3J80g

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
324
structure length
318
Chain Sequence
SSNIMLVLRGTLEGHNGWVTSLSTSAAQPNLLVSGSRDKTLISWRLTENEQQFGVPVRSYKGHSHIVQDVVVSADGNYAVSASWDKTLRLWNLATGNSEARFVGHTGDVLSVAIDANSSKIISASRDKTIRVWNTVGDCAYVLLGHTDWVTKVRVAPKNLVDDGRITFVSAGMDKIVRSWSLNSYRIEADFIGHNNYINVVQPSPDGSLAASAGKDGQIYVWNLKHKSAFMNFDAKDEVFALAFSPSRFWLTAATASGIKIYDLENEVLIDELKPEFAGYTKAQDPHAVSLAWSADGQTLFAGYTDNVIRVWQVMTAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 45
structure length 318
sequence length 324
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
g PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3j80g01
4AOWA 3N0DA 3UKUC 2W18A 2QXVA 4JSXC 4D6VA 3I89A 2HYEA 3RN0D 2GNQA 4CY3A 5CYKB 4J86A 3RN1D 3VGZA 5C2WB 5HE2B 5EMMB 1JMZB 3KRXB 2H9LA 3OL2B 3OKWA 4GQBB 2CO0A 4OWRA 2I0RA 2PBIB 3SWSD 5HE1B 5FKTA 2H9MA 5CXBA 5HQGA 4A11A 4GGCA 3AL8B 5H14A 1MG3A 4QQEA 3IJ0A 4GMBA 3DSMA 5IT9g 4ES0A 4CI3A 3IKOA 3UVLA 2HESX 1JOFA 3OKYA 2XL3A 4FHLA 4JD2C 1R5MA 5EARA 2UZXB 4L9OA 4O45A 1SQ9A 1QNIA 2YNNA 3IJCA 2H14A 3I7PA 4J73A 3IJ1A 3I7HA 2AH0A 2G99A 5FA5B 3BWSA 2P9SC 4BH6A 4PXWA 4A08B 4GZ8A 1SQJA 4L3HD 1B9XA 4GGAA 2H9NA 2XL2A 2YNOA 4X3EA 5HE0B 5SXMA 4FA1D 2OK4A 2CO0C 5FLXg 3JZHA 4ERYA 4A0AA 1GXRA 4PNKB 1K32A 1B9YA 2YB8B 1JMXB 2H47A 2OK6A 3IIWA 4A0AB 2AGYA 2CE8A 2P9PC 4FB1D 4PBZA 1NEXB 3CFSB 5CXCB 4CZYA 5I5MA 2AGWA 4A0BB 3C99A 4LG8A 5GMKn 5H1MA 4JT5C 4XYIA 3V7DB 3PSLA 4Y7RA 4ERQA 3PXWD 2I3SA 3SJLD 4GM8A 1GP2B 4J8BA 3HFQA 3EG6A 3J80g 2I0TA 3JROA 4X61B 5IJ7E 4J84A 3JZGA 2CN3A 2QC5A 5TF2A 3RMZD 3DXMC 2CN2A 3U4YA 3PXSD 4BUJC 2H6QA 1N6EA 3CFVA 4ZOZA 4JSPC 2GC7A 2H68A 4L3GD 5TEFA 3GFCA 1RI6A 1XIPA 3B7FA 4EWRA 1PI6A 4A09B 2J56H 3RSEC 5JWZA 1TYQC 4FWWA 4E54B 3CIKB 4E5ZA 2H6NA 3I7LA 3DXKC 3E0CA 2PM6B 3P4FA 5GXHA 5GSAA 2AGLA 2H3XA 3SMRA 5KDOB 4MK0B 1U2VC 4ZOXA 2J55H 4PSWB 1NR0A 2HKRA 4CY2A 3MMYA 3EI3A 4J8GA 5FQDA 5EMKB 1YFQA 4CZVA 3C75H 4HDJA 3DWLC 5EAPA 3PVUB 1OLZA 1Q47A 3I7OA 4CZXA 4OZUA 2P9IC 2IWKA 2YNPA 3SBQA 4I79A 3NVQA 2HJBA 2IUVA 5CXBB 4N14A 4FAVD 4J0WA 4A11B 4PBYA 4O1QD 5IGOA 3JZNA 4J78A 3EI2A 4J81A 5C2VB 2YBAA 3F3GA 2O9KA 2PM9A 3MKSB 2HXCA 2UZYB 4ZN4A 3ZWLB 3SVWD 3EI1A 5A2Qg 3FM0A 3OKYB 5EAMA 3MZKA 5TDHB 1PEVA 3MZLA 1JJUB 4BL0A 2B5LA 2OJYA 5K1CC 3N0EA 3MKQA 3ORVD 2IAAA 3OKTA 3UKRC 5IGQA 1N6FA 1MDAH 3EMHA 1U4CA 3RRMC 2BBKH 3UVNA 4CY1A 2J57G 4JSVC 5EM2A 3J81g 2AH1A 4H5JA 4CY5A 4AEZA 4FA5D 4U7AA 3PE7A 3C9CA 1VYHC 4D0KA 3I7KA 2IUQA 5EM2B 3EU7A 3L4MD 5H17A 3UVKA 3SLED 2BCJB 4CI1A 4XEIC 4ESGA 4QT8A 1XHMA 3FGBA 4TZ4A 3OTTA 4QL1A 1SHYB 4QRJA 1OMWB 5FXYA 3GREA 2B5MA 2IWFA 3JPXA 1GOTB 2HJ4A 1FWXA 4XYHA 4X60B 5HE3B 5FKQA 4KFMB 2H13A 3F3PA 4Z8LA 5AMSA 2GC4A 4FAND 4L1QD 1P22A 2P9UC 3AH8B 3PVWB 2HKMA 4O9DA 1A0RB 2B5NA 3SCYA 2AGXA 2MTAH 4YVDA 4O3TB 4J87A 2AGZA 1N6DA 1S4UX 3JAMg 2XYIA 4LGNA 3RLMD 4E5ZB 4JSNC 4CI2A 2XU7A 5CYKA 3ODTA 4JT6C 4J79A 2OVQB 5GXIA 4IA9A 2P9NC 2OVRB 3EWEA 5IC7A 3EI3B 4IMMA 3I8EA 3PSCB 4GM9A 3OL2A 4GQ2P 1PGUA 3SFZA 2OVPB 2H6KA 3I7NA 3MXXA 5TEEA 3I2NA 3UVMA 4K3JB 4Y5RD 4U1EI 2EBSA 4LG9A 3SHFA 4JXMA 2P9KC 3AL8A 4GGDA 4GQ1A 3V9FA 3ULEC 5AFU3 3IIYA 1ERJA 3SN6B 2Z2OA 4A2MA 1K8KC 3EI2B 3F3FA 2I3TA 2PM9B 2Q7QA 2B4EA 3VA6A 3EI1B 4ZOYA 3A0FA 1GG2B 2IUPA 2PM7B 5IJ8E 1TBGA 4ZOVA 2H9PA 5EMJB 5FKRA 5EALA 3VH0A 4J82A 2IURA 2AQ5A 4FA4D 3W15A 4A08A 3JRPA 4NSXA 3V5WB 3BG1A 3BG0A 3UR4A 5K19A 5B4WA 1PBYB 3C5MA 3AFCA 4R7AB 1MG2A 4K3ID 5CXCA 3JB9L 5C9ZB 4A0BA 3NVNA 2OIZA 4FA9D 2YMUA 4J77A 5FKSA 3RFHA 3FRXA 4PSXB 4UI9R 1L0QA 3OW8A 5I5IA 4CC9A 4CI8A 4X63B 2CE9A 2I0SA 3UVOA 3SXTD 4ERZA 2G9AA 5HYNB 3AL9A 4A7JA 4A2LA 2TRCB 3SBRA 2P9LC 4J0XA 3EI4A 4GM3A 3K27A 2Z2NA 2Z2PA 4PC0A 5EMLB 4O3UB 3K26A 3RFGA 3L4OD 3NVXA 5AJAA 3PXTD 2CNXA 3EI4B 1XKSA 5THAA 4A09A 3KRWB 3DM0A 3SBPA 4E54A 5I5JA 3I8CA 4H5IA 4G56B
