2G99A

Structural basis for the specific recognition of methylated histone h3 lysine 4 by the wd-40 protein wdr5
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
304
structure length
304
Chain Sequence
PVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna binding protein
molecule keywords WD-repeat protein 5
publication title Structural basis for the specific recognition of methylated histone H3 lysine 4 by the WD-40 protein WDR5
rcsb
source organism Homo sapiens
total genus 94
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2g99A00
3EWEA 5AMSA 3K26A 2XU7A 3IIWA 3SN6B 2H13A 4A2MA 5C9ZB 5C2VB 3JB9L 2IWKA 3DM0A 4BUJC 4AOWA 5IT9g 5HYNB 3I8CA 4O3TB 2B5LA 4CI8A 5H17A 2QXVA 3C5MA 4NSXA 4PC0A 4UI9R 1Q47A 1YFQA 4H5JA 5HE0B 4ERYA 5CXCA 2HESX 3MKQA 3ORVD 3OKWA 3PVUB 4J8GA 2Z2OA 3J80g 4JSNC 4QL1A 4FA4D 3UVOA 2Z2PA 4CY2A 3I7NA 4FB1D 3UKUC 3JZGA 1QNIA 2YNNA 2GC7A 3I8EA 5EAMA 2TRCB 4GZ8A 3VH0A 2PM6B 4CI1A 4CY1A 4GQ2P 1MDAH 2CN3A 2J56H 3RN0D 4CY3A 4JT5C 2W18A 4L3HD 1NR0A 4A09A 2AH0A 3KRWB 2H6KA 3EI2A 3CFSB 3MZKA 3OL2A 4EWRA 3UVKA 2BBKH 3OKTA 2J55H 2OVQB 5FKTA 4OZUA 2XL3A 3JAMg 3B7FA 5CYKA 3ODTA 5CXBA 1JMZB 2B5NA 3OKYA 3W15A 1NEXB 1P22A 2UZXB 3EI3B 4YVDA 2AQ5A 4FAND 4KFMB 4JSPC 4A2LA 3EI4B 5TDHB 3MMYA 2CO0C 2UZYB 4GGAA 5SXMA 4O3UB 1GP2B 4XYHA 3NVNA 3NVXA 4LGNA 5K19A 1ERJA 3DWLC 3PVWB 2HXCA 4A09B 3U4YA 4X63B 2I0RA 2QC5A 5AFU3 4O1QD 5THAA 3EI2B 2YNOA 4N14A 3E0CA 3MKSB 4A08A 3AL8A 3OL2B 4ERQA 4IMMA 5GMKn 3RFHA 3SJLD 3SXTD 1SHYB 2H68A 4LG8A 4J8BA 2AGYA 2P9IC 5CYKB 1OLZA 2BCJB 2IUVA 2IWFA 2P9SC 5EMKB 5CXBB 3RN1D 4FA5D 3OKYB 4ZOZA 4O9DA 2MTAH 4J84A 3I89A 4IA9A 3A0FA 3MXXA 4AEZA 2AGWA 2GNQA 3SCYA 4FA9D 4JD2C 2H9PA 5K1CC 1N6DA 4A0BA 4D0KA 1A0RB 3P4FA 2Z2NA 4ZOXA 2IAAA 1B9XA 3EMHA 5TEFA 3UVMA 3PXSD 3OW8A 2B5MA 2H6QA 1B9YA 4FWWA 4GMBA 5HE3B 4JSVC 3SBPA 4A0AB 1MG2A 2YBAA 2HJBA 2IURA 4J73A 5C2WB 2J57G 3K27A 3DXMC 4E54B 2CN2A 2H47A 5EAPA 4PSWB 4J87A 5EMLB 2YNPA 2OVPB 4K3JB 4U1EI 3DSMA 1PI6A 1S4UX 2I0TA 4ESGA 2EBSA 3F3GA 5IJ7E 2OVRB 2OK6A 4Z8LA 4GM9A 2HKMA 4MK0B 4XYIA 4XEIC 3HFQA 3I7KA 2CNXA 5FKQA 1XKSA 3AH8B 4JSXC 5A2Qg 4CZVA 2OK4A 2YB8B 2B4EA 4ZOVA 3V9FA 4A0BB 5CXCB 3SBRA 4Y7RA 4PBYA 1GG2B 4JT6C 4ES0A 3JROA 4A11A 4GQBB 2HYEA 3C9CA 3I7HA 1GOTB 3DXKC 3UKRC 3SVWD 1VYHC 5JWZA 1K8KC 3ULEC 3EG6A 3JZHA 5EARA 2G99A 3PE7A 3V5WB 5FLXg 3PXWD 1RI6A 3SWSD 3EU7A 3FGBA 1U4CA 4J78A 2GC4A 2PM9A 3F3FA 5EMJB 4QQEA 2IUPA 2H6NA 2CE8A 4GM3A 1XIPA 3IJ1A 4CZYA 4J81A 2P9KC 4OWRA 3IIYA 4G56B 2OJYA 3IKOA 3I7OA 3JRPA 4X61B 5AJAA 2O9KA 4QT8A 3UVLA 1JMXB 3MZLA 3PSLA 2G9AA 5H14A 4Y5RD 3I2NA 4FHLA 2Q7QA 4J0WA 3GFCA 2H3XA 1U2VC 5I5MA 2P9PC 4CI3A 4TZ4A 5KDOB 3C99A 4K3ID 4A11B 5HE1B 5I5IA 4PBZA 5IGQA 3BG0A 1N6EA 3RRMC 3SHFA 2I3SA 4GM8A 4GGDA 4GGCA 1XHMA 3VA6A 2XL2A 3RFGA 5I5JA 5GXHA 2PM9B 4FA1D 3KRXB 5HE2B 2OIZA 4LG9A 3AL9A 3GREA 4E5ZA 4X3EA 5FKSA 4R7AB 4CC9A 2PBIB 4A7JA 5B4WA 5FXYA 3C75H 4L3GD 2AGLA 4CI2A 4QRJA 4A08B 3AL8B 4GQ1A 3BG1A 3CFVA 4PSXB 2AGZA 4CY5A 3V7DB 4JXMA 4BL0A 5GXIA 4ERZA 2P9UC 2I0SA 1PBYB 1SQJA 5TF2A 1GXRA 3EI3A 1OMWB 5FKRA 3FM0A 5FQDA 3EI1A 5TEEA 3OTTA 2H9NA 3EI4A 4L1QD 5IJ8E 4L9OA 3UR4A 1FWXA 3VGZA 1PGUA 2H14A 5EM2A 4CZXA 4FAVD 3ZWLB 4BH6A 2YMUA 4U7AA 5HQGA 1R5MA 4X60B 3JZNA 4O45A 3AFCA 3NVQA 4PXWA 1MG3A 3PXTD 2H9MA 4E5ZB 2CE9A 2H9LA 3CIKB 4H5IA 5EMMB 1K32A 3IJCA 2HKRA 4D6VA 3I7PA 1SQ9A 5EALA 4J0XA 2CO0A 3F3PA 1TBGA 4J86A 2AGXA 5IC7A 3J81g 1N6FA 5FA5B 2P9LC 4J82A 5GSAA 3BWSA 1TYQC 2HJ4A 3L4OD 2XYIA 5IGOA 3L4MD 4J77A 3I7LA 2IUQA 3EI1B 1JOFA 3N0EA 4ZOYA 4PNKB 1PEVA 3UVNA 5EM2B 3SBQA 2AH1A 4I79A 3SFZA 3RSEC 3JPXA 1L0QA 3IJ0A 4ZN4A 3SLED 3N0DA 4A0AA 2I3TA 3RLMD 5H1MA 3FRXA 2PM7B 3SMRA 3PSCB 4E54A 4J79A 4HDJA 1JJUB 3RMZD 2P9NC
