2G99A

Structural basis for the specific recognition of methylated histone h3 lysine 4 by the wd-40 protein wdr5
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
304
structure length
304
Chain Sequence
PVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the specific recognition of methylated histone H3 lysine 4 by the WD-40 protein WDR5
rcsb
source organism Homo sapiens
molecule tags Structural protein/dna binding protein
molecule keywords WD-repeat protein 5
total genus 94
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2g99A00
3BG1A 1R5MA 2H3XA 3EMHA 3SLED 1SQ9A 3UVNA 2YMUA 5CXBA 2YB8B 3PXTD 3NVQA 2XL3A 2HJ4A 3I7PA 3PVWB 3RN0D 3I8EA 2HKMA 4NSXA 3I8CA 4H5JA 4E54B 3F3GA 2IURA 4J0XA 3PVUB 5CYKB 4GM8A 4A11B 3I7KA 5GXHA 5HE1B 4E54A 1OLZA 4JT6C 2HKRA 5FKSA 2HESX 5CXCB 3P4FA 1K32A 3NVNA 4YVDA 4A0AB 2CE8A 3W15A 4JT5C 4CY3A 1JOFA 5CXBB 5TF2A 5IT9g 4GM9A 4ERZA 3RFHA 2EBSA 4GZ8A 5FA5B 2HYEA 3DXMC 1S4UX 3UKUC 3IJCA 5TEFA 4LG8A 5EMKB 1MG2A 4A08B 3I7NA 3IKOA 4J82A 4OZUA 4LGNA 4PC0A 3EI2B 2OVQB 5CXCA 3IJ1A 3OW8A 5EALA 4J0WA 3F3FA 2OK4A 3K27A 2IUVA 4FHLA 3SN6B 3AH8B 1MG3A 4EWRA 4H5IA 3IIYA 5FKRA 4N14A 3I2NA 3J80g 2YNOA 3VH0A 2P9NC 2AGWA 2Z2OA 4GGAA 2GC4A 3CFVA 1GXRA 3EI1A 3E0CA 4O1QD 3SWSD 5GXIA 2BCJB 3I7HA 4ZOYA 3BG0A 2H9NA 4A7JA 4J81A 3ORVD 3B7FA 2MTAH 4OWRA 5IJ8E 3SCYA 3SBPA 4X3EA 1PI6A 5H14A 1N6EA 1YFQA 2CO0C 4CI2A 3IJ0A 4D0KA 2P9UC 4CI3A 3MKSB 4QQEA 1TBGA 1SHYB 2O9KA 5C2VB 4PBYA 4CZXA 3EI4B 3UKRC 2H47A 4O45A 5EM2B 4PSXB 1JMXB 2YNNA 3FM0A 2GC7A 5C2WB 4FWWA 3V9FA 4K3JB 3SBQA 3JAMg 3F3PA 2I3TA 3JZGA 2PM7B 4D6VA 3RLMD 4E5ZA 2AGLA 3UVKA 4IMMA 3SJLD 2IWKA 3PSLA 4FA5D 3KRWB 5KDOB 1N6DA 2OVPB 2I3SA 4FAND 5IC7A 3UVLA 5HE3B 5TDHB 4CY5A 5GMKn 3L4OD 3OKWA 3DM0A 4A0AA 3I89A 1P22A 4UI9R 5EARA 5I5MA 2PM6B 1QNIA 2OVRB 4XYIA 4BUJC 1MDAH 3SBRA 2P9KC 4PSWB 3PSCB 5THAA 4U7AA 5CYKA 4J8GA 1N6FA 1OMWB 3EI4A 2AQ5A 3VGZA 4FA4D 4J73A 4L9OA 4GGDA 4ES0A 3C75H 4CZYA 3AL9A 4A11A 3C99A 5B4WA 3AL8B 2AGZA 3CFSB 1PGUA 2QXVA 4A0BB 3A0FA 4QRJA 3AL8A 3OL2B 5FXYA 5I5JA 2G99A 5GSAA 4QL1A 2PM9B 2CO0A 4JSXC 3GFCA 2B5LA 3OL2A 1GOTB 2HXCA 4CZVA 3I7OA 3MMYA 4A08A 2PM9A 4A09A 5HYNB 4CC9A 2P9IC 4ESGA 1SQJA 4L3GD 3EI2A 3OKYB 1L0QA 3C9CA 2OK6A 2AH0A 3EG6A 3EWEA 2IWFA 3FRXA 4ZN4A 4FB1D 3MZLA 4FA9D 4X61B 3C5MA 3DXKC 2OJYA 1VYHC 4CY1A 5HQGA 4J84A 4G56B 1K8KC 5FQDA 4AEZA 2CE9A 2YBAA 4ERYA 1RI6A 1NEXB 4A09B 3BWSA 1JMZB 1XHMA 3OKTA 2P9PC 4LG9A 3ULEC 4Y5RD 3OKYA 3K26A 2B4EA 2I0RA 5AFU3 5JWZA 2H9MA 2P9SC 1JJUB 2YNPA 3SXTD 1B9XA 4CI8A 1TYQC 5FKTA 3ODTA 4TZ4A 5TEEA 4O9DA 2I0TA 4GM3A 2Z2NA 3UR4A 4U1EI 3CIKB 5SXMA 2UZYB 2XU7A 2QC5A 5H1MA 2B5NA 4J87A 4JSPC 3ZWLB 4L1QD 1U2VC 5EM2A 4FA1D 3I7LA 2I0SA 1XKSA 3PXSD 5AJAA 2H13A 2AGYA 4CY2A 4GQ2P 3SHFA 2H68A 3PE7A 4JD2C 4IA9A 4E5ZB 3SMRA 5K1CC 1GP2B 4A0BA 3UVMA 4JSNC 5EAMA 3EU7A 3V7DB 3IIWA 3L4MD 4Y7RA 3AFCA 5A2Qg 4GQBB 4O3UB 4J8BA 3MKQA 2J56H 3JRPA 2H9PA 2HJBA 1Q47A 5IJ7E 4J78A 4Z8LA 2AGXA 5HE0B 4BL0A 2IAAA 2OIZA 4J86A 1FWXA 4PBZA 4J77A 4XYHA 2BBKH 1XIPA 5HE2B 5K19A 1PBYB 5EAPA 5EMLB 3EI1B 4HDJA 2H6QA 3JPXA 5AMSA 2B5MA 3MXXA 2PBIB 1NR0A 3JZHA 3NVXA 