chains in the Genus database with same CATH superfamily
1H2ZA 4AOWA 3N0DA 3UKUC 2W18A 2QXVA 2VDOA 4JSXC 4D6VA 3I89A 1T2XA 4AMYA 2HYEA 3RN0D 2GNQA 1C9LA 4CY3A 5CYKB 4BCBA 4J86A 3NIFA 1GOHA 3RN1D 3ZE0A 4WK4A 5C92A 3VGZA 5C2WB 4O02A 1H2XA 5HE2B 4Z7OA 5EMMB 1JMZB 3KRXB 2VDQA 2H9LA 3OL2B 3OKWA 4GQBB 2CO0A 2JKXA 4OWRA 2I0RA 2PBIB 1BPOA 3SWSD 5HE1B 5FKTA 2H9MA 5CXBA 3ZE2A 1VE6A 5HQGA 4WJKA 4A11A 4GGCA 3AL8B 5H14A 1MG3A 3O4IA 4QQEA 5M61A 3EQ9A 3IJ0A 4GMBA 3DSMA 5IT9g 4ES0A 4CI3A 3IKOA 3UVLA 2HESX 1JOFA 3OKYA 1I2MB 2XL3A 4FHLA 1R5MA 4JD2C 5M5TA 5EARA 1UTCA 2UZXB 4L9OA 2EIEA 4O45A 1SQ9A 1QNIA 4G1EA 2YNNA 3IJCA 2H14A 3I7PA 4J73A 4JHPC 3OF7A 3IJ1A 3I7HA 3IUNA 2AH0A 2G99A 5FA5B 3BWSA 2P9SC 4L1MA 4IRZA 2HU7A 4BH6A 4PXWA 3KCIA 3MVDK 1M1XA 4A08B 4GZ8A 3ZDYA 1SQJA 1B9XA 4GGAA 4L3HD 2H9NA 2XL2A 2YNOA 4X3EA 3O4GA 5HE0B 5SXMA 4FA1D 5M5RA 2OK4A 2CO0C 5FLXg 3JZHA 4ERYA 4A0AA 1GXRA 1YR2A 4PNKB 1K32A 4UM9A 1B9YA 3EQ7A 2YB8B 1JMXB 4UM8A 2H47A 2OK6A 3IIWA 4A0AB 4NBMA 2AGYA 5FFOA 2CE8A 2P9PC 4FB1D 4PBZA 1NEXB 3CFSB 5CXCB 4CZYA 5I5MA 2AGWA 4A0BB 3C99A 4LG8A 2VDRA 5GMKn 5H1MA 1GOFA 4JT5C 4MMYA 4XYIA 3V7DB 4NENA 3PSLA 4Y7RA 4DNWA 4ERQA 3PXWD 2I3SA 3SJLD 4GM8A 1GP2B 4J8BA 3IUMA 3HFQA 3EG6A 3J80g 3ZE1A 2I0TA 3JROA 4X61B 5IJ7E 3K6SA 4J84A 3JZGA 2CN3A 2QC5A 1A12A 5TF2A 3RMZD 3DXMC 2CN2A 3U4YA 3PXSD 4MMZA 4BUJC 2H6QA 1N6EA 3CFVA 1VZ2A 4ZOZA 4JSPC 2GC7A 2H68A 4L3GD 5TEFA 3GFCA 1RI6A 3K72A 4RE6A 2VDMA 1XIPA 3B7FA 3T3PA 2VDKA 4EWRA 1PI6A 4A09B 2J56H 1O6GA 3RSEC 5JWZA 1TYQC 4FWWA 4E54B 1QFSA 3FCUA 3CIKB 5E6RA 2H6NA 4E5ZA 3I7LA 5M5VA 1UOQA 3DXKC 3E0CA 2PM6B 3P4FA 3FCSA 5GXHA 1K3IA 2AGLA 2H3XA 3SMRA 5GSAA 3V4VA 5KDOB 4MK0B 1U2VC 4D9SA 4ZOXA 2J55H 4PSWB 4BCCA 1NR0A 2HKRA 4CY2A 3MMYA 3IUJA 3EI3A 3O4HA 4J8GA 5E6UA 5FQDA 5EMKB 1YFQA 3DDUA 4CZVA 3C75H 4HDJA 3DWLC 2VDLA 5EAPA 1GOGA 3PVUB 2EICA 1OLZA 1Q47A 4BP9A 3I7OA 4CZXA 3V4PA 2HU5A 2XE4A 4OZUA 4QAMA 3K71A 2P9IC 2IWKA 2YNPA 2XZGA 3SBQA 4I79A 3NVQA 2HJBA 2IUVA 5CXBB 4N14A 4FAVD 4J0WA 4A11B 4PBYA 3T3MA 4O1QD 5IGOA 3JZNA 4J78A 3EI2A 4J81A 5C2VB 2YBAA 3F3GA 2O9KA 2PM9A 3MKSB 2HXCA 2UZYB 4ZN4A 3QHYB 3ZWLB 3SVWD 3EI1A 4AN0A 3GC3B 5A2Qg 3FM0A 3OKYB 1E8NA 5EAMA 3MZKA 5TDHB 1PEVA 3MZLA 1JJUB 4Z7NA 3MUOA 4BL0A 2B5LA 2OJYA 5K1CC 3N0EA 3MKQA 3ORVD 2IAAA 1VE7A 3OKTA 3UKRC 5IGQA 1N6FA 1MDAH 3EMHA 1U4CA 5E6SA 3RRMC 2BBKH 3UVNA 4CY1A 5HDBA 4BP8A 2J57G 4JSVC 4AX4A 1E5TA 5EM2A 3J81g 2AH1A 4H5JA 4CY5A 4AEZA 4DNVA 4FA5D 4U7AA 3PE7A 3C9CA 1H2WA 1VYHC 4D0KA 4DNUA 1L5GA 2EIBA 3I7KA 2IUQA 2QZPA 5EM2B 3EU7A 5FFGA 3L4MD 5H17A 3UVKA 1H2YA 3SLED 2BCJB 4CI1A 3O4JA 4XEIC 4O2WA 4ESGA 1U8CA 4QT8A 1XHMA 3FGBA 4TZ4A 3OTTA 4QL1A 1SHYB 4QRJA 3VI4A 1OMWB 5FXYA 3GREA 5M5SA 2B5MA 2IWFA 4AMZA 3JPXA 1GOTB 2HJ4A 1FWXA 4XYHA 4X60B 5HE3B 4NC4A 5FKQA 4KFMB 2H13A 3F3PA 4Z8LA 5AMSA 2GC4A 4FAND 1UOPA 4L1QD 1P22A 2P9UC 2HU8A 3AH8B 3PVWB 2HKMA 4O9DA 1A0RB 2B5NA 3SCYA 2AGXA 1UOOA 3ZDXA 2MTAH 4YVDA 4O3TB 4J87A 2AGZA 3IJEA 3NIDA 1N6DA 1S4UX 