chains in the Genus database with same CATH superfamily
3EWEA 5AMSA 3K26A 2XU7A 3IIWA 3SN6B 1M1XA 2H13A 4A2MA 5C9ZB 5C2VB 3JB9L 2IWKA 3DM0A 4QAMA 4BUJC 4AOWA 4WK2A 5IT9g 5HYNB 1E8MA 3I8CA 1O6GA 4O3TB 2B5LA 3K72A 4CI8A 5H17A 2QXVA 3NIGA 3C5MA 4NSXA 4PC0A 4UI9R 1Q47A 1UOQA 1YFQA 4H5JA 5HE0B 4ERYA 5CXCA 2HESX 3MKQA 1VE7A 3ORVD 3OKWA 2WQ8A 1VZ2A 4MMYA 3PVUB 2VDPA 4J8GA 2Z2OA 3J80g 4JSNC 4QL1A 4FA4D 3UVOA 2Z2PA 4CY2A 4UM9A 3I7NA 4FB1D 3UKUC 3JZGA 3ZE1A 1VE6A 3QI0A 1QNIA 2YNNA 2GC7A 3I8EA 5EAMA 2TRCB 4GZ8A 3VH0A 2PM6B 4WK4A 4CI1A 4CY1A 5M5TA 4GQ2P 1MDAH 1QFMA 2EIBA 3OF7A 2CN3A 2J56H 3RN0D 4AMZA 4CY3A 4JT5C 2W18A 3O4IA 4L3HD 1NR0A 4DNUA 4A09A 2AH0A 4AN0A 3KRWB 2HU7A 2H6KA 3EI2A 3CFSB 2HU8A 3MZKA 3OL2A 4EWRA 3UVKA 2BBKH 3OKTA 2J55H 2OVQB 5FKTA 4OZUA 2XL3A 3JAMg 3IUJA 3EQ9A 3B7FA 5CYKA 3ODTA 5CXBA 1JMZB 3IUQA 2B5NA 3OKYA 3EQ8A 1NEXB 1P22A 2EIEA 2UZXB 3EI3B 2AQ5A 4UM8A 4YVDA 3W15A 4FAND 4KFMB 3O4GA 4JSPC 4A2LA 3EI4B 5TDHB 1GOHA 3MMYA 2CO0C 2UZYB 4GGAA 5SXMA 4O3UB 1GP2B 4XYHA 2EICA 3GC3B 3NVNA 3NVXA 4LGNA 5K19A 1ERJA 4IRZA 3DWLC 2HU5A 3PVWB 2HXCA 4A09B 3U4YA 4X63B 2I0RA 2VDMA 2QC5A 5AFU3 4O1QD 5THAA 3EI2B 1L5GA 2YNOA 4N14A 3E0CA 3MKSB 4A08A 3AL8A 3OL2B 4NENA 4ERQA 4IMMA 5GMKn 3RFHA 3SJLD 3T3MA 4WK0A 3GD1I 3SXTD 1SHYB 2H68A 4LG8A 2VDNA 4J8BA 2AGYA 3ZDXA 2P9IC 5CYKB 1OLZA 2BCJB 2IUVA 2IWFA 2P9SC 5EMKB 5CXBB 3RN1D 4FA5D 3OKYB 4ZOZA 4O9DA 1H2ZA 2MTAH 4J84A 3I89A 4IA9A 3A0FA 2XZGA 3MXXA 5M5RA 4AEZA 2AGWA 2GNQA 3SCYA 3O4JA 4FA9D 4JD2C 2H9PA 5K1CC 1N6DA 4A0BA 4D0KA 1A0RB 3P4FA 2Z2NA 4ZOXA 2IAAA 1B9XA 3EMHA 5TEFA 3UVMA 3PXSD 3OW8A 2B5MA 2H6QA 4Z7QA 1B9YA 4FWWA 4GMBA 1U8CA 4RE6A 5HE3B 4JSVC 3SBPA 4A0AB 1MG2A 5E6SA 2YBAA 4Z7OA 2BKLA 2HJBA 2IURA 4J73A 5C2WB 2VDKA 1UOOA 2J57G 3K27A 3QHYB 3DXMC 4E54B 2CN2A 2H47A 5EAPA 4PSWB 4J87A 4RE5A 3ZE0A 5EMLB 2YNPA 2OVPB 4K3JB 4U1EI 4BCCA 3DSMA 1PI6A 1S4UX 2I0TA 4G1EA 3MUNA 4ESGA 5M5SA 2EBSA 4JHPC 3F3GA 3ZE2A 4NC4A 5IJ7E 2OVRB 2OK6A 4Z8LA 1C9IA 4GM9A 2HKMA 1T2XA 4MK0B 4XYIA 4XEIC 3HFQA 3IJEA 3VI4A 3I7KA 4L1MA 2CNXA 5FKQA 3DDUA 1JV2A 1XKSA 3AH8B 4JSXC 3NIFA 5A2Qg 4CZVA 2OK4A 1A12A 2B4EA 2YB8B 4ZOVA 3V9FA 4A0BB 5CXCB 3SBRA 4Y7RA 4PBYA 1GG2B 4JT6C 4ES0A 3JROA 1H2XA 4A11A 4GQBB 2HYEA 1VZ3A 3C9CA 3I7HA 1GOTB 1BPOA 3DXKC 3UKRC 3SVWD 1VYHC 5JWZA 1K8KC 3ULEC 3EG6A 3JZHA 5EARA 2G99A 3PE7A 1TYEA 3V5WB 5FLXg 3PXWD 5E6UA 1RI6A 3SWSD 3IURA 3V4PA 3EU7A 3FGBA 1U4CA 4J78A 2VC2A 2GC4A 2JKXA 2PM9A 3F3FA 5EMJB 4QQEA 2IUPA 2H6NA 2CE8A 4GM3A 1XIPA 3IJ1A 4CZYA 4J81A 2P9KC 1UOPA 4OWRA 5FFGA 4BCBA 3IIYA 4G56B 3IKOA 2OJYA 3I7OA 3JRPA 4X61B 4AN1A 5AJAA 2O9KA 4QT8A 3UVLA 1JMXB 3MZLA 2EIDA 3PSLA 2G9AA 5H14A 3MVDK 4Y5RD 3ZDZA 3I2NA 2QR5A 4D9SA 1GOGA 4JHNA 4BP9A 4FHLA 2Q7QA 4J0WA 3GFCA 2H3XA 1U2VC 5I5MA 2P9PC 3K6SA 4CI3A 4TZ4A 5KDOB 3IVMA 3C99A 4K3ID 4A11B 5HE1B 5I5IA 4PBZA 5IGQA 3BG0A 1N6EA 3RRMC 3SHFA 5M5UA 3ZDYA 2I3SA 1YR2A 4GM8A 4GGDA 4GGCA 1XHMA 3VA6A 2XL2A 3RFGA 1E5TA 2XDWA 5I5JA 5GXHA 2PM9B 4WJKA 5C86A 3T3PA 4FA1D 3KRXB 5HE2B 4Z7NA 2OIZA 4LG9A 3AL9A 4G55A 3GREA 