2G99A

Structural basis for the specific recognition of methylated histone h3 lysine 4 by the wd-40 protein wdr5
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
304
structure length
304
Chain Sequence
PVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD-repeat protein 5
publication title Structural basis for the specific recognition of methylated histone H3 lysine 4 by the WD-40 protein WDR5
rcsb
source organism Homo sapiens
molecule tags Structural protein/dna binding protein
total genus 94
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2g99A00
4A0BA 4GMBA 3EU7A 3UVKA 3AH8B 2PM9A 2P9IC 4O3TB 3N0DA 1NR0A 2H13A 5IC7A 4UI9R 4A11A 3JZNA 4PC0A 3BG0A 3SBQA 5FA5B 3I7NA 4X63B 3JROA 5IJ8E 4Y5RD 5C2WB 2B5NA 3MKSB 3OL2B 5FKQA 4ESGA 3I8EA 4PBYA 5GMKn 3SWSD 5TEFA 2AGZA 4CI1A 2H9NA 4Y7RA 4PSWB 3UKRC 3C75H 1N6DA 3PXTD 4L3GD 4CZXA 3EI4B 3SXTD 5THAA 3OTTA 2AGYA 2IUQA 4ES0A 5CXCA 1MG3A 3EMHA 1TBGA 1VYHC 2P9KC 4GGCA 5FKSA 4FA4D 2CO0C 2Z2PA 3OKYA 2YNNA 3J81g 2YNPA 4GQ2P 3SMRA 4A0AA 3V9FA 2I0RA 2H9LA 3B7FA 5AMSA 2H68A 4A09A 2PM6B 4X60B 3ULEC 1OLZA 3SBPA 3PXSD 4Z8LA 4PSXB 3JZGA 2I0TA 1OMWB 5IGQA 1U4CA 1A0RB 1JMZB 5HYNB 3AL8A 3ZWLB 2I3SA 2HJ4A 2IAAA 5FQDA 2J56H 4CC9A 2P9SC 3J80g 4D6VA 3JZHA 2H47A 4J8GA 4YVDA 5CXBB 3N0EA 4FWWA 2J57G 3L4MD 5A2Qg 5I5IA 4A08A 3EI3A 4E5ZB 5EARA 3I8CA 3C99A 2HKMA 4MK0B 3IIYA 4H5IA 4U1EI 5CYKA 2CNXA 3C5MA 2YMUA 1L0QA 4GM9A 3SCYA 3RFHA 2XU7A 4IMMA 3JB9L 5EM2A 4XYIA 3SN6B 4J86A 2AQ5A 1YFQA 5SXMA 4BUJC 2P9UC 4FHLA 4CY5A 3SVWD 2P9LC 3PVWB 3RRMC 5FLXg 2BCJB 5EAPA 2TRCB 2O9KA 4FA9D 5K19A 4X61B 3IIWA 2H9PA 5C9ZB 4J81A 3VGZA 5K1CC 4IA9A 2OVQB 2Z2NA 4ERQA 2HJBA 2OVRB 2HKRA 3EG6A 2XYIA 2CE8A 2IUVA 2XL3A 2OK4A 4OZUA 4ZOXA 2BBKH 2B5LA 1Q47A 5GSAA 4JSNC 1K32A 4ERZA 2OVPB 3MKQA 3OKTA 4BH6A 1RI6A 4L3HD 5IJ7E 4A0BB 3PSLA 3FRXA 3C9CA 5EMKB 4J78A 1B9XA 2YBAA 3L4OD 2GNQA 3VA6A 5HE1B 4FAVD 1N6EA 1P22A 3V7DB 2OJYA 3CFVA 4A11B 3I7PA 2AGLA 4I79A 1TYQC 4JSVC 3DSMA 1PBYB 3RLMD 3SHFA 3EI2B 5GXHA 1ERJA 3DWLC 5EMJB 2IWKA 2B4EA 2HYEA 3MZKA 4QRJA 4PBZA 2QC5A 3VH0A 1GOTB 5EMLB 3EI1B 4JSPC 4U7AA 5GXIA 2PBIB 3ODTA 2EBSA 4O45A 3UVNA 1U2VC 4GGDA 3P4FA 2Z2OA 3F3GA 4O9DA 4GZ8A 1JOFA 1GXRA 3IJ0A 2J55H 4J77A 1XKSA 4E54B 4GM3A 3SBRA 5CXBA 4JT5C 3A0FA 4AOWA 1S4UX 4ERYA 3MXXA 2YNOA 4CZVA 5HE0B 4ZN4A 4R7AB 4A09B 3FM0A 4QT8A 1R5MA 3DXMC 3NVNA 3UVMA 3RSEC 2GC7A 3EWEA 4ZOVA 2CN3A 3UVOA 4JT6C 4FA1D 1JJUB 1GG2B 1FWXA 4K3JB 3AL8B 4QQEA 4PNKB 5B4WA 5TEEA 5EMMB 1JMXB 4TZ4A 4PXWA 3GREA 5H1MA 4L9OA 3UR4A 3DXKC 3ORVD 1QNIA 4J0WA 2IUPA 4OWRA 4EWRA 4JXMA 2H3XA 3OKWA 1SQJA 5IT9g 2HESX 5EAMA 4A2MA 2CO0A 2H9MA 3OL2A 1K8KC 4LG9A 5C2VB 3CIKB 5FXYA 1PGUA 3SLED 3RFGA 3AFCA 3JPXA 5H14A 3W15A 4K3ID 4CY3A 3GFCA 3EI4A 2I0SA 5EM2B 3BWSA 1NEXB 1XHMA 5AFU3 5TF2A 4N14A 5HE2B 4LGNA 4BL0A 2YB8B 4H5JA 5IGOA 4J8BA 2PM9B 2P9PC 1XIPA 4JSXC 5EALA 3EI2A 2H6KA 3V5WB 3JAMg 3OW8A 5FKTA 3IKOA 4XYHA 3PSCB 2CE9A 3RN1D 3SJLD 4FB1D 2IURA 2OK6A 4A7JA 4GGAA 5TDHB 3MZLA 3EI1A 2H6NA 3IJCA 4A2LA 3NVQA 5H17A 1SHYB 3F3PA 5KDOB 4G56B 1MDAH 2AGWA 5JWZA 3E0CA 4E54A 4GM8A 4FAND 4JD2C 3KRWB 2HXCA 4NSXA 3I2NA 2IWFA 4ZOYA 3MMYA 1GP2B 4O1QD 4CI8A 1PI6A 2UZYB 2AH1A 3K26A 4GQBB 2UZXB 2B5MA 3I7HA 3PVUB 4GQ1A 3DM0A 4J0XA 5CXCB 2GC4A 4FA5D 5FKRA 4CY1A 5I5MA 3OKYB 3NVXA 2I3TA 2OIZA 5AJAA 2CN2A 4HDJA 2PM7B 2MTAH 4E5ZA 5HE3B 3FGBA 4A0AB 2Q7QA 3RN0D 1MG2A 4LG8A 4AEZA 5I5JA 4J84A 2XL2A 4J82A 3SFZA 2AGXA 3AL9A 4KFMB 3UVLA 4X3EA 3U4YA 4CZYA 3I7KA 4J79A 4J87A 3F3FA 4L1QD 2G9AA 3I7OA 1SQ9A 4XEIC 3IJ1A 3I89A 3HFQA 3PXWD 4CI3A 2H14A 3KRXB 2QXVA 4ZOZA 3JRPA 2W18A 3K27A 4CY2A 3UKUC 4J73A 4D0KA 4A08B 4CI2A 3EI3B 4O3UB 1PEVA 3CFSB 4QL1A 3PE7A 2AH0A 3RMZD 5CYKB 1N6FA 2P9NC 3I7LA 5HQGA 3BG1A 2G99A 2H6QA 1B9YA
