2G99A

Structural basis for the specific recognition of methylated histone h3 lysine 4 by the wd-40 protein wdr5
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
304
structure length
304
Chain Sequence
PVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the specific recognition of methylated histone H3 lysine 4 by the WD-40 protein WDR5
rcsb
source organism Homo sapiens
molecule tags Structural protein/dna binding protein
molecule keywords WD-repeat protein 5
total genus 94
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2g99A00
1MDAH 2H9PA 2P9KC 1FWXA 4XYIA 2H68A 5HQGA 3MKQA 3V7DB 3VGZA 5C2VB 3SXTD 2OK4A 4U7AA 2AH0A 4R7AB 2AGLA 2HESX 5TEEA 4K3ID 1U4CA 4LG8A 5HE3B 4J78A 3RFHA 2G99A 4QL1A 4ERYA 3PVWB 5TF2A 3UKUC 3K27A 2H9LA 3BG0A 2W18A 4FB1D 3FM0A 5CXCB 4J77A 4JT6C 5IC7A 5EM2A 4EWRA 1A0RB 2YBAA 3RN1D 3EI1B 4GMBA 4QRJA 4A0BA 3OKYB 4NSXA 3MZKA 4JSNC 1NR0A 2BBKH 3W15A 4Z8LA 3EI1A 3I7OA 1GG2B 3VA6A 4A11A 4GGAA 4JXMA 5EMMB 3GREA 4K3JB 4PBZA 5EALA 3CIKB 3I7KA 5FA5B 1GP2B 3I7PA 1GOTB 5IT9g 1B9XA 2B4EA 4UI9R 3SLED 1PI6A 2HYEA 1JMXB 3JB9L 2AGXA 3OKWA 5EMKB 4L3HD 3UR4A 3PVUB 2IURA 2H3XA 2H47A 2P9NC 4TZ4A 4BL0A 4O1QD 2IWFA 4GM9A 3SFZA 5FKTA 4BH6A 3IJCA 3NVNA 2I3SA 4ZOYA 1TYQC 3NVQA 4YVDA 1XHMA 4A11B 5TEFA 3DXKC 2PBIB 3EG6A 4JSXC 4ESGA 3EMHA 5A2Qg 2AGYA 3OKYA 4L9OA 1OMWB 3CFSB 3MZLA 2J55H 5EAPA 5GXHA 3EI4A 2I0RA 3MKSB 3SVWD 1PEVA 2CN2A 4J87A 4A0AB 2QXVA 3OL2B 3U4YA 4J0WA 4A08B 3MXXA 3A0FA 3K26A 1QNIA 3I8EA 4KFMB 3JZGA 4E54B 3OW8A 3SMRA 1PGUA 3JZNA 2HKMA 4X61B 3PSLA 4CY1A 2IUQA 3HFQA 2H6QA 3RFGA 4Y7RA 3JAMg 2CE8A 2H9NA 3GFCA 2YNPA 4CI8A 4CI3A 4J79A 2J56H 2PM7B 5HE0B 2CO0C 3ULEC 4H5IA 3IKOA 3EI2A 4X3EA 3OL2A 4A09A 2TRCB 1SQ9A 4J86A 3RN0D 3SBQA 4GGDA 1N6EA 5I5IA 3EI2B 3EI4B 1P22A 2H14A 5KDOB 4JSVC 4O3TB 1YFQA 4CY3A 3ZWLB 2XL3A 4E5ZA 4N14A 1JMZB 4JSPC 2Z2NA 2UZXB 5EM2B 5GMKn 3IJ1A 3JRPA 4L3GD 2B5LA 2XYIA 3FRXA 1PBYB 2XL2A 3I8CA 2P9UC 2IUVA 3I2NA 2CNXA 1R5MA 1S4UX 2IWKA 2PM9A 2HXCA 3UVKA 1MG3A 3JZHA 2Q7QA 3KRXB 4ES0A 1L0QA 5FKSA 3EI3B 4Y5RD 1RI6A 1GXRA 2Z2OA 1B9YA 5AFU3 4CZXA 4H5JA 1ERJA 4J81A 4FAVD 2B5NA 4PBYA 5EMJB 2H6NA 3IJ0A 2Z2PA 5B4WA 2AQ5A 3JPXA 3SJLD 5EMLB 2GC7A 3B7FA 4QT8A 3OKTA 2GC4A 4GZ8A 2I0SA 3AL8A 3C75H 3IIWA 4J8BA 5K1CC 4I79A 3RLMD 2CN3A 5HE1B 3FGBA 2AGWA 2O9KA 5C2WB 5C9ZB 3SBPA 1SQJA 2P9LC 4ZOXA 1N6DA 2UZYB 5H17A 3SWSD 4ERZA 5HYNB 1SHYB 3RMZD 2H13A 5H1MA 3PE7A 3P4FA 4J82A 5HE2B 4MK0B 4O3UB 2CE9A 2XU7A 4J73A 3DM0A 5EARA 3RRMC 1U2VC 2EBSA 4J0XA 3SBRA 5CXBB 3BWSA 2YNNA 4FAND 2YNOA 4OZUA 5THAA 3J81g 5FQDA 2I0TA 4FA1D 4XEIC 3SCYA 4IA9A 3V9FA 4GQ2P 4X63B 4QQEA 3C99A 2YMUA 3AL9A 3EWEA 4A2MA 4IMMA 5FLXg 5FXYA 4A09B 3BG1A 4A08A 4O45A 4JD2C 2PM6B 5AJAA 5CXCA 1XKSA 4ZOZA 5GSAA 5CYKB 4ZN4A 5IJ8E 1VYHC 4D6VA 2P9IC 3L4MD 5IJ7E 1NEXB 5JWZA 4ERQA 4BUJC 2P9PC 4E5ZB 5IGQA 2MTAH 2OK6A 4J84A 3DXMC 4GQ1A 2HJ4A 3UKRC 3CFVA 4AEZA 4E54A 3C5MA 4ZOVA 3NVXA 4CY5A 3I7HA 2CO0A 3AL8B 4PSXB 3PXSD 1K32A 4A0BB 5IGOA 2OVPB 4FA4D 3VH0A 1TBGA 4GQBB 3J80g 3N0EA 4PC0A 4LGNA 4O9DA 3ORVD 3KRWB 5CXBA 3C9CA 3DWLC 4PSWB 4CC9A 4A7JA 2AGZA 3F3PA 1XIPA 3N0DA 2H6KA 3RSEC 4L1QD 5I5JA 4FA9D 4OWRA 2G9AA 5H14A 3SHFA 4CZVA 4A2LA 1N6FA 2BCJB 3MMYA 5CYKA 3PXWD 2PM9B 2OIZA 3AFCA 4G56B 1Q47A 5FKRA 2P9SC 2J57G 3I89A 4PXWA 3I7LA 3EU7A 1JOFA 5I5MA 3PXTD 3DSMA 4GM8A 4FWWA 3SN6B 4U1EI 3JROA 3L4OD 2OVRB 3F3FA 3E0CA 3EI3A 4HDJA 2IUPA 3UVOA 4CI2A 4CY2A 5TDHB 2B5MA 2QC5A 3UVNA 3OTTA 4FHLA 4J8GA 4FA5D 4X60B 4CI1A 3UVMA 2HKRA 2IAAA 4GM3A 5K19A 4JT5C 5EAMA 2GNQA 2OJYA 4XYHA 4CZYA 1JJUB 1OLZA 3IIYA 3F3GA 5AMSA 5SXMA 2HJBA 4A0AA 5FKQA 5GXIA 1MG2A 2H9MA 3V5WB 3I7NA 3PSCB 2YB8B 3UVLA 2I3TA 3ODTA 2OVQB 2AH1A 4LG9A 4PNKB 4AOWA 3AH8B 1K8KC 4D0KA 4GGCA