4E5ZA 4X3EA 2VDLA 5FKSA 4R7AB 4CC9A 2PBIB 4A7JA 5B4WA 5FXYA 3C75H 4AMYA 4L3GD 2AGLA 3V4VA 1H2WA 4CI2A 1QFSA 2VDRA 4QRJA 4A08B 3AL8B 4GQ1A 3BG1A 3CFVA 4BP8A 4PSXB 2AGZA 4CY5A 3V7DB 4JXMA 4BL0A 5GXIA 4ERZA 5E6RA 3KCIA 2P9UC 2I0SA 1PBYB 1SQJA 5TF2A 3RMZD 1GXRA 3EI3A 1OMWB 5FKRA 5HDBA 3FM0A 1C9LA 5FQDA 2XE4A 3EI1A 5TEEA 3OTTA 2H9NA 4BCDA 3EI4A 3IUNA 4L1QD 5M61A 5IJ8E 4L9OA 3UR4A 1FWXA 3VGZA 1PGUA 2H14A 5EM2A 4CZXA 4FAVD 3ZWLB 4BH6A 2YMUA 4U7AA 1K3IA 5HQGA 1R5MA 4X60B 3JZNA 4O45A 1JTDB 4O2WA 3AFCA 3NVQA 3EQ7A 4PXWA 1MG3A 3PXTD 2H9MA 4E5ZB 2CE9A 2H9LA 5C92A 3CIKB 4H5IA 5EMMB 4G1MA 1K32A 3IJCA 2HKRA 4D6VA 3NIDA 3I7PA 4O02A 1SQ9A 5EALA 4J0XA 2CO0A 3F3PA 1TBGA 4J86A 2AGXA 5IC7A 3J81g 1N6FA 5FA5B 2P9LC 4J82A 5GSAA 3BWSA 1TYQC 2HJ4A 3L4OD 2XYIA 2VDOA 5IGOA 4DNWA 4MMZA 3L4MD 4J77A 3I7LA 4NBMA 2IUQA 3EI1B 1H2YA 3MUOA 1JOFA 3N0EA 2VZ3A 3O4HA 4ZOYA 4PNKB 1PEVA 3UVNA 5M5VA 2VDQA 3IULA 5EM2B 3SBQA 3FCUA 2AH1A 4I79A 5FFOA 3SFZA 4NAAA 3K71A 3RSEC 1I2MB 1GOFA 3JPXA 1L0QA 3IJ0A 4ZN4A 1O6FA 3SLED 3N0DA 4A0AA 2I3TA 3RLMD 3IUMA 5H1MA 1E8NA 3FRXA 2PM7B 3FCSA 3SMRA 3VI3A 1UTCA 4DNVA 3PSCB 4E54A 4J79A 4HDJA 4AX4A 4MMXA 1JJUB 2QZPA 2P9NC 2VZ1A
chains in the Genus database with same CATH topology
3EWEA 5AMSA 3K26A 2XU7A 3IIWA 3SN6B 2H13A 4A2MA 5C9ZB 5C2VB 3JB9L 2IWKA 3DM0A 4BUJC 4AOWA 5IT9g 5HYNB 3I8CA 4O3TB 2B5LA 4CI8A 5H17A 2QXVA 3C5MA 4NSXA 4PC0A 4UI9R 1Q47A 1YFQA 4H5JA 5HE0B 4ERYA 5CXCA 2HESX 3MKQA 3ORVD 3OKWA 3PVUB 4J8GA 2Z2OA 3J80g 4JSNC 4QL1A 4FA4D 3UVOA 2Z2PA 4CY2A 3I7NA 4FB1D 3UKUC 3JZGA 1QNIA 2YNNA 2GC7A 3I8EA 5EAMA 2TRCB 4GZ8A 3VH0A 2PM6B 4CI1A 4CY1A 4GQ2P 1MDAH 2CN3A 2J56H 3RN0D 4CY3A 4JT5C 2W18A 4L3HD 1NR0A 4A09A 2AH0A 3KRWB 2H6KA 3EI2A 3CFSB 3MZKA 3OL2A 4EWRA 3UVKA 2BBKH 3OKTA 2J55H 2OVQB 5FKTA 4OZUA 2XL3A 3JAMg 3B7FA 5CYKA 3ODTA 5CXBA 1JMZB 2B5NA 3OKYA 3W15A 1NEXB 1P22A 2UZXB 3EI3B 4YVDA 2AQ5A 4FAND 4KFMB 4JSPC 4A2LA 3EI4B 5TDHB 3MMYA 2CO0C 2UZYB 4GGAA 5SXMA 4O3UB 1GP2B 4XYHA 3NVNA 3NVXA 4LGNA 5K19A 1ERJA 3DWLC 3PVWB 2HXCA 4A09B 3U4YA 4X63B 2I0RA 2QC5A 5AFU3 4O1QD 5THAA 3EI2B 2YNOA 4N14A 3E0CA 3MKSB 4A08A 3AL8A 3OL2B 4ERQA 4IMMA 5GMKn 3RFHA 3SJLD 3SXTD 1SHYB 2H68A 4LG8A 4J8BA 2AGYA 2P9IC 5CYKB 1OLZA 2BCJB 2IUVA 2IWFA 2P9SC 5EMKB 5CXBB 3RN1D 4FA5D 3OKYB 4ZOZA 4O9DA 2MTAH 4J84A 3I89A 4IA9A 3A0FA 3MXXA 4AEZA 2AGWA 2GNQA 3SCYA 4FA9D 4JD2C 2H9PA 5K1CC 1N6DA 4A0BA 4D0KA 1A0RB 3P4FA 2Z2NA 4ZOXA 2IAAA 1B9XA 3EMHA 5TEFA 3UVMA 3PXSD 3OW8A 2B5MA 2H6QA 1B9YA 4FWWA 4GMBA 5HE3B 4JSVC 3SBPA 4A0AB 1MG2A 2YBAA 2HJBA 2IURA 4J73A 5C2WB 2J57G 3K27A 3DXMC 4E54B 2CN2A 2H47A 5EAPA 4PSWB 4J87A 5EMLB 2YNPA 2OVPB 4K3JB 4U1EI 3DSMA 1PI6A 1S4UX 2I0TA 4ESGA 2EBSA 3F3GA 5IJ7E 2OVRB 2OK6A 4Z8LA 4GM9A 2HKMA 4MK0B 4XYIA 4XEIC 3HFQA 3I7KA 2CNXA 5FKQA 1XKSA 3AH8B 4JSXC 5A2Qg 4CZVA 2OK4A 2YB8B 2B4EA 4ZOVA 3V9FA 4A0BB 5CXCB 3SBRA 4Y7RA 4PBYA 1GG2B 4JT6C 4ES0A 3JROA 4A11A 4GQBB 2HYEA 3C9CA 3I7HA 1GOTB 3DXKC 3UKRC 3SVWD 1VYHC 5JWZA 1K8KC 3ULEC 3EG6A 3JZHA 5EARA 2G99A 3PE7A 3V5WB 5FLXg 3PXWD 1RI6A 3SWSD 3EU7A 3FGBA 1U4CA 4J78A 2GC4A 2PM9A 3F3FA 5EMJB 4QQEA 2IUPA 2H6NA 2CE8A 4GM3A 1XIPA 3IJ1A 4CZYA 4J81A 2P9KC 4OWRA 3IIYA 4G56B 2OJYA 3IKOA 3I7OA 3JRPA 4X61B 5AJAA 2O9KA 4QT8A 3UVLA 1JMXB 3MZLA 3PSLA 2G9AA 5H14A 4Y5RD 3I2NA 4FHLA 2Q7QA 4J0WA 3GFCA 2H3XA 1U2VC 5I5MA 2P9PC 4CI3A 4TZ4A 5KDOB 3C99A 4K3ID 4A11B 5HE1B 5I5IA 4PBZA 5IGQA 