chains in the Genus database with same CATH superfamily
4A0BA 4GMBA 3EU7A 3UVKA 3AH8B 2PM9A 2P9IC 4O3TB 3N0DA 1NR0A 2H13A 5IC7A 4UI9R 4A11A 3JZNA 2XDWA 4PC0A 3GD1I 3BG0A 3SBQA 5FA5B 3I7NA 4X63B 3JROA 5IJ8E 3IJEA 4DNVA 4Y5RD 5C2WB 2B5NA 3MKSB 3OL2B 5FKQA 4ESGA 3I8EA 4PBYA 5GMKn 3SWSD 3K71A 5TEFA 2AGZA 2JKXA 4CI1A 2H9NA 4Y7RA 4PSWB 3IUJA 3UKRC 3C75H 1O6FA 1N6DA 3PXTD 4L3GD 4UM9A 4CZXA 3EI4B 3SXTD 5THAA 5E6RA 3OTTA 2AGYA 4RE6A 3ZDYA 2IUQA 4ES0A 5CXCA 1MG3A 3EMHA 1TBGA 1VYHC 3MVDK 2P9KC 1T2XA 4GGCA 5FKSA 4FA4D 2CO0C 2Z2PA 3EQ7A 3OKYA 5M61A 2YNNA 3J81g 3NIGA 2YNPA 4GQ2P 3SMRA 4A0AA 3V9FA 4JHPC 2EIEA 2H9LA 2I0RA 2VZ3A 3B7FA 5AMSA 1I2MB 2H68A 4A09A 2PM6B 4X60B 3ULEC 1OLZA 3SBPA 3PXSD 4Z8LA 4MMZA 4PSXB 3JZGA 2I0TA 1OMWB 5IGQA 1U4CA 1A0RB 3IUNA 3ZE0A 1JMZB 5HYNB 3AL8A 3ZWLB 4QAMA 2I3SA 2HJ4A 2IAAA 4O02A 5FQDA 1QFSA 2J56H 3O4GA 4CC9A 4Z7NA 2P9SC 3J80g 4IRZA 4BCBA 4D6VA 3JZHA 5M5SA 3T3MA 2H47A 4J8GA 3VI3A 4YVDA 3IUMA 5CXBB 3N0EA 3EQ8A 4FWWA 2J57G 3L4MD 5A2Qg 5I5IA 2VDLA 4A08A 3EI3A 4E5ZB 1L5GA 1QFMA 2EICA 5EARA 3I8CA 3C99A 2HKMA 4MK0B 3IIYA 4H5IA 4U1EI 2XE4A 5CYKA 2CNXA 3K72A 3C5MA 1E8MA 2YMUA 1L0QA 4GM9A 1VE6A 3SCYA 3IURA 3V4PA 3RFHA 1H2YA 2XU7A 4IMMA 4D9SA 5M5VA 3JB9L 1VZ2A 3KCIA 5EM2A 2WQ8A 4XYIA 3SN6B 4J86A 2AQ5A 4AMYA 1YFQA 5SXMA 4BUJC 2P9UC 4FHLA 4CY5A 2BKLA 3SVWD 2P9LC 3PVWB 3RRMC 5FLXg 2BCJB 5EAPA 3ZE1A 1UOPA 2VDPA 2TRCB 2O9KA 4FA9D 5K19A 4X61B 3IIWA 1VE7A 2H9PA 5C9ZB 4J81A 3VGZA 5K1CC 4IA9A 2OVQB 2Z2NA 4ERQA 2HJBA 4L1MA 2OVRB 2HKRA 2VDQA 3EG6A 1GOFA 2QZPA 2CE8A 2IUVA 2XL3A 2OK4A 2XYIA 4OZUA 4ZOXA 2BBKH 3ZE2A 2B5LA 1Q47A 5GSAA 4JSNC 1K32A 4ERZA 2OVPB 3MKQA 3OKTA 4BH6A 1RI6A 4L3HD 5IJ7E 3O4IA 3O4JA 3PSLA 4MMYA 3FRXA 4A0BB 3C9CA 5EMKB 4J78A 1B9XA 2YBAA 3L4OD 5E6UA 2GNQA 4NENA 3VA6A 1E5TA 5HE1B 4FAVD 1N6EA 4DNWA 1P22A 3V7DB 2OJYA 3CFVA 4DNUA 4A11B 3I7PA 2AGLA 4I79A 1TYQC 4JSVC 4AN1A 3DSMA 3FCSA 1PBYB 1K3IA 3IUQA 3RLMD 3SHFA 3EI2B 5GXHA 1UTCA 1ERJA 4WK0A 3DWLC 4BCCA 5EMJB 2IWKA 2B4EA 2HYEA 2QR5A 3MZKA 4QRJA 4PBZA 2QC5A 1GOHA 3DDUA 3VH0A 1GOTB 5EMLB 4Z7OA 3EI1B 4JSPC 1BPOA 4WK2A 4U7AA 5GXIA 2PBIB 3ODTA 2EBSA 4O45A 3UVNA 1U2VC 4GGDA 3P4FA 2Z2OA 3F3GA 4O9DA 3O4HA 3EQ9A 1C9IA 4GZ8A 2VDOA 1JOFA 1GXRA 2J55H 3IJ0A 4J77A 3ZDZA 1XKSA 4BCDA 4E54B 4GM3A 4WJKA 3SBRA 5CXBA 4JT5C 1U8CA 5FFGA 3A0FA 5C86A 4AOWA 4UM8A 5M5RA 1S4UX 4G55A 4ERYA 3MXXA 3NIDA 2YNOA 4CZVA 3QI0A 5HE0B 5M5UA 4ZN4A 4R7AB 4A09B 3FM0A 4QT8A 1R5MA 3DXMC 3NVNA 3UVMA 3RSEC 2GC7A 3EWEA 4NC4A 4ZOVA 2CN3A 3QHYB 3UVOA 1UOQA 2HU5A 4JT6C 4FA1D 1JJUB 5HDBA 1GG2B 1FWXA 4K3JB 3AL8B 4QQEA 4PNKB 5B4WA 3ZDXA 5TEEA 5EMMB 1JMXB 4TZ4A 4PXWA 3GREA 5H1MA 2HU8A 4L9OA 3UR4A 3DXKC 3ORVD 1QNIA 2VDMA 4J0WA 2IUPA 4OWRA 2HU7A 4JXMA 4EWRA 2H3XA 4NBMA 3OKWA 1SQJA 5IT9g 4JHNA 2HESX 5EAMA 4A2MA 2CO0A 2H9MA 3OL2A 1K8KC 1M1XA 4LG9A 5C2VB 3CIKB 4RE5A 5FXYA 1PGUA 3SLED 3RFGA 2XZGA 3AFCA 3JPXA 5H14A 4K3ID 3W15A 4CY3A 3GFCA 3EI4A 2I0SA 3MUOA 5EM2B 3BWSA 1NEXB 1XHMA 5AFU3 3OF7A 5TF2A 3V4VA 5M5TA 4N14A 5HE2B 4LGNA 4G1EA 4BL0A 2YB8B 