2G99A

Structural basis for the specific recognition of methylated histone h3 lysine 4 by the wd-40 protein wdr5
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
304
structure length
304
Chain Sequence
b'PVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD-repeat protein 5
publication title Structural basis for the specific recognition of methylated histone H3 lysine 4 by the WD-40 protein WDR5
rcsb
source organism Homo sapiens
molecule tags Structural protein/dna binding protein
total genus 94
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2g99A00
5TEFA 1JMXB 2P9PC 2GNQA 3UR4A 5CXCB 2AGXA 4A08A 2YBAA 2AQ5A 3PVUB 2PM9B 5EARA 3I8CA 4JXMA 3RSEC 2I0TA 5FA5B 3OL2B 3N0DA 4J73A 3ZWLB 3RLMD 4FA9D 4D0KA 4GQBB 3EG6A 3PXTD 2Z2OA 2CE9A 3RN1D 5EMKB 3NVNA 1U2VC 5FXYA 3FRXA 3AL8B 5C2VB 4KFMB 2Q7QA 4OZUA 4J0XA 4A2LA 3EI4B 3SFZA 5C2WB 2IUVA 4MK0B 2P9IC 4ZOXA 4X3EA 3PXSD 2AGZA 4FB1D 4K3ID 4AEZA 4ERZA 4A0AB 1R5MA 2OVQB 3E0CA 2H3XA 4Y5RD 3SVWD 2H9PA 3UVKA 2I3SA 4FHLA 3RFHA 2OJYA 2AGLA 2H6QA 4A11B 1A0RB 4XYHA 3EU7A 5HE3B 4AOWA 3JAMg 3W15A 1NR0A 2YNPA 3AH8B 5IJ8E 2J56H 2CE8A 3DM0A 2CNXA 3IJ0A 2BCJB 4CI1A 4GQ1A 4LG9A 1ERJA 4GGDA 3SHFA 4EWRA 3CIKB 2G99A 3EI3B 4QQEA 4O9DA 1JOFA 4ERYA 5HE1B 2MTAH 4TZ4A 4IA9A 4PC0A 4JT5C 5CXBA 3MZKA 5HE2B 5THAA 5EMJB 3ORVD 2I3TA 5EAPA 3FM0A 3C75H 3SBPA 2IUPA 2XU7A 3NVXA 4A09B 1P22A 5I5MA 4QT8A 4CZYA 4IMMA 4QL1A 2HKRA 2PM7B 4CC9A 5CYKB 4FAVD 2HYEA 5FKRA 4NSXA 5AMSA 4BL0A 3B7FA 4PBYA 3I7HA 4JSXC 3OKWA 4LG8A 1YFQA 4ZN4A 4CY1A 1K32A 4J8GA 3PE7A 4J87A 3PSCB 5K1CC 4O1QD 3UKUC 1OMWB 1NEXB 2AGWA 1XIPA 4JSPC 1VYHC 4J84A 1XHMA 5SXMA 5H14A 3PSLA 2TRCB 1JMZB 1SHYB 4E54A 3DWLC 2H6KA 4CY2A 2OVRB 3I8EA 3UVNA 1SQ9A 2P9NC 1MDAH 5EM2A 3UVMA 3I7NA 4ES0A 5CXBB 3EMHA 3J80g 2AGYA 4FA5D 2Z2NA 4ZOYA 2IURA 3I2NA 2OK6A 3EI2A 4OWRA 3I7OA 4FAND 4J77A 3JZGA 4CI2A 2H9NA 3PXWD 2IAAA 4BH6A 4J79A 2P9SC 3P4FA 2H47A 1L0QA 4J78A 1PBYB 1PEVA 2I0SA 2YMUA 2YNNA 4FA4D 2HESX 1GG2B 1QNIA 3JZHA 3I7LA 3U4YA 3EI1A 3UVOA 4E5ZB 5FKQA 3V7DB 4XYIA 1N6DA 2HXCA 4ERQA 4A08B 2B5LA 1PI6A 4D6VA 1B9XA 2PM6B 3I89A 5I5JA 4E54B 2Z2PA 3MMYA 4I79A 3CFSB 2O9KA 3JB9L 5GSAA 4L9OA 4PNKB 3IJCA 3RN0D 4A7JA 3IIWA 1GOTB 4GM9A 4XEIC 3VA6A 4L1QD 3UKRC 2CN2A 3JZNA 5IGQA 3GREA 3OKYA 4O3TB 2HJ4A 3N0EA 3BG0A 4A2MA 4JT6C 3SCYA 4BUJC 5CXCA 4CI8A 2P9UC 3DXKC 4O3UB 4N14A 1K8KC 2G9AA 3MKQA 4GM3A 4CY3A 2QC5A 3DSMA 3FGBA 5TEEA 5A2Qg 3V9FA 3OL2A 3BWSA 3CFVA 2OVPB 3GFCA 5IJ7E 3A0FA 1TBGA 2XL2A 4CI3A 5EMMB 2BBKH 2HKMA 4H5IA 4Z8LA 2XYIA 1N6EA 5FLXg 2CN3A 3RRMC 2W18A 4J8BA 3OTTA 4R7AB 3VGZA 2J55H 3AL8A 2H13A 4UI9R 3KRWB 3SJLD 4U1EI 2PBIB 2H6NA 5K19A 3EI4A 5GXIA 5EAMA 4ZOVA 3BG1A 3IKOA 5FKTA 2IUQA 3I7KA 3C9CA 5FQDA 2OIZA 4J86A 4GGAA 4LGNA 3ODTA 2B5MA 3UVLA 4JD2C 4J82A 1OLZA 2CO0A 3MZLA 3JROA 2AH1A 5H1MA 3F3PA 4HDJA 2H14A 1GP2B 3C99A 5EALA 4J0WA 3RFGA 3JRPA 4A11A 1TYQC 2P9KC 4PSXB 5KDOB 2UZYB 5FKSA 3MKSB 2H9MA 5IC7A 4Y7RA 1FWXA 5GXHA 2YNOA 2H68A 5AJAA 3EI3A 5HYNB 5TF2A 4ESGA 3I7PA 4K3JB 5HE0B 4GGCA 3SBQA 3SWSD 3ULEC 3SMRA 3AFCA 4ZOZA 3L4MD 3SLED 5EMLB 4FWWA 4JSNC 4FA1D 3K26A 1N6FA 4A09A 3F3FA 1MG2A 2H9LA 4YVDA 4X60B 4H5JA 1U4CA 5CYKA 5EM2B 4CZXA 1SQJA 2YB8B 5H17A 3SN6B 3IJ1A 1B9YA 1RI6A 3EWEA 3L4OD 1MG3A 2QXVA 4GMBA 5I5IA 2CO0C 4A0BA 3EI2B 5JWZA 4L3GD 4GZ8A 4L3HD 2EBSA 3F3GA 2J57G 3MXXA 4X63B 2B5NA 2OK4A 2PM9A 2I0RA 4JSVC 5AFU3 5IT9g 2P9LC 5HQGA 3C5MA 1S4UX 4U7AA 5GMKn 4O45A 1PGUA 3J81g 4G56B 3EI1B 3KRXB 3OKTA 4PBZA 2B4EA 3SBRA 3K27A 1Q47A 5C9ZB 2IWFA 4CY5A 2GC4A 3SXTD 3OW8A 3AL9A 1GXRA 3VH0A 5IGOA 3DXMC 3V5WB 5B4WA 3RMZD 4GM8A 4X61B 4CZVA 3NVQA 4J81A 1JJUB 4PSWB 2GC7A 3HFQA 2UZXB 2HJBA 2AH0A 2XL3A 4QRJA 4PXWA 3PVWB 4A0BB 3IIYA 1XKSA 2IWKA 3JPXA 4GQ2P 5TDHB 3OKYB 4A0AA 4E5ZA