2CN2A 5FKQA 3V5WB 3SFZA 1GG2B 2UZXB 3HFQA 4A2LA 5FLXg 2J55H 3SVWD 3UVOA 2H6NA 2Q7QA 5IGOA 4O3TB 4BH6A 3J81g 4ZOVA 1U4CA 2Z2PA 3DSMA 4QT8A 3N0DA 3EI3A 1ERJA 2AH1A 2J57G 4X60B 3RFGA 3RSEC 2GNQA 4J79A 3GREA 3MZKA 2G9AA 3KRXB 4X63B 3EI3B 4XEIC 4JXMA 4CI1A 5C9ZB 3RN1D 4KFMB 5IGQA 2P9LC 3JROA 2IUPA 4K3ID 2CN3A 3DWLC 2TRCB 4R7AB 4PXWA 4AOWA 3RRMC 3OTTA 4GMBA 3JB9L 2CNXA 4GQ1A 5I5IA 3PXWD 4MK0B 5EMJB 4A2MA 3JZNA 4L3HD 4ERQA 4FAVD 1A0RB 4GGCA 4ZOXA 5EMMB 1PEVA 4ZOZA 5H17A 3N0EA 4PNKB 2H14A 4I79A 2XL2A 4JSVC 2XYIA 3U4YA 2W18A 2IUQA 2H9LA 3VA6A 2H6KA 3RMZD 1B9YA 3FGBA
chains in the Genus database with same CATH superfamily
3BG1A 1VE7A 1R5MA 2H3XA 3EMHA 3SLED 1SQ9A 3UVNA 2YMUA 5CXBA 2XZGA 4BP8A 2YB8B 3PXTD 3NVQA 4NBMA 2XL3A 2HJ4A 3I7PA 3PVWB 3RN0D 3I8EA 2HKMA 4NSXA 3I8CA 4H5JA 2EIBA 1VE6A 4E54B 3F3GA 4Z7OA 2IURA 4J0XA 3PVUB 5CYKB 4GM8A 3O4HA 4A11B 3I7KA 5GXHA 5HE1B 4E54A 1OLZA 4JT6C 2HKRA 3IULA 3EQ9A 5E6SA 5FKSA 2HESX 5CXCB 3KCIA 4RE5A 3P4FA 2HU5A 1K32A 3NVNA 4YVDA 4A0AB 4BCDA 2CE8A 3W15A 4JT5C 4CY3A 1JOFA 5CXBB 5TF2A 5IT9g 4GM9A 2VDRA 4ERZA 3RFHA 2EBSA 4AX4A 4GZ8A 5FA5B 2HYEA 3DXMC 1S4UX 3UKUC 3IJCA 2WQ8A 5TEFA 4LG8A 5EMKB 1MG2A 2VDPA 4A08B 3I7NA 3IKOA 4J82A 3ZE2A 4OZUA 2JKXA 4LGNA 4PC0A 1T2XA 3EI2B 2OVQB 5CXCA 3IJ1A 3OW8A 3ZDXA 5EALA 4J0WA 5E6RA 3F3FA 2OK4A 3K27A 1E8NA 4O2WA 2IUVA 4FHLA 3SN6B 3AH8B 1MG3A 4QAMA 4EWRA 3IIYA 4H5IA 5FKRA 4N14A 3I2NA 3J80g 2YNOA 3VH0A 2P9NC 2AGWA 2Z2OA 4GGAA 2GC4A 3CFVA 1GXRA 2VDNA 3EI1A 5FFOA 3E0CA 4O1QD 3SWSD 2HU7A 5GXIA 2BCJB 3I7HA 4ZOYA 3BG0A 2H9NA 4A7JA 4J81A 3ORVD 3B7FA 1O6FA 2MTAH 4OWRA 5IJ8E 3SCYA 3SBPA 4X3EA 1PI6A 5H14A 1N6EA 1YFQA 2VZ1A 4WK0A 2CO0C 4CI2A 3IJ0A 4D0KA 2P9UC 4CI3A 3MKSB 4QQEA 1TBGA 3EQ8A 4JHNA 1SHYB 2O9KA 1VZ2A 5C2VB 4NENA 2VC2A 4PBYA 4BP9A 4CZXA 3EI4B 2BKLA 2EIEA 3UKRC 4BCBA 2H47A 4WK2A 4O45A 1JV2A 3FM0A 1JMXB 2YNNA 4PSXB 2GC7A 5C2WB 5C92A 5EM2B 4FWWA 2VDQA 2VDKA 3V9FA 1O6GA 4K3JB 3SBQA 1U8CA 3JAMg 3F3PA 2I3TA 3JZGA 2PM7B 4D6VA 3RLMD 4AMZA 4E5ZA 2AGLA 3UVKA 4IMMA 3SJLD 2IWKA 3PSLA 4FA5D 2HU8A 3KRWB 1UOQA 5KDOB 1VZ3A 4DNVA 3OF7A 1N6DA 2OVPB 4BCCA 2I3SA 2VZ3A 4FAND 5IC7A 5M5SA 2QZPA 5C86A 3UVLA 5HE3B 5TDHB 4CY5A 5FFGA 5GMKn 3L4OD 3OKWA 4G55A 3DM0A 4A0AA 3I89A 1P22A 4UI9R 5EARA 5I5MA 2PM6B 1QNIA 2OVRB 4XYIA 4DNUA 4BUJC 1MDAH 3SBRA 2P9KC 4AN0A 4WK4A 4PSWB 3PSCB 3IVMA 5THAA 4NAAA 5M5UA 4U7AA 5M5TA 3GD1I 3T3MA 5CYKA 4J8GA 2XDWA 1N6FA 1OMWB 3EI4A 3NIGA 2AQ5A 3VGZA 4FA4D 4J73A 4L9OA 4GGDA 4ES0A 3V4PA 3C75H 4CZYA 3AL9A 1C9IA 4A11A 3C99A 5B4WA 3AL8B 2AGZA 3CFSB 1BPOA 1PGUA 2QXVA 4A0BB 3A0FA 4QRJA 3AL8A 3OL2B 5FXYA 2QR5A 5I5JA 2G99A 3O4GA 5GSAA 5HDBA 4QL1A 2PM9B 2CO0A 1A12A 4MMXA 4JSXC 3GFCA 2B5LA 3OL2A 1GOTB 3IUNA 2HXCA 4CZVA 3I7OA 1GOFA 3MMYA 4A08A 2PM9A 4A09A 4G1MA 5HYNB 4CC9A 2P9IC 4ESGA 1SQJA 4L3GD 3IJEA 3OKYB 3EI2A 1L0QA 3C9CA 2OK6A 2AH0A 3EG6A 3EWEA 2IWFA 3FRXA 4ZN4A 4FB1D 3MZLA 4FA9D 4X61B 3C5MA 3IUQA 3MUOA 3DXKC 2OJYA 3MVDK 1VYHC 4CY1A 5HQGA 1UOOA 1I2MB 4J84A 4G56B 1K8KC 5FQDA 4AEZA 2CE9A 2YBAA 4ERYA 3IURA 3VI3A 1RI6A 1NEXB 4DNWA 4A09B 3BWSA 2EICA 1JMZB 1XHMA 3OKTA 4Z7NA 2P9PC 4LG9A 3ULEC 4Y5RD 