4WK4A 4H5JA 5IGOA 4J8BA 2PM9B 2P9PC 3GC3B 1XIPA 1H2WA 4JSXC 5EALA 4BP8A 2EIBA 3EI2A 2H6KA 3V5WB 3JAMg 3OW8A 5FKTA 3IKOA 4XYHA 3PSCB 2CE9A 3RN1D 3SJLD 4FB1D 2IURA 2OK6A 3IULA 4GGAA 5TDHB 3MZLA 4A7JA 3EI1A 2H6NA 1A12A 3IJCA 4A2LA 3FCUA 3NVQA 1O6GA 5H17A 1SHYB 3F3PA 5KDOB 4G56B 1MDAH 2VC2A 2AGWA 5JWZA 3E0CA 4E54A 4GM8A 4FAND 4JD2C 3KRWB 2HXCA 4NSXA 3I2NA 2IWFA 4ZOYA 3MMYA 1GP2B 4O1QD 1JTDB 3K6SA 4CI8A 1PI6A 4AN0A 2UZYB 2AH1A 3K26A 2UZXB 2VDNA 2B5MA 3I7HA 4GQBB 3PVUB 4GQ1A 3DM0A 4J0XA 5CXCB 2GC4A 4FA5D 5FKRA 4NAAA 4CY1A 5I5MA 3OKYB 3NVXA 2I3TA 2OIZA 5AJAA 1H2XA 2CN2A 2VZ1A 4HDJA 5E6SA 2PM7B 2MTAH 4E5ZA 5HE3B 3FGBA 4A0AB 2Q7QA 1YR2A 5FFOA 3RN0D 1MG2A 1JV2A 1UOOA 4LG8A 4AX4A 4AEZA 2EIDA 5I5JA 3T3PA 4J84A 2XL2A 4J82A 4O2WA 3SFZA 5C92A 2AGXA 1H2ZA 3AL9A 3NIFA 4KFMB 1E8NA 1VZ3A 3UVLA 2VDKA 4X3EA 3U4YA 4CZYA 3I7KA 4J79A 4J87A 3F3FA 4AMZA 1C9LA 4L1QD 2G9AA 3I7OA 1SQ9A 4XEIC 3IJ1A 4BP9A 1TYEA 3I89A 3HFQA 3IVMA 3PXWD 4CI3A 2H14A 3KRXB 2QXVA 3MUNA 4ZOZA 3JRPA 2W18A 3K27A 4CY2A 3VI4A 2VDRA 3UKUC 4J73A 4D0KA 4MMXA 4A08B 4CI2A 3EI3B 4O3UB 1PEVA 3CFSB 4QL1A 3PE7A 2AH0A 3RMZD 5CYKB 1N6FA 2P9NC 4G1MA 4Z7QA 3I7LA 5HQGA 3BG1A 2G99A 1GOGA 2H6QA 1B9YA
chains in the Genus database with same CATH topology
4A0BA 4GMBA 3EU7A 3UVKA 3AH8B 2PM9A 2P9IC 4O3TB 3N0DA 1NR0A 2H13A 5IC7A 4UI9R 4A11A 3JZNA 4PC0A 3BG0A 3SBQA 5FA5B 3I7NA 4X63B 3JROA 5IJ8E 4Y5RD 5C2WB 2B5NA 3MKSB 3OL2B 5FKQA 4ESGA 3I8EA 4PBYA 5GMKn 3SWSD 5TEFA 2AGZA 4CI1A 2H9NA 4Y7RA 4PSWB 3UKRC 3C75H 1N6DA 3PXTD 4L3GD 4CZXA 3EI4B 3SXTD 5THAA 3OTTA 2AGYA 2IUQA 4ES0A 5CXCA 1MG3A 3EMHA 1TBGA 1VYHC 2P9KC 4GGCA 5FKSA 4FA4D 2CO0C 2Z2PA 3OKYA 2YNNA 3J81g 2YNPA 4GQ2P 3SMRA 4A0AA 3V9FA 2I0RA 2H9LA 3B7FA 5AMSA 2H68A 4A09A 2PM6B 4X60B 3ULEC 1OLZA 3SBPA 3PXSD 4Z8LA 4PSXB 3JZGA 2I0TA 1OMWB 5IGQA 1U4CA 1A0RB 1JMZB 5HYNB 3AL8A 3ZWLB 2I3SA 2HJ4A 2IAAA 5FQDA 2J56H 4CC9A 2P9SC 3J80g 4D6VA 3JZHA 2H47A 4J8GA 4YVDA 5CXBB 3N0EA 4FWWA 2J57G 3L4MD 5A2Qg 5I5IA 4A08A 3EI3A 4E5ZB 5EARA 3I8CA 3C99A 2HKMA 4MK0B 3IIYA 4H5IA 4U1EI 5CYKA 2CNXA 3C5MA 2YMUA 1L0QA 4GM9A 3SCYA 3RFHA 2XU7A 4IMMA 3JB9L 5EM2A 4XYIA 3SN6B 4J86A 2AQ5A 1YFQA 5SXMA 4BUJC 2P9UC 4FHLA 4CY5A 3SVWD 2P9LC 3PVWB 3RRMC 5FLXg 2BCJB 5EAPA 2TRCB 2O9KA 4FA9D 5K19A 4X61B 3IIWA 2H9PA 5C9ZB 4J81A 3VGZA 5K1CC 4IA9A 2OVQB 2Z2NA 4ERQA 2HJBA 2OVRB 2HKRA 3EG6A 2XYIA 2CE8A 2IUVA 2XL3A 2OK4A 4OZUA 4ZOXA 2BBKH 2B5LA 1Q47A 5GSAA 4JSNC 1K32A 4ERZA 2OVPB 3MKQA 3OKTA 4BH6A 1RI6A 4L3HD 5IJ7E 4A0BB 3PSLA 3FRXA 3C9CA 5EMKB 4J78A 1B9XA 2YBAA 3L4OD 2GNQA 3VA6A 5HE1B 4FAVD 1N6EA 1P22A 3V7DB 2OJYA 3CFVA 4A11B 3I7PA 2AGLA 4I79A 1TYQC 4JSVC 3DSMA 1PBYB 3RLMD 3SHFA 3EI2B 5GXHA 1ERJA 3DWLC 5EMJB 2IWKA 2B4EA 2HYEA 3MZKA 4QRJA 4PBZA 2QC5A 3VH0A 1GOTB 5EMLB 3EI1B 4JSPC 4U7AA 5GXIA 2PBIB 3ODTA 2EBSA 4O45A 3UVNA 1U2VC 4GGDA 3P4FA 2Z2OA 3F3GA 4O9DA 4GZ8A 1JOFA 1GXRA 3IJ0A 2J55H 4J77A 1XKSA 4E54B 4GM3A 3SBRA 5CXBA 4JT5C 3A0FA 4AOWA 1S4UX 4ERYA 3MXXA 2YNOA 4CZVA 5HE0B 4ZN4A 4R7AB 4A09B 3FM0A 4QT8A 1R5MA 3DXMC 3NVNA 3UVMA 3RSEC 2GC7A 3EWEA 4ZOVA 2CN3A 3UVOA 4JT6C 4FA1D 1JJUB 1GG2B 1FWXA 4K3JB 3AL8B 4QQEA 4PNKB 5B4WA 5TEEA 5EMMB 1JMXB 4TZ4A 4PXWA 3GREA 5H1MA 4L9OA 3UR4A 3DXKC 3ORVD 1QNIA 4J0WA 2IUPA 4OWRA 4EWRA 4JXMA 2H3XA 3OKWA 1SQJA 5IT9g 2HESX 5EAMA 4A2MA 2CO0A 2H9MA 3OL2A 1K8KC 4LG9A 5C2VB 3CIKB 5FXYA 1PGUA 3SLED 3RFGA 3AFCA 3JPXA 5H14A 3W15A 4K3ID 