chains in the Genus database with same CATH superfamily
5TEFA 1JMXB 3IURA 2P9PC 2QZPA 2GNQA 5E6SA 3UR4A 3EQ8A 5CXCB 4WK2A 2AGXA 4A08A 1JV2A 2YBAA 2AQ5A 3PVUB 2VDPA 2PM9B 5EARA 4WK4A 3I8CA 4JXMA 3RSEC 1M1XA 2I0TA 5FA5B 3IVMA 3OL2B 3N0DA 4J73A 3ZWLB 3RLMD 4FA9D 4D0KA 3IULA 4GQBB 3EG6A 3PXTD 2Z2OA 2CE9A 1H2YA 3RN1D 5EMKB 3NVNA 1U2VC 5FXYA 3FRXA 1UOOA 3AL8B 5C2VB 4KFMB 2Q7QA 4OZUA 4J0XA 3O4HA 4A2LA 3EI4B 3SFZA 1UOPA 5C2WB 3T3MA 2IUVA 3O4GA 3NIFA 4MK0B 2P9IC 4ZOXA 4X3EA 3PXSD 2AGZA 3IUQA 4FB1D 4K3ID 4AEZA 4ERZA 4A0AB 2VC2A 1R5MA 2OVQB 3E0CA 2H3XA 4BP9A 4Y5RD 3ZDXA 3MUNA 3SVWD 2H9PA 3UVKA 2I3SA 4FHLA 3RFHA 2OJYA 2AGLA 2H6QA 4A11B 1E8NA 1A0RB 4UM8A 3EU7A 4XYHA 5HE3B 4AOWA 3JAMg 3W15A 3ZE0A 1NR0A 4QAMA 2YNPA 3AH8B 5IJ8E 1H2XA 2J56H 2CE8A 3DM0A 2CNXA 3IJ0A 2BCJB 4CI1A 4GQ1A 4LG9A 1ERJA 4GGDA 3SHFA 4EWRA 3CIKB 5E6RA 2G99A 3EI3B 2VDQA 3FCUA 4O9DA 4QQEA 1JOFA 2XE4A 4ERYA 5HE1B 2MTAH 4TZ4A 4IA9A 4PC0A 3K71A 4JT5C 5CXBA 1VE7A 3MZKA 5HE2B 5THAA 5EMJB 3ORVD 2I3TA 5EAPA 3FM0A 3GD1I 1L5GA 5M5SA 3C75H 3SBPA 2IUPA 2XU7A 3NVXA 4A09B 1P22A 5FFOA 5I5MA 4QT8A 4CZYA 2JKXA 4IMMA 4QL1A 2HKRA 2PM7B 4CC9A 4Z7NA 5CYKB 4FAVD 2HYEA 5FKRA 4NSXA 4Z7OA 5AMSA 4BL0A 3B7FA 4PBYA 3I7HA 3EQ9A 4JSXC 1A12A 3OKWA 4LG8A 1YFQA 1VE6A 4ZN4A 3K6SA 4CY1A 1K32A 3QHYB 4J8GA 3PE7A 4J87A 4NAAA 3PSCB 1UOQA 5K1CC 3ZE2A 2VDOA 2VZ1A 4O1QD 3UKUC 3K72A 1OMWB 1NEXB 2AGWA 1XIPA 4JSPC 3IUNA 1VYHC 4J84A 1XHMA 2HU8A 5SXMA 5H14A 3O4IA 3PSLA 2TRCB 1UTCA 3NIDA 5M5RA 1JMZB 1SHYB 2VDRA 4E54A 3DWLC 2H6KA 4CY2A 2OVRB 1E8MA 3I8EA 1SQ9A 2P9NC 1MDAH 4G1MA 5EM2A 3UVNA 3UVMA 3I7NA 4ES0A 5CXBB 3EMHA 1GOGA 2VDLA 2AGYA 4FA5D 3J80g 3ZDYA 4MMXA 2Z2NA 4ZOYA 1VZ2A 2IURA 3I2NA 4IRZA 4D9SA 4NC4A 1T2XA 2OK6A 4DNUA 3EI2A 4OWRA 3VI4A 3I7OA 4FAND 4J77A 3JZGA 4CI2A 2H9NA 3PXWD 2IAAA 4BH6A 3V4PA 4J79A 4MMYA 2P9SC 3P4FA 2H47A 1L0QA 4L1MA 4J78A 1PBYB 1PEVA 2I0SA 2YMUA 2YNNA 4FA4D 1VZ3A 2HESX 1GG2B 1QNIA 3JZHA 3I7LA 3U4YA 3EI1A 3MUOA 3UVOA 4E5ZB 3NIGA 5FKQA 3V7DB 4XYIA 1N6DA 2HXCA 4JHPC 4DNWA 4ERQA 2B5LA 2EIEA 1PI6A 2XZGA 4A08B 4D6VA 1B9XA 2PM6B 3I89A 5I5JA 4E54B 2Z2PA 3MMYA 4I79A 4AMZA 3CFSB 2BKLA 2O9KA 3JB9L 1QFSA 5GSAA 1O6GA 4L9OA 4PNKB 3IJCA 3RN0D 3FCSA 4A7JA 3IIWA 1GOTB 4GM9A 4XEIC 3VA6A 2WQ8A 3V4VA 4L1QD 3UKRC 4BCBA 2CN2A 3JZNA 5IGQA 3GREA 3OKYA 4O3TB 2HJ4A 3N0EA 3BG0A 4A2MA 4JT6C 3SCYA 4BUJC 2VZ3A 5CXCA 2P9UC 4CI8A 3DXKC 4O3UB 4N14A 1K8KC 3OF7A 4RE5A 2G9AA 3MKQA 4GM3A 4CY3A 2QC5A 3DSMA 3FGBA 5TEEA 1GOHA 5A2Qg 3V9FA 3OL2A 3BWSA 2XDWA 3CFVA 2OVPB 3GFCA 5IJ7E 3A0FA 1TBGA 2XL2A 4CI3A 5EMMB 2EICA 2BBKH 2HKMA 4H5IA 4Z8LA 4O2WA 2XYIA 1N6EA 5FLXg 2CN3A 3RRMC 2W18A 4AN0A 4J8BA 3OTTA 4R7AB 3VGZA 4O02A 2J55H 1BPOA 3AL8A 2H13A 4UI9R 3ZE1A 5FFGA 1H2WA 3DDUA 4AN1A 3KRWB 3SJLD 4U1EI 2PBIB 4NENA 2H6NA 5K19A 5M5TA 4G55A 3EI4A 5GXIA 5EAMA 4ZOVA 2VDKA 3BG1A 4MMZA 3IKOA 5FKTA 2IUQA 3I7KA 3C9CA 3VI3A 5FQDA 2OIZA 4J86A 4Z7QA 4GGAA 4LGNA 3ODTA 2B5MA 4DNVA 1QFMA 3UVLA 4JD2C 4J82A 3QI0A 1OLZA 2CO0A 3MZLA 2VDNA 4BCDA 4G1EA 3JROA 2AH1A 5H1MA 1U8CA 3F3PA 