMB 4ES0A 1L0QA 4CY1A 3DXMC 3OW8A 5IJ8E 3RN0D 4J78A 3SWSD 3AH8B 2B5NA 5GXHA 1NEXB 3GREA 4O3TB 4A0AB 3PVUB 3MXXA 3EWEA 2CNXA 2PM7B 2IUQA 2Z2NA 3EI3A 3PE7A 2IWKA 3OL2B 3IJ0A 4JXMA 5C2VB 3NVNA 3JZNA 4E5ZA 3AL8B 1RI6A 3RFHA 4PSXB 3FM0A 4A0BA 4QT8A 2Z2PA 4J82A 5CXBA 5I5MA 3E0CA 2B5LA 4D6VA 4FA1D 4JT6C 5HE1B 3IJCA 4CI1A 1NR0A 2BBKH 4PC0A 1U2VC 4G56B 4AOWA 3JZGA 2CN2A 3IJ1A 2GC4A 2IUPA 4CZXA 3I2NA 5FKRA 1MG3A 5TEFA 4CZVA 2I0RA 5EAMA 3SBRA 3W15A 3MZLA 2QC5A 2OVRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B4E A;  4A2M A;  5TDH B;  4OZU A;  5AMS A;  1TYQ C;  3EI2 A;  2HJ4 A;  4A11 B;  3P4F A;  3I7P A;  5CYK B;  3RMZ D;  3BG1 A;  4O45 A;  4A08 A;  5H17 A;  4J0X A;  2PM6 B;  2CO0 A;  3VGZ A;  4N14 A;  3SCY A;  4JSX C;  2H9P A;  4J73 A;  2GC7 A;  4GGC A;  1N6D A;  4L3G D;  3EI3 B;  3EI1 A;  3C99 A;  3MKQ A;  4K3I D;  4J84 A;  4E5Z B;  3B7F A;  1A0R B;  4J0W A;  4X63 B;  5JWZ A;  3IIY A;  4CY2 A;  2IUR A;  4A0B B;  2YMU A;  3KRX B;  5CXB B;  4BL0 A;  4LG8 A;  1XHM A;  2XL3 A;  4GGD A;  4KFM B;  3U4Y A;  3OTT A;  1OLZ A;  1FWX A;  2Z2O A;  4Z8L A;  3EI4 A;  2XYI A;  2J57 G;  3UVN A;  4CZY A;  1GG2 B;  2UZY B;  2I0T A;  2UZX B;  1JMX B;  3EU7 A;  5H1M A;  3IKO A;  5GSA A;  1PI6 A;  3UKR C;  4ZN4 A;  2PM9 A;  4ERY A;  4GQB B;  4L3H D;  3N0E A;  2TRC B;  1B9Y A;  1GP2 B;  4XYH A;  3EI2 B;  4JT5 C;  3J80 g;  4ESG A;  1PBY B;  4FB1 D;  4A2L A;  3AFC A;  1ERJ A;  5THA A;  3BG0 A;  3UVM A;  4CY5 A;  3JB9 L;  3OKY A;  5AJA A;  3I7L A;  1S4U X;  2P9P C;  2YNP A;  4LG9 A;  4GM9 A;  3F3G A;  3I8E A;  2H14 A;  3VH0 A;  4BH6 A;  4PNK B;  3V7D B;  4GMB A;  3EG6 A;  2P9N C;  3C9C A;  4CI8 A;  5B4W A;  5TF2 A;  1N6E A;  3SXT D;  3ORV D;  5IGO A;  5K1C C;  2CE9 A;  4GGA A;  3KRW B;  4J8G A;  4IMM A;  2G9A A;  4EWR A;  1JOF A;  2AGX A;  5CXC A;  2AQ5 A;  2MTA H;  4ERQ A;  2AGZ A;  3BWS A;  4E54 A;  4FAN D;  4D0K A;  1SQJ A;  3UR4 A;  2I3T A;  4H5I A;  1B9X A;  2CN3 A;  4Y5R D;  2YB8 B;  4GZ8 A;  4PSW B;  3EI4 B;  4O9D A;  2AH1 A;  3OKW A;  3K27 A;  