3BG0A 1N6EA 3RRMC 3SHFA 2I3SA 4GM8A 4GGDA 4GGCA 1XHMA 3VA6A 2XL2A 3RFGA 5I5JA 5GXHA 2PM9B 4FA1D 3KRXB 5HE2B 2OIZA 4LG9A 3AL9A 3GREA 4E5ZA 4X3EA 5FKSA 4R7AB 4CC9A 2PBIB 4A7JA 5B4WA 5FXYA 3C75H 4L3GD 2AGLA 4CI2A 4QRJA 4A08B 3AL8B 4GQ1A 3BG1A 3CFVA 4PSXB 2AGZA 4CY5A 3V7DB 4JXMA 4BL0A 5GXIA 4ERZA 2P9UC 2I0SA 1PBYB 1SQJA 5TF2A 1GXRA 3EI3A 1OMWB 5FKRA 3FM0A 5FQDA 3EI1A 5TEEA 3OTTA 2H9NA 3EI4A 4L1QD 5IJ8E 4L9OA 3UR4A 1FWXA 3VGZA 1PGUA 2H14A 5EM2A 4CZXA 4FAVD 3ZWLB 4BH6A 2YMUA 4U7AA 5HQGA 1R5MA 4X60B 3JZNA 4O45A 3AFCA 3NVQA 4PXWA 1MG3A 3PXTD 2H9MA 4E5ZB 2CE9A 2H9LA 3CIKB 4H5IA 5EMMB 1K32A 3IJCA 2HKRA 4D6VA 3I7PA 1SQ9A 5EALA 4J0XA 2CO0A 3F3PA 1TBGA 4J86A 2AGXA 5IC7A 3J81g 1N6FA 5FA5B 2P9LC 4J82A 5GSAA 3BWSA 1TYQC 2HJ4A 3L4OD 2XYIA 5IGOA 3L4MD 4J77A 3I7LA 2IUQA 3EI1B 1JOFA 3N0EA 4ZOYA 4PNKB 1PEVA 3UVNA 5EM2B 3SBQA 2AH1A 4I79A 3SFZA 3RSEC 3JPXA 1L0QA 3IJ0A 4ZN4A 3SLED 3N0DA 4A0AA 2I3TA 3RLMD 5H1MA 3FRXA 2PM7B 3SMRA 3PSCB 4E54A 4J79A 4HDJA 1JJUB 3RMZD 2P9NC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EWE A;  5AMS A;  3K26 A;  2XU7 A;  3IIW A;  3SN6 B;  2H13 A;  4A2M A;  5C9Z B;  5C2V B;  3JB9 L;  2IWK A;  3DM0 A;  4BUJ C;  4AOW A;  5IT9 g;  5HYN B;  3I8C A;  4O3T B;  2B5L A;  4CI8 A;  5H17 A;  2QXV A;  3C5M A;  4NSX A;  4PC0 A;  4UI9 R;  1Q47 A;  1YFQ A;  4H5J A;  5HE0 B;  4ERY A;  5CXC A;  2HES X;  3MKQ A;  3ORV D;  3OKW A;  3PVU B;  4J8G A;  2Z2O A;  3J80 g;  4JSN C;  4QL1 A;  4FA4 D;  3UVO A;  2Z2P A;  4CY2 A;  3I7N A;  4FB1 D;  3UKU C;  3JZG A;  1QNI A;  2YNN A;  2GC7 A;  3I8E A;  5EAM A;  2TRC B;  4GZ8 A;  3VH0 A;  2PM6 B;  4CI1 A;  4CY1 A;  4GQ2 P;  1MDA H;  2CN3 A;  2J56 H;  3RN0 D;  4CY3 A;  4JT5 C;  2W18 A;  4L3H D;  1NR0 A;  4A09 A;  2AH0 A;  3KRW B;  2H6K A;  3EI2 A;  3CFS B;  3MZK A;  3OL2 A;  4EWR A;  3UVK A;  2BBK H;  3OKT A;  2J55 H;  2OVQ B;  5FKT A;  4OZU A;  2XL3 A;  3JAM g;  3B7F A;  5CYK A;  3ODT A;  5CXB A;  1JMZ B;  2B5N A;  3OKY A;  3W15 A;  1NEX B;  1P22 A;  2UZX B;  3EI3 B;  4YVD A;  2AQ5 A;  4FAN D;  4KFM B;  4JSP C;  4A2L A;  3EI4 B;  5TDH B;  3MMY A;  2CO0 C;  2UZY B;  4GGA A;  5SXM A;  4O3U B;  1GP2 B;  4XYH A;  3NVN A;  3NVX A;  4LGN A;  5K19 A;  1ERJ A;  3DWL C;  3PVW B;  2HXC A;  4A09 B;  3U4Y A;  4X63 B;  2I0R A;  2QC5 A;  5AFU 3;  4O1Q D;  5THA A;  3EI2 B;  2YNO A;  4N14 A;  3E0C A;  3MKS B;  4A08 A;  3AL8 A;  3OL2 B;  4ERQ A;  4IMM A;  5GMK n;  3RFH A;  3SJL D;  3SXT D;  1SHY B;  2H68 A;  4LG8 A;  4J8B A;  2AGY A;  2P9I C;  5CYK B;  1OLZ A;  2BCJ B;  2IUV A;  2IWF A;  2P9S C;  5EMK B;  5CXB B;  3RN1 D;  4FA5 D;  3OKY B;  4ZOZ A;  4O9D A;  2MTA H;  4J84 A;  3I89 A;  4IA9 A;  3A0F A;  3MXX A;  4AEZ A;  2AGW A;  2GNQ A;  3SCY A;  4FA9 D;  4JD2 C;  2H9P A;  5K1C C;  1N6D A;  4A0B A;  4D0K A;  1A0R B;  3P4F A;  2Z2N A;  4ZOX A;  2IAA A;  1B9X A;  3EMH A;  5TEF A;  3UVM A;  3PXS D;  3OW8 A;  2B5M A;  2H6Q A;  1B9Y A;  4FWW A;  4GMB A;  5HE3 B;  4JSV C;  3SBP A;  4A0A B;  1MG2 A;  2YBA A;  2HJB A;  2IUR A;  4J73 A;  5C2W B;  2J57 G;  3K27 A;  3DXM C;  4E54 B;  2CN2 A;  2H47 A;  5EAP A;  4PSW B;  4J87 A;  5EML B;  2YNP A;  2OVP B;  4K3J B;  4U1E I;  3DSM A;  1PI6 A;  1S4U X;  2I0T A;  4ESG A;  2EBS A;  3F3G A;  5IJ7 E;  2OVR B;  2OK6 A;  4Z8L A;  4GM9 A;  2HKM A;  4MK0 B;  4XYI A;  4XEI C;  3HFQ A;  3I7K A;  2CNX A;  5FKQ A;  1XKS A;  3AH8 B;  4JSX C;  