4HDJA 2H14A 1GP2B 3C99A 5EALA 4J0WA 3RFGA 3JRPA 4A11A 1TYQC 2P9KC 4PSXB 5KDOB 2UZYB 5FKSA 3MKSB 4AMYA 2H9MA 5IC7A 4Y7RA 1FWXA 5GXHA 2YNOA 2H68A 5AJAA 3EI3A 5HYNB 5TF2A 3KCIA 4ESGA 3GC3B 2QR5A 3I7PA 3ZDZA 4K3JB 5HE0B 4GGCA 3SBQA 3EQ7A 3SWSD 3ULEC 3SMRA 3AFCA 4RE6A 1JTDB 4ZOZA 3L4MD 3SLED 1I2MB 5EMLB 1C9LA 4FWWA 4JSNC 3IUJA 4FA1D 3K26A 1N6FA 5E6UA 4A09A 4WK0A 3F3FA 1MG2A 2H9LA 4YVDA 4X60B 3MVDK 4H5JA 1U4CA 2HU7A 5CYKA 1K3IA 5EM2B 4CZXA 1SQJA 2YB8B 5H17A 3SN6B 3IJ1A 1B9YA 1RI6A 3EWEA 3L4OD 1MG3A 2QXVA 4GMBA 5I5IA 2CO0C 4WJKA 4A0BA 3EI2B 5JWZA 4GZ8A 4L3GD 4L3HD 2EBSA 3F3GA 2VDMA 2J57G 3O4JA 3MXXA 2HU5A 4X63B 1TYEA 5M5UA 5M5VA 4UM9A 5M61A 2B5NA 2OK4A 2PM9A 2I0RA 4JSVC 5AFU3 5IT9g 1O6FA 2P9LC 2EIDA 5HQGA 3C5MA 1S4UX 4U7AA 5GMKn 4O45A 1PGUA 3J81g 4G56B 3EI1B 3KRXB 3OKTA 4PBZA 2B4EA 3SBRA 3K27A 1H2ZA 1Q47A 5C9ZB 2IWFA 4CY5A 5C86A 2GC4A 3SXTD 3OW8A 3AL9A 1GXRA 1YR2A 3VH0A 5IGOA 5C92A 3DXMC 3V5WB 3T3PA 1C9IA 5B4WA 3RMZD 4AX4A 4GM8A 4X61B 4BCCA 4CZVA 2EIBA 3NVQA 4J81A 1JJUB 4PSWB 2GC7A 3HFQA 3IJEA 2UZXB 2HJBA 1GOFA 4BP8A 2AH0A 5HDBA 2XL3A 4JHNA 4QRJA 4PXWA 1E5TA 3PVWB 3IUMA 4NBMA 4A0BB 3IIYA 1XKSA 2IWKA 3JPXA 4GQ2P 5TDHB 3OKYB 4A0AA 4E5ZA
chains in the Genus database with same CATH topology
5TEFA 1JMXB 2P9PC 2GNQA 3UR4A 5CXCB 2AGXA 4A08A 2YBAA 2AQ5A 3PVUB 2PM9B 5EARA 3I8CA 4JXMA 3RSEC 2I0TA 5FA5B 3OL2B 3N0DA 4J73A 3ZWLB 3RLMD 4FA9D 4D0KA 4GQBB 3EG6A 3PXTD 2Z2OA 2CE9A 3RN1D 5EMKB 3NVNA 1U2VC 5FXYA 3FRXA 3AL8B 5C2VB 4KFMB 2Q7QA 4OZUA 4J0XA 4A2LA 3EI4B 3SFZA 5C2WB 2IUVA 4MK0B 2P9IC 4ZOXA 4X3EA 3PXSD 2AGZA 4FB1D 4K3ID 4AEZA 4ERZA 4A0AB 1R5MA 2OVQB 3E0CA 2H3XA 4Y5RD 3SVWD 2H9PA 3UVKA 2I3SA 4FHLA 3RFHA 2OJYA 2AGLA 2H6QA 4A11B 1A0RB 4XYHA 3EU7A 5HE3B 4AOWA 3JAMg 3W15A 1NR0A 2YNPA 3AH8B 5IJ8E 2J56H 2CE8A 3DM0A 2CNXA 3IJ0A 2BCJB 4CI1A 4GQ1A 4LG9A 1ERJA 4GGDA 3SHFA 4EWRA 3CIKB 2G99A 3EI3B 4QQEA 4O9DA 1JOFA 4ERYA 5HE1B 2MTAH 4TZ4A 4IA9A 4PC0A 4JT5C 5CXBA 3MZKA 5HE2B 5THAA 5EMJB 3ORVD 2I3TA 5EAPA 3FM0A 3C75H 3SBPA 2IUPA 2XU7A 3NVXA 4A09B 1P22A 5I5MA 4QT8A 4CZYA 4IMMA 4QL1A 2HKRA 2PM7B 4CC9A 5CYKB 4FAVD 2HYEA 5FKRA 4NSXA 5AMSA 4BL0A 3B7FA 4PBYA 3I7HA 4JSXC 3OKWA 4LG8A 1YFQA 4ZN4A 4CY1A 1K32A 4J8GA 3PE7A 4J87A 3PSCB 5K1CC 4O1QD 3UKUC 1OMWB 1NEXB 2AGWA 1XIPA 4JSPC 1VYHC 4J84A 1XHMA 5SXMA 5H14A 3PSLA 2TRCB 1JMZB 1SHYB 4E54A 3DWLC 2H6KA 4CY2A 2OVRB 3I8EA 3UVNA 1SQ9A 2P9NC 1MDAH 5EM2A 3UVMA 3I7NA 4ES0A 5CXBB 3EMHA 3J80g 2AGYA 4FA5D 2Z2NA 4ZOYA 2IURA 3I2NA 2OK6A 3EI2A 4OWRA 3I7OA 4FAND 4J77A 3JZGA 4CI2A 2H9NA 3PXWD 2IAAA 4BH6A 4J79A 2P9SC 3P4FA 2H47A 1L0QA 4J78A 1PBYB 1PEVA 2I0SA 2YMUA 2YNNA 4FA4D 2HESX 1GG2B 1QNIA 3JZHA 3I7LA 3U4YA 3EI1A 3UVOA 4E5ZB 5FKQA 3V7DB 4XYIA 1N6DA 2HXCA 4ERQA 4A08B 2B5LA 1PI6A 4D6VA 1B9XA 2PM6B 3I89A 5I5JA 4E54B 2Z2PA 3MMYA 4I79A 3CFSB 2O9KA 3JB9L 5GSAA 4L9OA 4PNKB 3IJCA 3RN0D 4A7JA 3IIWA 1GOTB 4GM9A 4XEIC 3VA6A 4L1QD 3UKRC 2CN2A 3JZNA 5IGQA 3GREA 3OKYA 4O3TB 2HJ4A 3N0EA 3BG0A 4A2MA 4JT6C 3SCYA 4BUJC 5CXCA 4CI8A 2P9UC 3DXKC 4O3UB 4N14A 1K8KC 2G9AA 3MKQA 4GM3A 4CY3A 2QC5A 3DSMA 3FGBA 5TEEA 5A2Qg 3V9FA 3OL2A 3BWSA 3CFVA 2OVPB 3GFCA 5IJ7E 3A0FA 1TBGA 2XL2A 4CI3A 5EMMB 2BBKH 2HKMA 4H5IA 4Z8LA 2XYIA 1N6EA 5FLXg 2CN3A 3RRMC 2W18A 4J8BA 3OTTA 4R7AB 3VGZA 2J55H 3AL8A 2H13A 4UI9R 3KRWB 3SJLD 4U1EI 2PBIB 2H6NA 5K19A 3EI4A 5GXIA 5EAMA 4ZOVA 3BG1A 3IKOA 5FKTA 2IUQA 3I7KA 3C9CA 5FQDA 2OIZA 