4CY3A 3GFCA 3EI4A 2I0SA 5EM2B 3BWSA 1NEXB 1XHMA 5AFU3 5TF2A 4N14A 5HE2B 4LGNA 4BL0A 2YB8B 4H5JA 5IGOA 4J8BA 2PM9B 2P9PC 1XIPA 4JSXC 5EALA 3EI2A 2H6KA 3V5WB 3JAMg 3OW8A 5FKTA 3IKOA 4XYHA 3PSCB 2CE9A 3RN1D 3SJLD 4FB1D 2IURA 2OK6A 4A7JA 4GGAA 5TDHB 3MZLA 3EI1A 2H6NA 3IJCA 4A2LA 3NVQA 5H17A 1SHYB 3F3PA 5KDOB 4G56B 1MDAH 2AGWA 5JWZA 3E0CA 4E54A 4GM8A 4FAND 4JD2C 3KRWB 2HXCA 4NSXA 3I2NA 2IWFA 4ZOYA 3MMYA 1GP2B 4O1QD 4CI8A 1PI6A 2UZYB 2AH1A 3K26A 4GQBB 2UZXB 2B5MA 3I7HA 3PVUB 4GQ1A 3DM0A 4J0XA 5CXCB 2GC4A 4FA5D 5FKRA 4CY1A 5I5MA 3OKYB 3NVXA 2I3TA 2OIZA 5AJAA 2CN2A 4HDJA 2PM7B 2MTAH 4E5ZA 5HE3B 3FGBA 4A0AB 2Q7QA 3RN0D 1MG2A 4LG8A 4AEZA 5I5JA 4J84A 2XL2A 4J82A 3SFZA 2AGXA 3AL9A 4KFMB 3UVLA 4X3EA 3U4YA 4CZYA 3I7KA 4J79A 4J87A 3F3FA 4L1QD 2G9AA 3I7OA 1SQ9A 4XEIC 3IJ1A 3I89A 3HFQA 3PXWD 4CI3A 2H14A 3KRXB 2QXVA 4ZOZA 3JRPA 2W18A 3K27A 4CY2A 3UKUC 4J73A 4D0KA 4A08B 4CI2A 3EI3B 4O3UB 1PEVA 3CFSB 4QL1A 3PE7A 2AH0A 3RMZD 5CYKB 1N6FA 2P9NC 3I7LA 5HQGA 3BG1A 2G99A 2H6QA 1B9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A0B A;  4GMB A;  3EU7 A;  3UVK A;  3AH8 B;  2PM9 A;  2P9I C;  4O3T B;  3N0D A;  1NR0 A;  2H13 A;  5IC7 A;  4UI9 R;  4A11 A;  3JZN A;  4PC0 A;  3BG0 A;  3SBQ A;  5FA5 B;  3I7N A;  4X63 B;  3JRO A;  5IJ8 E;  4Y5R D;  5C2W B;  2B5N A;  3MKS B;  3OL2 B;  5FKQ A;  4ESG A;  3I8E A;  4PBY A;  5GMK n;  3SWS D;  5TEF A;  2AGZ A;  4CI1 A;  2H9N A;  4Y7R A;  4PSW B;  3UKR C;  3C75 H;  1N6D A;  3PXT D;  4L3G D;  4CZX A;  3EI4 B;  3SXT D;  5THA A;  3OTT A;  2AGY A;  2IUQ A;  4ES0 A;  5CXC A;  1MG3 A;  3EMH A;  1TBG A;  1VYH C;  2P9K C;  4GGC A;  5FKS A;  4FA4 D;  2CO0 C;  2Z2P A;  3OKY A;  2YNN A;  3J81 g;  2YNP A;  4GQ2 P;  3SMR A;  4A0A A;  3V9F A;  2I0R A;  2H9L A;  3B7F A;  5AMS A;  2H68 A;  4A09 A;  2PM6 B;  4X60 B;  3ULE C;  1OLZ A;  3SBP A;  3PXS D;  4Z8L A;  4PSX B;  3JZG A;  2I0T A;  1OMW B;  5IGQ A;  1U4C A;  1A0R B;  1JMZ B;  5HYN B;  3AL8 A;  3ZWL B;  2I3S A;  2HJ4 A;  2IAA A;  5FQD A;  2J56 H;  4CC9 A;  2P9S C;  3J80 g;  4D6V A;  3JZH A;  2H47 A;  4J8G A;  4YVD A;  5CXB B;  3N0E A;  4FWW A;  2J57 G;  3L4M D;  5A2Q g;  5I5I A;  4A08 A;  3EI3 A;  4E5Z B;  5EAR A;  3I8C A;  3C99 A;  2HKM A;  4MK0 B;  3IIY A;  4H5I A;  4U1E I;  5CYK A;  2CNX A;  3C5M A;  2YMU A;  1L0Q A;  4GM9 A;  3SCY A;  3RFH A;  2XU7 A;  4IMM A;  3JB9 L;  5EM2 A;  4XYI A;  3SN6 B;  4J86 A;  2AQ5 A;  1YFQ A;  5SXM A;  4BUJ C;  2P9U C;  4FHL A;  4CY5 A;  3SVW D;  2P9L C;  3PVW B;  3RRM C;  5FLX g;  2BCJ B;  5EAP A;  2TRC B;  2O9K A;  4FA9 D;  5K19 A;  4X61 B;  3IIW A;  2H9P A;  5C9Z B;  4J81 A;  3VGZ A;  5K1C C;  4IA9 A;  2OVQ B;  2Z2N A;  4ERQ A;  2HJB A;  2OVR B;  2HKR A;  3EG6 A;  2XYI A;  2CE8 A;  2IUV A;  2XL3 A;  2OK4 A;  4OZU A;  4ZOX A;  2BBK H;  2B5L A;  1Q47 A;  5GSA A;  4JSN C;  1K32 A;  4ERZ A;  2OVP B;  3MKQ A;  3OKT A;  4BH6 A;  1RI6 A;  4L3H D;  5IJ7 E;  4A0B B;  3PSL A;  3FRX A;  3C9C A;  5EMK B;  4J78 A;  1B9X A;  2YBA A;  3L4O D;  2GNQ A;  3VA6 A;  5HE1 B;  4FAV D;  1N6E A;  1P22 A;  3V7D B;  2OJY A;  3CFV A;  4A11 B;  3I7P A;  2AGL A;  4I79 A;  1TYQ C;  4JSV C;  3DSM A;  1PBY B;  3RLM D;  3SHF A;  3EI2 B;  5GXH A;  1ERJ A;  3DWL C;  5EMJ B;  2IWK A;  2B4E A;  2HYE A;  3MZK A;  4QRJ A;  4PBZ A;  2QC5 A;  3VH0 A;  1GOT B;  5EML B;  3EI1 B;  4JSP C;  4U7A A;  5GXI A;  2PBI B;  3ODT A;  2EBS A;  