3OKYA 4G1EA 3K26A 1E8MA 2B4EA 3MUNA 2I0RA 5AFU3 3O4JA 4UM8A 3DDUA 5JWZA 2H9MA 2P9SC 1JJUB 2YNPA 3SXTD 1B9XA 4RE6A 4IRZA 4CI8A 1TYQC 5FKTA 3ODTA 4TZ4A 5TEEA 4O9DA 2I0TA 4NC4A 4GM3A 3T3PA 2Z2NA 3UR4A 2VDLA 4U1EI 3CIKB 5SXMA 1QFSA 2UZYB 2XU7A 2QC5A 5H1MA 2B5NA 4J87A 4JSPC 3ZWLB 4L1QD 1U2VC 5EM2A 4FA1D 3I7LA 2I0SA 1XKSA 3IUMA 3PXSD 4MMZA 5AJAA 2H13A 2AGYA 2XE4A 1JTDB 4CY2A 4GQ2P 3SHFA 2H68A 3PE7A 4JD2C 1TYEA 4IA9A 3SMRA 4E5ZB 5K1CC 1GP2B 4A0BA 3UVMA 4Z7QA 4JSNC 5EAMA 4MMYA 3EU7A 3V7DB 3QI0A 3IIWA 3L4MD 3QHYB 4Y7RA 3AFCA 5A2Qg 4GQBB 4O3UB 1L5GA 4J8BA 3MKQA 2J56H 3JRPA 2H9PA 2HJBA 1Q47A 5IJ7E 4AMYA 4AN1A 4J78A 4JHPC 4Z8LA 2AGXA 5HE0B 4BL0A 2IAAA 5M5VA 1E5TA 4WJKA 2VDMA 2OIZA 4J86A 3ZDYA 1GOGA 1FWXA 1K3IA 4PBZA 4J77A 3EQ7A 4XYHA 2BBKH 1XIPA 5HE2B 5M61A 5K19A 1PBYB 4O02A 5EAPA 5EMLB 3EI1B 4HDJA 2H6QA 3JPXA 1QFMA 5AMSA 1H2ZA 4D9SA 2B5MA 3MXXA 4L1MA 2PBIB 1NR0A 3JZHA 3NVXA 2CN2A 5FKQA 3K6SA 3V5WB 3SFZA 1GG2B 3V4VA 2UZXB 3HFQA 5M5RA 4A2LA 5FLXg 2J55H 3SVWD 1H2XA 3UVOA 2H6NA 2Q7QA 5IGOA 1UOPA 4O3TB 4BH6A 3J81g 4ZOVA 1U4CA 2Z2PA 3DSMA 3IUJA 3VI4A 1GOHA 4QT8A 3N0DA 3EI3A 1ERJA 1C9LA 2AH1A 2J57G 3FCUA 4X60B 3RFGA 3RSEC 2GNQA 4J79A 3O4IA 1M1XA 3GREA 3MZKA 2G9AA 2EIDA 3KRXB 4X63B 3EI3B 4XEIC 3GC3B 4JXMA 4CI1A 5C9ZB 3NIFA 4KFMB 3RN1D 5IGQA 1YR2A 2P9LC 3FCSA 3JROA 2IUPA 4K3ID 1H2WA 2CN3A 3DWLC 2TRCB 4R7AB 4PXWA 4AOWA 3RRMC 3OTTA 4GMBA 3K71A 3JB9L 2CNXA 4GQ1A 3ZE0A 2VDOA 5I5IA 3K72A 3PXWD 4MK0B 3ZE1A 1H2YA 5EMJB 4A2MA 3JZNA 4L3HD 4ERQA 4FAVD 1A0RB 4GGCA 4ZOXA 5EMMB 1PEVA 4ZOZA 5H17A 3N0EA 4PNKB 2H14A 4I79A 4UM9A 3ZDZA 2XL2A 4JSVC 3NIDA 2XYIA 3U4YA 1UTCA 2W18A 2IUQA 2H9LA 3VA6A 2H6KA 3RMZD 1B9YA 5E6UA 3FGBA
chains in the Genus database with same CATH topology
3BG1A 1R5MA 2H3XA 3EMHA 3SLED 1SQ9A 3UVNA 2YMUA 5CXBA 2YB8B 3PXTD 3NVQA 2XL3A 2HJ4A 3I7PA 3PVWB 3RN0D 3I8EA 2HKMA 4NSXA 3I8CA 4H5JA 4E54B 3F3GA 2IURA 4J0XA 3PVUB 5CYKB 4GM8A 4A11B 3I7KA 5GXHA 5HE1B 4E54A 1OLZA 4JT6C 2HKRA 5FKSA 2HESX 5CXCB 3P4FA 1K32A 3NVNA 4YVDA 4A0AB 2CE8A 3W15A 4JT5C 4CY3A 1JOFA 5CXBB 5TF2A 5IT9g 4GM9A 4ERZA 3RFHA 2EBSA 4GZ8A 5FA5B 2HYEA 3DXMC 1S4UX 3UKUC 3IJCA 5TEFA 4LG8A 5EMKB 1MG2A 4A08B 3I7NA 3IKOA 4J82A 4OZUA 4LGNA 4PC0A 3EI2B 2OVQB 5CXCA 3IJ1A 3OW8A 5EALA 4J0WA 3F3FA 2OK4A 3K27A 2IUVA 4FHLA 3SN6B 3AH8B 1MG3A 4EWRA 4H5IA 3IIYA 5FKRA 4N14A 3I2NA 3J80g 2YNOA 3VH0A 2P9NC 2AGWA 2Z2OA 4GGAA 2GC4A 3CFVA 1GXRA 3EI1A 3E0CA 4O1QD 3SWSD 5GXIA 2BCJB 3I7HA 4ZOYA 3BG0A 2H9NA 4A7JA 4J81A 3ORVD 3B7FA 2MTAH 4OWRA 5IJ8E 3SCYA 3SBPA 4X3EA 1PI6A 5H14A 1N6EA 1YFQA 2CO0C 4CI2A 3IJ0A 4D0KA 2P9UC 4CI3A 3MKSB 4QQEA 1TBGA 1SHYB 2O9KA 5C2VB 4PBYA 4CZXA 3EI4B 3UKRC 2H47A 4O45A 5EM2B 4PSXB 1JMXB 2YNNA 3FM0A 2GC7A 5C2WB 4FWWA 3V9FA 4K3JB 3SBQA 3JAMg 3F3PA 2I3TA 3JZGA 2PM7B 4D6VA 3RLMD 4E5ZA 2AGLA 3UVKA 4IMMA 3SJLD 2IWKA 3PSLA 4FA5D 3KRWB 5KDOB 1N6DA 2OVPB 2I3SA 4FAND 5IC7A 3UVLA 5HE3B 5TDHB 4CY5A 5GMKn 3L4OD 3OKWA 3DM0A 4A0AA 3I89A 1P22A 4UI9R 5EARA 5I5MA 2PM6B 1QNIA 2OVRB 4XYIA 4BUJC 1MDAH 3SBRA 2P9KC 4PSWB 3PSCB 5THAA 4U7AA 5CYKA 4J8GA 1N6FA 1OMWB 3EI4A 2AQ5A 3VGZA 4FA4D 4J73A 4L9OA 4GGDA 4ES0A 3C75H 