4J86A 4GGAA 4LGNA 3ODTA 2B5MA 3UVLA 4JD2C 4J82A 1OLZA 2CO0A 3MZLA 3JROA 2AH1A 5H1MA 3F3PA 4HDJA 2H14A 1GP2B 3C99A 5EALA 4J0WA 3RFGA 3JRPA 4A11A 1TYQC 2P9KC 4PSXB 5KDOB 2UZYB 5FKSA 3MKSB 2H9MA 5IC7A 4Y7RA 1FWXA 5GXHA 2YNOA 2H68A 5AJAA 3EI3A 5HYNB 5TF2A 4ESGA 3I7PA 4K3JB 5HE0B 4GGCA 3SBQA 3SWSD 3ULEC 3SMRA 3AFCA 4ZOZA 3L4MD 3SLED 5EMLB 4FWWA 4JSNC 4FA1D 3K26A 1N6FA 4A09A 3F3FA 1MG2A 2H9LA 4YVDA 4X60B 4H5JA 1U4CA 5CYKA 5EM2B 4CZXA 1SQJA 2YB8B 5H17A 3SN6B 3IJ1A 1B9YA 1RI6A 3EWEA 3L4OD 1MG3A 2QXVA 4GMBA 5I5IA 2CO0C 4A0BA 3EI2B 5JWZA 4L3GD 4GZ8A 4L3HD 2EBSA 3F3GA 2J57G 3MXXA 4X63B 2B5NA 2OK4A 2PM9A 2I0RA 4JSVC 5AFU3 5IT9g 2P9LC 5HQGA 3C5MA 1S4UX 4U7AA 5GMKn 4O45A 1PGUA 3J81g 4G56B 3EI1B 3KRXB 3OKTA 4PBZA 2B4EA 3SBRA 3K27A 1Q47A 5C9ZB 2IWFA 4CY5A 2GC4A 3SXTD 3OW8A 3AL9A 1GXRA 3VH0A 5IGOA 3DXMC 3V5WB 5B4WA 3RMZD 4GM8A 4X61B 4CZVA 3NVQA 4J81A 1JJUB 4PSWB 2GC7A 3HFQA 2UZXB 2HJBA 2AH0A 2XL3A 4QRJA 4PXWA 3PVWB 4A0BB 3IIYA 1XKSA 2IWKA 3JPXA 4GQ2P 5TDHB 3OKYB 4A0AA 4E5ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TEF A;  1JMX B;  2P9P C;  2GNQ A;  3UR4 A;  5CXC B;  2AGX A;  4A08 A;  2YBA A;  2AQ5 A;  3PVU B;  2PM9 B;  5EAR A;  3I8C A;  4JXM A;  3RSE C;  2I0T A;  5FA5 B;  3OL2 B;  3N0D A;  4J73 A;  3ZWL B;  3RLM D;  4FA9 D;  4D0K A;  4GQB B;  3EG6 A;  3PXT D;  2Z2O A;  2CE9 A;  3RN1 D;  5EMK B;  3NVN A;  1U2V C;  5FXY A;  3FRX A;  3AL8 B;  5C2V B;  4KFM B;  2Q7Q A;  4OZU A;  4J0X A;  4A2L A;  3EI4 B;  3SFZ A;  5C2W B;  2IUV A;  4MK0 B;  2P9I C;  4ZOX A;  4X3E A;  3PXS D;  2AGZ A;  4FB1 D;  4K3I D;  4AEZ A;  4ERZ A;  4A0A B;  1R5M A;  2OVQ B;  3E0C A;  2H3X A;  4Y5R D;  3SVW D;  2H9P A;  3UVK A;  2I3S A;  4FHL A;  3RFH A;  2OJY A;  2AGL A;  2H6Q A;  4A11 B;  1A0R B;  4XYH A;  3EU7 A;  5HE3 B;  4AOW A;  3JAM g;  3W15 A;  1NR0 A;  2YNP A;  3AH8 B;  5IJ8 E;  2J56 H;  2CE8 A;  3DM0 A;  2CNX A;  3IJ0 A;  2BCJ B;  4CI1 A;  4GQ1 A;  4LG9 A;  1ERJ A;  4GGD A;  3SHF A;  4EWR A;  3CIK B;  2G99 A;  3EI3 B;  4QQE A;  4O9D A;  1JOF A;  4ERY A;  5HE1 B;  2MTA H;  4TZ4 A;  4IA9 A;  4PC0 A;  4JT5 C;  5CXB A;  3MZK A;  5HE2 B;  5THA A;  5EMJ B;  3ORV D;  2I3T A;  5EAP A;  3FM0 A;  3C75 H;  3SBP A;  2IUP A;  2XU7 A;  3NVX A;  4A09 B;  1P22 A;  5I5M A;  4QT8 A;  4CZY A;  4IMM A;  4QL1 A;  2HKR A;  2PM7 B;  4CC9 A;  5CYK B;  4FAV D;  2HYE A;  5FKR A;  4NSX A;  5AMS A;  4BL0 A;  3B7F A;  4PBY A;  3I7H A;  4JSX C;  3OKW A;  4LG8 A;  1YFQ A;  4ZN4 A;  4CY1 A;  1K32 A;  4J8G A;  3PE7 A;  4J87 A;  3PSC B;  5K1C C;  4O1Q D;  3UKU C;  1OMW B;  1NEX B;  2AGW A;  1XIP A;  4JSP C;  1VYH C;  4J84 A;  1XHM A;  5SXM A;  5H14 A;  3PSL A;  2TRC B;  1JMZ B;  1SHY B;  4E54 A;  3DWL C;  2H6K A;  4CY2 A;  2OVR B;  3I8E A;  3UVN A;  1SQ9 A;  2P9N C;  1MDA H;  5EM2 A;  3UVM A;  3I7N A;  4ES0 A;  5CXB B;  3EMH A;  3J80 g;  2AGY A;  4FA5 D;  2Z2N A;  4ZOY A;  2IUR A;  3I2N A;  2OK6 A;  3EI2 A;  4OWR A;  3I7O A;  4FAN D;  4J77 A;  3JZG A;  4CI2 A;  2H9N A;  3PXW D;  2IAA A;  4BH6 A;  4J79 A;  2P9S C;  3P4F A;  2H47 A;  1L0Q A;  4J78 A;  1PBY B;  1PEV A;  2I0S A;  2YMU A;  2YNN A;  4FA4 D;  2HES X;  1GG2 B;  1QNI A;  3JZH A;  3I7L A;  3U4Y A;  3EI1 A;  3UVO A;  4E5Z B;  5FKQ A;  3V7D B;  4XYI A;  1N6D A;  2HXC A;  4ERQ A;  4A08 B;  2B5L A;  1PI6 A;  4D6V A;  1B9X A;  2PM6 B;  3I89 A;  5I5J A;  4E54 B;  2Z2P A;  3MMY A;  4I79 A;  