2QR5A 3JAMg 2XYIA 4LGNA 3RLMD 3NIGA 4E5ZB 4JSNC 4CI2A 4AN1A 2XU7A 3IUQA 5CYKA 3ODTA 4JT6C 4J79A 2OVQB 3QI0A 5GXIA 4IA9A 2P9NC 2OVRB 3EWEA 5IC7A 3EI3B 4IMMA 3I8EA 3PSCB 4GM9A 3OL2A 4GQ2P 1PGUA 3SFZA 3ZDZA 2OVPB 2H6KA 4NAAA 3I7NA 3MXXA 5TEEA 3I2NA 3UVMA 4K3JB 4Y5RD 4U1EI 2EBSA 4LG9A 3SHFA 4JXMA 2P9KC 3AL8A 4GGDA 4GQ1A 3V9FA 3ULEC 5AFU3 5M5UA 2VC2A 1O6FA 2VZ3A 3IIYA 1ERJA 3SN6B 2Z2OA 4A2MA 1K8KC 3EI2B 3F3FA 3VI3A 2I3TA 2PM9B 2Q7QA 2B4EA 3VA6A 3EI1B 4ZOYA 3A0FA 4Z7QA 1GG2B 2IUPA 2PM7B 3IULA 5IJ8E 4JHNA 1TBGA 4ZOVA 2H9PA 5EMJB 5FKRA 4G55A 5EALA 3VH0A 4J82A 2IURA 2AQ5A 4FA4D 2XDWA 3W15A 4A08A 3JRPA 4NSXA 3V5WB 3BG1A 3BG0A 5C86A 3UR4A 1QFMA 5K19A 5B4WA 2WQ8A 1PBYB 1JV2A 3GD1I 3C5MA 1TYEA 4MMXA 3AFCA 1E8MA 4R7AB 1MG2A 4K3ID 5CXCA 3JB9L 5C9ZB 4A0BA 3NVNA 2BKLA 2OIZA 4FA9D 2YMUA 4J77A 5FKSA 3RFHA 3FRXA 4PSXB 4UI9R 1L0QA 3OW8A 2VDPA 5I5IA 4CC9A 4CI8A 2VDNA 3MUNA 4WK0A 4X63B 2CE9A 2I0SA 1C9IA 3UVOA 3SXTD 4ERZA 2G9AA 5HYNB 3AL9A 4A7JA 4A2LA 2TRCB 3SBRA 4G1MA 3IURA 2EIDA 2P9LC 4J0XA 3EI4A 4GM3A 3K27A 2Z2NA 4WK2A 2Z2PA 4PC0A 3EQ8A 5EMLB 4O3UB 3K26A 3RFGA 3L4OD 3NVXA 5AJAA 3PXTD 2CNXA 3EI4B 1XKSA 5THAA 4A09A 3IVMA 3KRWB 1JTDB 3DM0A 4RE5A 1VZ3A 2VZ1A 3SBPA 4E54A 5I5JA 3I8CA 4H5IA 4BCDA 4G56B
chains in the Genus database with same CATH topology
4AOWA 3N0DA 3UKUC 2W18A 2QXVA 4JSXC 4D6VA 3I89A 2HYEA 3RN0D 2GNQA 4CY3A 5CYKB 4J86A 3RN1D 3VGZA 5C2WB 5HE2B 5EMMB 1JMZB 3KRXB 2H9LA 3OL2B 3OKWA 4GQBB 2CO0A 4OWRA 2I0RA 2PBIB 3SWSD 5HE1B 5FKTA 2H9MA 5CXBA 5HQGA 4A11A 4GGCA 3AL8B 5H14A 1MG3A 4QQEA 3IJ0A 4GMBA 3DSMA 5IT9g 4ES0A 4CI3A 3IKOA 3UVLA 2HESX 1JOFA 3OKYA 2XL3A 4FHLA 4JD2C 1R5MA 5EARA 2UZXB 4L9OA 4O45A 1SQ9A 1QNIA 2YNNA 3IJCA 2H14A 3I7PA 4J73A 3IJ1A 3I7HA 2AH0A 2G99A 5FA5B 3BWSA 2P9SC 4BH6A 4PXWA 4A08B 4GZ8A 1SQJA 4L3HD 1B9XA 4GGAA 2H9NA 2XL2A 2YNOA 4X3EA 5HE0B 5SXMA 4FA1D 2OK4A 2CO0C 5FLXg 3JZHA 4ERYA 4A0AA 1GXRA 4PNKB 1K32A 1B9YA 2YB8B 1JMXB 2H47A 2OK6A 3IIWA 4A0AB 2AGYA 2CE8A 2P9PC 4FB1D 4PBZA 1NEXB 3CFSB 5CXCB 4CZYA 5I5MA 2AGWA 4A0BB 3C99A 4LG8A 5GMKn 5H1MA 4JT5C 4XYIA 3V7DB 3PSLA 4Y7RA 4ERQA 3PXWD 2I3SA 3SJLD 4GM8A 1GP2B 4J8BA 3HFQA 3EG6A 3J80g 2I0TA 3JROA 4X61B 5IJ7E 4J84A 3JZGA 2CN3A 2QC5A 5TF2A 3RMZD 3DXMC 2CN2A 3U4YA 3PXSD 4BUJC 2H6QA 1N6EA 3CFVA 4ZOZA 4JSPC 2GC7A 2H68A 4L3GD 5TEFA 3GFCA 1RI6A 1XIPA 3B7FA 4EWRA 1PI6A 4A09B 2J56H 3RSEC 5JWZA 1TYQC 4FWWA 4E54B 3CIKB 4E5ZA 2H6NA 3I7LA 3DXKC 3E0CA 2PM6B 3P4FA 5GXHA 5GSAA 2AGLA 2H3XA 3SMRA 5KDOB 4MK0B 1U2VC 4ZOXA 2J55H 4PSWB 1NR0A 2HKRA 4CY2A 3MMYA 3EI3A 4J8GA 5FQDA 5EMKB 1YFQA 4CZVA 3C75H 4HDJA 3DWLC 5EAPA 3PVUB 1OLZA 1Q47A 3I7OA 4CZXA 4OZUA 2P9IC 2IWKA 2YNPA 3SBQA 4I79A 3NVQA 2HJBA 2IUVA 5CXBB 4N14A 4FAVD 4J0WA 4A11B 4PBYA 4O1QD 5IGOA 3JZNA 4J78A 3EI2A 4J81A 5C2VB 2YBAA 3F3GA 2O9KA 2PM9A 3MKSB 2HXCA 2UZYB 4ZN4A 3ZWLB 3SVWD 3EI1A 5A2Qg 3FM0A 3OKYB 5EAMA 3MZKA 5TDHB 1PEVA 3MZLA 1JJUB 4BL0A 2B5LA 2OJYA 5K1CC 3N0EA 3MKQA 3ORVD 2IAAA 3OKTA 3UKRC 5IGQA 1N6FA 1MDAH 3EMHA 1U4CA 3RRMC 2BBKH 3UVNA 4CY1A 2J57G 4JSVC 5EM2A 3J81g 2AH1A 4H5JA 4CY5A 4AEZA 4FA5D 4U7AA 3PE7A 3C9CA 1VYHC 4D0KA 3I7KA 2IUQA 5EM2B 3EU7A 3L4MD 5H17A 3UVKA 3SLED 2BCJB 4CI1A 4XEIC 4ESGA 4QT8A 1XHMA 3FGBA 4TZ4A 3OTTA 4QL1A 1SHYB 4QRJA 1OMWB 5FXYA 3GREA 2B5MA 2IWFA 3JPXA 1GOTB 2HJ4A 1FWXA 4XYHA 4X60B 5HE3B 5FKQA 4KFMB 2H13A 3F3PA 4Z8LA 5AMSA 2GC4A 4FAND 4L1QD 1P22A 2P9UC 3AH8B 3PVWB 2HKMA 4O9DA 