5A2Q g;  4CZV A;  2OK4 A;  2YB8 B;  2B4E A;  4ZOV A;  3V9F A;  4A0B B;  5CXC B;  3SBR A;  4Y7R A;  4PBY A;  1GG2 B;  4JT6 C;  4ES0 A;  3JRO A;  4A11 A;  4GQB B;  2HYE A;  3C9C A;  3I7H A;  1GOT B;  3DXK C;  3UKR C;  3SVW D;  1VYH C;  5JWZ A;  1K8K C;  3ULE C;  3EG6 A;  3JZH A;  5EAR A;  2G99 A;  3PE7 A;  3V5W B;  5FLX g;  3PXW D;  1RI6 A;  3SWS D;  3EU7 A;  3FGB A;  1U4C A;  4J78 A;  2GC4 A;  2PM9 A;  3F3F A;  5EMJ B;  4QQE A;  2IUP A;  2H6N A;  2CE8 A;  4GM3 A;  1XIP A;  3IJ1 A;  4CZY A;  4J81 A;  2P9K C;  4OWR A;  3IIY A;  4G56 B;  2OJY A;  3IKO A;  3I7O A;  3JRP A;  4X61 B;  5AJA A;  2O9K A;  4QT8 A;  3UVL A;  1JMX B;  3MZL A;  3PSL A;  2G9A A;  5H14 A;  4Y5R D;  3I2N A;  4FHL A;  2Q7Q A;  4J0W A;  3GFC A;  2H3X A;  1U2V C;  5I5M A;  2P9P C;  4CI3 A;  4TZ4 A;  5KDO B;  3C99 A;  4K3I D;  4A11 B;  5HE1 B;  5I5I A;  4PBZ A;  5IGQ A;  3BG0 A;  1N6E A;  3RRM C;  3SHF A;  2I3S A;  4GM8 A;  4GGD A;  4GGC A;  1XHM A;  3VA6 A;  2XL2 A;  3RFG A;  5I5J A;  5GXH A;  2PM9 B;  4FA1 D;  3KRX B;  5HE2 B;  2OIZ A;  4LG9 A;  3AL9 A;  3GRE A;  4E5Z A;  4X3E A;  5FKS A;  4R7A B;  4CC9 A;  2PBI B;  4A7J A;  5B4W A;  5FXY A;  3C75 H;  4L3G D;  2AGL A;  4CI2 A;  4QRJ A;  4A08 B;  3AL8 B;  4GQ1 A;  3BG1 A;  3CFV A;  4PSX B;  2AGZ A;  4CY5 A;  3V7D B;  4JXM A;  4BL0 A;  5GXI A;  4ERZ A;  2P9U C;  2I0S A;  1PBY B;  1SQJ A;  5TF2 A;  1GXR A;  3EI3 A;  1OMW B;  5FKR A;  3FM0 A;  5FQD A;  3EI1 A;  5TEE A;  3OTT A;  2H9N A;  3EI4 A;  4L1Q D;  5IJ8 E;  4L9O A;  3UR4 A;  1FWX A;  3VGZ A;  1PGU A;  2H14 A;  5EM2 A;  4CZX A;  4FAV D;  3ZWL B;  4BH6 A;  2YMU A;  4U7A A;  5HQG A;  1R5M A;  4X60 B;  3JZN A;  4O45 A;  3AFC A;  3NVQ A;  4PXW A;  1MG3 A;  3PXT D;  2H9M A;  4E5Z B;  2CE9 A;  2H9L A;  3CIK B;  4H5I A;  5EMM B;  1K32 A;  3IJC A;  2HKR A;  4D6V A;  3I7P A;  1SQ9 A;  5EAL A;  4J0X A;  2CO0 A;  3F3P A;  1TBG A;  4J86 A;  2AGX A;  5IC7 A;  3J81 g;  1N6F A;  5FA5 B;  2P9L C;  4J82 A;  5GSA A;  3BWS A;  1TYQ C;  2HJ4 A;  3L4O D;  2XYI A;  5IGO A;  3L4M D;  4J77 A;  3I7L A;  2IUQ A;  3EI1 B;  1JOF A;  3N0E A;  4ZOY A;  4PNK B;  1PEV A;  3UVN A;  5EM2 B;  3SBQ A;  2AH1 A;  4I79 A;  3SFZ A;  3RSE C;  3JPX A;  1L0Q A;  3IJ0 A;  4ZN4 A;  3SLE D;  3N0D A;  4A0A A;  2I3T A;  3RLM D;  5H1M A;  3FRX A;  2PM7 B;  3SMR A;  3PSC B;  4E54 A;  4J79 A;  4HDJ A;  1JJU B;  3RMZ D;  2P9N C; 
#chains in the Genus database with same CATH topology
 3EWE A;  5AMS A;  3K26 A;  2XU7 A;  3IIW A;  3SN6 B;  1M1X A;  2H13 A;  4A2M A;  5C9Z B;  5C2V B;  3JB9 L;  2IWK A;  3DM0 A;  4QAM A;  4BUJ C;  4AOW A;  4WK2 A;  5IT9 g;  5HYN B;  1E8M A;  3I8C A;  1O6G A;  4O3T B;  2B5L A;  3K72 A;  4CI8 A;  5H17 A;  2QXV A;  3NIG A;  3C5M A;  4NSX A;  4PC0 A;  4UI9 R;  1Q47 A;  1UOQ A;  1YFQ A;  4H5J A;  5HE0 B;  4ERY A;  5CXC A;  2HES X;  3MKQ A;  1VE7 A;  3ORV D;  3OKW A;  2WQ8 A;  1VZ2 A;  4MMY A;  3PVU B;  2VDP A;  4J8G A;  2Z2O A;  3J80 g;  4JSN C;  4QL1 A;  4FA4 D;  3UVO A;  2Z2P A;  4CY2 A;  4UM9 A;  3I7N A;  4FB1 D;  3UKU C;  3JZG A;  3ZE1 A;  1VE6 A;  3QI0 A;  1QNI A;  2YNN A;  2GC7 A;  3I8E A;  5EAM A;  2TRC B;  4GZ8 A;  3VH0 A;  2PM6 B;  4WK4 A;  4CI1 A;  4CY1 A;  5M5T A;  4GQ2 P;  1MDA H;  1QFM A;  2EIB A;  3OF7 A;  2CN3 A;  2J56 H;  3RN0 D;  4AMZ A;  4CY3 A;  4JT5 C;  2W18 A;  3O4I A;  4L3H D;  1NR0 A;  4DNU A;  4A09 A;  2AH0 A;  