5EM2 B;  5GMK n;  3PSL A;  3SBP A;  1R5M A;  3PVW B;  2EBS A;  2GNQ A;  3SJL D;  1MG2 A;  2PM9 B;  4FWW A;  2OK4 A;  4L1Q D;  5SXM A;  3CFV A;  1JMZ B;  4ERZ A;  1K32 A;  3NVX A;  5FKT A;  5EAL A;  3ODT A;  3C5M A;  4CY3 A;  1GXR A;  2PBI B;  4JSN C;  2OVQ B;  5C9Z B;  4FA9 D;  3AL9 A;  1TBG A;  3OKY B;  3MZK A;  3PXW D;  3AL8 A;  3JRO A;  4JSV C;  3SFZ A;  2H6Q A;  2YNO A;  2H3X A;  2H9M A;  2OVP B;  3J81 g;  3L4O D;  5A2Q g;  4QRJ A;  5K19 A;  3SHF A;  2HKM A;  2O9K A;  5EMK B;  3UKU C;  2P9S C;  5CXC B;  5KDO B;  3SN6 B;  1PEV A;  3FRX A;  5EAP A;  5EML B;  3L4M D;  5I5I A;  3V9F A;  4BUJ C;  2AGW A;  1P22 A;  3JRP A;  4A09 A;  4UI9 R;  3JZH A;  2CO0 C;  2P9I C;  1QNI A;  4MK0 B;  2YBA A;  4K3J B;  3SVW D;  2H13 A;  3I7K A;  4NSX A;  3SLE D;  3C75 H;  4JD2 C;  3RLM D;  2XU7 A;  5FKQ A;  5HQG A;  4A08 B;  1XKS A;  3PSC B;  5IC7 A;  5FA5 B;  5HYN B;  5IGQ A;  3SMR A;  1PGU A;  3HFQ A;  4QQE A;  3EMH A;  5C2W B;  3UVK A;  2W18 A;  4O1Q D;  1YFQ A;  3RN1 D;  5GXI A;  4CI3 A;  4QL1 A;  4Y7R A;  3EI1 B;  2H6N A;  3I7N A;  4IA9 A;  1MDA H;  3I8C A;  5HE2 B;  5FQD A;  4L9O A;  2H9N A;  3IIW A;  4HDJ A;  2IAA A;  4OWR A;  1VYH C;  1GOT B;  1Q47 A;  2B5M A;  3DM0 A;  5EAR A;  3NVQ A;  4I79 A;  4PXW A;  3FGB A;  2OK6 A;  3MKS B;  4O3U B;  4J86 A;  4CI2 A;  2H6K A;  4U7A A;  3CFS B;  1N6F A;  2P9K C;  3I7H A;  4GQ2 P;  3UVO A;  4YVD A;  5TEE A;  2CE8 A;  3K26 A;  5FLX g;  2P9U C;  3DSM A;  4U1E I;  3PXS D;  4R7A B;  3CIK B;  3MMY A;  2IUV A;  3I7O A;  5I5J A;  4GM3 A;  1SQ9 A;  1JJU B;  4AEZ A;  4LGN A;  4ZOX A;  4J87 A;  4GM8 A;  2I0S A;  3F3F A;  5HE3 B;  4J8B A;  4A09 B;  2HYE A;  2AGY A;  5EMJ B;  4J81 A;  2G99 A;  4A0A A;  1OMW B;  3RSE C;  3DWL C;  2OIZ A;  2AGL A;  2H68 A;  3GFC A;  3OL2 A;  1K8K C;  3JPX A;  3A0F A;  4JSP C;  3SBQ A;  3RFG A;  4H5J A;  4X60 B;  5FXY A;  3ZWL B;  4J79 A;  3RRM C;  2Q7Q A;  2IWF A;  5AFU 3;  2QXV A;  3F3P A;  4A7J A;  2H9L A;  2XL2 A;  3ULE C;  3VA6 A;  4X3E A;  3V5W B;  2J56 H;  2BCJ B;  4ZOV