1A0RB 2B5NA 3SCYA 2AGXA 2MTAH 4YVDA 4O3TB 4J87A 2AGZA 1N6DA 1S4UX 3JAMg 2XYIA 4LGNA 3RLMD 4E5ZB 4JSNC 4CI2A 2XU7A 5CYKA 3ODTA 4JT6C 4J79A 2OVQB 5GXIA 4IA9A 2P9NC 2OVRB 3EWEA 5IC7A 3EI3B 4IMMA 3I8EA 3PSCB 4GM9A 3OL2A 4GQ2P 1PGUA 3SFZA 2OVPB 2H6KA 3I7NA 3MXXA 5TEEA 3I2NA 3UVMA 4K3JB 4Y5RD 4U1EI 2EBSA 4LG9A 3SHFA 4JXMA 2P9KC 3AL8A 4GGDA 4GQ1A 3V9FA 3ULEC 5AFU3 3IIYA 1ERJA 3SN6B 2Z2OA 4A2MA 1K8KC 3EI2B 3F3FA 2I3TA 2PM9B 2Q7QA 2B4EA 3VA6A 3EI1B 4ZOYA 3A0FA 1GG2B 2IUPA 2PM7B 5IJ8E 1TBGA 4ZOVA 2H9PA 5EMJB 5FKRA 5EALA 3VH0A 4J82A 2IURA 2AQ5A 4FA4D 3W15A 4A08A 3JRPA 4NSXA 3V5WB 3BG1A 3BG0A 3UR4A 5K19A 5B4WA 1PBYB 3C5MA 3AFCA 4R7AB 1MG2A 4K3ID 5CXCA 3JB9L 5C9ZB 4A0BA 3NVNA 2OIZA 4FA9D 2YMUA 4J77A 5FKSA 3RFHA 3FRXA 4PSXB 4UI9R 1L0QA 3OW8A 5I5IA 4CC9A 4CI8A 4X63B 2CE9A 2I0SA 3UVOA 3SXTD 4ERZA 2G9AA 5HYNB 3AL9A 4A7JA 4A2LA 2TRCB 3SBRA 2P9LC 4J0XA 3EI4A 4GM3A 3K27A 2Z2NA 2Z2PA 4PC0A 5EMLB 4O3UB 3K26A 3RFGA 3L4OD 3NVXA 5AJAA 3PXTD 2CNXA 3EI4B 1XKSA 5THAA 4A09A 3KRWB 3DM0A 3SBPA 4E54A 5I5JA 3I8CA 4H5IA 4G56B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AOW A;  3N0D A;  3UKU C;  2W18 A;  2QXV A;  4JSX C;  4D6V A;  3I89 A;  2HYE A;  3RN0 D;  2GNQ A;  4CY3 A;  5CYK B;  4J86 A;  3RN1 D;  3VGZ A;  5C2W B;  5HE2 B;  5EMM B;  1JMZ B;  3KRX B;  2H9L A;  3OL2 B;  3OKW A;  4GQB B;  2CO0 A;  4OWR A;  2I0R A;  2PBI B;  3SWS D;  5HE1 B;  5FKT A;  2H9M A;  5CXB A;  5HQG A;  4A11 A;  4GGC A;  3AL8 B;  5H14 A;  1MG3 A;  4QQE A;  3IJ0 A;  4GMB A;  3DSM A;  5IT9 g;  4ES0 A;  4CI3 A;  3IKO A;  3UVL A;  2HES X;  1JOF A;  3OKY A;  2XL3 A;  4FHL A;  4JD2 C;  1R5M A;  5EAR A;  2UZX B;  4L9O A;  4O45 A;  1SQ9 A;  1QNI A;  2YNN A;  3IJC A;  2H14 A;  3I7P A;  4J73 A;  3IJ1 A;  3I7H A;  2AH0 A;  2G99 A;  5FA5 B;  3BWS A;  2P9S C;  4BH6 A;  4PXW A;  4A08 B;  4GZ8 A;  1SQJ A;  4L3H D;  1B9X A;  4GGA A;  2H9N A;  2XL2 A;  2YNO A;  4X3E A;  5HE0 B;  5SXM A;  4FA1 D;  2OK4 A;  2CO0 C;  5FLX g;  3JZH A;  4ERY A;  4A0A A;  1GXR A;  4PNK B;  1K32 A;  1B9Y A;  2YB8 B;  1JMX B;  2H47 A;  2OK6 A;  3IIW A;  4A0A B;  2AGY A;  2CE8 A;  2P9P C;  4FB1 D;  4PBZ A;  1NEX B;  3CFS B;  5CXC B;  4CZY A;  5I5M A;  2AGW A;  4A0B B;  3C99 A;  4LG8 A;  5GMK n;  5H1M A;  4JT5 C;  4XYI A;  3V7D B;  3PSL A;  4Y7R A;  4ERQ A;  3PXW D;  2I3S A;  3SJL D;  4GM8 A;  1GP2 B;  4J8B A;  3HFQ A;  3EG6 A;  3J80 g;  2I0T A;  3JRO A;  4X61 B;  5IJ7 E;  4J84 A;  3JZG A;  2CN3 A;  2QC5 A;  5TF2 A;  3RMZ D;  3DXM C;  2CN2 A;  3U4Y A;  3PXS D;  4BUJ C;  2H6Q A;  1N6E A;  3CFV A;  4ZOZ A;  4JSP C;  2GC7 A;  2H68 A;  4L3G D;  5TEF A;  3GFC A;  1RI6 A;  1XIP A;  3B7F A;  4EWR A;  1PI6 A;  4A09 B;  2J56 H;  3RSE C;  5JWZ A;  1TYQ C;  4FWW A;  4E54 B;  3CIK B;  4E5Z A;  2H6N A;  3I7L A;  3DXK C;  3E0C A;  2PM6 B;  3P4F A;  5GXH A;  5GSA A;  2AGL A;  2H3X A;  3SMR A;  5KDO B;  4MK0 B;  1U2V C;  4ZOX A;  2J55 H;  4PSW B;  1NR0 A;  2HKR A;  4CY2 A;  3MMY A;  3EI3 A;  4J8G A;  5FQD A;  5EMK B;  1YFQ A;  4CZV A;  3C75 H;  4HDJ A;  3DWL C;  5EAP A;  3PVU B;  1OLZ A;  1Q47 A;  3I7O A;  4CZX A;  4OZU A;  2P9I C;  2IWK A;  2YNP A;  3SBQ A;  4I79 A;  3NVQ A;  2HJB A;  2IUV A;  5CXB B;  4N14 A;  4FAV D;  4J0W A;  4A11 B;  4PBY A;  4O1Q D;  5IGO A;  3JZN A;  4J78 A;  3EI2 A;  4J81 A;  5C2V B;  2YBA A;  3F3G A;  2O9K A;  2PM9 A;  3MKS B;  2HXC A;  2UZY B;  4ZN4 A;  3ZWL B;  3SVW