4CZYA 3AL9A 4A11A 3C99A 5B4WA 3AL8B 2AGZA 3CFSB 1PGUA 2QXVA 4A0BB 3A0FA 4QRJA 3AL8A 3OL2B 5FXYA 5I5JA 2G99A 5GSAA 4QL1A 2PM9B 2CO0A 4JSXC 3GFCA 2B5LA 3OL2A 1GOTB 2HXCA 4CZVA 3I7OA 3MMYA 4A08A 2PM9A 4A09A 5HYNB 4CC9A 2P9IC 4ESGA 1SQJA 4L3GD 3EI2A 3OKYB 1L0QA 3C9CA 2OK6A 2AH0A 3EG6A 3EWEA 2IWFA 3FRXA 4ZN4A 4FB1D 3MZLA 4FA9D 4X61B 3C5MA 3DXKC 2OJYA 1VYHC 4CY1A 5HQGA 4J84A 4G56B 1K8KC 5FQDA 4AEZA 2CE9A 2YBAA 4ERYA 1RI6A 1NEXB 4A09B 3BWSA 1JMZB 1XHMA 3OKTA 2P9PC 4LG9A 3ULEC 4Y5RD 3OKYA 3K26A 2B4EA 2I0RA 5AFU3 5JWZA 2H9MA 2P9SC 1JJUB 2YNPA 3SXTD 1B9XA 4CI8A 1TYQC 5FKTA 3ODTA 4TZ4A 5TEEA 4O9DA 2I0TA 4GM3A 2Z2NA 3UR4A 4U1EI 3CIKB 5SXMA 2UZYB 2XU7A 2QC5A 5H1MA 2B5NA 4J87A 4JSPC 3ZWLB 4L1QD 1U2VC 5EM2A 4FA1D 3I7LA 2I0SA 1XKSA 3PXSD 5AJAA 2H13A 2AGYA 4CY2A 4GQ2P 3SHFA 2H68A 3PE7A 4JD2C 4IA9A 4E5ZB 3SMRA 5K1CC 1GP2B 4A0BA 3UVMA 4JSNC 5EAMA 3EU7A 3V7DB 3IIWA 3L4MD 4Y7RA 3AFCA 5A2Qg 4GQBB 4O3UB 4J8BA 3MKQA 2J56H 3JRPA 2H9PA 2HJBA 1Q47A 5IJ7E 4J78A 4Z8LA 2AGXA 5HE0B 4BL0A 2IAAA 2OIZA 4J86A 1FWXA 4PBZA 4J77A 4XYHA 2BBKH 1XIPA 5HE2B 5K19A 1PBYB 5EAPA 5EMLB 3EI1B 4HDJA 2H6QA 3JPXA 5AMSA 2B5MA 3MXXA 2PBIB 1NR0A 3JZHA 3NVXA 2CN2A 5FKQA 3V5WB 3SFZA 1GG2B 2UZXB 3HFQA 4A2LA 5FLXg 2J55H 3SVWD 3UVOA 2H6NA 2Q7QA 5IGOA 4O3TB 4BH6A 3J81g 4ZOVA 1U4CA 2Z2PA 3DSMA 4QT8A 3N0DA 3EI3A 1ERJA 2AH1A 2J57G 4X60B 3RFGA 3RSEC 2GNQA 4J79A 3GREA 3MZKA 2G9AA 3KRXB 4X63B 3EI3B 4XEIC 4JXMA 4CI1A 5C9ZB 3RN1D 4KFMB 5IGQA 2P9LC 3JROA 2IUPA 4K3ID 2CN3A 3DWLC 2TRCB 4R7AB 4PXWA 4AOWA 3RRMC 3OTTA 4GMBA 3JB9L 2CNXA 4GQ1A 5I5IA 3PXWD 4MK0B 5EMJB 4A2MA 3JZNA 4L3HD 4ERQA 4FAVD 1A0RB 4GGCA 4ZOXA 5EMMB 1PEVA 4ZOZA 5H17A 3N0EA 4PNKB 2H14A 4I79A 2XL2A 4JSVC 2XYIA 3U4YA 2W18A 2IUQA 2H9LA 3VA6A 2H6KA 3RMZD 1B9YA 3FGBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BG1 A;  1R5M A;  2H3X A;  3EMH A;  3SLE D;  1SQ9 A;  3UVN A;  2YMU A;  5CXB A;  2YB8 B;  3PXT D;  3NVQ A;  2XL3 A;  2HJ4 A;  3I7P A;  3PVW B;  3RN0 D;  3I8E A;  2HKM A;  4NSX A;  3I8C A;  4H5J A;  4E54 B;  3F3G A;  2IUR A;  4J0X A;  3PVU B;  5CYK B;  4GM8 A;  4A11 B;  3I7K A;  5GXH A;  5HE1 B;  4E54 A;  1OLZ A;  4JT6 C;  2HKR A;  5FKS A;  2HES X;  5CXC B;  3P4F A;  1K32 A;  3NVN A;  4YVD A;  4A0A B;  2CE8 A;  3W15 A;  4JT5 C;  4CY3 A;  1JOF A;  5CXB B;  5TF2 A;  5IT9 g;  4GM9 A;  4ERZ A;  3RFH A;  2EBS A;  4GZ8 A;  5FA5 B;  2HYE A;  3DXM C;  1S4U X;  3UKU C;  3IJC A;  5TEF A;  4LG8 A;  5EMK B;  1MG2 A;  4A08 B;  3I7N A;  3IKO A;  4J82 A;  4OZU A;  4LGN A;  4PC0 A;  3EI2 B;  2OVQ B;  5CXC A;  3IJ1 A;  3OW8 A;  5EAL A;  4J0W A;  3F3F A;  2OK4 A;  3K27 A;  2IUV A;  4FHL A;  3SN6 B;  3AH8 B;  1MG3 A;  4EWR A;  4H5I A;  3IIY A;  5FKR A;  4N14 A;  3I2N A;  3J80 g;  2YNO A;  3VH0 A;  2P9N C;  2AGW A;  2Z2O A;  4GGA A;  2GC4 A;  3CFV A;  1GXR A;  3EI1 A;  3E0C A;  4O1Q D;  3SWS D;  5GXI A;  2BCJ B;  3I7H A;  4ZOY A;  3BG0 A;  2H9N A;  4A7J A;  4J81 A;  3ORV D;  3B7F A;  2MTA H;  4OWR A;  5IJ8 E;  3SCY A;  3SBP A;  4X3E A;  1PI6 A;  5H14 A;  1N6E A;  1YFQ A;  2CO0 C;  4CI2 A;  3IJ0 A;  4D0K A;  2P9U C;  4CI3 A;  3MKS B;  4QQE A;  1TBG A;  1SHY