chains in the Genus database with same CATH superfamily
4DNVA 1VZ2A 1MDAH 2H9PA 2P9KC 1FWXA 4XYIA 2H68A 5HQGA 3MKQA 4BP9A 3V7DB 3VGZA 5C2VB 2EIBA 3SXTD 2OK4A 4U7AA 2AH0A 4R7AB 2AGLA 2HESX 5TEEA 4K3ID 1U4CA 4LG8A 5HE3B 5M5RA 1E8NA 4J78A 3RFHA 2G99A 4Z7QA 4QL1A 4ERYA 3FCSA 1C9IA 3PVWB 5TF2A 3UKUC 4DNWA 3K27A 3IUMA 2H9LA 1GOHA 3BG0A 2W18A 4G1EA 3FM0A 4JHNA 4RE6A 5CXCB 4FB1D 4J77A 4JT6C 5IC7A 4BCBA 5EM2A 4EWRA 1A0RB 2YBAA 3RN1D 3EI1B 4GMBA 4QRJA 4A0BA 3OKYB 4WJKA 4NSXA 3GD1I 3MZKA 4G55A 3K6SA 4JSNC 1NR0A 2BBKH 4AMZA 3W15A 4WK2A 1UOQA 4O02A 4Z8LA 3EI1A 3I7OA 4D9SA 1GG2B 3VA6A 4A11A 5C86A 4GGAA 4JXMA 5EMMB 3GREA 4K3JB 4PBZA 5EALA 3CIKB 3I7KA 1C9LA 5FA5B 1BPOA 3K72A 1GP2B 3ZE2A 3I7PA 1I2MB 4WK4A 5M5TA 1O6FA 4AN1A 1GOTB 5C92A 5IT9g 1B9XA 2B4EA 4UI9R 3SLED 1PI6A 2HYEA 1JMXB 3JB9L 3V4VA 2AGXA 3OKWA 5EMKB 4L3HD 3UR4A 3PVUB 2IURA 2H3XA 2H47A 2P9NC 4TZ4A 4BL0A 4O1QD 4JHPC 2IWFA 4GM9A 3SFZA 3FCUA 5FKTA 4BH6A 5FFGA 3IJCA 1H2XA 3NVNA 2I3SA 3IURA 4ZOYA 1TYQC 4AX4A 3NVQA 4YVDA 5M5UA 1XHMA 4A11B 5TEFA 3DXKC 2PBIB 3EG6A 4JSXC 4ESGA 2VDKA 3EMHA 5A2Qg 2VDLA 2AGYA 2BKLA 2XDWA 3EQ7A 3OKYA 4IRZA 4L9OA 3K71A 1OMWB 3CFSB 3MZLA 2J55H 5EAPA 2VZ1A 5GXHA 5FFOA 1QFSA 3EI4A 2I0RA 3MKSB 3SVWD 1PEVA 2CN2A 4J87A 4L1MA 4A0AB 1U8CA 2QXVA 3OL2B 3U4YA 4J0WA 4A08B 3MXXA 3A0FA 3NIGA 3K26A 1QNIA 3I8EA 4KFMB 2VDMA 3JZGA 1A12A 4E54B 3OW8A 3SMRA 2EIEA 1PGUA 2VDRA 2HKMA 3JZNA 4X61B 3PSLA 4CY1A 2IUQA 3HFQA 2H6QA 3RFGA 4NC4A 4Y7RA 3JAMg 2CE8A 2XE4A 2H9NA 3GFCA 2YNPA 4CI8A 4CI3A 1T2XA 3ZE1A 4J79A 2J56H 2PM7B 1JV2A 5HE0B 2CO0C 3ULEC 1VE6A 4H5IA 3IKOA 3EI2A 4X3EA 3OL2A 4O2WA 4A09A 2VDNA 2TRCB 1SQ9A 3DDUA 4J86A 3RN0D 3SBQA 4GGDA 1N6EA 5I5IA 3EI2B 3EI4B 3ZDZA 1P22A 2H14A 5KDOB 4JSVC 4O3TB 1YFQA 4CY3A 3ZWLB 2XL3A 5M5VA 4E5ZA 4N14A 1JMZB 4JSPC 2Z2NA 2VZ3A 2UZXB 3QHYB 5EM2B 5GMKn 3IJ1A 3JRPA 4UM8A 4L3GD 5HYNB 2B5LA 2XYIA 3FRXA 3MUNA 1PBYB 2XL2A 3I8CA 2P9UC 2IUVA 3I2NA 3IVMA 2CNXA 1R5MA 1S4UX 2IWKA 2PM9A 2HXCA 3UVKA 1MG3A 3JZHA 2Q7QA 3KRXB 4ES0A 1L0QA 5FKSA 3EI3B 4Y5RD 1RI6A 2HU5A 1GXRA 1VZ3A 2Z2OA 1B9YA 5AFU3 4CZXA 4H5JA 1ERJA 4J81A 4FAVD 2B5NA 4PBYA 5EMJB 1TYEA 2H6NA 1E5TA 3IJ0A 2Z2PA 2HU8A 5B4WA 3VI4A 2AQ5A 3JPXA 3SJLD 5EMLB 2GC7A 3B7FA 4QT8A 3OKTA 2GC4A 4BCDA 4NAAA 4GZ8A 1H2ZA 2I0SA 3AL8A 3C75H 3IIWA 4J8BA 5K1CC 4I79A 3RLMD 2CN3A 1UTCA 5HE1B 3T3MA 3FGBA 2AGWA 2O9KA 5C2WB 5C9ZB 3EQ9A 2EIDA 3SBPA 1SQJA 2P9LC 3T3PA 1GOGA 1N6DA 2UZYB 4ZOXA 5E6UA 5H17A 3SWSD 1SHYB 3RMZD 2H13A 4ERZA 5H1MA 3PE7A 3P4FA 4J82A 3GC3B 1YR2A 5HE2B 4MK0B 4O3UB 2WQ8A 2HU7A 2CE9A 2XU7A 4J73A 3DM0A 5EARA 3RRMC 3KCIA 1U2VC 2EBSA 4NBMA 4J0XA 5E6SA 3SBRA 1K3IA 5CXBB 3BWSA 2YNNA 1UOOA 4FAND 2YNOA 2JKXA 1O6GA 4OZUA 5THAA 3J81g 1L5GA 5FQDA 2XZGA 4MMXA 3OF7A 2I0TA 4FA1D 4BP8A 4AN0A 4XEIC 3SCYA 4IA9A 3V9FA 4GQ2P 4X63B 4QQEA 3C99A 2YMUA 3AL9A 4MMZA 3EWEA 1E8MA 4A2MA 4IMMA 5FLXg 3MUOA 4QAMA 5FXYA 4UM9A 4A09B 3EQ8A 3BG1A 4A08A 4O45A 4JD2C 2PM6B 5AJAA 3O4HA 1QFMA 5CXCA 1XKSA 5M61A 4WK0A 4G1MA 4ZOZA 5GSAA 5CYKB 4ZN4A 5IJ8E 1VYHC 1H2WA 2VDOA 2P9IC 4D6VA 3L4MD 