A;  4FA5 D;  2OJY A;  3PXT D;  4XYI A;  4XEI C;  5FKS A;  2I3S A;  3N0D A;  5H14 A;  1U4C A;  3JAM g;  4E54 B;  4GQ1 A;  4FAV D;  2HJB A;  4FA4 D;  4CC9 A;  4J77 A;  4PBY A;  5HE0 B;  5IJ7 E;  2J55 H;  3DXK C;  3I89 A;  5IT9 g;  2HXC A;  2H47 A;  2P9L C;  2AH0 A;  3OKT A;  1SHY B;  3UVL A;  1XIP A;  2YNN A;  4A11 A;  4TZ4 A;  2HKR A;  5CYK A;  2HES X;  4PBZ A;  5EM2 A;  4ZOZ A;  4ZOY A;  4FHL A;  4X61 B;  5EMM B;  4ES0 A;  1L0Q A;  4CY1 A;  3DXM C;  3OW8 A;  5IJ8 E;  3RN0 D;  4J78 A;  3SWS D;  3AH8 B;  2B5N A;  5GXH A;  1NEX B;  3GRE A;  4O3T B;  4A0A B;  3PVU B;  3MXX A;  3EWE A;  2CNX A;  2PM7 B;  2IUQ A;  2Z2N A;  3EI3 A;  3PE7 A;  2IWK A;  3OL2 B;  3IJ0 A;  4JXM A;  5C2V B;  3NVN A;  3JZN A;  4E5Z A;  3AL8 B;  1RI6 A;  3RFH A;  4PSX B;  3FM0 A;  4A0B A;  4QT8 A;  2Z2P A;  4J82 A;  5CXB A;  5I5M A;  3E0C A;  2B5L A;  4D6V A;  4FA1 D;  4JT6 C;  5HE1 B;  3IJC A;  4CI1 A;  1NR0 A;  2BBK H;  4PC0 A;  1U2V C;  4G56 B;  4AOW A;  3JZG A;  2CN2 A;  3IJ1 A;  2GC4 A;  2IUP A;  4CZX A;  3I2N A;  5FKR A;  1MG3 A;  5TEF A;  4CZV A;  2I0R A;  5EAM A;  3SBR A;  3W15 A;  3MZL A;  2QC5 A;  2OVR B; 
#chains in the Genus database with same CATH topology
 3IUR A;  2B4E A;  4A2M A;  5TDH B;  3ZDX A;  4OZU A;  5AMS A;  1TYQ C;  3EI2 A;  2HJ4 A;  4A11 B;  3P4F A;  3I7P A;  4DNU A;  5CYK B;  3RMZ D;  3BG1 A;  4O45 A;  4BCD A;  4L1M A;  2QR5 A;  3ZE1 A;  4A08 A;  1A12 A;  5H17 A;  1I2M B;  4J0X A;  2HU7 A;  2PM6 B;  2CO0 A;  3MUO A;  3VGZ A;  4N14 A;  3SCY A;  4JSX C;  2H9P A;  4J73 A;  2GC7 A;  4GGC A;  1N6D A;  3KCI A;  4L3G D;  3EI3 B;  4UM8 A;  3EI1 A;  3C99 A;  2VDO A;  3MKQ A;  1M1X A;  4K3I D;  4J84 A;  1VE7 A;  4E5Z B;  3B7F A;  1A0R B;  4J0W A;  4X63 B;  4AN1 A;  3T3P A;  5JWZ A;  1H2Z A;  3EQ7 A;  3IIY A;  4CY2 A;  1T2X A;  3O4I A;  2IUR A;  3IUL A;  4A0B B;  5E6U A;  2VDP A;  2YMU A;  3KRX B;  3NIG A;  2JKX A;  4WK4 A;  5CXB B;  4BL0 A;  4LG8 A;  1XHM A;  2XL3 A;  4GGD A;  4KFM B;  3U4Y A;  3OTT A;  1OLZ A;  3IVM A;  3EQ9 A;  1FWX A;  