B;  2O9K A;  5C2V B;  4PBY A;  4CZX A;  3EI4 B;  3UKR C;  2H47 A;  4O45 A;  5EM2 B;  4PSX B;  1JMX B;  2YNN A;  3FM0 A;  2GC7 A;  5C2W B;  4FWW A;  3V9F A;  4K3J B;  3SBQ A;  3JAM g;  3F3P A;  2I3T A;  3JZG A;  2PM7 B;  4D6V A;  3RLM D;  4E5Z A;  2AGL A;  3UVK A;  4IMM A;  3SJL D;  2IWK A;  3PSL A;  4FA5 D;  3KRW B;  5KDO B;  1N6D A;  2OVP B;  2I3S A;  4FAN D;  5IC7 A;  3UVL A;  5HE3 B;  5TDH B;  4CY5 A;  5GMK n;  3L4O D;  3OKW A;  3DM0 A;  4A0A A;  3I89 A;  1P22 A;  4UI9 R;  5EAR A;  5I5M A;  2PM6 B;  1QNI A;  2OVR B;  4XYI A;  4BUJ C;  1MDA H;  3SBR A;  2P9K C;  4PSW B;  3PSC B;  5THA A;  4U7A A;  5CYK A;  4J8G A;  1N6F A;  1OMW B;  3EI4 A;  2AQ5 A;  3VGZ A;  4FA4 D;  4J73 A;  4L9O A;  4GGD A;  4ES0 A;  3C75 H;  4CZY A;  3AL9 A;  4A11 A;  3C99 A;  5B4W A;  3AL8 B;  2AGZ A;  3CFS B;  1PGU A;  2QXV A;  4A0B B;  3A0F A;  4QRJ A;  3AL8 A;  3OL2 B;  5FXY A;  5I5J A;  2G99 A;  5GSA A;  4QL1 A;  2PM9 B;  2CO0 A;  4JSX C;  3GFC A;  2B5L A;  3OL2 A;  1GOT B;  2HXC A;  4CZV A;  3I7O A;  3MMY A;  4A08 A;  2PM9 A;  4A09 A;  5HYN B;  4CC9 A;  2P9I C;  4ESG A;  1SQJ A;  4L3G D;  3EI2 A;  3OKY B;  1L0Q A;  3C9C A;  2OK6 A;  2AH0 A;  3EG6 A;  3EWE A;  2IWF A;  3FRX A;  4ZN4 A;  4FB1 D;  3MZL A;  4FA9 D;  4X61 B;  3C5M A;  3DXK C;  2OJY A;  1VYH C;  4CY1 A;  5HQG A;  4J84 A;  4G56 B;  1K8K C;  5FQD A;  4AEZ A;  2CE9 A;  2YBA A;  4ERY A;  1RI6 A;  1NEX B;  4A09 B;  3BWS A;  1JMZ B;  1XHM A;  3OKT A;  2P9P C;  4LG9 A;  3ULE C;  4Y5R D;  3OKY A;  3K26 A;  2B4E A;  2I0R A;  5AFU 3;  5JWZ A;  2H9M A;  2P9S C;  1JJU B;  2YNP A;  3SXT D;  1B9X A;  4CI8 A;  1TYQ C;  5FKT A;  3ODT A;  4TZ4 A;  5TEE A;  4O9D A;  2I0T A;  4GM3 A;  2Z2N A;  3UR4 A;  4U1E I;  3CIK B;  5SXM A;  2UZY B;  2XU7 A;  2QC5 A;  5H1M A;  2B5N A;  4J87 A;  4JSP C;  3ZWL B;  4L1Q D;  1U2V C;  5EM2 A;  4FA1 D;  3I7L A;  2I0S A;  1XKS A;  3PXS D;  5AJA A;  2H13 A;  2AGY A;  4CY2 A;  4GQ2 P;  3SHF A;  2H68 A;  3PE7 A;  4JD2 C;  4IA9 A;  4E5Z B;  3SMR A;  5K1C C;  1GP2 B;  4A0B A;  3UVM A;  4JSN C;  5EAM A;  3EU7 A;  3V7D B;  3IIW A;  3L4M D;  4Y7R A;  3AFC A;  5A2Q g;  4GQB B;  4O3U B;  4J8B A;  3MKQ A;  2J56 H;  3JRP A;  2H9P A;  2HJB A;  1Q47 A;  5IJ7 E;  4J78 A;  4Z8L A;  2AGX A;  5HE0 B;  4BL0 A;  2IAA A;  2OIZ A;  4J86 A;  1FWX A;  4PBZ A;  4J77 A;  4XYH A;  2BBK H;  1XIP A;  5HE2 B;  5K19 A;  1PBY B;  5EAP A;  5EML B;  3EI1 B;  4HDJ A;  2H6Q A;  3JPX A;  5AMS A;  2B5M A;  3MXX A;  2PBI B;  1NR0 A;  3JZH A;  3NVX A;  2CN2 A;  5FKQ A;  3V5W B;  3SFZ A;  1GG2 B;  2UZX B;  3HFQ A;  4A2L A;  5FLX g;  2J55 H;  3SVW D;  3UVO A;  2H6N A;  2Q7Q A;  5IGO A;  4O3T B;  4BH6 A;  3J81 g;  4ZOV A;  1U4C A;  2Z2P A;  3DSM A;  4QT8 A;  3N0D A;  3EI3 A;  1ERJ A;  2AH1 A;  2J57 G;  4X60 B;  3RFG A;  3RSE C;  2GNQ A;  4J79 A;  3GRE A;  3MZK A;  2G9A A;  3KRX B;  4X63 B;  3EI3 B;  4XEI C;  4JXM A;  4CI1 A;  5C9Z B;  3RN1 D;  4KFM B;  5IGQ A;  2P9L C;  3JRO A;  2IUP A;  4K3I D;  2CN3 A;  3DWL C;  2TRC B;  4R7A B;  4PXW A;  4AOW A;  3RRM C;  3OTT A;  4GMB A;  3JB9 L;  2CNX A;  4GQ1 A;  5I5I A;  3PXW D;  4MK0 B;  5EMJ B;  4A2M A;  3JZN A;  4L3H D;  4ERQ A;  4FAV D;  1A0R B;  4GGC A;  4ZOX A;  5EMM B;  1PEV A;  4ZOZ A;  5H17 A;  3N0E A;  4PNK B;  2H14 A;  4I79 A;  2XL2 A;  4JSV C;  2XYI A;  3U4Y A;  2W18 A;  2IUQ A;  2H9L A;  3VA6 A;  2H6K A;  3RMZ D;  1B9Y A;  3FGB A; 