4O45 A;  3UVN A;  1U2V C;  4GGD A;  3P4F A;  2Z2O A;  3F3G A;  4O9D A;  4GZ8 A;  1JOF A;  1GXR A;  3IJ0 A;  2J55 H;  4J77 A;  1XKS A;  4E54 B;  4GM3 A;  3SBR A;  5CXB A;  4JT5 C;  3A0F A;  4AOW A;  1S4U X;  4ERY A;  3MXX A;  2YNO A;  4CZV A;  5HE0 B;  4ZN4 A;  4R7A B;  4A09 B;  3FM0 A;  4QT8 A;  1R5M A;  3DXM C;  3NVN A;  3UVM A;  3RSE C;  2GC7 A;  3EWE A;  4ZOV A;  2CN3 A;  3UVO A;  4JT6 C;  4FA1 D;  1JJU B;  1GG2 B;  1FWX A;  4K3J B;  3AL8 B;  4QQE A;  4PNK B;  5B4W A;  5TEE A;  5EMM B;  1JMX B;  4TZ4 A;  4PXW A;  3GRE A;  5H1M A;  4L9O A;  3UR4 A;  3DXK C;  3ORV D;  1QNI A;  4J0W A;  2IUP A;  4OWR A;  4EWR A;  4JXM A;  2H3X A;  3OKW A;  1SQJ A;  5IT9 g;  2HES X;  5EAM A;  4A2M A;  2CO0 A;  2H9M A;  3OL2 A;  1K8K C;  4LG9 A;  5C2V B;  3CIK B;  5FXY A;  1PGU A;  3SLE D;  3RFG A;  3AFC A;  3JPX A;  5H14 A;  3W15 A;  4K3I D;  4CY3 A;  3GFC A;  3EI4 A;  2I0S A;  5EM2 B;  3BWS A;  1NEX B;  1XHM A;  5AFU 3;  5TF2 A;  4N14 A;  5HE2 B;  4LGN A;  4BL0 A;  2YB8 B;  4H5J A;  5IGO A;  4J8B A;  2PM9 B;  2P9P C;  1XIP A;  4JSX C;  5EAL A;  3EI2 A;  2H6K A;  3V5W B;  3JAM g;  3OW8 A;  5FKT A;  3IKO A;  4XYH A;  3PSC B;  2CE9 A;  3RN1 D;  3SJL D;  4FB1 D;  2IUR A;  2OK6 A;  4A7J A;  4GGA A;  5TDH B;  3MZL A;  3EI1 A;  2H6N A;  3IJC A;  4A2L A;  3NVQ A;  5H17 A;  1SHY B;  3F3P A;  5KDO B;  4G56 B;  1MDA H;  2AGW A;  5JWZ A;  3E0C A;  4E54 A;  4GM8 A;  4FAN D;  4JD2 C;  3KRW B;  2HXC A;  4NSX A;  3I2N A;  2IWF A;  4ZOY A;  3MMY A;  1GP2 B;  4O1Q D;  4CI8 A;  1PI6 A;  2UZY B;  2AH1 A;  3K26 A;  4GQB B;  2UZX B;  2B5M A;  3I7H A;  3PVU B;  4GQ1 A;  3DM0 A;  4J0X A;  5CXC B;  2GC4 A;  4FA5 D;  5FKR A;  4CY1 A;  5I5M A;  3OKY B;  3NVX A;  2I3T A;  2OIZ A;  5AJA A;  2CN2 A;  4HDJ A;  2PM7 B;  2MTA H;  4E5Z A;  5HE3 B;  3FGB A;  4A0A B;  2Q7Q A;  3RN0 D;  1MG2 A;  4LG8 A;  4AEZ A;  5I5J A;  4J84 A;  2XL2 A;  4J82 A;  3SFZ A;  2AGX A;  3AL9 A;  4KFM B;  3UVL A;  4X3E A;  3U4Y A;  4CZY A;  3I7K A;  4J79 A;  4J87 A;  3F3F A;  4L1Q D;  2G9A A;  3I7O A;  1SQ9 A;  4XEI C;  3IJ1 A;  3I89 A;  3HFQ A;  3PXW D;  4CI3 A;  2H14 A;  3KRX B;  2QXV A;  4ZOZ A;  3JRP A;  2W18 A;  3K27 A;  4CY2 A;  3UKU C;  4J73 A;  4D0K A;  4A08 B;  4CI2 A;  3EI3 B;  4O3U B;  1PEV A;  3CFS B;  4QL1 A;  3PE7 A;  2AH0 A;  3RMZ D;  5CYK B;  1N6F A;  2P9N C;  3I7L A;  5HQG A;  3BG1 A;  2G99 A;  2H6Q A;  1B9Y A; 
#chains in the Genus database with same CATH topology
 4A0B A;  4GMB A;  3EU7 A;  3UVK A;  3AH8 B;  2PM9 A;  2P9I C;  4O3T B;  3N0D A;  1NR0 A;  2H13 A;  5IC7 A;  4UI9 R;  4A11 A;  3JZN A;  2XDW A;  4PC0 A;  3GD1 I;  3BG0 A;  3SBQ A;  5FA5 B;  3I7N A;  4X63 B;  3JRO A;  5IJ8 E;  3IJE A;  4DNV A;  4Y5R D;  5C2W B;  2B5N A;  3MKS B;  3OL2 B;  5FKQ A;  4ESG A;  3I8E A;  4PBY A;  5GMK n;  3SWS D;  3K71 A;  5TEF A;  2AGZ A;  2JKX A;  4CI1 A;  2H9N A;  4Y7R A;  4PSW B;  3IUJ A;  3UKR C;  3C75 H;  1O6F A;  1N6D A;  3PXT D;  4L3G D;  4UM9 A;  4CZX A;  3EI4 B;  3SXT D;  5THA A;  5E6R A;  3OTT A;  2AGY A;  4RE6 A;  3ZDY A;  2IUQ A;  4ES0 A;  5CXC A;  1MG3 A;  3EMH A;  1TBG A;  1VYH C;  3MVD K;  2P9K C;  1T2X A;  4GGC A;  5FKS A;  4FA4 D;  2CO0 C;  2Z2P A;  3EQ7 A;  3OKY A;  5M61 A;  2YNN A;  3J81 g;  3NIG A;  2YNP A;  4GQ2 P;  3SMR A;  4A0A A;  3V9F A;  4JHP C;  2EIE A;  2H9L A;  2I0R A;  2VZ3 A;  3B7F A;  5AMS A;  1I2M B;  2H68 A;  4A09 