3CFS B;  2O9K A;  3JB9 L;  5GSA A;  4L9O A;  4PNK B;  3IJC A;  3RN0 D;  4A7J A;  3IIW A;  1GOT B;  4GM9 A;  4XEI C;  3VA6 A;  4L1Q D;  3UKR C;  2CN2 A;  3JZN A;  5IGQ A;  3GRE A;  3OKY A;  4O3T B;  2HJ4 A;  3N0E A;  3BG0 A;  4A2M A;  4JT6 C;  3SCY A;  4BUJ C;  5CXC A;  4CI8 A;  2P9U C;  3DXK C;  4O3U B;  4N14 A;  1K8K C;  2G9A A;  3MKQ A;  4GM3 A;  4CY3 A;  2QC5 A;  3DSM A;  3FGB A;  5TEE A;  5A2Q g;  3V9F A;  3OL2 A;  3BWS A;  3CFV A;  2OVP B;  3GFC A;  5IJ7 E;  3A0F A;  1TBG A;  2XL2 A;  4CI3 A;  5EMM B;  2BBK H;  2HKM A;  4H5I A;  4Z8L A;  2XYI A;  1N6E A;  5FLX g;  2CN3 A;  3RRM C;  2W18 A;  4J8B A;  3OTT A;  4R7A B;  3VGZ A;  2J55 H;  3AL8 A;  2H13 A;  4UI9 R;  3KRW B;  3SJL D;  4U1E I;  2PBI B;  2H6N A;  5K19 A;  3EI4 A;  5GXI A;  5EAM A;  4ZOV A;  3BG1 A;  3IKO A;  5FKT A;  2IUQ A;  3I7K A;  3C9C A;  5FQD A;  2OIZ A;  4J86 A;  4GGA A;  4LGN A;  3ODT A;  2B5M A;  3UVL A;  4JD2 C;  4J82 A;  1OLZ A;  2CO0 A;  3MZL A;  3JRO A;  2AH1 A;  5H1M A;  3F3P A;  4HDJ A;  2H14 A;  1GP2 B;  3C99 A;  5EAL A;  4J0W A;  3RFG A;  3JRP A;  4A11 A;  1TYQ C;  2P9K C;  4PSX B;  5KDO B;  2UZY B;  5FKS A;  3MKS B;  2H9M A;  5IC7 A;  4Y7R A;  1FWX A;  5GXH A;  2YNO A;  2H68 A;  5AJA A;  3EI3 A;  5HYN B;  5TF2 A;  4ESG A;  3I7P A;  4K3J B;  5HE0 B;  4GGC A;  3SBQ A;  3SWS D;  3ULE C;  3SMR A;  3AFC A;  4ZOZ A;  3L4M D;  3SLE D;  5EML B;  4FWW A;  4JSN C;  4FA1 D;  3K26 A;  1N6F A;  4A09 A;  3F3F A;  1MG2 A;  2H9L A;  4YVD A;  4X60 B;  4H5J A;  1U4C A;  5CYK A;  5EM2 B;  4CZX A;  1SQJ A;  2YB8 B;  5H17 A;  3SN6 B;  3IJ1 A;  1B9Y A;  1RI6 A;  3EWE A;  3L4O D;  1MG3 A;  2QXV A;  4GMB A;  5I5I A;  2CO0 C;  4A0B A;  3EI2 B;  5JWZ A;  4L3G D;  4GZ8 A;  4L3H D;  2EBS A;  3F3G A;  2J57 G;  3MXX A;  4X63 B;  2B5N A;  2OK4 A;  2PM9 A;  2I0R A;  4JSV C;  5AFU 3;  5IT9 g;  2P9L C;  5HQG A;  3C5M A;  1S4U X;  4U7A A;  5GMK n;  4O45 A;  1PGU A;  3J81 g;  4G56 B;  3EI1 B;  3KRX B;  3OKT A;  4PBZ A;  2B4E A;  3SBR A;  3K27 A;  1Q47 A;  5C9Z B;  2IWF A;  4CY5 A;  2GC4 A;  3SXT D;  3OW8 A;  3AL9 A;  1GXR A;  3VH0 A;  5IGO A;  3DXM C;  3V5W B;  5B4W A;  3RMZ D;  4GM8 A;  4X61 B;  4CZV A;  3NVQ A;  4J81 A;  1JJU B;  4PSW B;  2GC7 A;  3HFQ A;  2UZX B;  2HJB A;  2AH0 A;  2XL3 A;  4QRJ A;  4PXW A;  3PVW B;  4A0B B;  3IIY A;  1XKS A;  2IWK A;  3JPX A;  4GQ2 P;  5TDH B;  3OKY B;  4A0A A;  4E5Z A; 
#chains in the Genus database with same CATH topology
 5TEF A;  1JMX B;  3IUR A;  2P9P C;  2QZP A;  2GNQ A;  5E6S A;  3UR4 A;  3EQ8 A;  5CXC B;  4WK2 A;  2AGX A;  4A08 A;  1JV2 A;  2YBA A;  2AQ5 A;  3PVU B;  2VDP A;  2PM9 B;  5EAR A;  4WK4 A;  3I8C A;  4JXM A;  3RSE C;  1M1X A;  2I0T A;  5FA5 B;  3IVM A;  3OL2 B;  3N0D A;  4J73 A;  3ZWL B;  3RLM D;  4FA9 D;  4D0K A;  3IUL A;  4GQB B;  3EG6 A;  3PXT D;  2Z2O A;  2CE9 A;  1H2Y A;  3RN1 D;  5EMK B;  3NVN A;  1U2V C;  5FXY A;  3FRX A;  1UOO A;  3AL8 B;  5C2V B;  4KFM B;  2Q7Q A;  4OZU A;  4J0X A;  3O4H A;  4A2L A;  3EI4 B;  3SFZ A;  1UOP A;  5C2W B;  3T3M A;  2IUV A;  3O4G A;  3NIF A;  4MK0 B;  2P9I C;  4ZOX A;  4X3E A;  3PXS D;  2AGZ A;  3IUQ A;  4FB1 D;  4K3I D;  4AEZ A;  4ERZ A;  4A0A B;  2VC2 A;  1R5M A;  2OVQ B;  3E0C A;  2H3X A;  4BP9 A;  4Y5R D;  3ZDX A;  3MUN A;  3SVW D;  2H9P A;  3UVK A;  2I3S A;  4FHL A;  3RFH A;  2OJY A;  2AGL A;  2H6Q A;  4A11 B;  1E8N A;  1A0R B;  4UM8 