4AN0 A;  3KRW B;  2HU7 A;  2H6K A;  3EI2 A;  3CFS B;  2HU8 A;  3MZK A;  3OL2 A;  4EWR A;  3UVK A;  2BBK H;  3OKT A;  2J55 H;  2OVQ B;  5FKT A;  4OZU A;  2XL3 A;  3JAM g;  3IUJ A;  3EQ9 A;  3B7F A;  5CYK A;  3ODT A;  5CXB A;  1JMZ B;  3IUQ A;  2B5N A;  3OKY A;  3EQ8 A;  1NEX B;  1P22 A;  2EIE A;  2UZX B;  3EI3 B;  2AQ5 A;  4UM8 A;  4YVD A;  3W15 A;  4FAN D;  4KFM B;  3O4G A;  4JSP C;  4A2L A;  3EI4 B;  5TDH B;  1GOH A;  3MMY A;  2CO0 C;  2UZY B;  4GGA A;  5SXM A;  4O3U B;  1GP2 B;  4XYH A;  2EIC A;  3GC3 B;  3NVN A;  3NVX A;  4LGN A;  5K19 A;  1ERJ A;  4IRZ A;  3DWL C;  2HU5 A;  3PVW B;  2HXC A;  4A09 B;  3U4Y A;  4X63 B;  2I0R A;  2VDM A;  2QC5 A;  5AFU 3;  4O1Q D;  5THA A;  3EI2 B;  1L5G A;  2YNO A;  4N14 A;  3E0C A;  3MKS B;  4A08 A;  3AL8 A;  3OL2 B;  4NEN A;  4ERQ A;  4IMM A;  5GMK n;  3RFH A;  3SJL D;  3T3M A;  4WK0 A;  3GD1 I;  3SXT D;  1SHY B;  2H68 A;  4LG8 A;  2VDN A;  4J8B A;  2AGY A;  3ZDX A;  2P9I C;  5CYK B;  1OLZ A;  2BCJ B;  2IUV A;  2IWF A;  2P9S C;  5EMK B;  5CXB B;  3RN1 D;  4FA5 D;  3OKY B;  4ZOZ A;  4O9D A;  1H2Z A;  2MTA H;  4J84 A;  3I89 A;  4IA9 A;  3A0F A;  2XZG A;  3MXX A;  5M5R A;  4AEZ A;  2AGW A;  2GNQ A;  3SCY A;  3O4J A;  4FA9 D;  4JD2 C;  2H9P A;  5K1C C;  1N6D A;  4A0B A;  4D0K A;  1A0R B;  3P4F A;  2Z2N A;  4ZOX A;  2IAA A;  1B9X A;  3EMH A;  5TEF A;  3UVM A;  3PXS D;  3OW8 A;  2B5M A;  2H6Q A;  4Z7Q A;  1B9Y A;  4FWW A;  4GMB A;  1U8C A;  4RE6 A;  5HE3 B;  4JSV C;  3SBP A;  4A0A B;  1MG2 A;  5E6S A;  2YBA A;  4Z7O A;  2BKL A;  2HJB A;  2IUR A;  4J73 A;  5C2W B;  2VDK A;  1UOO A;  2J57 G;  3K27 A;  3QHY B;  3DXM C;  4E54 B;  2CN2 A;  2H47 A;  5EAP A;  4PSW B;  4J87 A;  4RE5 A;  3ZE0 A;  5EML B;  2YNP A;  2OVP B;  4K3J B;  4U1E I;  4BCC A;  3DSM A;  1PI6 A;  1S4U X;  2I0T A;  4G1E A;  3MUN A;  4ESG A;  5M5S A;  2EBS A;  4JHP C;  3F3G A;  3ZE2 A;  4NC4 A;  5IJ7 E;  2OVR B;  2OK6 A;  4Z8L A;  1C9I A;  4GM9 A;  2HKM A;  1T2X A;  4MK0 B;  4XYI A;  4XEI C;  3HFQ A;  3IJE A;  3VI4 A;  3I7K A;  4L1M A;  2CNX A;  5FKQ A;  3DDU A;  1JV2 A;  1XKS A;  3AH8 B;  4JSX C;  3NIF A;  5A2Q g;  4CZV A;  2OK4 A;  1A12 A;  2B4E A;  2YB8 B;  4ZOV A;  3V9F A;  4A0B B;  5CXC B;  3SBR A;  4Y7R A;  4PBY A;  1GG2 B;  4JT6 C;  4ES0 A;  3JRO A;  1H2X A;  4A11 A;  4GQB B;  2HYE A;  1VZ3 A;  3C9C A;  3I7H A;  1GOT B;  1BPO A;  3DXK C;  3UKR C;  3SVW D;  1VYH C;  5JWZ A;  1K8K C;  3ULE C;  3EG6 A;  3JZH A;  5EAR A;  2G99 A;  3PE7 A;  1TYE A;  3V5W B;  5FLX g;  3PXW D;  5E6U A;  1RI6 A;  3SWS D;  3IUR A;  3V4P A;  3EU7 A;  3FGB A;  1U4C A;  4J78 A;  2VC2 A;  2GC4 A;  2JKX A;  2PM9 A;  3F3F A;  5EMJ B;  4QQE A;  2IUP A;  2H6N A;  2CE8 A;  4GM3 A;  1XIP A;  3IJ1 A;  4CZY A;  4J81 A;  2P9K C;  1UOP A;  4OWR A;  5FFG A;  4BCB A;  3IIY A;  4G56 B;  3IKO A;  2OJY A;  3I7O A;  3JRP A;  4X61 B;  4AN1 A;  5AJA A;  2O9K A;  4QT8 A;  3UVL A;  1JMX B;  3MZL A;  2EID A;  3PSL A;  2G9A A;  5H14 A;  3MVD K;  4Y5R D;  3ZDZ A;  3I2N A;  2QR5 A;  4D9S A;  1GOG A;  4JHN A;  4BP9 A;  4FHL A;  2Q7Q A;  4J0W A;  3GFC A;  2H3X A;  1U2V C;  5I5M A;  2P9P C;  3K6S A;  4CI3 A;  4TZ4 A;  5KDO B;  3IVM A;  3C99 A;  4K3I D;  4A11 B;  5HE1 B;  5I5I A;  4PBZ A;  5IGQ A;  3BG0 A;  1N6E A;  3RRM C;  3SHF A;  5M5U A;  3ZDY A;  2I3S A;  1YR2 A;  4GM8 A;  4GGD A;  4GGC A;  1XHM A;  3VA6 A;  2XL2 A;  3RFG A;  1E5T