A;  2PM6 B;  4X60 B;  3ULE C;  1OLZ A;  3SBP A;  3PXS D;  4Z8L A;  4MMZ A;  4PSX B;  3JZG A;  2I0T A;  1OMW B;  5IGQ A;  1U4C A;  1A0R B;  3IUN A;  3ZE0 A;  1JMZ B;  5HYN B;  3AL8 A;  3ZWL B;  4QAM A;  2I3S A;  2HJ4 A;  2IAA A;  4O02 A;  5FQD A;  1QFS A;  2J56 H;  3O4G A;  4CC9 A;  4Z7N A;  2P9S C;  3J80 g;  4IRZ A;  4BCB A;  4D6V A;  3JZH A;  5M5S A;  3T3M A;  2H47 A;  4J8G A;  3VI3 A;  4YVD A;  3IUM A;  5CXB B;  3N0E A;  3EQ8 A;  4FWW A;  2J57 G;  3L4M D;  5A2Q g;  5I5I A;  2VDL A;  4A08 A;  3EI3 A;  4E5Z B;  1L5G A;  1QFM A;  2EIC A;  5EAR A;  3I8C A;  3C99 A;  2HKM A;  4MK0 B;  3IIY A;  4H5I A;  4U1E I;  2XE4 A;  5CYK A;  2CNX A;  3K72 A;  3C5M A;  1E8M A;  2YMU A;  1L0Q A;  4GM9 A;  1VE6 A;  3SCY A;  3IUR A;  3V4P A;  3RFH A;  1H2Y A;  2XU7 A;  4IMM A;  4D9S A;  5M5V A;  3JB9 L;  1VZ2 A;  3KCI A;  5EM2 A;  2WQ8 A;  4XYI A;  3SN6 B;  4J86 A;  2AQ5 A;  4AMY A;  1YFQ A;  5SXM A;  4BUJ C;  2P9U C;  4FHL A;  4CY5 A;  2BKL A;  3SVW D;  2P9L C;  3PVW B;  3RRM C;  5FLX g;  2BCJ B;  5EAP A;  3ZE1 A;  1UOP A;  2VDP A;  2TRC B;  2O9K A;  4FA9 D;  5K19 A;  4X61 B;  3IIW A;  1VE7 A;  2H9P A;  5C9Z B;  4J81 A;  3VGZ A;  5K1C C;  4IA9 A;  2OVQ B;  2Z2N A;  4ERQ A;  2HJB A;  4L1M A;  2OVR B;  2HKR A;  2VDQ A;  3EG6 A;  1GOF A;  2QZP A;  2CE8 A;  2IUV A;  2XL3 A;  2OK4 A;  2XYI A;  4OZU A;  4ZOX A;  2BBK H;  3ZE2 A;  2B5L A;  1Q47 A;  5GSA A;  4JSN C;  1K32 A;  4ERZ A;  2OVP B;  3MKQ A;  3OKT A;  4BH6 A;  1RI6 A;  4L3H D;  5IJ7 E;  3O4I A;  3O4J A;  3PSL A;  4MMY A;  3FRX A;  4A0B B;  3C9C A;  5EMK B;  4J78 A;  1B9X A;  2YBA A;  3L4O D;  5E6U A;  2GNQ A;  4NEN A;  3VA6 A;  1E5T A;  5HE1 B;  4FAV D;  1N6E A;  4DNW A;  1P22 A;  3V7D B;  2OJY A;  3CFV A;  4DNU A;  4A11 B;  3I7P A;  2AGL A;  4I79 A;  1TYQ C;  4JSV C;  4AN1 A;  3DSM A;  3FCS A;  1PBY B;  1K3I A;  3IUQ A;  3RLM D;  3SHF A;  3EI2 B;  5GXH A;  1UTC A;  1ERJ A;  4WK0 A;  3DWL C;  4BCC A;  5EMJ B;  2IWK A;  2B4E A;  2HYE A;  2QR5 A;  3MZK A;  4QRJ A;  4PBZ A;  2QC5 A;  1GOH A;  3DDU A;  3VH0 A;  1GOT B;  5EML B;  4Z7O A;  3EI1 B;  4JSP C;  1BPO A;  4WK2 A;  4U7A A;  5GXI A;  2PBI B;  3ODT A;  2EBS A;  4O45 A;  3UVN A;  1U2V C;  4GGD A;  3P4F A;  2Z2O A;  3F3G A;  4O9D A;  3O4H A;  3EQ9 A;  1C9I A;  4GZ8 A;  2VDO A;  1JOF A;  1GXR A;  2J55 H;  3IJ0 A;  4J77 A;  3ZDZ A;  1XKS A;  4BCD A;  4E54 B;  4GM3 A;  4WJK A;  3SBR A;  5CXB A;  4JT5 C;  1U8C A;  5FFG A;  3A0F A;  5C86 A;  4AOW A;  4UM8 A;  5M5R A;  1S4U X;  4G55 A;  4ERY A;  3MXX A;  3NID A;  2YNO A;  4CZV A;  3QI0 A;  5HE0 B;  5M5U A;  4ZN4 A;  4R7A B;  4A09 B;  3FM0 A;  4QT8 A;  1R5M A;  3DXM C;  3NVN A;  3UVM A;  3RSE C;  2GC7 A;  3EWE A;  4NC4 A;  4ZOV A;  2CN3 A;  3QHY B;  3UVO A;  1UOQ A;  2HU5 A;  4JT6 C;  4FA1 D;  1JJU B;  5HDB A;  1GG2 B;  1FWX A;  4K3J B;  3AL8 B;  4QQE A;  4PNK B;  5B4W A;  3ZDX A;  5TEE A;  5EMM B;  1JMX B;  4TZ4 A;  4PXW A;  3GRE A;  5H1M A;  2HU8 A;  4L9O A;  3UR4 A;  3DXK C;  3ORV D;  1QNI A;  2VDM A;  4J0W A;  2IUP A;  4OWR A;  2HU7 A;  4JXM A;  4EWR A;  2H3X A;  4NBM A;  3OKW A;  1SQJ A;  5IT9 g;  4JHN A;  2HES X;  5EAM A;  4A2M A;  2CO0 A;  2H9M A;  3OL2 A;  1K8K C;  1M1X A;  4LG9 A;  5C2V B;  3CIK B;  4RE5 A;  5FXY A;  1PGU A;  3SLE D;  3RFG A;  2XZG A;  3AFC A;  3JPX A;  5H14 A;  4K3I D;  3W15 A;  4CY3 A;  3GFC A;  3EI4 A;  2I0S A;  3MUO A;  