2Z2O A;  4Z8L A;  4WK0 A;  3EI4 A;  2XYI A;  2WQ8 A;  2J57 G;  3O4J A;  3UVN A;  4CZY A;  1GG2 B;  2UZY B;  2I0T A;  2UZX B;  1JMX B;  3EU7 A;  5H1M A;  3IKO A;  5GSA A;  1PI6 A;  3UKR C;  4ZN4 A;  2PM9 A;  4ERY A;  4GQB B;  4L3H D;  3N0E A;  2TRC B;  1B9Y A;  1GP2 B;  4XYH A;  3EI2 B;  5E6R A;  4JT5 C;  3J80 g;  4ESG A;  2VDR A;  1PBY B;  4FB1 D;  4A2L A;  3AFC A;  1QFS A;  1ERJ A;  5THA A;  3BG0 A;  3UVM A;  4CY5 A;  3JB9 L;  3OKY A;  5AJA A;  3I7L A;  1S4U X;  2P9P C;  2YNP A;  1VE6 A;  4LG9 A;  4GM9 A;  3QI0 A;  3F3G A;  3I8E A;  2H14 A;  3VH0 A;  3T3M A;  4BH6 A;  4PNK B;  3V7D B;  4GMB A;  1GOG A;  3EG6 A;  2P9N C;  3QHY B;  3C9C A;  4CI8 A;  5B4W A;  5TF2 A;  1N6E A;  3SXT D;  3ORV D;  5IGO A;  5K1C C;  2CE9 A;  4GGA A;  3KRW B;  4J8G A;  2VDK A;  4IMM A;  2G9A A;  1UOO A;  4EWR A;  1JOF A;  2AGX A;  1C9L A;  5CXC A;  2AQ5 A;  2MTA H;  4ERQ A;  3IUM A;  2AGZ A;  3BWS A;  4E54 A;  4FAN D;  4D0K A;  2XDW A;  1SQJ A;  3UR4 A;  2I3T A;  4H5I A;  1B9X A;  2CN3 A;  4Y5R D;  2YB8 B;  4GZ8 A;  3IUQ A;  4PSW B;  3EI4 B;  4O9D A;  2AH1 A;  3OKW A;  3MVD K;  3K27 A;  5EM2 B;  5GMK n;  3PSL A;  3SBP A;  1R5M A;  4DNW A;  3PVW B;  1O6F A;  2EBS A;  2GNQ A;  3SJL D;  1MG2 A;  2PM9 B;  4FWW A;  2OK4 A;  5FFO A;  4L1Q D;  5SXM A;  3CFV A;  4MMY A;  3K6S A;  4IRZ A;  1JMZ B;  4NEN A;  4ERZ A;  1K32 A;  3FCS A;  3NVX A;  5FKT A;  5EAL A;  3ODT A;  3C5M A;  4CY3 A;  1GXR A;  2PBI B;  4JSN C;  2OVQ B;  5C9Z B;  4FA9 D;  1C9I A;  1U8C A;  3AL9 A;  1TBG A;  3OKY B;  4JHP C;  3MZK A;  1E8M A;  3PXW D;  2XE4 A;  4UM9 A;  3AL8 A;  1TYE A;  2XZG A;  3JRO A;  4JSV C;  3SFZ A;  2H6Q A;  1GOH A;  2YNO A;  3K71 A;  2H3X A;  2H9M A;  2OVP B;  4WJK A;  3J81 g;  3L4O D;  5A2Q g;  4QRJ A;  5K19 A;  3SHF A;  2HKM A;  2O9K A;  5EMK B;  3UKU C;  4AMY A;  2P9S C;  3GC3 B;  5E6S A;  5CXC B;  5KDO B;  3SN6 B;  1PEV A;  3FRX A;  5EAP A;  4RE5 A;  5EML B;  3L4M D;  5I5I A;  3V9F A;  5M5T A;  2EIC A;  4BUJ C;  2AGW A;  1P22 A;  3JRP A;  4A09 A;  4UI9 R;  3JZH