D;  3EI1 A;  5A2Q g;  3FM0 A;  3OKY B;  5EAM A;  3MZK A;  5TDH B;  1PEV A;  3MZL A;  1JJU B;  4BL0 A;  2B5L A;  2OJY A;  5K1C C;  3N0E A;  3MKQ A;  3ORV D;  2IAA A;  3OKT A;  3UKR C;  5IGQ A;  1N6F A;  1MDA H;  3EMH A;  1U4C A;  3RRM C;  2BBK H;  3UVN A;  4CY1 A;  2J57 G;  4JSV C;  5EM2 A;  3J81 g;  2AH1 A;  4H5J A;  4CY5 A;  4AEZ A;  4FA5 D;  4U7A A;  3PE7 A;  3C9C A;  1VYH C;  4D0K A;  3I7K A;  2IUQ A;  5EM2 B;  3EU7 A;  3L4M D;  5H17 A;  3UVK A;  3SLE D;  2BCJ B;  4CI1 A;  4XEI C;  4ESG A;  4QT8 A;  1XHM A;  3FGB A;  4TZ4 A;  3OTT A;  4QL1 A;  1SHY B;  4QRJ A;  1OMW B;  5FXY A;  3GRE A;  2B5M A;  2IWF A;  3JPX A;  1GOT B;  2HJ4 A;  1FWX A;  4XYH A;  4X60 B;  5HE3 B;  5FKQ A;  4KFM B;  2H13 A;  3F3P A;  4Z8L A;  5AMS A;  2GC4 A;  4FAN D;  4L1Q D;  1P22 A;  2P9U C;  3AH8 B;  3PVW B;  2HKM A;  4O9D A;  1A0R B;  2B5N A;  3SCY A;  2AGX A;  2MTA H;  4YVD A;  4O3T B;  4J87 A;  2AGZ A;  1N6D A;  1S4U X;  3JAM g;  2XYI A;  4LGN A;  3RLM D;  4E5Z B;  4JSN C;  4CI2 A;  2XU7 A;  5CYK A;  3ODT A;  4JT6 C;  4J79 A;  2OVQ B;  5GXI A;  4IA9 A;  2P9N C;  2OVR B;  3EWE A;  5IC7 A;  3EI3 B;  4IMM A;  3I8E A;  3PSC B;  4GM9 A;  3OL2 A;  4GQ2 P;  1PGU A;  3SFZ A;  2OVP B;  2H6K A;  3I7N A;  3MXX A;  5TEE A;  3I2N A;  3UVM A;  4K3J B;  4Y5R D;  4U1E I;  2EBS A;  4LG9 A;  3SHF A;  4JXM A;  2P9K C;  3AL8 A;  4GGD A;  4GQ1 A;  3V9F A;  3ULE C;  5AFU 3;  3IIY A;  1ERJ A;  3SN6 B;  2Z2O A;  4A2M A;  1K8K C;  3EI2 B;  3F3F A;  2I3T A;  2PM9 B;  2Q7Q A;  2B4E A;  3VA6 A;  3EI1 B;  4ZOY A;  3A0F A;  1GG2 B;  2IUP A;  2PM7 B;  5IJ8 E;  1TBG A;  4ZOV A;  2H9P A;  5EMJ B;  5FKR A;  5EAL A;  3VH0 A;  4J82 A;  2IUR A;  2AQ5 A;  4FA4 D;  3W15 A;  4A08 A;  3JRP A;  4NSX A;  3V5W B;  3BG1 A;  3BG0 A;  3UR4 A;  5K19 A;  5B4W A;  1PBY B;  3C5M A;  3AFC A;  4R7A B;  1MG2 A;  4K3I D;  5CXC A;  3JB9 L;  5C9Z B;  4A0B A;  3NVN A;  2OIZ A;  4FA9 D;  2YMU A;  4J77 A;  5FKS A;  3RFH A;  3FRX A;  4PSX B;  4UI9 R;  1L0Q A;  3OW8 A;  5I5I A;  4CC9 A;  4CI8 A;  4X63 B;  2CE9 A;  2I0S A;  3UVO A;  3SXT D;  4ERZ A;  2G9A A;  5HYN B;  3AL9 A;  4A7J A;  4A2L A;  2TRC B;  3SBR A;  2P9L C;  4J0X A;  3EI4 A;  4GM3 A;  3K27 A;  2Z2N A;  2Z2P A;  4PC0 A;  5EML B;  4O3U B;  3K26 A;  3RFG A;  3L4O D;  3NVX A;  5AJA A;  3PXT D;  2CNX A;  3EI4 B;  1XKS A;  5THA A;  4A09 A;  3KRW B;  3DM0 A;  3SBP A;  4E54 A;  5I5J A;  3I8C A;  4H5I A;  4G56 B; 
#chains in the Genus database with same CATH topology
 1H2Z A;  4AOW A;  3N0D A;  3UKU C;  2W18 A;  2QXV A;  2VDO A;  4JSX C;  4D6V A;  3I89 A;  1T2X A;  4AMY A;  2HYE A;  3RN0 D;  2GNQ A;  1C9L A;  4CY3 A;  5CYK B;  4BCB A;  4J86 A;  3NIF A;  1GOH A;  3RN1 D;  3ZE0 A;  4WK4 A;  5C92 A;  3VGZ A;  5C2W B;  4O02 A;  1H2X A;  5HE2 B;  4Z7O A;  5EMM B;  1JMZ B;  3KRX B;  2VDQ A;  2H9L A;  3OL2 B;  3OKW A;  4GQB B;  2CO0 A;  2JKX A;  4OWR A;  2I0R A;  2PBI B;  1BPO A;  3SWS D;  5HE1 B;  5FKT A;  2H9M A;  5CXB A;  3ZE2 A;  1VE6 A;  5HQG A;  4WJK A;  4A11 A;  4GGC A;  3AL8 B;  5H14 A;  1MG3 A;  3O4I A;  4QQE A;  5M61 A;  3EQ9 A;  3IJ0 A;  4GMB A;  3DSM A;  5IT9 g;  4ES0 A;  4CI3 A;  3IKO A;  3UVL A;  2HES X;  1JOF A;  3OKY A;  1I2M B;  2XL3 A;  4FHL A;  1R5M A;  4JD2 C;  5M5T A;  5EAR A;  1UTC A;  2UZX B;  4L9O A;  2EIE A;  4O45 A;  1SQ9 A;  1QNI A;  4G1E A;  2YNN A;  3IJC A;  2H14 A;  3I7P A;  4J73 A;  4JHP C;  