#chains in the Genus database with same CATH topology
 3BG1 A;  1VE7 A;  1R5M A;  2H3X A;  3EMH A;  3SLE D;  1SQ9 A;  3UVN A;  2YMU A;  5CXB A;  2XZG A;  4BP8 A;  2YB8 B;  3PXT D;  3NVQ A;  4NBM A;  2XL3 A;  2HJ4 A;  3I7P A;  3PVW B;  3RN0 D;  3I8E A;  2HKM A;  4NSX A;  3I8C A;  4H5J A;  2EIB A;  1VE6 A;  4E54 B;  3F3G A;  4Z7O A;  2IUR A;  4J0X A;  3PVU B;  5CYK B;  4GM8 A;  3O4H A;  4A11 B;  3I7K A;  5GXH A;  5HE1 B;  4E54 A;  1OLZ A;  4JT6 C;  2HKR A;  3IUL A;  3EQ9 A;  5E6S A;  5FKS A;  2HES X;  5CXC B;  3KCI A;  4RE5 A;  3P4F A;  2HU5 A;  1K32 A;  3NVN A;  4YVD A;  4A0A B;  4BCD A;  2CE8 A;  3W15 A;  4JT5 C;  4CY3 A;  1JOF A;  5CXB B;  5TF2 A;  5IT9 g;  4GM9 A;  2VDR A;  4ERZ A;  3RFH A;  2EBS A;  4AX4 A;  4GZ8 A;  5FA5 B;  2HYE A;  3DXM C;  1S4U X;  3UKU C;  3IJC A;  2WQ8 A;  5TEF A;  4LG8 A;  5EMK B;  1MG2 A;  2VDP A;  4A08 B;  3I7N A;  3IKO A;  4J82 A;  3ZE2 A;  4OZU A;  2JKX A;  4LGN A;  4PC0 A;  1T2X A;  3EI2 B;  2OVQ B;  5CXC A;  3IJ1 A;  3OW8 A;  3ZDX A;  5EAL A;  4J0W A;  5E6R A;  3F3F A;  2OK4 A;  3K27 A;  1E8N A;  4O2W A;  2IUV A;  4FHL A;  3SN6 B;  3AH8 B;  1MG3 A;  4QAM A;  4EWR A;  3IIY A;  4H5I A;  5FKR A;  4N14 A;  3I2N A;  3J80 g;  2YNO A;  3VH0 A;  2P9N C;  2AGW A;  2Z2O A;  4GGA A;  2GC4 A;  3CFV A;  1GXR A;  2VDN A;  3EI1 A;  5FFO A;  3E0C A;  4O1Q D;  3SWS D;  2HU7 A;  5GXI A;  2BCJ B;  3I7H A;  4ZOY A;  3BG0 A;  2H9N A;  4A7J A;  4J81 A;  3ORV D;  3B7F A;  1O6F A;  2MTA H;  4OWR A;  5IJ8 E;  3SCY A;  3SBP A;  4X3E A;  1PI6 A;  5H14 A;  1N6E A;  1YFQ A;  2VZ1 A;  4WK0 A;  2CO0 C;  4CI2 A;  3IJ0 A;  4D0K A;  2P9U C;  4CI3 A;  3MKS B;  4QQE A;  1TBG A;  3EQ8 A;  4JHN A;  1SHY B;  2O9K A;  1VZ2 A;  5C2V B;  4NEN A;  2VC2 A;  4PBY A;  4BP9 A;  4CZX A;  3EI4 B;  2BKL A;  2EIE A;  3UKR C;  4BCB A;  2H47 A;  4WK2 A;  4O45 A;  1JV2 A;  3FM0 A;  1JMX B;  2YNN A;  4PSX B;  2GC7 A;  5C2W B;  5C92 A;  5EM2 B;  4FWW A;  2VDQ A;  2VDK A;  3V9F A;  1O6G A;  4K3J B;  3SBQ A;  1U8C A;  3JAM g;  3F3P A;  2I3T A;  3JZG A;  2PM7 B;  4D6V A;  3RLM D;  4AMZ A;  4E5Z A;  2AGL A;  3UVK A;  4IMM A;  3SJL D;  2IWK A;  3PSL A;  4FA5 D;  2HU8 A;  3KRW B;  1UOQ A;  5KDO B;  1VZ3 A;  4DNV A;  3OF7 A;  1N6D A;  2OVP B;  4BCC A;  2I3S A;  2VZ3 A;  4FAN D;  5IC7 A;  5M5S A;  2QZP A;  5C86 A;  3UVL A;  5HE3 B;  5TDH B;  4CY5 A;  5FFG A;  5GMK n;  3L4O D;  3OKW A;  4G55 A;  3DM0 A;  4A0A A;  3I89 A;  1P22 A;  4UI9 R;  5EAR A;  5I5M A;  2PM6 B;  1QNI A;  2OVR B;  4XYI A;  4DNU A;  4BUJ C;  1MDA H;  3SBR A;  2P9K C;  4AN0 A;  4WK4 A;  4PSW B;  3PSC B;  3IVM A;  5THA A;  4NAA A;  5M5U A;  4U7A A;  5M5T A;  3GD1 I;  3T3M A;  5CYK A;  4J8G A;  2XDW A;  1N6F A;  1OMW B;  3EI4 A;  3NIG A;  2AQ5 A;  3VGZ A;  4FA4 D;  4J73 A;  4L9O A;  4GGD A;  4ES0 A;  3V4P A;  3C75 H;  4CZY A;  3AL9 A;  1C9I