5IJ7E 1NEXB 5JWZA 4ERQA 4BUJC 2P9PC 4E5ZB 5IGQA 2MTAH 2OK6A 3DXMC 4J84A 2EICA 4GQ1A 2HJ4A 3UKRC 3CFVA 4AEZA 4E54A 3C5MA 4ZOVA 3NVXA 4CY5A 3ZDYA 3I7HA 3O4JA 2CO0A 3AL8B 3NIFA 3O4IA 4PSXB 3PXSD 1K32A 4A0BB 1VE7A 5IGOA 2OVPB 4FA4D 3VH0A 1TBGA 2VDPA 4GQBB 3J80g 3N0EA 4PC0A 4LGNA 3O4GA 4O9DA 3ORVD 3KRWB 5CXBA 3C9CA 3DWLC 4PSWB 1GOFA 4CC9A 4A7JA 2AGZA 3F3PA 1XIPA 3N0DA 2H6KA 3RSEC 4Z7NA 3IUNA 4L1QD 5I5JA 4FA9D 4OWRA 2G9AA 5H14A 3SHFA 4CZVA 4A2LA 1N6FA 2BCJB 3MMYA 5CYKA 3PXWD 2PM9B 2OIZA 3AFCA 3MVDK 3ZDXA 3NIDA 4G56B 1Q47A 5FKRA 3IJEA 2P9SC 2J57G 3I89A 3I7LA 3EU7A 2QR5A 1JOFA 4PXWA 4DNUA 5I5MA 3PXTD 3DSMA 5HDBA 4GM8A 2VC2A 4AMYA 4FWWA 3SN6B 4U1EI 3JROA 3L4OD 2OVRB 3F3FA 3QI0A 3E0CA 3EI3A 3ZE0A 4HDJA 2IUPA 3UVOA 3V4PA 4CY2A 5TDHB 4CI2A 3VI3A 2B5MA 2QC5A 3UVNA 1JTDB 3OTTA 4FHLA 4J8GA 3IUJA 4FA5D 4X60B 4CI1A 3UVMA 2HKRA 2IAAA 4NENA 4GM3A 5K19A 4JT5C 5EAMA 5E6RA 1M1XA 2GNQA 2OJYA 4XYHA 4CZYA 1JJUB 2QZPA 4RE5A 1OLZA 5M5SA 3IIYA 3IULA 1H2YA 3F3GA 5AMSA 5SXMA 2HJBA 4Z7OA 4A0AA 5FKQA 5GXIA 1MG2A 2H9MA 2VDQA 3V5WB 3I7NA 4BCCA 3PSCB 2YB8B 3UVLA 3IUQA 2I3TA 3ODTA 4MMYA 2OVQB 2AH1A 4LG9A 4PNKB 4AOWA 3AH8B 1K8KC 4D0KA 4GGCA 1UOPA
chains in the Genus database with same CATH topology
1MDAH 2H9PA 2P9KC 1FWXA 4XYIA 2H68A 5HQGA 3MKQA 3V7DB 3VGZA 5C2VB 3SXTD 2OK4A 4U7AA 2AH0A 4R7AB 2AGLA 2HESX 5TEEA 4K3ID 1U4CA 4LG8A 5HE3B 4J78A 3RFHA 2G99A 4QL1A 4ERYA 3PVWB 5TF2A 3UKUC 3K27A 2H9LA 3BG0A 2W18A 4FB1D 3FM0A 5CXCB 4J77A 4JT6C 5IC7A 5EM2A 4EWRA 1A0RB 2YBAA 3RN1D 3EI1B 4GMBA 4QRJA 4A0BA 3OKYB 4NSXA 3MZKA 4JSNC 1NR0A 2BBKH 3W15A 4Z8LA 3EI1A 3I7OA 1GG2B 3VA6A 4A11A 4GGAA 4JXMA 5EMMB 3GREA 4K3JB 4PBZA 5EALA 3CIKB 3I7KA 5FA5B 1GP2B 3I7PA 1GOTB 5IT9g 1B9XA 2B4EA 4UI9R 3SLED 1PI6A 2HYEA 1JMXB 3JB9L 2AGXA 3OKWA 5EMKB 4L3HD 3UR4A 3PVUB 2IURA 2H3XA 2H47A 2P9NC 4TZ4A 4BL0A 4O1QD 2IWFA 4GM9A 3SFZA 5FKTA 4BH6A 3IJCA 3NVNA 2I3SA 4ZOYA 1TYQC 3NVQA 4YVDA 1XHMA 4A11B 5TEFA 3DXKC 2PBIB 3EG6A 4JSXC 4ESGA 3EMHA 5A2Qg 2AGYA 3OKYA 4L9OA 1OMWB 3CFSB 3MZLA 2J55H 5EAPA 5GXHA 3EI4A 2I0RA 3MKSB 3SVWD 1PEVA 2CN2A 4J87A 4A0AB 2QXVA 3OL2B 3U4YA 4J0WA 4A08B 3MXXA 3A0FA 3K26A 1QNIA 3I8EA 4KFMB 3JZGA 4E54B 3OW8A 3SMRA 1PGUA 3JZNA 2HKMA 4X61B 3PSLA 4CY1A 2IUQA 3HFQA 2H6QA 3RFGA 4Y7RA 3JAMg 2CE8A 2H9NA 3GFCA 2YNPA 4CI8A 4CI3A 4J79A 2J56H 2PM7B 5HE0B 2CO0C 3ULEC 4H5IA 3IKOA 3EI2A 4X3EA 3OL2A 4A09A 2TRCB 1SQ9A 4J86A 3RN0D 3SBQA 4GGDA 1N6EA 5I5IA 3EI2B 3EI4B 1P22A 2H14A 5KDOB 4JSVC 4O3TB 1YFQA 4CY3A 3ZWLB 2XL3A 4E5ZA 4N14A 1JMZB 4JSPC 2Z2NA 2UZXB 5EM2B 5GMKn 3IJ1A 3JRPA 4L3GD 2B5LA 2XYIA 3FRXA 1PBYB 2XL2A 3I8CA 2P9UC 2IUVA 3I2NA 2CNXA 1R5MA 1S4UX 2IWKA 2PM9A 2HXCA 3UVKA 1MG3A 3JZHA 2Q7QA 3KRXB 4ES0A 1L0QA 5FKSA 3EI3B 4Y5RD 1RI6A 1GXRA 2Z2OA 1B9YA 5AFU3 4CZXA 4H5JA 1ERJA 4J81A 4FAVD 2B5NA 4PBYA 5EMJB 2H6NA 3IJ0A 2Z2PA 5B4WA 2AQ5A 3JPXA 3SJLD 5EMLB 2GC7A 3B7FA 4QT8A 3OKTA 2GC4A 4GZ8A 2I0SA 3AL8A 3C75H 3IIWA 4J8BA 5K1CC 4I79A 3RLMD 2CN3A 5HE1B 3FGBA 2AGWA 2O9KA 5C2WB 5C9ZB 3SBPA 1SQJA 2P9LC 4ZOXA 1N6DA 2UZYB 5H17A 3SWSD 4ERZA 5HYNB 1SHYB 3RMZD 2H13A 5H1MA 3PE7A 3P4FA 4J82A 5HE2B 4MK0B 4O3UB 2CE9A 2XU7A 4J73A 3DM0A 5EARA 3RRMC 1U2VC 2EBSA 4J0XA 3SBRA 5CXBB 3BWSA 2YNNA 4FAND 2YNOA 4OZUA 5THAA 3J81g 5FQDA 2I0TA 4FA1D 4XEIC 3SCYA 4IA9A 3V9FA 4GQ2P 4X63B 4QQEA 3C99A 2YMUA 3AL9A 3EWEA 4A2MA 4IMMA 5FLXg 5FXYA 4A09B 3BG1A 4A08A 4O45A 4JD2C 2PM6B 