A;  2CO0 C;  2P9I C;  1QNI A;  4MK0 B;  2YBA A;  4K3J B;  3SVW D;  2H13 A;  1K3I A;  3I7K A;  4NSX A;  3SLE D;  3V4P A;  3C75 H;  4JD2 C;  3RLM D;  2XU7 A;  5FKQ A;  5HQG A;  4A08 B;  1XKS A;  5M5U A;  3PSC B;  4G1M A;  5IC7 A;  5FA5 B;  1GOF A;  2EIE A;  5HYN B;  2EIB A;  4AMZ A;  5IGQ A;  3SMR A;  1PGU A;  5M5R A;  3HFQ A;  3K72 A;  4QQE A;  3EMH A;  5C2W B;  3UVK A;  4BCC A;  5M5V A;  2W18 A;  4NAA A;  4O1Q D;  3OF7 A;  1YFQ A;  3RN1 D;  5GXI A;  4CI3 A;  4QL1 A;  4Y7R A;  3EI1 B;  5M61 A;  2H6N A;  3I7N A;  4IA9 A;  1MDA H;  3I8C A;  4Z7O A;  5HE2 B;  5FQD A;  4L9O A;  2H9N A;  3IIW A;  4MMX A;  4NBM A;  4HDJ A;  2IAA A;  3EQ8 A;  4OWR A;  1VYH C;  4QAM A;  1GOT B;  2HU5 A;  3O4G A;  3VI3 A;  1Q47 A;  2B5M A;  3DM0 A;  4O2W A;  5EAR A;  3NVQ A;  4I79 A;  1BPO A;  4PXW A;  3FGB A;  2OK6 A;  3MKS B;  4O3U B;  4AN0 A;  4J86 A;  4CI2 A;  2H6K A;  4U7A A;  3CFS B;  3FCU A;  1N6F A;  2P9K C;  3I7H A;  2VDN A;  4GQ2 P;  3UVO A;  4YVD A;  5TEE A;  2CE8 A;  3K26 A;  5FLX g;  2P9U C;  3DSM A;  4U1E I;  3PXS D;  4R7A B;  4BCB A;  3CIK B;  3MMY A;  2IUV A;  1UTC A;  3I7O A;  2HU8 A;  4GM3 A;  1SQ9 A;  1JJU B;  5I5J A;  4AEZ A;  4Z7Q A;  4LGN A;  4ZOX A;  4J87 A;  4GM8 A;  3IUJ A;  2I0S A;  3F3F A;  1JV2 A;  5HE3 B;  4RE6 A;  4J8B A;  4A09 B;  4BP9 A;  1E8N A;  2EID A;  2HYE A;  2AGY A;  5EMJ B;  4J81 A;  2G99 A;  4A0A A;  2VDM A;  1OMW B;  3RSE C;  3DWL C;  4G1E A;  5M5S A;  2OIZ A;  2AGL A;  2H68 A;  3GFC A;  3OL2 A;  1K8K C;  3JPX A;  3VI4 A;  3A0F A;  4JSP C;  3SBQ A;  3DDU A;  3IJE A;  3RFG A;  4AX4 A;  2VDQ A;  4WK2 A;  4H5J A;  4JHN A;  4X60 B;  3IUN A;  5FXY A;  3ZWL B;  4J79 A;  3RRM C;  1YR2 A;  4DNV A;  4D9S A;  2Q7Q A;  2IWF A;  5AFU 3;  2QXV A;  1VZ2 A;  3F3P A;  4A7J A;  2H9L A;  2BKL A;  2XL2 A;  1H2W A;  3ULE C;  4X3E A;  3VA6 A;  3V5W B;  1JTD B;  2J56 H;  2BCJ B;  4ZOV A;  4FA5 D;  2OJY A;  3PXT D;  4XYI A;  1QFM A;  4XEI C;  5FKS A;  2I3S A;  3MUN A;  3NID A;  3N0D A;  5H14 A;  1U4C A;  3JAM g;  4E54 B;  4GQ1 A;  