5EM2 B;  3BWS A;  1NEX B;  1XHM A;  5AFU 3;  3OF7 A;  5TF2 A;  3V4V A;  5M5T A;  4N14 A;  5HE2 B;  4LGN A;  4G1E A;  4BL0 A;  2YB8 B;  4WK4 A;  4H5J A;  5IGO A;  4J8B A;  2PM9 B;  2P9P C;  3GC3 B;  1XIP A;  1H2W A;  4JSX C;  5EAL A;  4BP8 A;  2EIB A;  3EI2 A;  2H6K A;  3V5W B;  3JAM g;  3OW8 A;  5FKT A;  3IKO A;  4XYH A;  3PSC B;  2CE9 A;  3RN1 D;  3SJL D;  4FB1 D;  2IUR A;  2OK6 A;  3IUL A;  4GGA A;  5TDH B;  3MZL A;  4A7J A;  3EI1 A;  2H6N A;  1A12 A;  3IJC A;  4A2L A;  3FCU A;  3NVQ A;  1O6G A;  5H17 A;  1SHY B;  3F3P A;  5KDO B;  4G56 B;  1MDA H;  2VC2 A;  2AGW A;  5JWZ A;  3E0C A;  4E54 A;  4GM8 A;  4FAN D;  4JD2 C;  3KRW B;  2HXC A;  4NSX A;  3I2N A;  2IWF A;  4ZOY A;  3MMY A;  1GP2 B;  4O1Q D;  1JTD B;  3K6S A;  4CI8 A;  1PI6 A;  4AN0 A;  2UZY B;  2AH1 A;  3K26 A;  2UZX B;  2VDN A;  2B5M A;  3I7H A;  4GQB B;  3PVU B;  4GQ1 A;  3DM0 A;  4J0X A;  5CXC B;  2GC4 A;  4FA5 D;  5FKR A;  4NAA A;  4CY1 A;  5I5M A;  3OKY B;  3NVX A;  2I3T A;  2OIZ A;  5AJA A;  1H2X A;  2CN2 A;  2VZ1 A;  4HDJ A;  5E6S A;  2PM7 B;  2MTA H;  4E5Z A;  5HE3 B;  3FGB A;  4A0A B;  2Q7Q A;  1YR2 A;  5FFO A;  3RN0 D;  1MG2 A;  1JV2 A;  1UOO A;  4LG8 A;  4AX4 A;  4AEZ A;  2EID A;  5I5J A;  3T3P A;  4J84 A;  2XL2 A;  4J82 A;  4O2W A;  3SFZ A;  5C92 A;  2AGX A;  1H2Z A;  3AL9 A;  3NIF A;  4KFM B;  1E8N A;  1VZ3 A;  3UVL A;  2VDK A;  4X3E A;  3U4Y A;  4CZY A;  3I7K A;  4J79 A;  4J87 A;  3F3F A;  4AMZ A;  1C9L A;  4L1Q D;  2G9A A;  3I7O A;  1SQ9 A;  4XEI C;  3IJ1 A;  4BP9 A;  1TYE A;  3I89 A;  3HFQ A;  3IVM A;  3PXW D;  4CI3 A;  2H14 A;  3KRX B;  2QXV A;  3MUN A;  4ZOZ A;  3JRP A;  2W18 A;  3K27 A;  4CY2 A;  3VI4 A;  2VDR A;  3UKU C;  4J73 A;  4D0K A;  4MMX A;  4A08 B;  4CI2 A;  3EI3 B;  4O3U B;  1PEV A;  3CFS B;  4QL1 A;  3PE7 A;  2AH0 A;  3RMZ D;  5CYK B;  1N6F A;  2P9N C;  4G1M A;  4Z7Q A;  3I7L A;  5HQG A;  3BG1 A;  2G99 A;  1GOG A;  2H6Q A;  1B9Y A; 
#chains in the Genus database with same CATH homology
 4A0B A;  4GMB A;  3EU7 A;  3UVK A;  3AH8 B;  2PM9 A;  2P9I C;  4O3T B;  3N0D A;  1NR0 A;  2H13 A;  5IC7 A;  4UI9 R;  4A11 A;  3JZN A;  4PC0 A;  3BG0 A;  3SBQ A;  5FA5 B;  3I7N A;  4X63 B;  3JRO A;  5IJ8 E;  4Y5R D;  5C2W B;  2B5N A;  3MKS B;  3OL2 B;  5FKQ A;  4ESG A;  3I8E A;  4PBY A;  5GMK n;  3SWS D;  5TEF A;  2AGZ A;  4CI1 A;  2H9N A;  4Y7R A;  4PSW B;  3UKR C;  3C75 H;  1N6D A;  3PXT D;  4L3G D;  4CZX A;  3EI4 B;  3SXT D;  5THA A;  3OTT A;  2AGY A;  2IUQ A;  4ES0 A;  5CXC A;  1MG3 A;  3EMH A;  1TBG A;  1VYH C;  2P9K C;  4GGC A;  5FKS A;  4FA4 D;  2CO0 C;  2Z2P A;  3OKY A;  2YNN A;  3J81 g;  2YNP A;  4GQ2 P;  3SMR A;  4A0A A;  3V9F A;  2I0R A;  2H9L A;  3B7F A;  5AMS A;  2H68 A;  4A09 A;  2PM6 B;  4X60 B;  3ULE C;  1OLZ A;  3SBP A;  3PXS D;  4Z8L A;  4PSX B;  3JZG A;  2I0T A;  1OMW B;  5IGQ A;  1U4C A;  1A0R B;  1JMZ B;  5HYN B;  3AL8 A;  3ZWL B;  2I3S A;  2HJ4 A;  2IAA A;  5FQD A;  2J56 H;  4CC9 A;  2P9S C;  3J80 g;  4D6V A;  3JZH A;  2H47 A;  4J8G A;  4YVD A;  5CXB B;  3N0E A;  4FWW A;  2J57 G;  3L4M D;  5A2Q g;  5I5I A;  4A08 A;  3EI3 A;  4E5Z B;  5EAR A;  3I8C A;  3C99 A;  2HKM A;  4MK0 B;  3IIY A;  4H5I A;  4U1E I;  5CYK A;  2CNX A;  3C5M A;  2YMU A;  1L0Q A;  4GM9 A;  3SCY A;  3RFH A;  2XU7 A;  4IMM A;  3JB9 L;  5EM2 A;  4XYI A;  3SN6 B;  4J86 A;  2AQ5 A;  1YFQ A;  5SXM A;  4BUJ C;  2P9U C;  