5AJAA 5CXCA 1XKSA 4ZOZA 5GSAA 5CYKB 4ZN4A 5IJ8E 1VYHC 4D6VA 2P9IC 3L4MD 5IJ7E 1NEXB 5JWZA 4ERQA 4BUJC 2P9PC 4E5ZB 5IGQA 2MTAH 2OK6A 4J84A 3DXMC 4GQ1A 2HJ4A 3UKRC 3CFVA 4AEZA 4E54A 3C5MA 4ZOVA 3NVXA 4CY5A 3I7HA 2CO0A 3AL8B 4PSXB 3PXSD 1K32A 4A0BB 5IGOA 2OVPB 4FA4D 3VH0A 1TBGA 4GQBB 3J80g 3N0EA 4PC0A 4LGNA 4O9DA 3ORVD 3KRWB 5CXBA 3C9CA 3DWLC 4PSWB 4CC9A 4A7JA 2AGZA 3F3PA 1XIPA 3N0DA 2H6KA 3RSEC 4L1QD 5I5JA 4FA9D 4OWRA 2G9AA 5H14A 3SHFA 4CZVA 4A2LA 1N6FA 2BCJB 3MMYA 5CYKA 3PXWD 2PM9B 2OIZA 3AFCA 4G56B 1Q47A 5FKRA 2P9SC 2J57G 3I89A 4PXWA 3I7LA 3EU7A 1JOFA 5I5MA 3PXTD 3DSMA 4GM8A 4FWWA 3SN6B 4U1EI 3JROA 3L4OD 2OVRB 3F3FA 3E0CA 3EI3A 4HDJA 2IUPA 3UVOA 4CI2A 4CY2A 5TDHB 2B5MA 2QC5A 3UVNA 3OTTA 4FHLA 4J8GA 4FA5D 4X60B 4CI1A 3UVMA 2HKRA 2IAAA 4GM3A 5K19A 4JT5C 5EAMA 2GNQA 2OJYA 4XYHA 4CZYA 1JJUB 1OLZA 3IIYA 3F3GA 5AMSA 5SXMA 2HJBA 4A0AA 5FKQA 5GXIA 1MG2A 2H9MA 3V5WB 3I7NA 3PSCB 2YB8B 3UVLA 2I3TA 3ODTA 2OVQB 2AH1A 4LG9A 4PNKB 4AOWA 3AH8B 1K8KC 4D0KA 4GGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MDA H;  2H9P A;  2P9K C;  1FWX A;  4XYI A;  2H68 A;  5HQG A;  3MKQ A;  3V7D B;  3VGZ A;  5C2V B;  3SXT D;  2OK4 A;  4U7A A;  2AH0 A;  4R7A B;  2AGL A;  2HES X;  5TEE A;  4K3I D;  1U4C A;  4LG8 A;  5HE3 B;  4J78 A;  3RFH A;  2G99 A;  4QL1 A;  4ERY A;  3PVW B;  5TF2 A;  3UKU C;  3K27 A;  2H9L A;  3BG0 A;  2W18 A;  4FB1 D;  3FM0 A;  5CXC B;  4J77 A;  4JT6 C;  5IC7 A;  5EM2 A;  4EWR A;  1A0R B;  2YBA A;  3RN1 D;  3EI1 B;  4GMB A;  4QRJ A;  4A0B A;  3OKY B;  4NSX A;  3MZK A;  4JSN C;  1NR0 A;  2BBK H;  3W15 A;  4Z8L A;  3EI1 A;  3I7O A;  1GG2 B;  3VA6 A;  4A11 A;  4GGA A;  4JXM A;  5EMM B;  3GRE A;  4K3J B;  4PBZ A;  5EAL A;  3CIK B;  3I7K A;  5FA5 B;  1GP2 B;  3I7P A;  1GOT B;  5IT9 g;  1B9X A;  2B4E A;  4UI9 R;  3SLE D;  1PI6 A;  2HYE A;  1JMX B;  3JB9 L;  2AGX A;  3OKW A;  5EMK B;  4L3H D;  3UR4 A;  3PVU B;  2IUR A;  2H3X A;  2H47 A;  2P9N C;  4TZ4 A;  4BL0 A;  4O1Q D;  2IWF A;  4GM9 A;  3SFZ A;  5FKT A;  4BH6 A;  3IJC A;  3NVN A;  2I3S A;  4ZOY A;  1TYQ C;  3NVQ A;  4YVD A;  1XHM A;  4A11 B;  5TEF A;  3DXK C;  2PBI B;  3EG6 A;  4JSX C;  4ESG A;  3EMH A;  5A2Q g;  2AGY A;  3OKY A;  4L9O A;  1OMW B;  3CFS B;  3MZL A;  2J55 H;  5EAP A;  5GXH A;  3EI4 A;  2I0R A;  3MKS B;  3SVW D;  1PEV A;  2CN2 A;  4J87 A;  4A0A B;  2QXV A;  3OL2 B;  3U4Y A;  4J0W A;  4A08 B;  3MXX A;  3A0F A;  3K26 A;  1QNI A;  3I8E A;  4KFM B;  3JZG A;  4E54 B;  3OW8 A;  3SMR A;  1PGU A;  3JZN A;  2HKM A;  4X61 B;  3PSL A;  4CY1 A;  2IUQ A;  3HFQ A;  2H6Q A;  3RFG A;  4Y7R A;  3JAM g;  2CE8 A;  2H9N A;  3GFC A;  2YNP A;  4CI8 A;  4CI3 A;  4J79 A;  2J56 H;  2PM7 B;  5HE0 B;  2CO0 C;  3ULE C;  4H5I A;  3IKO A;  3EI2 A;  4X3E A;  3OL2 A;  4A09 A;  2TRC B;  1SQ9 A;  4J86 A;  3RN0 D;  3SBQ A;  4GGD A;  1N6E A;  5I5I A;  3EI2 B;  3EI4 B;  1P22 A;  2H14 A;  5KDO B;  4JSV C;  4O3T B;  1YFQ A;  4CY3 A;  3ZWL B;  2XL3 A;  4E5Z A;  4N14 A;  1JMZ B;  4JSP C;  2Z2N A;  2UZX B;  5EM2 B;  5GMK n;  3IJ1 A;  3JRP A;  4L3G D;  2B5L A;  2XYI A;  3FRX A;  1PBY B;  2XL2 A;  3I8C A;  2P9U C;  2IUV A;  3I2N A;  2CNX A;  1R5M A;  1S4U X;  2IWK A;  2PM9 A;  2HXC A;  3UVK A;  1MG3 A;  3JZH A;  2Q7Q A;  3KRX B;  4ES0 A;  1L0Q A;  5FKS A;  3EI3 B;  4Y5R D;  1RI6 A;  1GXR A;  2Z2O A;  1B9Y A;  5AFU 3;  4CZX A;  4H5J A;  1ERJ A;  4J81 A;  4FAV D;  2B5N