A;  4A11 A;  3C99 A;  5B4W A;  3AL8 B;  2AGZ A;  3CFS B;  1BPO A;  1PGU A;  2QXV A;  4A0B B;  3A0F A;  4QRJ A;  3AL8 A;  3OL2 B;  5FXY A;  2QR5 A;  5I5J A;  2G99 A;  3O4G A;  5GSA A;  5HDB A;  4QL1 A;  2PM9 B;  2CO0 A;  1A12 A;  4MMX A;  4JSX C;  3GFC A;  2B5L A;  3OL2 A;  1GOT B;  3IUN A;  2HXC A;  4CZV A;  3I7O A;  1GOF A;  3MMY A;  4A08 A;  2PM9 A;  4A09 A;  4G1M A;  5HYN B;  4CC9 A;  2P9I C;  4ESG A;  1SQJ A;  4L3G D;  3IJE A;  3OKY B;  3EI2 A;  1L0Q A;  3C9C A;  2OK6 A;  2AH0 A;  3EG6 A;  3EWE A;  2IWF A;  3FRX A;  4ZN4 A;  4FB1 D;  3MZL A;  4FA9 D;  4X61 B;  3C5M A;  3IUQ A;  3MUO A;  3DXK C;  2OJY A;  3MVD K;  1VYH C;  4CY1 A;  5HQG A;  1UOO A;  1I2M B;  4J84 A;  4G56 B;  1K8K C;  5FQD A;  4AEZ A;  2CE9 A;  2YBA A;  4ERY A;  3IUR A;  3VI3 A;  1RI6 A;  1NEX B;  4DNW A;  4A09 B;  3BWS A;  2EIC A;  1JMZ B;  1XHM A;  3OKT A;  4Z7N A;  2P9P C;  4LG9 A;  3ULE C;  4Y5R D;  3OKY A;  4G1E A;  3K26 A;  1E8M A;  2B4E A;  3MUN A;  2I0R A;  5AFU 3;  3O4J A;  4UM8 A;  3DDU A;  5JWZ A;  2H9M A;  2P9S C;  1JJU B;  2YNP A;  3SXT D;  1B9X A;  4RE6 A;  4IRZ A;  4CI8 A;  1TYQ C;  5FKT A;  3ODT A;  4TZ4 A;  5TEE A;  4O9D A;  2I0T A;  4NC4 A;  4GM3 A;  3T3P A;  2Z2N A;  3UR4 A;  2VDL A;  4U1E I;  3CIK B;  5SXM A;  1QFS A;  2UZY B;  2XU7 A;  2QC5 A;  5H1M A;  2B5N A;  4J87 A;  4JSP C;  3ZWL B;  4L1Q D;  1U2V C;  5EM2 A;  4FA1 D;  3I7L A;  2I0S A;  1XKS A;  3IUM A;  3PXS D;  4MMZ A;  5AJA A;  2H13 A;  2AGY A;  2XE4 A;  1JTD B;  4CY2 A;  4GQ2 P;  3SHF A;  2H68 A;  3PE7 A;  4JD2 C;  1TYE A;  4IA9 A;  3SMR A;  4E5Z B;  5K1C C;  1GP2 B;  4A0B A;  3UVM A;  4Z7Q A;  4JSN C;  5EAM A;  4MMY A;  3EU7 A;  3V7D B;  3QI0 A;  3IIW A;  3L4M D;  3QHY B;  4Y7R A;  3AFC A;  5A2Q g;  4GQB B;  4O3U B;  1L5G A;  4J8B A;  3MKQ A;  2J56 H;  3JRP A;  2H9P A;  2HJB A;  1Q47 A;  5IJ7 E;  4AMY A;  4AN1 A;  4J78 A;  4JHP C;  4Z8L A;  2AGX A;  5HE0 B;  4BL0 A;  2IAA A;  5M5V A;  1E5T A;  4WJK A;  2VDM A;  2OIZ A;  4J86 A;  3ZDY A;  1GOG A;  1FWX A;  1K3I A;  4PBZ A;  4J77 A;  3EQ7 A;  4XYH A;  2BBK H;  1XIP A;  5HE2 B;  5M61 A;  5K19 A;  1PBY B;  4O02 A;  5EAP A;  5EML B;  3EI1 B;  4HDJ A;  2H6Q A;  3JPX A;  1QFM A;  5AMS A;  1H2Z A;  4D9S A;  2B5M A;  3MXX A;  4L1M A;  2PBI B;  1NR0 A;  3JZH A;  3NVX A;  2CN2 A;  5FKQ A;  3K6S A;  3V5W B;  3SFZ A;  1GG2 B;  3V4V A;  2UZX B;  3HFQ A;  5M5R A;  4A2L A;  5FLX g;  2J55 H;  3SVW D;  1H2X A;  3UVO A;  2H6N A;  2Q7Q A;  5IGO A;  1UOP A;  4O3T B;  4BH6 A;  3J81 g;  4ZOV A;  1U4C A;  2Z2P A;  3DSM A;  3IUJ A;  3VI4 A;  1GOH A;  4QT8 A;  3N0D A;  3EI3 A;  1ERJ A;  1C9L A;  2AH1 A;  2J57 G;  3FCU A;  4X60 B;  3RFG A;  3RSE C;  2GNQ A;  4J79 A;  3O4I A;  1M1X A;  3GRE A;  3MZK A;  2G9A A;  2EID A;  3KRX B;  4X63 B;  3EI3 B;  4XEI C;  3GC3 B;  4JXM A;  4CI1 A;  5C9Z B;  3NIF A;  4KFM B;  3RN1 D;  5IGQ A;  1YR2 A;  2P9L C;  3FCS A;  3JRO A;  2IUP A;  4K3I D;  1H2W A;  2CN3 A;  3DWL C;  2TRC B;  4R7A B;  4PXW A;  4AOW A;  3RRM C;  3OTT A;  4GMB A;  3K71 A;  3JB9 L;  2CNX A;  4GQ1 A;  3ZE0 A;  2VDO A;  5I5I A;  3K72 A;  3PXW D;  4MK0 B;  3ZE1 A;  1H2Y A;  5EMJ B;  4A2M A;  3JZN A;  4L3H D;  4ERQ A;  4FAV D;  1A0R B;  4GGC A;  4ZOX A;  5EMM B;  1PEV A;  4ZOZ A;  5H17 A;  3N0E A;  4PNK B;  2H14 A;  4I79 A;  4UM9 A;  3ZDZ A;  2XL2 A;  4JSV C;  3NID A;  2XYI A;  3U4Y A;  1UTC A;  2W18 A;  2IUQ A;  2H9L A;  3VA6 A;  2H6K A;  3RMZ D;  1B9Y A;  5E6U A;  3FGB A; 