A;  2XDW A;  5I5J A;  5GXH A;  2PM9 B;  4WJK A;  5C86 A;  3T3P A;  4FA1 D;  3KRX B;  5HE2 B;  4Z7N A;  2OIZ A;  4LG9 A;  3AL9 A;  4G55 A;  3GRE A;  4E5Z A;  4X3E A;  2VDL A;  5FKS A;  4R7A B;  4CC9 A;  2PBI B;  4A7J A;  5B4W A;  5FXY A;  3C75 H;  4AMY A;  4L3G D;  2AGL A;  3V4V A;  1H2W A;  4CI2 A;  1QFS A;  2VDR A;  4QRJ A;  4A08 B;  3AL8 B;  4GQ1 A;  3BG1 A;  3CFV A;  4BP8 A;  4PSX B;  2AGZ A;  4CY5 A;  3V7D B;  4JXM A;  4BL0 A;  5GXI A;  4ERZ A;  5E6R A;  3KCI A;  2P9U C;  2I0S A;  1PBY B;  1SQJ A;  5TF2 A;  3RMZ D;  1GXR A;  3EI3 A;  1OMW B;  5FKR A;  5HDB A;  3FM0 A;  1C9L A;  5FQD A;  2XE4 A;  3EI1 A;  5TEE A;  3OTT A;  2H9N A;  4BCD A;  3EI4 A;  3IUN A;  4L1Q D;  5M61 A;  5IJ8 E;  4L9O A;  3UR4 A;  1FWX A;  3VGZ A;  1PGU A;  2H14 A;  5EM2 A;  4CZX A;  4FAV D;  3ZWL B;  4BH6 A;  2YMU A;  4U7A A;  1K3I A;  5HQG A;  1R5M A;  4X60 B;  3JZN A;  4O45 A;  1JTD B;  4O2W A;  3AFC A;  3NVQ A;  3EQ7 A;  4PXW A;  1MG3 A;  3PXT D;  2H9M A;  4E5Z B;  2CE9 A;  2H9L A;  5C92 A;  3CIK B;  4H5I A;  5EMM B;  4G1M A;  1K32 A;  3IJC A;  2HKR A;  4D6V A;  3NID A;  3I7P A;  4O02 A;  1SQ9 A;  5EAL A;  4J0X A;  2CO0 A;  3F3P A;  1TBG A;  4J86 A;  2AGX A;  5IC7 A;  3J81 g;  1N6F A;  5FA5 B;  2P9L C;  4J82 A;  5GSA A;  3BWS A;  1TYQ C;  2HJ4 A;  3L4O D;  2XYI A;  2VDO A;  5IGO A;  4DNW A;  4MMZ A;  3L4M D;  4J77 A;  3I7L A;  4NBM A;  2IUQ A;  3EI1 B;  1H2Y A;  3MUO A;  1JOF A;  3N0E A;  2VZ3 A;  3O4H A;  4ZOY A;  4PNK B;  1PEV A;  3UVN A;  5M5V A;  2VDQ A;  3IUL A;  5EM2 B;  3SBQ A;  3FCU A;  2AH1 A;  4I79 A;  5FFO A;  3SFZ A;  4NAA A;  3K71 A;  3RSE C;  1I2M B;  1GOF A;  3JPX A;  1L0Q A;  3IJ0 A;  4ZN4 A;  1O6F A;  3SLE D;  3N0D A;  4A0A A;  2I3T A;  3RLM D;  3IUM A;  5H1M A;  1E8N A;  3FRX A;  2PM7 B;  3FCS A;  3SMR A;  3VI3 A;  1UTC A;  4DNV A;  3PSC B;  4E54 A;  4J79 A;  4HDJ A;  4AX4 A;  4MMX A;  1JJU B;  2QZP A;  2P9N C;  2VZ1 A; 
#chains in the Genus database with same CATH homology
 3EWE A;  5AMS A;  3K26 A;  2XU7 A;  3IIW A;  3SN6 B;  2H13 A;  4A2M A;  5C9Z B;  5C2V B;  3JB9 L;  2IWK A;  3DM0 A;  4BUJ C;  4AOW A;  5IT9 g;  5HYN B;  3I8C A;  4O3T B;  2B5L A;  4CI8 A;  5H17 A;  2QXV A;  3C5M A;  4NSX A;  4PC0 A;  4UI9 R;  1Q47 A;  1YFQ A;  4H5J A;  5HE0 B;  4ERY A;  5CXC A;  2HES X;  3MKQ A;  3ORV D;  3OKW A;  3PVU B;  4J8G A;  2Z2O A;  3J80 g;  4JSN C;  4QL1 A;  4FA4 D;  3UVO A;  2Z2P A;  4CY2 A;  3I7N A;  4FB1 D;  3UKU C;  3JZG A;  1QNI A;  2YNN A;  2GC7 A;  3I8E A;  5EAM A;  2TRC B;  4GZ8 A;  3VH0 A;  2PM6 B;  4CI1 A;  4CY1 A;  4GQ2 P;  1MDA H;  2CN3 A;  2J56 H;  3RN0 D;  4CY3 A;  4JT5 C;  2W18 A;  4L3H D;  1NR0 A;  4A09 A;  2AH0 A;  3KRW B;  2H6K A;  3EI2 A;  3CFS B;  3MZK A;  3OL2 A;  4EWR A;  3UVK A;  2BBK H;  3OKT A;  2J55 H;  2OVQ B;  5FKT A;  4OZU A;  2XL3 A;  3JAM g;  3B7F A;  5CYK A;  3ODT A;  5CXB A;  1JMZ B;  2B5N A;  3OKY A;  3W15 A;  1NEX B;  1P22 A;  2UZX B;  3EI3 B;  4YVD A;  2AQ5 A;  4FAN D;  4KFM B;  4JSP C;  4A2L A;  3EI4 B;  5TDH B;  3MMY A;  2CO0 C;  2UZY B;  4GGA A;  5SXM A;  4O3U B;  1GP2 B;  4XYH A;  3NVN A;  3NVX A;  4LGN A;  5K19 A;  1ERJ A;  3DWL C;  3PVW B;  2HXC A;  4A09 B;  3U4Y A;  4X63 B;  2I0R A;  2QC5 A;  5AFU 3;  4O1Q D;  5THA A;  3EI2 B;  2YNO A;  4N14 A;  3E0C A;  3MKS B;  4A08 A;  3AL8 A;  3OL2 B;  4ERQ A;  4IMM A;  5GMK n;  3RFH A;  3SJL D;  3SXT