4FAV D;  2HJB A;  2VZ3 A;  4FA4 D;  4CC9 A;  4J77 A;  4PBY A;  5HE0 B;  1UOP A;  5IJ7 E;  2J55 H;  3DXK C;  3I89 A;  5IT9 g;  3NIF A;  2HXC A;  2H47 A;  1UOQ A;  2P9L C;  2AH0 A;  3OKT A;  1SHY B;  3UVL A;  1XIP A;  2YNN A;  4A11 A;  4TZ4 A;  2HKR A;  5CYK A;  2HES X;  4PBZ A;  5EM2 A;  4ZOZ A;  5HDB A;  4ZOY A;  4FHL A;  3ZDY A;  4X61 B;  5EMM B;  4ES0 A;  4Z7N A;  2VC2 A;  1L0Q A;  4CY1 A;  1E5T A;  3DXM C;  3OW8 A;  5IJ8 E;  3RN0 D;  4J78 A;  3SWS D;  3AH8 B;  3O4H A;  2B5N A;  5GXH A;  1L5G A;  1NEX B;  3GRE A;  4O3T B;  4A0A B;  3PVU B;  3MXX A;  3EWE A;  2CNX A;  2PM7 B;  2IUQ A;  2Z2N A;  5C92 A;  4G55 A;  3EI3 A;  3PE7 A;  2IWK A;  3GD1 I;  3OL2 B;  2QZP A;  1H2Y A;  3IJ0 A;  2VDL A;  4JXM A;  5C2V B;  3NVN A;  3JZN A;  4E5Z A;  3ZE2 A;  3AL8 B;  1RI6 A;  3RFH A;  4PSX B;  3ZDZ A;  1VZ3 A;  3FM0 A;  4NC4 A;  3V4V A;  4A0B A;  2VZ1 A;  4QT8 A;  2Z2P A;  3ZE0 A;  4J82 A;  5CXB A;  4BP8 A;  5I5M A;  3E0C A;  2B5L A;  4D6V A;  4FA1 D;  4JT6 C;  5HE1 B;  3IJC A;  4CI1 A;  1NR0 A;  2BBK H;  4PC0 A;  1U2V C;  4G56 B;  4AOW A;  3JZG A;  2CN2 A;  3IJ1 A;  2GC4 A;  2IUP A;  4CZX A;  1O6G A;  3I2N A;  4MMZ A;  4O02 A;  5FKR A;  1MG3 A;  5TEF A;  4CZV A;  2I0R A;  5C86 A;  5FFG A;  5EAM A;  3SBR A;  3W15 A;  3MZL A;  1H2X A;  2QC5 A;  2OVR B; 
#chains in the Genus database with same CATH homology
 2B4E A;  4A2M A;  5TDH B;  4OZU A;  5AMS A;  1TYQ C;  3EI2 A;  2HJ4 A;  4A11 B;  3P4F A;  3I7P A;  5CYK B;  3RMZ D;  3BG1 A;  4O45 A;  4A08 A;  5H17 A;  4J0X A;  2PM6 B;  2CO0 A;  3VGZ A;  4N14 A;  3SCY A;  4JSX C;  2H9P A;  4J73 A;  2GC7 A;  4GGC A;  1N6D A;  4L3G D;  3EI3 B;  3EI1 A;  3C99 A;  3MKQ A;  4K3I D;  4J84 A;  4E5Z B;  3B7F A;  1A0R B;  4J0W A;  4X63 B;  5JWZ A;  3IIY A;  4CY2 A;  2IUR A;  4A0B B;  2YMU A;  3KRX B;  5CXB B;  4BL0 A;  4LG8 A;  1XHM A;  2XL3 A;  4GGD A;  4KFM B;  3U4Y A;  3OTT A;  1OLZ A;  1FWX A;  2Z2O A;  4Z8L A;  3EI4 A;  2XYI A;  2J57 G;  3UVN A;  4CZY A;  1GG2 B;  2UZY B;  2I0T A;  2UZX B;  1JMX B;  3EU7 