A;  4PBY A;  5EMJ B;  2H6N A;  3IJ0 A;  2Z2P A;  5B4W A;  2AQ5 A;  3JPX A;  3SJL D;  5EML B;  2GC7 A;  3B7F A;  4QT8 A;  3OKT A;  2GC4 A;  4GZ8 A;  2I0S A;  3AL8 A;  3C75 H;  3IIW A;  4J8B A;  5K1C C;  4I79 A;  3RLM D;  2CN3 A;  5HE1 B;  3FGB A;  2AGW A;  2O9K A;  5C2W B;  5C9Z B;  3SBP A;  1SQJ A;  2P9L C;  4ZOX A;  1N6D A;  2UZY B;  5H17 A;  3SWS D;  4ERZ A;  5HYN B;  1SHY B;  3RMZ D;  2H13 A;  5H1M A;  3PE7 A;  3P4F A;  4J82 A;  5HE2 B;  4MK0 B;  4O3U B;  2CE9 A;  2XU7 A;  4J73 A;  3DM0 A;  5EAR A;  3RRM C;  1U2V C;  2EBS A;  4J0X A;  3SBR A;  5CXB B;  3BWS A;  2YNN A;  4FAN D;  2YNO A;  4OZU A;  5THA A;  3J81 g;  5FQD A;  2I0T A;  4FA1 D;  4XEI C;  3SCY A;  4IA9 A;  3V9F A;  4GQ2 P;  4X63 B;  4QQE A;  3C99 A;  2YMU A;  3AL9 A;  3EWE A;  4A2M A;  4IMM A;  5FLX g;  5FXY A;  4A09 B;  3BG1 A;  4A08 A;  4O45 A;  4JD2 C;  2PM6 B;  5AJA A;  5CXC A;  1XKS A;  4ZOZ A;  5GSA A;  5CYK B;  4ZN4 A;  5IJ8 E;  1VYH C;  4D6V A;  2P9I C;  3L4M D;  5IJ7 E;  1NEX B;  5JWZ A;  4ERQ A;  4BUJ C;  2P9P C;  4E5Z B;  5IGQ A;  2MTA H;  2OK6 A;  4J84 A;  3DXM C;  4GQ1 A;  2HJ4 A;  3UKR C;  3CFV A;  4AEZ A;  4E54 A;  3C5M A;  4ZOV A;  3NVX A;  4CY5 A;  3I7H A;  2CO0 A;  3AL8 B;  4PSX B;  3PXS D;  1K32 A;  4A0B B;  5IGO A;  2OVP B;  4FA4 D;  3VH0 A;  1TBG A;  4GQB B;  3J80 g;  3N0E A;  4PC0 A;  4LGN A;  4O9D A;  3ORV D;  3KRW B;  5CXB A;  3C9C A;  3DWL C;  4PSW B;  4CC9 A;  4A7J A;  2AGZ A;  3F3P A;  1XIP A;  3N0D A;  2H6K A;  3RSE C;  4L1Q D;  5I5J A;  4FA9 D;  4OWR A;  2G9A A;  5H14 A;  3SHF A;  4CZV A;  4A2L A;  1N6F A;  2BCJ B;  3MMY A;  5CYK A;  3PXW D;  2PM9 B;  2OIZ A;  3AFC A;  4G56 B;  1Q47 A;  5FKR A;  2P9S C;  2J57 G;  3I89 A;  4PXW A;  3I7L A;  3EU7 A;  1JOF A;  5I5M A;  3PXT D;  3DSM A;  4GM8 A;  4FWW A;  3SN6 B;  4U1E I;  3JRO A;  3L4O D;  2OVR B;  3F3F A;  3E0C A;  3EI3 A;  4HDJ A;  2IUP A;  3UVO A;  4CI2 A;  4CY2 A;  5TDH B;  2B5M A;  2QC5 A;  3UVN A;  3OTT A;  4FHL A;  4J8G A;  4FA5 D;  4X60 B;  4CI1 A;  3UVM A;  2HKR A;  2IAA A;  4GM3 A;  5K19 A;  4JT5 C;  5EAM A;  2GNQ A;  2OJY A;  4XYH A;  4CZY A;  1JJU B;  1OLZ A;  3IIY A;  3F3G A;  5AMS A;  5SXM A;  2HJB A;  4A0A A;  5FKQ A;  5GXI A;  1MG2 A;  2H9M A;  3V5W B;  3I7N A;  3PSC B;  2YB8 B;  3UVL A;  2I3T A;  3ODT A;  2OVQ B;  2AH1 A;  4LG9 A;  4PNK B;  4AOW A;  3AH8 B;  1K8K C;  4D0K A;  4GGC A; 
#chains in the Genus database with same CATH topology
 4DNV A;  1VZ2 A;  1MDA H;  2H9P A;  2P9K C;  1FWX A;  4XYI A;  2H68 A;  5HQG A;  3MKQ A;  4BP9 A;  3V7D B;  3VGZ A;  5C2V B;  2EIB A;  3SXT D;  2OK4 A;  4U7A A;  2AH0 A;  4R7A B;  2AGL A;  2HES X;  5TEE A;  4K3I D;  1U4C A;  4LG8 A;  5HE3 B;  5M5R A;  1E8N A;  4J78 A;  3RFH A;  2G99 A;  4Z7Q A;  4QL1 A;  4ERY A;  3FCS A;  1C9I A;  3PVW B;  5TF2 A;  3UKU C;  4DNW A;  3K27 A;  3IUM A;  2H9L A;  1GOH A;  3BG0 A;  2W18 A;  4G1E A;  3FM0 A;  4JHN A;  4RE6 A;  5CXC B;  4FB1 D;  4J77 A;  4JT6 C;  5IC7 A;  4BCB A;  5EM2 A;  4EWR A;  1A0R B;  2YBA A;  3RN1 D;  3EI1 B;  4GMB A;  4QRJ A;  4A0B A;  3OKY B;  4WJK A;  4NSX A;  3GD1 I;  3MZK A;  4G55 A;  3K6S A;  4JSN C;  1NR0 A;  2BBK H;  4AMZ A;  3W15 A;  4WK2 A;  1UOQ A;  4O02 A;  4Z8L A;  3EI1 A;  3I7O A;  4D9S A;  1GG2 B;  3VA6 A;  4A11 A;  5C86 A;  4GGA A;  4JXM A;  5EMM B;  3GRE A;  4K3J B;  4PBZ A;  5EAL A;  3CIK B;  3I7K A;  1C9L A;  5FA5 