3OF7 A;  3IJ1 A;  3I7H A;  3IUN A;  2AH0 A;  2G99 A;  5FA5 B;  3BWS A;  2P9S C;  4L1M A;  4IRZ A;  2HU7 A;  4BH6 A;  4PXW A;  3KCI A;  3MVD K;  1M1X A;  4A08 B;  4GZ8 A;  3ZDY A;  1SQJ A;  1B9X A;  4GGA A;  4L3H D;  2H9N A;  2XL2 A;  2YNO A;  4X3E A;  3O4G A;  5HE0 B;  5SXM A;  4FA1 D;  5M5R A;  2OK4 A;  2CO0 C;  5FLX g;  3JZH A;  4ERY A;  4A0A A;  1GXR A;  1YR2 A;  4PNK B;  1K32 A;  4UM9 A;  1B9Y A;  3EQ7 A;  2YB8 B;  1JMX B;  4UM8 A;  2H47 A;  2OK6 A;  3IIW A;  4A0A B;  4NBM A;  2AGY A;  5FFO A;  2CE8 A;  2P9P C;  4FB1 D;  4PBZ A;  1NEX B;  3CFS B;  5CXC B;  4CZY A;  5I5M A;  2AGW A;  4A0B B;  3C99 A;  4LG8 A;  2VDR A;  5GMK n;  5H1M A;  1GOF A;  4JT5 C;  4MMY A;  4XYI A;  3V7D B;  4NEN A;  3PSL A;  4Y7R A;  4DNW A;  4ERQ A;  3PXW D;  2I3S A;  3SJL D;  4GM8 A;  1GP2 B;  4J8B A;  3IUM A;  3HFQ A;  3EG6 A;  3J80 g;  3ZE1 A;  2I0T A;  3JRO A;  4X61 B;  5IJ7 E;  3K6S A;  4J84 A;  3JZG A;  2CN3 A;  2QC5 A;  1A12 A;  5TF2 A;  3RMZ D;  3DXM C;  2CN2 A;  3U4Y A;  3PXS D;  4MMZ A;  4BUJ C;  2H6Q A;  1N6E A;  3CFV A;  1VZ2 A;  4ZOZ A;  4JSP C;  2GC7 A;  2H68 A;  4L3G D;  5TEF A;  3GFC A;  1RI6 A;  3K72 A;  4RE6 A;  2VDM A;  1XIP A;  3B7F A;  3T3P A;  2VDK A;  4EWR A;  1PI6 A;  4A09 B;  2J56 H;  1O6G A;  3RSE C;  5JWZ A;  1TYQ C;  4FWW A;  4E54 B;  1QFS A;  3FCU A;  3CIK B;  5E6R A;  2H6N A;  4E5Z A;  3I7L A;  5M5V A;  1UOQ A;  3DXK C;  3E0C A;  2PM6 B;  3P4F A;  3FCS A;  5GXH A;  1K3I A;  2AGL A;  2H3X A;  3SMR A;  5GSA A;  3V4V A;  5KDO B;  4MK0 B;  1U2V C;  4D9S A;  4ZOX A;  2J55 H;  4PSW B;  4BCC A;  1NR0 A;  2HKR A;  4CY2 A;  3MMY A;  3IUJ A;  3EI3 A;  3O4H A;  4J8G A;  5E6U A;  5FQD A;  5EMK B;  1YFQ A;  3DDU A;  4CZV A;  3C75 H;  4HDJ A;  3DWL C;  2VDL A;  5EAP A;  1GOG A;  3PVU B;  2EIC A;  1OLZ A;  1Q47 A;  4BP9 A;  3I7O A;  4CZX A;  3V4P A;  2HU5 A;  2XE4 A;  4OZU A;  4QAM A;  3K71 A;  2P9I C;  2IWK A;  2YNP A;  2XZG A;  3SBQ A;  4I79 A;  3NVQ A;  2HJB A;  2IUV A;  5CXB B;  4N14 A;  4FAV D;  4J0W A;  4A11 B;  4PBY A;  3T3M A;  4O1Q D;  5IGO A;  3JZN A;  4J78 A;  3EI2 A;  4J81 A;  5C2V B;  2YBA A;  3F3G A;  2O9K A;  2PM9 A;  3MKS B;  2HXC A;  2UZY B;  4ZN4 A;  3QHY B;  3ZWL B;  3SVW D;  3EI1 A;  4AN0 A;  3GC3 B;  5A2Q g;  3FM0 A;  3OKY B;  1E8N A;  5EAM A;  3MZK A;  5TDH B;  1PEV A;  3MZL A;  1JJU B;  4Z7N A;  3MUO A;  4BL0 A;  2B5L A;  2OJY A;  5K1C C;  3N0E A;  3MKQ A;  3ORV D;  2IAA A;  1VE7 A;  3OKT A;  3UKR C;  5IGQ A;  1N6F A;  1MDA H;  3EMH A;  1U4C A;  5E6S A;  3RRM C;  2BBK H;  3UVN A;  4CY1 A;  5HDB A;  4BP8 A;  2J57 G;  4JSV C;  4AX4 A;  1E5T A;  5EM2 A;  3J81 g;  2AH1 A;  4H5J A;  4CY5 A;  4AEZ A;  4DNV A;  4FA5 D;  4U7A A;  3PE7 A;  3C9C A;  1H2W A;  1VYH C;  4D0K A;  4DNU A;  1L5G A;  2EIB A;  3I7K A;  2IUQ A;  2QZP A;  5EM2 B;  3EU7 A;  5FFG A;  3L4M D;  5H17 A;  3UVK A;  1H2Y A;  3SLE D;  2BCJ B;  4CI1 A;  3O4J A;  4XEI C;  4O2W A;  4ESG A;  1U8C A;  4QT8 A;  1XHM A;  3FGB A;  4TZ4 A;  3OTT A;  4QL1 A;  1SHY B;  4QRJ A;  3VI4 A;  1OMW B;  5FXY A;  3GRE A;  5M5S A;  2B5M A;  2IWF A;  4AMZ A;  3JPX A;  1GOT B;  2HJ4 A;  1FWX A;  4XYH A;  4X60 B;  5HE3 B;  4NC4 A;  5FKQ A;  4KFM B;  2H13 A;  3F3P A;  4Z8L A;  5AMS A;  2GC4 A;  4FAN D;  1UOP A;  4L1Q D;  1P22 A;  2P9U C;  2HU8 A;  3AH8 B;  3PVW B;  2HKM A;  4O9D A;  1A0R B;  2B5N A;  3SCY A;  2AGX A;  1UOO A;  3ZDX A;  