4FHL A;  4CY5 A;  3SVW D;  2P9L C;  3PVW B;  3RRM C;  5FLX g;  2BCJ B;  5EAP A;  2TRC B;  2O9K A;  4FA9 D;  5K19 A;  4X61 B;  3IIW A;  2H9P A;  5C9Z B;  4J81 A;  3VGZ A;  5K1C C;  4IA9 A;  2OVQ B;  2Z2N A;  4ERQ A;  2HJB A;  2OVR B;  2HKR A;  3EG6 A;  2XYI A;  2CE8 A;  2IUV A;  2XL3 A;  2OK4 A;  4OZU A;  4ZOX A;  2BBK H;  2B5L A;  1Q47 A;  5GSA A;  4JSN C;  1K32 A;  4ERZ A;  2OVP B;  3MKQ A;  3OKT A;  4BH6 A;  1RI6 A;  4L3H D;  5IJ7 E;  4A0B B;  3PSL A;  3FRX A;  3C9C A;  5EMK B;  4J78 A;  1B9X A;  2YBA A;  3L4O D;  2GNQ A;  3VA6 A;  5HE1 B;  4FAV D;  1N6E A;  1P22 A;  3V7D B;  2OJY A;  3CFV A;  4A11 B;  3I7P A;  2AGL A;  4I79 A;  1TYQ C;  4JSV C;  3DSM A;  1PBY B;  3RLM D;  3SHF A;  3EI2 B;  5GXH A;  1ERJ A;  3DWL C;  5EMJ B;  2IWK A;  2B4E A;  2HYE A;  3MZK A;  4QRJ A;  4PBZ A;  2QC5 A;  3VH0 A;  1GOT B;  5EML B;  3EI1 B;  4JSP C;  4U7A A;  5GXI A;  2PBI B;  3ODT A;  2EBS A;  4O45 A;  3UVN A;  1U2V C;  4GGD A;  3P4F A;  2Z2O A;  3F3G A;  4O9D A;  4GZ8 A;  1JOF A;  1GXR A;  3IJ0 A;  2J55 H;  4J77 A;  1XKS A;  4E54 B;  4GM3 A;  3SBR A;  5CXB A;  4JT5 C;  3A0F A;  4AOW A;  1S4U X;  4ERY A;  3MXX A;  2YNO A;  4CZV A;  5HE0 B;  4ZN4 A;  4R7A B;  4A09 B;  3FM0 A;  4QT8 A;  1R5M A;  3DXM C;  3NVN A;  3UVM A;  3RSE C;  2GC7 A;  3EWE A;  4ZOV A;  2CN3 A;  3UVO A;  4JT6 C;  4FA1 D;  1JJU B;  1GG2 B;  1FWX A;  4K3J B;  3AL8 B;  4QQE A;  4PNK B;  5B4W A;  5TEE A;  5EMM B;  1JMX B;  4TZ4 A;  4PXW A;  3GRE A;  5H1M A;  4L9O A;  3UR4 A;  3DXK C;  3ORV D;  1QNI A;  4J0W A;  2IUP A;  4OWR A;  4EWR A;  4JXM A;  2H3X A;  3OKW A;  1SQJ A;  5IT9 g;  2HES X;  5EAM A;  4A2M A;  2CO0 A;  2H9M A;  3OL2 A;  1K8K C;  4LG9 A;  5C2V B;  3CIK B;  5FXY A;  1PGU A;  3SLE D;  3RFG A;  3AFC A;  3JPX A;  5H14 A;  3W15 A;  4K3I D;  4CY3 A;  3GFC A;  3EI4 A;  2I0S A;  5EM2 B;  3BWS A;  1NEX B;  1XHM A;  5AFU 3;  5TF2 A;  4N14 A;  5HE2 B;  4LGN A;  4BL0 A;  2YB8 B;  4H5J A;  5IGO A;  4J8B A;  2PM9 B;  2P9P C;  1XIP A;  4JSX C;  5EAL A;  3EI2 A;  2H6K A;  3V5W B;  3JAM g;  3OW8 A;  5FKT A;  3IKO A;  4XYH A;  3PSC B;  2CE9 A;  3RN1 D;  3SJL D;  4FB1 D;  2IUR A;  2OK6 A;  4A7J A;  4GGA A;  5TDH B;  3MZL A;  3EI1 A;  2H6N A;  3IJC A;  4A2L A;  3NVQ A;  5H17 A;  1SHY B;  3F3P A;  5KDO B;  4G56 B;  1MDA H;  2AGW A;  5JWZ A;  3E0C A;  4E54 A;  4GM8 A;  4FAN D;  4JD2 C;  3KRW B;  2HXC A;  4NSX A;  3I2N A;  2IWF A;  4ZOY A;  3MMY A;  1GP2 B;  4O1Q D;  4CI8 A;  1PI6 A;  2UZY B;  2AH1 A;  3K26 A;  4GQB B;  2UZX B;  2B5M A;  3I7H A;  3PVU B;  4GQ1 A;  3DM0 A;  4J0X A;  5CXC B;  2GC4 A;  4FA5 D;  5FKR A;  4CY1 A;  5I5M A;  3OKY B;  3NVX A;  2I3T A;  2OIZ A;  5AJA A;  2CN2 A;  4HDJ A;  2PM7 B;  2MTA H;  4E5Z A;  5HE3 B;  3FGB A;  4A0A B;  2Q7Q A;  3RN0 D;  1MG2 A;  4LG8 A;  4AEZ A;  5I5J A;  4J84 A;  2XL2 A;  4J82 A;  3SFZ A;  2AGX A;  3AL9 A;  4KFM B;  3UVL A;  4X3E A;  3U4Y A;  4CZY A;  3I7K A;  4J79 A;  4J87 A;  3F3F A;  4L1Q D;  2G9A A;  3I7O A;  1SQ9 A;  4XEI C;  3IJ1 A;  3I89 A;  3HFQ A;  3PXW D;  4CI3 A;  2H14 A;  3KRX B;  2QXV A;  4ZOZ A;  3JRP A;  2W18 A;  3K27 A;  4CY2 A;  3UKU C;  4J73 A;  4D0K A;  4A08 B;  4CI2 A;  3EI3 B;  4O3U B;  1PEV A;  3CFS B;  4QL1 A;  3PE7 A;  2AH0 A;  3RMZ D;  5CYK B;  1N6F A;  2P9N C;  3I7L A;  5HQG A;  3BG1 A;  2G99 A;  2H6Q A;  1B9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...