A;  3EU7 A;  4XYH A;  5HE3 B;  4AOW A;  3JAM g;  3W15 A;  3ZE0 A;  1NR0 A;  4QAM A;  2YNP A;  3AH8 B;  5IJ8 E;  1H2X A;  2J56 H;  2CE8 A;  3DM0 A;  2CNX A;  3IJ0 A;  2BCJ B;  4CI1 A;  4GQ1 A;  4LG9 A;  1ERJ A;  4GGD A;  3SHF A;  4EWR A;  3CIK B;  5E6R A;  2G99 A;  3EI3 B;  2VDQ A;  3FCU A;  4O9D A;  4QQE A;  1JOF A;  2XE4 A;  4ERY A;  5HE1 B;  2MTA H;  4TZ4 A;  4IA9 A;  4PC0 A;  3K71 A;  4JT5 C;  5CXB A;  1VE7 A;  3MZK A;  5HE2 B;  5THA A;  5EMJ B;  3ORV D;  2I3T A;  5EAP A;  3FM0 A;  3GD1 I;  1L5G A;  5M5S A;  3C75 H;  3SBP A;  2IUP A;  2XU7 A;  3NVX A;  4A09 B;  1P22 A;  5FFO A;  5I5M A;  4QT8 A;  4CZY A;  2JKX A;  4IMM A;  4QL1 A;  2HKR A;  2PM7 B;  4CC9 A;  4Z7N A;  5CYK B;  4FAV D;  2HYE A;  5FKR A;  4NSX A;  4Z7O A;  5AMS A;  4BL0 A;  3B7F A;  4PBY A;  3I7H A;  3EQ9 A;  4JSX C;  1A12 A;  3OKW A;  4LG8 A;  1YFQ A;  1VE6 A;  4ZN4 A;  3K6S A;  4CY1 A;  1K32 A;  3QHY B;  4J8G A;  3PE7 A;  4J87 A;  4NAA A;  3PSC B;  1UOQ A;  5K1C C;  3ZE2 A;  2VDO A;  2VZ1 A;  4O1Q D;  3UKU C;  3K72 A;  1OMW B;  1NEX B;  2AGW A;  1XIP A;  4JSP C;  3IUN A;  1VYH C;  4J84 A;  1XHM A;  2HU8 A;  5SXM A;  5H14 A;  3O4I A;  3PSL A;  2TRC B;  1UTC A;  3NID A;  5M5R A;  1JMZ B;  1SHY B;  2VDR A;  4E54 A;  3DWL C;  2H6K A;  4CY2 A;  2OVR B;  1E8M A;  3I8E A;  1SQ9 A;  2P9N C;  1MDA H;  4G1M A;  5EM2 A;  3UVN A;  3UVM A;  3I7N A;  4ES0 A;  5CXB B;  3EMH A;  1GOG A;  2VDL A;  2AGY A;  4FA5 D;  3J80 g;  3ZDY A;  4MMX A;  2Z2N A;  4ZOY A;  1VZ2 A;  2IUR A;  3I2N A;  4IRZ A;  4D9S A;  4NC4 A;  1T2X A;  2OK6 A;  4DNU A;  3EI2 A;  4OWR A;  3VI4 A;  3I7O A;  4FAN D;  4J77 A;  3JZG A;  4CI2 A;  2H9N A;  3PXW D;  2IAA A;  4BH6 A;  3V4P A;  4J79 A;  4MMY A;  2P9S C;  3P4F A;  2H47 A;  1L0Q A;  4L1M A;  4J78 A;  1PBY B;  1PEV A;  2I0S A;  2YMU A;  2YNN A;  4FA4 D;  1VZ3 A;  2HES X;  1GG2 B;  1QNI A;  3JZH A;  3I7L A;  3U4Y A;  3EI1 A;  3MUO A;  3UVO A;  4E5Z B;  3NIG A;  5FKQ A;  3V7D B;  4XYI A;  1N6D A;  2HXC A;  4JHP C;  4DNW A;  4ERQ A;  2B5L A;  2EIE A;  1PI6 A;  2XZG A;  4A08 B;  4D6V A;  1B9X A;  2PM6 B;  3I89 A;  5I5J A;  4E54 B;  2Z2P A;  3MMY A;  4I79 A;  4AMZ A;  3CFS B;  2BKL A;  2O9K A;  3JB9 L;  1QFS A;  5GSA A;  1O6G A;  4L9O A;  4PNK B;  3IJC A;  3RN0 D;  3FCS A;  4A7J A;  3IIW A;  1GOT B;  4GM9 A;  4XEI C;  3VA6 A;  2WQ8 A;  3V4V A;  4L1Q D;  3UKR C;  4BCB A;  2CN2 A;  3JZN A;  5IGQ A;  3GRE A;  3OKY A;  4O3T B;  2HJ4 A;  3N0E A;  3BG0 A;  4A2M A;  4JT6 C;  3SCY A;  4BUJ C;  2VZ3 A;  5CXC A;  2P9U C;  4CI8 A;  3DXK C;  4O3U B;  4N14 A;  1K8K C;  3OF7 A;  4RE5 A;  2G9A A;  3MKQ A;  4GM3 A;  4CY3 A;  2QC5 A;  3DSM A;  3FGB A;  5TEE A;  1GOH A;  5A2Q g;  3V9F A;  3OL2 A;  3BWS A;  2XDW A;  3CFV A;  2OVP B;  3GFC A;  5IJ7 E;  3A0F A;  1TBG A;  2XL2 A;  4CI3 A;  5EMM B;  2EIC A;  2BBK H;  2HKM A;  4H5I A;  4Z8L A;  4O2W A;  2XYI A;  1N6E A;  5FLX g;  2CN3 A;  3RRM C;  2W18 A;  4AN0 A;  4J8B A;  3OTT A;  4R7A B;  3VGZ A;  4O02 A;  2J55 H;  1BPO A;  3AL8 A;  2H13 A;  4UI9 R;  3ZE1 A;  5FFG A;  1H2W A;  3DDU A;  4AN1 A;  3KRW B;  3SJL D;  4U1E I;  2PBI B;  4NEN A;  2H6N A;  5K19 A;  5M5T A;  4G55 A;  3EI4 A;  5GXI A;  5EAM A;  4ZOV A;  2VDK A;  3BG1 A;  4MMZ A;  3IKO A;  5FKT A;  2IUQ A;  3I7K A;  3C9C A;  3VI3 A;  5FQD A;  2OIZ A;  4J86 A;  4Z7Q A;  4GGA A;  4LGN A;  3ODT A;  2B5M A;  4DNV A;  1QFM A;  