B;  1BPO A;  3K72 A;  1GP2 B;  3ZE2 A;  3I7P A;  1I2M B;  4WK4 A;  5M5T A;  1O6F A;  4AN1 A;  1GOT B;  5C92 A;  5IT9 g;  1B9X A;  2B4E A;  4UI9 R;  3SLE D;  1PI6 A;  2HYE A;  1JMX B;  3JB9 L;  3V4V A;  2AGX A;  3OKW A;  5EMK B;  4L3H D;  3UR4 A;  3PVU B;  2IUR A;  2H3X A;  2H47 A;  2P9N C;  4TZ4 A;  4BL0 A;  4O1Q D;  4JHP C;  2IWF A;  4GM9 A;  3SFZ A;  3FCU A;  5FKT A;  4BH6 A;  5FFG A;  3IJC A;  1H2X A;  3NVN A;  2I3S A;  3IUR A;  4ZOY A;  1TYQ C;  4AX4 A;  3NVQ A;  4YVD A;  5M5U A;  1XHM A;  4A11 B;  5TEF A;  3DXK C;  2PBI B;  3EG6 A;  4JSX C;  4ESG A;  2VDK A;  3EMH A;  5A2Q g;  2VDL A;  2AGY A;  2BKL A;  2XDW A;  3EQ7 A;  3OKY A;  4IRZ A;  4L9O A;  3K71 A;  1OMW B;  3CFS B;  3MZL A;  2J55 H;  5EAP A;  2VZ1 A;  5GXH A;  5FFO A;  1QFS A;  3EI4 A;  2I0R A;  3MKS B;  3SVW D;  1PEV A;  2CN2 A;  4J87 A;  4L1M A;  4A0A B;  1U8C A;  2QXV A;  3OL2 B;  3U4Y A;  4J0W A;  4A08 B;  3MXX A;  3A0F A;  3NIG A;  3K26 A;  1QNI A;  3I8E A;  4KFM B;  2VDM A;  3JZG A;  1A12 A;  4E54 B;  3OW8 A;  3SMR A;  2EIE A;  1PGU A;  2VDR A;  2HKM A;  3JZN A;  4X61 B;  3PSL A;  4CY1 A;  2IUQ A;  3HFQ A;  2H6Q A;  3RFG A;  4NC4 A;  4Y7R A;  3JAM g;  2CE8 A;  2XE4 A;  2H9N A;  3GFC A;  2YNP A;  4CI8 A;  4CI3 A;  1T2X A;  3ZE1 A;  4J79 A;  2J56 H;  2PM7 B;  1JV2 A;  5HE0 B;  2CO0 C;  3ULE C;  1VE6 A;  4H5I A;  3IKO A;  3EI2 A;  4X3E A;  3OL2 A;  4O2W A;  4A09 A;  2VDN A;  2TRC B;  1SQ9 A;  3DDU A;  4J86 A;  3RN0 D;  3SBQ A;  4GGD A;  1N6E A;  5I5I A;  3EI2 B;  3EI4 B;  3ZDZ A;  1P22 A;  2H14 A;  5KDO B;  4JSV C;  4O3T B;  1YFQ A;  4CY3 A;  3ZWL B;  2XL3 A;  5M5V A;  4E5Z A;  4N14 A;  1JMZ B;  4JSP C;  2Z2N A;  2VZ3 A;  2UZX B;  3QHY B;  5EM2 B;  5GMK n;  3IJ1 A;  3JRP A;  4UM8 A;  4L3G D;  5HYN B;  2B5L A;  2XYI A;  3FRX A;  3MUN A;  1PBY B;  2XL2 A;  3I8C A;  2P9U C;  2IUV A;  3I2N A;  3IVM A;  2CNX A;  1R5M A;  1S4U X;  2IWK A;  2PM9 A;  2HXC A;  3UVK A;  1MG3 A;  3JZH A;  2Q7Q A;  3KRX B;  4ES0 A;  1L0Q A;  5FKS A;  3EI3 B;  4Y5R D;  1RI6 A;  2HU5 A;  1GXR A;  1VZ3 A;  2Z2O A;  1B9Y A;  5AFU 3;  4CZX A;  4H5J A;  1ERJ A;  4J81 A;  4FAV D;  2B5N A;  4PBY A;  5EMJ B;  1TYE A;  2H6N A;  1E5T A;  3IJ0 A;  2Z2P A;  2HU8 A;  5B4W A;  3VI4 A;  2AQ5 A;  3JPX A;  3SJL D;  5EML B;  2GC7 A;  3B7F A;  4QT8 A;  3OKT A;  2GC4 A;  4BCD A;  4NAA A;  4GZ8 A;  1H2Z A;  2I0S A;  3AL8 A;  3C75 H;  3IIW A;  4J8B A;  5K1C C;  4I79 A;  3RLM D;  2CN3 A;  1UTC A;  5HE1 B;  3T3M A;  3FGB A;  2AGW A;  2O9K A;  5C2W B;  5C9Z B;  3EQ9 A;  2EID A;  3SBP A;  1SQJ A;  2P9L C;  3T3P A;  1GOG A;  1N6D A;  2UZY B;  4ZOX A;  5E6U A;  5H17 A;  3SWS D;  1SHY B;  3RMZ D;  2H13 A;  4ERZ A;  5H1M A;  3PE7 A;  3P4F A;  4J82 A;  3GC3 B;  1YR2 A;  5HE2 B;  4MK0 B;  4O3U B;  2WQ8 A;  2HU7 A;  2CE9 A;  2XU7 A;  4J73 A;  3DM0 A;  5EAR A;  3RRM C;  3KCI A;  1U2V C;  2EBS A;  4NBM A;  4J0X A;  5E6S A;  3SBR A;  1K3I A;  5CXB B;  3BWS A;  2YNN A;  1UOO A;  4FAN D;  2YNO A;  2JKX A;  1O6G A;  4OZU A;  5THA A;  3J81 g;  1L5G A;  5FQD A;  2XZG A;  4MMX A;  3OF7 A;  2I0T A;  4FA1 D;  4BP8 A;  4AN0 A;  4XEI C;  3SCY A;  4IA9 A;  3V9F A;  4GQ2 P;  4X63 B;  4QQE A;  3C99 A;  2YMU A;  3AL9 A;  4MMZ A;  3EWE A;  1E8M A;  4A2M A;  4IMM A;  5FLX g;  3MUO A;  4QAM A;  5FXY A;  4UM9 A;  4A09 B;  3EQ8 A;  3BG1 A;  4A08 A;  4O45 A;  4JD2 C;  2PM6 B;  5AJA A;  3O4H