A;  5H1M A;  3IKO A;  5GSA A;  1PI6 A;  3UKR C;  4ZN4 A;  2PM9 A;  4ERY A;  4GQB B;  4L3H D;  3N0E A;  2TRC B;  1B9Y A;  1GP2 B;  4XYH A;  3EI2 B;  4JT5 C;  3J80 g;  4ESG A;  1PBY B;  4FB1 D;  4A2L A;  3AFC A;  1ERJ A;  5THA A;  3BG0 A;  3UVM A;  4CY5 A;  3JB9 L;  3OKY A;  5AJA A;  3I7L A;  1S4U X;  2P9P C;  2YNP A;  4LG9 A;  4GM9 A;  3F3G A;  3I8E A;  2H14 A;  3VH0 A;  4BH6 A;  4PNK B;  3V7D B;  4GMB A;  3EG6 A;  2P9N C;  3C9C A;  4CI8 A;  5B4W A;  5TF2 A;  1N6E A;  3SXT D;  3ORV D;  5IGO A;  5K1C C;  2CE9 A;  4GGA A;  3KRW B;  4J8G A;  4IMM A;  2G9A A;  4EWR A;  1JOF A;  2AGX A;  5CXC A;  2AQ5 A;  2MTA H;  4ERQ A;  2AGZ A;  3BWS A;  4E54 A;  4FAN D;  4D0K A;  1SQJ A;  3UR4 A;  2I3T A;  4H5I A;  1B9X A;  2CN3 A;  4Y5R D;  2YB8 B;  4GZ8 A;  4PSW B;  3EI4 B;  4O9D A;  2AH1 A;  3OKW A;  3K27 A;  5EM2 B;  5GMK n;  3PSL A;  3SBP A;  1R5M A;  3PVW B;  2EBS A;  2GNQ A;  3SJL D;  1MG2 A;  2PM9 B;  4FWW A;  2OK4 A;  4L1Q D;  5SXM A;  3CFV A;  1JMZ B;  4ERZ A;  1K32 A;  3NVX A;  5FKT A;  5EAL A;  3ODT A;  3C5M A;  4CY3 A;  1GXR A;  2PBI B;  4JSN C;  2OVQ B;  5C9Z B;  4FA9 D;  3AL9 A;  1TBG A;  3OKY B;  3MZK A;  3PXW D;  3AL8 A;  3JRO A;  4JSV C;  3SFZ A;  2H6Q A;  2YNO A;  2H3X A;  2H9M A;  2OVP B;  3J81 g;  3L4O D;  5A2Q g;  4QRJ A;  5K19 A;  3SHF A;  2HKM A;  2O9K A;  5EMK B;  3UKU C;  2P9S C;  5CXC B;  5KDO B;  3SN6 B;  1PEV A;  3FRX A;  5EAP A;  5EML B;  3L4M D;  5I5I A;  3V9F A;  4BUJ C;  2AGW A;  1P22 A;  3JRP A;  4A09 A;  4UI9 R;  3JZH A;  2CO0 C;  2P9I C;  1QNI A;  4MK0 B;  2YBA A;  4K3J B;  3SVW D;  2H13 A;  3I7K A;  4NSX A;  3SLE D;  3C75 H;  4JD2 C;  3RLM D;  2XU7 A;  5FKQ A;  5HQG A;  4A08 B;  1XKS A;  3PSC B;  5IC7 A;  5FA5 B;  5HYN B;  5IGQ A;  3SMR A;  1PGU A;  3HFQ A;  4QQE A;  3EMH A;  5C2W B;  3UVK A;  2W18 A;  4O1Q D;  1YFQ A;  3RN1 D;  5GXI A;  4CI3 A;  4QL1 A;  4Y7R A;  3EI1 B;  2H6N A;  3I7N A;  4IA9 A;  1MDA H;  3I8C A;  5HE2 B;  5FQD A;  4L9O A;  2H9N A;  3IIW A;  4HDJ A;  2IAA A;  4OWR A;  1VYH C;  1GOT B;  