3UVL A;  4JD2 C;  4J82 A;  3QI0 A;  1OLZ A;  2CO0 A;  3MZL A;  2VDN A;  4BCD A;  4G1E A;  3JRO A;  2AH1 A;  5H1M A;  1U8C A;  3F3P A;  4HDJ A;  2H14 A;  1GP2 B;  3C99 A;  5EAL A;  4J0W A;  3RFG A;  3JRP A;  4A11 A;  1TYQ C;  2P9K C;  4PSX B;  5KDO B;  2UZY B;  5FKS A;  3MKS B;  4AMY A;  2H9M A;  5IC7 A;  4Y7R A;  1FWX A;  5GXH A;  2YNO A;  2H68 A;  5AJA A;  3EI3 A;  5HYN B;  5TF2 A;  3KCI A;  4ESG A;  3GC3 B;  2QR5 A;  3I7P A;  3ZDZ A;  4K3J B;  5HE0 B;  4GGC A;  3SBQ A;  3EQ7 A;  3SWS D;  3ULE C;  3SMR A;  3AFC A;  4RE6 A;  1JTD B;  4ZOZ A;  3L4M D;  3SLE D;  1I2M B;  5EML B;  1C9L A;  4FWW A;  4JSN C;  3IUJ A;  4FA1 D;  3K26 A;  1N6F A;  5E6U A;  4A09 A;  4WK0 A;  3F3F A;  1MG2 A;  2H9L A;  4YVD A;  4X60 B;  3MVD K;  4H5J A;  1U4C A;  2HU7 A;  5CYK A;  1K3I A;  5EM2 B;  4CZX A;  1SQJ A;  2YB8 B;  5H17 A;  3SN6 B;  3IJ1 A;  1B9Y A;  1RI6 A;  3EWE A;  3L4O D;  1MG3 A;  2QXV A;  4GMB A;  5I5I A;  2CO0 C;  4WJK A;  4A0B A;  3EI2 B;  5JWZ A;  4GZ8 A;  4L3G D;  4L3H D;  2EBS A;  3F3G A;  2VDM A;  2J57 G;  3O4J A;  3MXX A;  2HU5 A;  4X63 B;  1TYE A;  5M5U A;  5M5V A;  4UM9 A;  5M61 A;  2B5N A;  2OK4 A;  2PM9 A;  2I0R A;  4JSV C;  5AFU 3;  5IT9 g;  1O6F A;  2P9L C;  2EID A;  5HQG A;  3C5M A;  1S4U X;  4U7A A;  5GMK n;  4O45 A;  1PGU A;  3J81 g;  4G56 B;  3EI1 B;  3KRX B;  3OKT A;  4PBZ A;  2B4E A;  3SBR A;  3K27 A;  1H2Z A;  1Q47 A;  5C9Z B;  2IWF A;  4CY5 A;  5C86 A;  2GC4 A;  3SXT D;  3OW8 A;  3AL9 A;  1GXR A;  1YR2 A;  3VH0 A;  5IGO A;  5C92 A;  3DXM C;  3V5W B;  3T3P A;  1C9I A;  5B4W A;  3RMZ D;  4AX4 A;  4GM8 A;  4X61 B;  4BCC A;  4CZV A;  2EIB A;  3NVQ A;  4J81 A;  1JJU B;  4PSW B;  2GC7 A;  3HFQ A;  3IJE A;  2UZX B;  2HJB A;  1GOF A;  4BP8 A;  2AH0 A;  5HDB A;  2XL3 A;  4JHN A;  4QRJ A;  4PXW A;  1E5T A;  3PVW B;  3IUM A;  4NBM A;  4A0B B;  3IIY A;  1XKS A;  2IWK A;  3JPX A;  4GQ2 P;  5TDH B;  3OKY B;  4A0A A;  4E5Z A; 
#chains in the Genus database with same CATH homology
 5TEF A;  1JMX B;  2P9P C;  2GNQ A;  3UR4 A;  5CXC B;  2AGX A;  4A08 A;  2YBA A;  2AQ5 A;  3PVU B;  2PM9 B;  5EAR A;  3I8C A;  4JXM A;  3RSE C;  2I0T A;  5FA5 B;  3OL2 B;  3N0D A;  4J73 A;  3ZWL B;  3RLM D;  4FA9 D;  4D0K A;  4GQB B;  3EG6 A;  3PXT D;  2Z2O A;  2CE9 A;  3RN1 D;  5EMK B;  3NVN A;  1U2V C;  5FXY A;  3FRX A;  3AL8 B;  5C2V B;  4KFM B;  2Q7Q A;  4OZU A;  4J0X A;  4A2L A;  3EI4 B;  3SFZ A;  5C2W B;  2IUV A;  4MK0 B;  2P9I C;  4ZOX A;  4X3E A;  3PXS D;  2AGZ A;  4FB1 D;  4K3I D;  4AEZ A;  4ERZ A;  4A0A B;  1R5M A;  2OVQ B;  3E0C A;  2H3X A;  4Y5R D;  3SVW D;  2H9P A;  3UVK A;  2I3S A;  4FHL A;  3RFH A;  2OJY A;  2AGL A;  2H6Q A;  4A11 B;  1A0R B;  4XYH A;  3EU7 A;  5HE3 B;  4AOW A;  3JAM g;  3W15 A;  1NR0 A;  2YNP A;  3AH8 B;  5IJ8 E;  2J56 H;  2CE8 A;  3DM0 A;  2CNX A;  3IJ0 A;  2BCJ B;  4CI1 A;  4GQ1 A;  4LG9 A;  1ERJ A;  4GGD A;  3SHF A;  4EWR A;  3CIK B;  2G99 A;  3EI3 B;  4QQE A;  4O9D A;  1JOF A;  4ERY A;  5HE1 B;  2MTA H;  4TZ4 A;  4IA9 A;  4PC0 A;  4JT5 C;  5CXB A;  3MZK A;  5HE2 B;  5THA A;  5EMJ B;  3ORV D;  2I3T A;  5EAP A;  3FM0 A;  3C75 H;  3SBP A;  2IUP A;  2XU7 A;  3NVX A;  4A09 B;  1P22 A;  5I5M A;  4QT8 A;  4CZY A;  4IMM A;  4QL1 A;  2HKR A;  2PM7 B;  4CC9 A;  5CYK B;  4FAV D;  2HYE A;  5FKR A;  4NSX A;  5AMS A;  4BL0 A;  3B7F A;  4PBY A;  3I7H A;  4JSX C;  3OKW A;  4LG8 A;  