A;  1QFM A;  5CXC A;  1XKS A;  5M61 A;  4WK0 A;  4G1M A;  4ZOZ A;  5GSA A;  5CYK B;  4ZN4 A;  5IJ8 E;  1VYH C;  1H2W A;  2VDO A;  2P9I C;  4D6V A;  3L4M D;  5IJ7 E;  1NEX B;  5JWZ A;  4ERQ A;  4BUJ C;  2P9P C;  4E5Z B;  5IGQ A;  2MTA H;  2OK6 A;  3DXM C;  4J84 A;  2EIC A;  4GQ1 A;  2HJ4 A;  3UKR C;  3CFV A;  4AEZ A;  4E54 A;  3C5M A;  4ZOV A;  3NVX A;  4CY5 A;  3ZDY A;  3I7H A;  3O4J A;  2CO0 A;  3AL8 B;  3NIF A;  3O4I A;  4PSX B;  3PXS D;  1K32 A;  4A0B B;  1VE7 A;  5IGO A;  2OVP B;  4FA4 D;  3VH0 A;  1TBG A;  2VDP A;  4GQB B;  3J80 g;  3N0E A;  4PC0 A;  4LGN A;  3O4G A;  4O9D A;  3ORV D;  3KRW B;  5CXB A;  3C9C A;  3DWL C;  4PSW B;  1GOF A;  4CC9 A;  4A7J A;  2AGZ A;  3F3P A;  1XIP A;  3N0D A;  2H6K A;  3RSE C;  4Z7N A;  3IUN A;  4L1Q D;  5I5J A;  4FA9 D;  4OWR A;  2G9A A;  5H14 A;  3SHF A;  4CZV A;  4A2L A;  1N6F A;  2BCJ B;  3MMY A;  5CYK A;  3PXW D;  2PM9 B;  2OIZ A;  3AFC A;  3MVD K;  3ZDX A;  3NID A;  4G56 B;  1Q47 A;  5FKR A;  3IJE A;  2P9S C;  2J57 G;  3I89 A;  3I7L A;  3EU7 A;  2QR5 A;  1JOF A;  4PXW A;  4DNU A;  5I5M A;  3PXT D;  3DSM A;  5HDB A;  4GM8 A;  2VC2 A;  4AMY A;  4FWW A;  3SN6 B;  4U1E I;  3JRO A;  3L4O D;  2OVR B;  3F3F A;  3QI0 A;  3E0C A;  3EI3 A;  3ZE0 A;  4HDJ A;  2IUP A;  3UVO A;  3V4P A;  4CY2 A;  5TDH B;  4CI2 A;  3VI3 A;  2B5M A;  2QC5 A;  3UVN A;  1JTD B;  3OTT A;  4FHL A;  4J8G A;  3IUJ A;  4FA5 D;  4X60 B;  4CI1 A;  3UVM A;  2HKR A;  2IAA A;  4NEN A;  4GM3 A;  5K19 A;  4JT5 C;  5EAM A;  5E6R A;  1M1X A;  2GNQ A;  2OJY A;  4XYH A;  4CZY A;  1JJU B;  2QZP A;  4RE5 A;  1OLZ A;  5M5S A;  3IIY A;  3IUL A;  1H2Y A;  3F3G A;  5AMS A;  5SXM A;  2HJB A;  4Z7O A;  4A0A A;  5FKQ A;  5GXI A;  1MG2 A;  2H9M A;  2VDQ A;  3V5W B;  3I7N A;  4BCC A;  3PSC B;  2YB8 B;  3UVL A;  3IUQ A;  2I3T A;  3ODT A;  4MMY A;  2OVQ B;  2AH1 A;  4LG9 A;  4PNK B;  4AOW A;  3AH8 B;  1K8K C;  4D0K A;  4GGC A;  1UOP A; 
#chains in the Genus database with same CATH homology
 1MDA H;  2H9P A;  2P9K C;  1FWX A;  4XYI A;  2H68 A;  5HQG A;  3MKQ A;  3V7D B;  3VGZ A;  5C2V B;  3SXT D;  2OK4 A;  4U7A A;  2AH0 A;  4R7A B;  2AGL A;  2HES X;  5TEE A;  4K3I D;  1U4C A;  4LG8 A;  5HE3 B;  4J78 A;  3RFH A;  2G99 A;  4QL1 A;  4ERY A;  3PVW B;  5TF2 A;  3UKU C;  3K27 A;  2H9L A;  3BG0 A;  2W18 A;  4FB1 D;  3FM0 A;  5CXC B;  4J77 A;  4JT6 C;  5IC7 A;  5EM2 A;  4EWR A;  1A0R B;  2YBA A;  3RN1 D;  3EI1 B;  4GMB A;  4QRJ A;  4A0B A;  3OKY B;  4NSX A;  3MZK A;  4JSN C;  1NR0 A;  2BBK H;  3W15 A;  4Z8L A;  3EI1 A;  3I7O A;  1GG2 B;  3VA6 A;  4A11 A;  4GGA A;  4JXM A;  5EMM B;  3GRE A;  4K3J B;  4PBZ A;  5EAL A;  3CIK B;  3I7K A;  5FA5 B;  1GP2 B;  3I7P A;  1GOT B;  5IT9 g;  1B9X A;  2B4E A;  4UI9 R;  3SLE D;  1PI6 A;  2HYE A;  1JMX B;  3JB9 L;  2AGX A;  3OKW A;  5EMK B;  4L3H D;  3UR4 A;  3PVU B;  2IUR A;  2H3X A;  2H47 A;  2P9N C;  4TZ4 A;  4BL0 A;  4O1Q D;  2IWF A;  4GM9 A;  3SFZ A;  5FKT A;  4BH6 A;  3IJC A;  3NVN A;  2I3S A;  4ZOY A;  1TYQ C;  3NVQ A;  4YVD A;  1XHM A;  4A11 B;  5TEF A;  3DXK C;  2PBI B;  3EG6 A;  4JSX C;  4ESG A;  3EMH A;  5A2Q g;  2AGY A;  3OKY A;  4L9O A;  1OMW B;  3CFS B;  3MZL A;  2J55 H;  5EAP A;  5GXH A;  3EI4 A;  2I0R A;  3MKS B;  3SVW D;  1PEV A;  2CN2 A;  4J87 A;  4A0A B;  2QXV A;  3OL2 B;  3U4Y A;  4J0W A;  4A08 B;  3MXX A;  3A0F A;  3K26 A;  1QNI A;  3I8E A;  4KFM