2MTA H;  4YVD A;  4O3T B;  4J87 A;  2AGZ A;  3IJE A;  3NID A;  1N6D A;  1S4U X;  2QR5 A;  3JAM g;  2XYI A;  4LGN A;  3RLM D;  3NIG A;  4E5Z B;  4JSN C;  4CI2 A;  4AN1 A;  2XU7 A;  3IUQ A;  5CYK A;  3ODT A;  4JT6 C;  4J79 A;  2OVQ B;  3QI0 A;  5GXI A;  4IA9 A;  2P9N C;  2OVR B;  3EWE A;  5IC7 A;  3EI3 B;  4IMM A;  3I8E A;  3PSC B;  4GM9 A;  3OL2 A;  4GQ2 P;  1PGU A;  3SFZ A;  3ZDZ A;  2OVP B;  2H6K A;  4NAA A;  3I7N A;  3MXX A;  5TEE A;  3I2N A;  3UVM A;  4K3J B;  4Y5R D;  4U1E I;  2EBS A;  4LG9 A;  3SHF A;  4JXM A;  2P9K C;  3AL8 A;  4GGD A;  4GQ1 A;  3V9F A;  3ULE C;  5AFU 3;  5M5U A;  2VC2 A;  1O6F A;  2VZ3 A;  3IIY A;  1ERJ A;  3SN6 B;  2Z2O A;  4A2M A;  1K8K C;  3EI2 B;  3F3F A;  3VI3 A;  2I3T A;  2PM9 B;  2Q7Q A;  2B4E A;  3VA6 A;  3EI1 B;  4ZOY A;  3A0F A;  4Z7Q A;  1GG2 B;  2IUP A;  2PM7 B;  3IUL A;  5IJ8 E;  4JHN A;  1TBG A;  4ZOV A;  2H9P A;  5EMJ B;  5FKR A;  4G55 A;  5EAL A;  3VH0 A;  4J82 A;  2IUR A;  2AQ5 A;  4FA4 D;  2XDW A;  3W15 A;  4A08 A;  3JRP A;  4NSX A;  3V5W B;  3BG1 A;  3BG0 A;  5C86 A;  3UR4 A;  1QFM A;  5K19 A;  5B4W A;  2WQ8 A;  1PBY B;  1JV2 A;  3GD1 I;  3C5M A;  1TYE A;  4MMX A;  3AFC A;  1E8M A;  4R7A B;  1MG2 A;  4K3I D;  5CXC A;  3JB9 L;  5C9Z B;  4A0B A;  3NVN A;  2BKL A;  2OIZ A;  4FA9 D;  2YMU A;  4J77 A;  5FKS A;  3RFH A;  3FRX A;  4PSX B;  4UI9 R;  1L0Q A;  3OW8 A;  2VDP A;  5I5I A;  4CC9 A;  4CI8 A;  2VDN A;  3MUN A;  4WK0 A;  4X63 B;  2CE9 A;  2I0S A;  1C9I A;  3UVO A;  3SXT D;  4ERZ A;  2G9A A;  5HYN B;  3AL9 A;  4A7J A;  4A2L A;  2TRC B;  3SBR A;  4G1M A;  3IUR A;  2EID A;  2P9L C;  4J0X A;  3EI4 A;  4GM3 A;  3K27 A;  2Z2N A;  4WK2 A;  2Z2P A;  4PC0 A;  3EQ8 A;  5EML B;  4O3U B;  3K26 A;  3RFG A;  3L4O D;  3NVX A;  5AJA A;  3PXT D;  2CNX A;  3EI4 B;  1XKS A;  5THA A;  4A09 A;  3IVM A;  3KRW B;  1JTD B;  3DM0 A;  4RE5 A;  1VZ3 A;  2VZ1 A;  3SBP A;  4E54 A;  5I5J A;  3I8C A;  4H5I A;  4BCD A;  4G56 B; 
#chains in the Genus database with same CATH homology
 4AOW A;  3N0D A;  3UKU C;  2W18 A;  2QXV A;  4JSX C;  4D6V A;  3I89 A;  2HYE A;  3RN0 D;  2GNQ A;  4CY3 A;  5CYK B;  4J86 A;  3RN1 D;  3VGZ A;  5C2W B;  5HE2 B;  5EMM B;  1JMZ B;  3KRX B;  2H9L A;  3OL2 B;  3OKW A;  4GQB B;  2CO0 A;  4OWR A;  2I0R A;  2PBI B;  3SWS D;  5HE1 B;  5FKT A;  2H9M A;  5CXB A;  5HQG A;  4A11 A;  4GGC A;  3AL8 B;  5H14 A;  1MG3 A;  4QQE A;  3IJ0 A;  4GMB A;  3DSM A;  5IT9 g;  4ES0 A;  4CI3 A;  3IKO A;  3UVL A;  2HES X;  1JOF A;  3OKY A;  2XL3 A;  4FHL A;  4JD2 C;  1R5M A;  5EAR A;  2UZX B;  4L9O A;  4O45 A;  1SQ9 A;  1QNI A;  2YNN A;  3IJC A;  2H14 A;  3I7P A;  4J73 A;  3IJ1 A;  3I7H A;  2AH0 A;  2G99 A;  5FA5 B;  3BWS A;  2P9S C;  4BH6 A;  4PXW A;  4A08 B;  4GZ8 A;  1SQJ A;  4L3H D;  1B9X A;  4GGA A;  2H9N A;  2XL2 A;  2YNO A;  4X3E A;  5HE0 B;  5SXM A;  4FA1 D;  2OK4 A;  2CO0 C;  5FLX g;  3JZH A;  4ERY A;  4A0A A;  1GXR A;  4PNK B;  1K32 A;  1B9Y A;  2YB8 B;  1JMX B;  2H47 A;  2OK6 A;  3IIW A;  4A0A B;  2AGY A;  2CE8 A;  2P9P C;  4FB1 D;  4PBZ A;  1NEX B;  3CFS B;  5CXC B;  4CZY A;  5I5M A;  2AGW A;  4A0B B;  3C99 A;  4LG8 A;  5GMK n;  5H1M A;  4JT5 C;  4XYI A;  3V7D B;  3PSL A;  4Y7R A;  4ERQ A;  3PXW D;  2I3S A;  3SJL D;  4GM8 A;  1GP2 B;  4J8B A;  3HFQ A;  3EG6 A;  3J80 g;  2I0T A;  3JRO A;  4X61 B;  5IJ7 E;  4J84 A;  3JZG A;  2CN3 A;  2QC5 A;  5TF2 A;  3RMZ D;  3DXM