1Q47 A;  2B5M A;  3DM0 A;  5EAR A;  3NVQ A;  4I79 A;  4PXW A;  3FGB A;  2OK6 A;  3MKS B;  4O3U B;  4J86 A;  4CI2 A;  2H6K A;  4U7A A;  3CFS B;  1N6F A;  2P9K C;  3I7H A;  4GQ2 P;  3UVO A;  4YVD A;  5TEE A;  2CE8 A;  3K26 A;  5FLX g;  2P9U C;  3DSM A;  4U1E I;  3PXS D;  4R7A B;  3CIK B;  3MMY A;  2IUV A;  3I7O A;  5I5J A;  4GM3 A;  1SQ9 A;  1JJU B;  4AEZ A;  4LGN A;  4ZOX A;  4J87 A;  4GM8 A;  2I0S A;  3F3F A;  5HE3 B;  4J8B A;  4A09 B;  2HYE A;  2AGY A;  5EMJ B;  4J81 A;  2G99 A;  4A0A A;  1OMW B;  3RSE C;  3DWL C;  2OIZ A;  2AGL A;  2H68 A;  3GFC A;  3OL2 A;  1K8K C;  3JPX A;  3A0F A;  4JSP C;  3SBQ A;  3RFG A;  4H5J A;  4X60 B;  5FXY A;  3ZWL B;  4J79 A;  3RRM C;  2Q7Q A;  2IWF A;  5AFU 3;  2QXV A;  3F3P A;  4A7J A;  2H9L A;  2XL2 A;  3ULE C;  3VA6 A;  4X3E A;  3V5W B;  2J56 H;  2BCJ B;  4ZOV A;  4FA5 D;  2OJY A;  3PXT D;  4XYI A;  4XEI C;  5FKS A;  2I3S A;  3N0D A;  5H14 A;  1U4C A;  3JAM g;  4E54 B;  4GQ1 A;  4FAV D;  2HJB A;  4FA4 D;  4CC9 A;  4J77 A;  4PBY A;  5HE0 B;  5IJ7 E;  2J55 H;  3DXK C;  3I89 A;  5IT9 g;  2HXC A;  2H47 A;  2P9L C;  2AH0 A;  3OKT A;  1SHY B;  3UVL A;  1XIP A;  2YNN A;  4A11 A;  4TZ4 A;  2HKR A;  5CYK A;  2HES X;  4PBZ A;  5EM2 A;  4ZOZ A;  4ZOY A;  4FHL A;  4X61 B;  5EMM B;  4ES0 A;  1L0Q A;  4CY1 A;  3DXM C;  3OW8 A;  5IJ8 E;  3RN0 D;  4J78 A;  3SWS D;  3AH8 B;  2B5N A;  5GXH A;  1NEX B;  3GRE A;  4O3T B;  4A0A B;  3PVU B;  3MXX A;  3EWE A;  2CNX A;  2PM7 B;  2IUQ A;  2Z2N A;  3EI3 A;  3PE7 A;  2IWK A;  3OL2 B;  3IJ0 A;  4JXM A;  5C2V B;  3NVN A;  3JZN A;  4E5Z A;  3AL8 B;  1RI6 A;  3RFH A;  4PSX B;  3FM0 A;  4A0B A;  4QT8 A;  2Z2P A;  4J82 A;  5CXB A;  5I5M A;  3E0C A;  2B5L A;  4D6V A;  4FA1 D;  4JT6 C;  5HE1 B;  3IJC A;  4CI1 A;  1NR0 A;  2BBK H;  4PC0 A;  1U2V C;  4G56 B;  4AOW A;  3JZG A;  2CN2 A;  3IJ1 A;  2GC4 A;  2IUP A;  4CZX A;  3I2N A;  5FKR A;  1MG3 A;  5TEF A;  4CZV A;  2I0R A;  5EAM A;  3SBR A;  3W15 A;  3MZL A;  2QC5 A;  2OVR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...