1YFQ A;  4ZN4 A;  4CY1 A;  1K32 A;  4J8G A;  3PE7 A;  4J87 A;  3PSC B;  5K1C C;  4O1Q D;  3UKU C;  1OMW B;  1NEX B;  2AGW A;  1XIP A;  4JSP C;  1VYH C;  4J84 A;  1XHM A;  5SXM A;  5H14 A;  3PSL A;  2TRC B;  1JMZ B;  1SHY B;  4E54 A;  3DWL C;  2H6K A;  4CY2 A;  2OVR B;  3I8E A;  3UVN A;  1SQ9 A;  2P9N C;  1MDA H;  5EM2 A;  3UVM A;  3I7N A;  4ES0 A;  5CXB B;  3EMH A;  3J80 g;  2AGY A;  4FA5 D;  2Z2N A;  4ZOY A;  2IUR A;  3I2N A;  2OK6 A;  3EI2 A;  4OWR A;  3I7O A;  4FAN D;  4J77 A;  3JZG A;  4CI2 A;  2H9N A;  3PXW D;  2IAA A;  4BH6 A;  4J79 A;  2P9S C;  3P4F A;  2H47 A;  1L0Q A;  4J78 A;  1PBY B;  1PEV A;  2I0S A;  2YMU A;  2YNN A;  4FA4 D;  2HES X;  1GG2 B;  1QNI A;  3JZH A;  3I7L A;  3U4Y A;  3EI1 A;  3UVO A;  4E5Z B;  5FKQ A;  3V7D B;  4XYI A;  1N6D A;  2HXC A;  4ERQ A;  4A08 B;  2B5L A;  1PI6 A;  4D6V A;  1B9X A;  2PM6 B;  3I89 A;  5I5J A;  4E54 B;  2Z2P A;  3MMY A;  4I79 A;  3CFS B;  2O9K A;  3JB9 L;  5GSA A;  4L9O A;  4PNK B;  3IJC A;  3RN0 D;  4A7J A;  3IIW A;  1GOT B;  4GM9 A;  4XEI C;  3VA6 A;  4L1Q D;  3UKR C;  2CN2 A;  3JZN A;  5IGQ A;  3GRE A;  3OKY A;  4O3T B;  2HJ4 A;  3N0E A;  3BG0 A;  4A2M A;  4JT6 C;  3SCY A;  4BUJ C;  5CXC A;  4CI8 A;  2P9U C;  3DXK C;  4O3U B;  4N14 A;  1K8K C;  2G9A A;  3MKQ A;  4GM3 A;  4CY3 A;  2QC5 A;  3DSM A;  3FGB A;  5TEE A;  5A2Q g;  3V9F A;  3OL2 A;  3BWS A;  3CFV A;  2OVP B;  3GFC A;  5IJ7 E;  3A0F A;  1TBG A;  2XL2 A;  4CI3 A;  5EMM B;  2BBK H;  2HKM A;  4H5I A;  4Z8L A;  2XYI A;  1N6E A;  5FLX g;  2CN3 A;  3RRM C;  2W18 A;  4J8B A;  3OTT A;  4R7A B;  3VGZ A;  2J55 H;  3AL8 A;  2H13 A;  4UI9 R;  3KRW B;  3SJL D;  4U1E I;  2PBI B;  2H6N A;  5K19 A;  3EI4 A;  5GXI A;  5EAM A;  4ZOV A;  3BG1 A;  3IKO A;  5FKT A;  2IUQ A;  3I7K A;  3C9C A;  5FQD A;  2OIZ A;  4J86 A;  4GGA A;  4LGN A;  3ODT A;  2B5M A;  3UVL A;  4JD2 C;  4J82 A;  1OLZ A;  2CO0 A;  3MZL A;  3JRO A;  2AH1 A;  5H1M A;  3F3P A;  4HDJ A;  2H14 A;  1GP2 B;  3C99 A;  5EAL A;  4J0W A;  3RFG A;  3JRP A;  4A11 A;  1TYQ C;  2P9K C;  4PSX B;  5KDO B;  2UZY B;  5FKS A;  3MKS B;  2H9M A;  5IC7 A;  4Y7R A;  1FWX A;  5GXH A;  2YNO A;  2H68 A;  5AJA A;  3EI3 A;  5HYN B;  5TF2 A;  4ESG A;  3I7P A;  4K3J B;  5HE0 B;  4GGC A;  3SBQ A;  3SWS D;  3ULE C;  3SMR A;  3AFC A;  4ZOZ A;  3L4M D;  3SLE D;  5EML B;  4FWW A;  4JSN C;  4FA1 D;  3K26 A;  1N6F A;  4A09 A;  3F3F A;  1MG2 A;  2H9L A;  4YVD A;  4X60 B;  4H5J A;  1U4C A;  5CYK A;  5EM2 B;  4CZX A;  1SQJ A;  2YB8 B;  5H17 A;  3SN6 B;  3IJ1 A;  1B9Y A;  1RI6 A;  3EWE A;  3L4O D;  1MG3 A;  2QXV A;  4GMB A;  5I5I A;  2CO0 C;  4A0B A;  3EI2 B;  5JWZ A;  4L3G D;  4GZ8 A;  4L3H D;  2EBS A;  3F3G A;  2J57 G;  3MXX A;  4X63 B;  2B5N A;  2OK4 A;  2PM9 A;  2I0R A;  4JSV C;  5AFU 3;  5IT9 g;  2P9L C;  5HQG A;  3C5M A;  1S4U X;  4U7A A;  5GMK n;  4O45 A;  1PGU A;  3J81 g;  4G56 B;  3EI1 B;  3KRX B;  3OKT A;  4PBZ A;  2B4E A;  3SBR A;  3K27 A;  1Q47 A;  5C9Z B;  2IWF A;  4CY5 A;  2GC4 A;  3SXT D;  3OW8 A;  3AL9 A;  1GXR A;  3VH0 A;  5IGO A;  3DXM C;  3V5W B;  5B4W A;  3RMZ D;  4GM8 A;  4X61 B;  4CZV A;  3NVQ A;  4J81 A;  1JJU B;  4PSW B;  2GC7 A;  3HFQ A;  2UZX B;  2HJB A;  2AH0 A;  2XL3 A;  4QRJ A;  4PXW A;  3PVW B;  4A0B B;  3IIY A;  1XKS A;  2IWK A;  3JPX A;  4GQ2 P;  5TDH B;  3OKY B;  4A0A A;  4E5Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...