C;  2CN2 A;  3U4Y A;  3PXS D;  4BUJ C;  2H6Q A;  1N6E A;  3CFV A;  4ZOZ A;  4JSP C;  2GC7 A;  2H68 A;  4L3G D;  5TEF A;  3GFC A;  1RI6 A;  1XIP A;  3B7F A;  4EWR A;  1PI6 A;  4A09 B;  2J56 H;  3RSE C;  5JWZ A;  1TYQ C;  4FWW A;  4E54 B;  3CIK B;  4E5Z A;  2H6N A;  3I7L A;  3DXK C;  3E0C A;  2PM6 B;  3P4F A;  5GXH A;  5GSA A;  2AGL A;  2H3X A;  3SMR A;  5KDO B;  4MK0 B;  1U2V C;  4ZOX A;  2J55 H;  4PSW B;  1NR0 A;  2HKR A;  4CY2 A;  3MMY A;  3EI3 A;  4J8G A;  5FQD A;  5EMK B;  1YFQ A;  4CZV A;  3C75 H;  4HDJ A;  3DWL C;  5EAP A;  3PVU B;  1OLZ A;  1Q47 A;  3I7O A;  4CZX A;  4OZU A;  2P9I C;  2IWK A;  2YNP A;  3SBQ A;  4I79 A;  3NVQ A;  2HJB A;  2IUV A;  5CXB B;  4N14 A;  4FAV D;  4J0W A;  4A11 B;  4PBY A;  4O1Q D;  5IGO A;  3JZN A;  4J78 A;  3EI2 A;  4J81 A;  5C2V B;  2YBA A;  3F3G A;  2O9K A;  2PM9 A;  3MKS B;  2HXC A;  2UZY B;  4ZN4 A;  3ZWL B;  3SVW D;  3EI1 A;  5A2Q g;  3FM0 A;  3OKY B;  5EAM A;  3MZK A;  5TDH B;  1PEV A;  3MZL A;  1JJU B;  4BL0 A;  2B5L A;  2OJY A;  5K1C C;  3N0E A;  3MKQ A;  3ORV D;  2IAA A;  3OKT A;  3UKR C;  5IGQ A;  1N6F A;  1MDA H;  3EMH A;  1U4C A;  3RRM C;  2BBK H;  3UVN A;  4CY1 A;  2J57 G;  4JSV C;  5EM2 A;  3J81 g;  2AH1 A;  4H5J A;  4CY5 A;  4AEZ A;  4FA5 D;  4U7A A;  3PE7 A;  3C9C A;  1VYH C;  4D0K A;  3I7K A;  2IUQ A;  5EM2 B;  3EU7 A;  3L4M D;  5H17 A;  3UVK A;  3SLE D;  2BCJ B;  4CI1 A;  4XEI C;  4ESG A;  4QT8 A;  1XHM A;  3FGB A;  4TZ4 A;  3OTT A;  4QL1 A;  1SHY B;  4QRJ A;  1OMW B;  5FXY A;  3GRE A;  2B5M A;  2IWF A;  3JPX A;  1GOT B;  2HJ4 A;  1FWX A;  4XYH A;  4X60 B;  5HE3 B;  5FKQ A;  4KFM B;  2H13 A;  3F3P A;  4Z8L A;  5AMS A;  2GC4 A;  4FAN D;  4L1Q D;  1P22 A;  2P9U C;  3AH8 B;  3PVW B;  2HKM A;  4O9D A;  1A0R B;  2B5N A;  3SCY A;  2AGX A;  2MTA H;  4YVD A;  4O3T B;  4J87 A;  2AGZ A;  1N6D A;  1S4U X;  3JAM g;  2XYI A;  4LGN A;  3RLM D;  4E5Z B;  4JSN C;  4CI2 A;  2XU7 A;  5CYK A;  3ODT A;  4JT6 C;  4J79 A;  2OVQ B;  5GXI A;  4IA9 A;  2P9N C;  2OVR B;  3EWE A;  5IC7 A;  3EI3 B;  4IMM A;  3I8E A;  3PSC B;  4GM9 A;  3OL2 A;  4GQ2 P;  1PGU A;  3SFZ A;  2OVP B;  2H6K A;  3I7N A;  3MXX A;  5TEE A;  3I2N A;  3UVM A;  4K3J B;  4Y5R D;  4U1E I;  2EBS A;  4LG9 A;  3SHF A;  4JXM A;  2P9K C;  3AL8 A;  4GGD A;  4GQ1 A;  3V9F A;  3ULE C;  5AFU 3;  3IIY A;  1ERJ A;  3SN6 B;  2Z2O A;  4A2M A;  1K8K C;  3EI2 B;  3F3F A;  2I3T A;  2PM9 B;  2Q7Q A;  2B4E A;  3VA6 A;  3EI1 B;  4ZOY A;  3A0F A;  1GG2 B;  2IUP A;  2PM7 B;  5IJ8 E;  1TBG A;  4ZOV A;  2H9P A;  5EMJ B;  5FKR A;  5EAL A;  3VH0 A;  4J82 A;  2IUR A;  2AQ5 A;  4FA4 D;  3W15 A;  4A08 A;  3JRP A;  4NSX A;  3V5W B;  3BG1 A;  3BG0 A;  3UR4 A;  5K19 A;  5B4W A;  1PBY B;  3C5M A;  3AFC A;  4R7A B;  1MG2 A;  4K3I D;  5CXC A;  3JB9 L;  5C9Z B;  4A0B A;  3NVN A;  2OIZ A;  4FA9 D;  2YMU A;  4J77 A;  5FKS A;  3RFH A;  3FRX A;  4PSX B;  4UI9 R;  1L0Q A;  3OW8 A;  5I5I A;  4CC9 A;  4CI8 A;  4X63 B;  2CE9 A;  2I0S A;  3UVO A;  3SXT D;  4ERZ A;  2G9A A;  5HYN B;  3AL9 A;  4A7J A;  4A2L A;  2TRC B;  3SBR A;  2P9L C;  4J0X A;  3EI4 A;  4GM3 A;  3K27 A;  2Z2N A;  2Z2P A;  4PC0 A;  5EML B;  4O3U B;  3K26 A;  3RFG A;  3L4O D;  3NVX A;  5AJA A;  3PXT D;  2CNX A;  3EI4 B;  1XKS A;  5THA A;  4A09 A;  3KRW B;  3DM0 A;  3SBP A;  4E54 A;  5I5J A;  3I8C A;  4H5I A;  4G56 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...