B;  3JZG A;  4E54 B;  3OW8 A;  3SMR A;  1PGU A;  3JZN A;  2HKM A;  4X61 B;  3PSL A;  4CY1 A;  2IUQ A;  3HFQ A;  2H6Q A;  3RFG A;  4Y7R A;  3JAM g;  2CE8 A;  2H9N A;  3GFC A;  2YNP A;  4CI8 A;  4CI3 A;  4J79 A;  2J56 H;  2PM7 B;  5HE0 B;  2CO0 C;  3ULE C;  4H5I A;  3IKO A;  3EI2 A;  4X3E A;  3OL2 A;  4A09 A;  2TRC B;  1SQ9 A;  4J86 A;  3RN0 D;  3SBQ A;  4GGD A;  1N6E A;  5I5I A;  3EI2 B;  3EI4 B;  1P22 A;  2H14 A;  5KDO B;  4JSV C;  4O3T B;  1YFQ A;  4CY3 A;  3ZWL B;  2XL3 A;  4E5Z A;  4N14 A;  1JMZ B;  4JSP C;  2Z2N A;  2UZX B;  5EM2 B;  5GMK n;  3IJ1 A;  3JRP A;  4L3G D;  2B5L A;  2XYI A;  3FRX A;  1PBY B;  2XL2 A;  3I8C A;  2P9U C;  2IUV A;  3I2N A;  2CNX A;  1R5M A;  1S4U X;  2IWK A;  2PM9 A;  2HXC A;  3UVK A;  1MG3 A;  3JZH A;  2Q7Q A;  3KRX B;  4ES0 A;  1L0Q A;  5FKS A;  3EI3 B;  4Y5R D;  1RI6 A;  1GXR A;  2Z2O A;  1B9Y A;  5AFU 3;  4CZX A;  4H5J A;  1ERJ A;  4J81 A;  4FAV D;  2B5N A;  4PBY A;  5EMJ B;  2H6N A;  3IJ0 A;  2Z2P A;  5B4W A;  2AQ5 A;  3JPX A;  3SJL D;  5EML B;  2GC7 A;  3B7F A;  4QT8 A;  3OKT A;  2GC4 A;  4GZ8 A;  2I0S A;  3AL8 A;  3C75 H;  3IIW A;  4J8B A;  5K1C C;  4I79 A;  3RLM D;  2CN3 A;  5HE1 B;  3FGB A;  2AGW A;  2O9K A;  5C2W B;  5C9Z B;  3SBP A;  1SQJ A;  2P9L C;  4ZOX A;  1N6D A;  2UZY B;  5H17 A;  3SWS D;  4ERZ A;  5HYN B;  1SHY B;  3RMZ D;  2H13 A;  5H1M A;  3PE7 A;  3P4F A;  4J82 A;  5HE2 B;  4MK0 B;  4O3U B;  2CE9 A;  2XU7 A;  4J73 A;  3DM0 A;  5EAR A;  3RRM C;  1U2V C;  2EBS A;  4J0X A;  3SBR A;  5CXB B;  3BWS A;  2YNN A;  4FAN D;  2YNO A;  4OZU A;  5THA A;  3J81 g;  5FQD A;  2I0T A;  4FA1 D;  4XEI C;  3SCY A;  4IA9 A;  3V9F A;  4GQ2 P;  4X63 B;  4QQE A;  3C99 A;  2YMU A;  3AL9 A;  3EWE A;  4A2M A;  4IMM A;  5FLX g;  5FXY A;  4A09 B;  3BG1 A;  4A08 A;  4O45 A;  4JD2 C;  2PM6 B;  5AJA A;  5CXC A;  1XKS A;  4ZOZ A;  5GSA A;  5CYK B;  4ZN4 A;  5IJ8 E;  1VYH C;  4D6V A;  2P9I C;  3L4M D;  5IJ7 E;  1NEX B;  5JWZ A;  4ERQ A;  4BUJ C;  2P9P C;  4E5Z B;  5IGQ A;  2MTA H;  2OK6 A;  4J84 A;  3DXM C;  4GQ1 A;  2HJ4 A;  3UKR C;  3CFV A;  4AEZ A;  4E54 A;  3C5M A;  4ZOV A;  3NVX A;  4CY5 A;  3I7H A;  2CO0 A;  3AL8 B;  4PSX B;  3PXS D;  1K32 A;  4A0B B;  5IGO A;  2OVP B;  4FA4 D;  3VH0 A;  1TBG A;  4GQB B;  3J80 g;  3N0E A;  4PC0 A;  4LGN A;  4O9D A;  3ORV D;  3KRW B;  5CXB A;  3C9C A;  3DWL C;  4PSW B;  4CC9 A;  4A7J A;  2AGZ A;  3F3P A;  1XIP A;  3N0D A;  2H6K A;  3RSE C;  4L1Q D;  5I5J A;  4FA9 D;  4OWR A;  2G9A A;  5H14 A;  3SHF A;  4CZV A;  4A2L A;  1N6F A;  2BCJ B;  3MMY A;  5CYK A;  3PXW D;  2PM9 B;  2OIZ A;  3AFC A;  4G56 B;  1Q47 A;  5FKR A;  2P9S C;  2J57 G;  3I89 A;  4PXW A;  3I7L A;  3EU7 A;  1JOF A;  5I5M A;  3PXT D;  3DSM A;  4GM8 A;  4FWW A;  3SN6 B;  4U1E I;  3JRO A;  3L4O D;  2OVR B;  3F3F A;  3E0C A;  3EI3 A;  4HDJ A;  2IUP A;  3UVO A;  4CI2 A;  4CY2 A;  5TDH B;  2B5M A;  2QC5 A;  3UVN A;  3OTT A;  4FHL A;  4J8G A;  4FA5 D;  4X60 B;  4CI1 A;  3UVM A;  2HKR A;  2IAA A;  4GM3 A;  5K19 A;  4JT5 C;  5EAM A;  2GNQ A;  2OJY A;  4XYH A;  4CZY A;  1JJU B;  1OLZ A;  3IIY A;  3F3G A;  5AMS A;  5SXM A;  2HJB A;  4A0A A;  5FKQ A;  5GXI A;  1MG2 A;  2H9M A;  3V5W B;  3I7N A;  3PSC B;  2YB8 B;  3UVL A;  2I3T A;  3ODT A;  2OVQ B;  2AH1 A;  4LG9 A;  4PNK B;  4AOW A;  3AH8 B;  1K8K C;  4D0K A;  4GGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...