D;  1SHY B;  2H68 A;  4LG8 A;  4J8B A;  2AGY A;  2P9I C;  5CYK B;  1OLZ A;  2BCJ B;  2IUV A;  2IWF A;  2P9S C;  5EMK B;  5CXB B;  3RN1 D;  4FA5 D;  3OKY B;  4ZOZ A;  4O9D A;  2MTA H;  4J84 A;  3I89 A;  4IA9 A;  3A0F A;  3MXX A;  4AEZ A;  2AGW A;  2GNQ A;  3SCY A;  4FA9 D;  4JD2 C;  2H9P A;  5K1C C;  1N6D A;  4A0B A;  4D0K A;  1A0R B;  3P4F A;  2Z2N A;  4ZOX A;  2IAA A;  1B9X A;  3EMH A;  5TEF A;  3UVM A;  3PXS D;  3OW8 A;  2B5M A;  2H6Q A;  1B9Y A;  4FWW A;  4GMB A;  5HE3 B;  4JSV C;  3SBP A;  4A0A B;  1MG2 A;  2YBA A;  2HJB A;  2IUR A;  4J73 A;  5C2W B;  2J57 G;  3K27 A;  3DXM C;  4E54 B;  2CN2 A;  2H47 A;  5EAP A;  4PSW B;  4J87 A;  5EML B;  2YNP A;  2OVP B;  4K3J B;  4U1E I;  3DSM A;  1PI6 A;  1S4U X;  2I0T A;  4ESG A;  2EBS A;  3F3G A;  5IJ7 E;  2OVR B;  2OK6 A;  4Z8L A;  4GM9 A;  2HKM A;  4MK0 B;  4XYI A;  4XEI C;  3HFQ A;  3I7K A;  2CNX A;  5FKQ A;  1XKS A;  3AH8 B;  4JSX C;  5A2Q g;  4CZV A;  2OK4 A;  2YB8 B;  2B4E A;  4ZOV A;  3V9F A;  4A0B B;  5CXC B;  3SBR A;  4Y7R A;  4PBY A;  1GG2 B;  4JT6 C;  4ES0 A;  3JRO A;  4A11 A;  4GQB B;  2HYE A;  3C9C A;  3I7H A;  1GOT B;  3DXK C;  3UKR C;  3SVW D;  1VYH C;  5JWZ A;  1K8K C;  3ULE C;  3EG6 A;  3JZH A;  5EAR A;  2G99 A;  3PE7 A;  3V5W B;  5FLX g;  3PXW D;  1RI6 A;  3SWS D;  3EU7 A;  3FGB A;  1U4C A;  4J78 A;  2GC4 A;  2PM9 A;  3F3F A;  5EMJ B;  4QQE A;  2IUP A;  2H6N A;  2CE8 A;  4GM3 A;  1XIP A;  3IJ1 A;  4CZY A;  4J81 A;  2P9K C;  4OWR A;  3IIY A;  4G56 B;  2OJY A;  3IKO A;  3I7O A;  3JRP A;  4X61 B;  5AJA A;  2O9K A;  4QT8 A;  3UVL A;  1JMX B;  3MZL A;  3PSL A;  2G9A A;  5H14 A;  4Y5R D;  3I2N A;  4FHL A;  2Q7Q A;  4J0W A;  3GFC A;  2H3X A;  1U2V C;  5I5M A;  2P9P C;  4CI3 A;  4TZ4 A;  5KDO B;  3C99 A;  4K3I D;  4A11 B;  5HE1 B;  5I5I A;  4PBZ A;  5IGQ A;  3BG0 A;  1N6E A;  3RRM C;  3SHF A;  2I3S A;  4GM8 A;  4GGD A;  4GGC A;  1XHM A;  3VA6 A;  2XL2 A;  3RFG A;  5I5J A;  5GXH A;  2PM9 B;  4FA1 D;  3KRX B;  5HE2 B;  2OIZ A;  4LG9 A;  3AL9 A;  3GRE A;  4E5Z A;  4X3E A;  5FKS A;  4R7A B;  4CC9 A;  2PBI B;  4A7J A;  5B4W A;  5FXY A;  3C75 H;  4L3G D;  2AGL A;  4CI2 A;  4QRJ A;  4A08 B;  3AL8 B;  4GQ1 A;  3BG1 A;  3CFV A;  4PSX B;  2AGZ A;  4CY5 A;  3V7D B;  4JXM A;  4BL0 A;  5GXI A;  4ERZ A;  2P9U C;  2I0S A;  1PBY B;  1SQJ A;  5TF2 A;  1GXR A;  3EI3 A;  1OMW B;  5FKR A;  3FM0 A;  5FQD A;  3EI1 A;  5TEE A;  3OTT A;  2H9N A;  3EI4 A;  4L1Q D;  5IJ8 E;  4L9O A;  3UR4 A;  1FWX A;  3VGZ A;  1PGU A;  2H14 A;  5EM2 A;  4CZX A;  4FAV D;  3ZWL B;  4BH6 A;  2YMU A;  4U7A A;  5HQG A;  1R5M A;  4X60 B;  3JZN A;  4O45 A;  3AFC A;  3NVQ A;  4PXW A;  1MG3 A;  3PXT D;  2H9M A;  4E5Z B;  2CE9 A;  2H9L A;  3CIK B;  4H5I A;  5EMM B;  1K32 A;  3IJC A;  2HKR A;  4D6V A;  3I7P A;  1SQ9 A;  5EAL A;  4J0X A;  2CO0 A;  3F3P A;  1TBG A;  4J86 A;  2AGX A;  5IC7 A;  3J81 g;  1N6F A;  5FA5 B;  2P9L C;  4J82 A;  5GSA A;  3BWS A;  1TYQ C;  2HJ4 A;  3L4O D;  2XYI A;  5IGO A;  3L4M D;  4J77 A;  3I7L A;  2IUQ A;  3EI1 B;  1JOF A;  3N0E A;  4ZOY A;  4PNK B;  1PEV A;  3UVN A;  5EM2 B;  3SBQ A;  2AH1 A;  4I79 A;  3SFZ A;  3RSE C;  3JPX A;  1L0Q A;  3IJ0 A;  4ZN4 A;  3SLE D;  3N0D A;  4A0A A;  2I3T A;  3RLM D;  5H1M A;  3FRX A;  2PM7 B;  3SMR A;  3PSC B;  4E54 A;  4J79 A;  4HDJ A;  1JJU B;  3RMZ D;  2P9N C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...