#chains in the Genus database with same CATH homology
 3BG1 A;  1R5M A;  2H3X A;  3EMH A;  3SLE D;  1SQ9 A;  3UVN A;  2YMU A;  5CXB A;  2YB8 B;  3PXT D;  3NVQ A;  2XL3 A;  2HJ4 A;  3I7P A;  3PVW B;  3RN0 D;  3I8E A;  2HKM A;  4NSX A;  3I8C A;  4H5J A;  4E54 B;  3F3G A;  2IUR A;  4J0X A;  3PVU B;  5CYK B;  4GM8 A;  4A11 B;  3I7K A;  5GXH A;  5HE1 B;  4E54 A;  1OLZ A;  4JT6 C;  2HKR A;  5FKS A;  2HES X;  5CXC B;  3P4F A;  1K32 A;  3NVN A;  4YVD A;  4A0A B;  2CE8 A;  3W15 A;  4JT5 C;  4CY3 A;  1JOF A;  5CXB B;  5TF2 A;  5IT9 g;  4GM9 A;  4ERZ A;  3RFH A;  2EBS A;  4GZ8 A;  5FA5 B;  2HYE A;  3DXM C;  1S4U X;  3UKU C;  3IJC A;  5TEF A;  4LG8 A;  5EMK B;  1MG2 A;  4A08 B;  3I7N A;  3IKO A;  4J82 A;  4OZU A;  4LGN A;  4PC0 A;  3EI2 B;  2OVQ B;  5CXC A;  3IJ1 A;  3OW8 A;  5EAL A;  4J0W A;  3F3F A;  2OK4 A;  3K27 A;  2IUV A;  4FHL A;  3SN6 B;  3AH8 B;  1MG3 A;  4EWR A;  4H5I A;  3IIY A;  5FKR A;  4N14 A;  3I2N A;  3J80 g;  2YNO A;  3VH0 A;  2P9N C;  2AGW A;  2Z2O A;  4GGA A;  2GC4 A;  3CFV A;  1GXR A;  3EI1 A;  3E0C A;  4O1Q D;  3SWS D;  5GXI A;  2BCJ B;  3I7H A;  4ZOY A;  3BG0 A;  2H9N A;  4A7J A;  4J81 A;  3ORV D;  3B7F A;  2MTA H;  4OWR A;  5IJ8 E;  3SCY A;  3SBP A;  4X3E A;  1PI6 A;  5H14 A;  1N6E A;  1YFQ A;  2CO0 C;  4CI2 A;  3IJ0 A;  4D0K A;  2P9U C;  4CI3 A;  3MKS B;  4QQE A;  1TBG A;  1SHY B;  2O9K A;  5C2V B;  4PBY A;  4CZX A;  3EI4 B;  3UKR C;  2H47 A;  4O45 A;  5EM2 B;  4PSX B;  1JMX B;  2YNN A;  3FM0 A;  2GC7 A;  5C2W B;  4FWW A;  3V9F A;  4K3J B;  3SBQ A;  3JAM g;  3F3P A;  2I3T A;  3JZG A;  2PM7 B;  4D6V A;  3RLM D;  4E5Z A;  2AGL A;  3UVK A;  4IMM A;  3SJL D;  2IWK A;  3PSL A;  4FA5 D;  3KRW B;  5KDO B;  1N6D A;  2OVP B;  2I3S A;  4FAN D;  5IC7 A;  3UVL A;  5HE3 B;  5TDH B;  4CY5 A;  5GMK n;  3L4O D;  3OKW A;  3DM0 A;  4A0A A;  3I89 A;  1P22 A;  4UI9 R;  5EAR A;  5I5M A;  2PM6 B;  1QNI A;  2OVR B;  4XYI A;  4BUJ C;  1MDA H;  3SBR A;  2P9K C;  4PSW B;  3PSC B;  5THA A;  4U7A A;  5CYK A;  4J8G A;  1N6F A;  1OMW B;  3EI4 A;  2AQ5 A;  3VGZ A;  4FA4 D;  4J73 A;  4L9O A;  4GGD A;  4ES0 A;  3C75 H;  4CZY A;  3AL9 A;  4A11 A;  3C99 A;  5B4W A;  3AL8 B;  2AGZ A;  3CFS B;  1PGU A;  2QXV A;  4A0B B;  3A0F A;  4QRJ A;  3AL8 A;  3OL2 B;  5FXY A;  5I5J A;  2G99 A;  5GSA A;  4QL1 A;  2PM9 B;  2CO0 A;  4JSX C;  3GFC A;  2B5L A;  3OL2 A;  1GOT B;  2HXC A;  4CZV A;  3I7O A;  3MMY A;  4A08 A;  2PM9 A;  4A09 A;  5HYN B;  4CC9 A;  2P9I C;  4ESG A;  1SQJ A;  4L3G D;  3EI2 A;  3OKY B;  1L0Q A;  3C9C A;  2OK6 A;  2AH0 A;  3EG6 A;  3EWE A;  2IWF A;  3FRX A;  4ZN4 A;  4FB1 D;  3MZL A;  4FA9 D;  4X61 B;  3C5M A;  3DXK C;  2OJY A;  1VYH C;  4CY1 A;  5HQG A;  4J84 A;  4G56 B;  1K8K C;  5FQD A;  4AEZ A;  2CE9 A;  2YBA A;  4ERY A;  1RI6 A;  1NEX B;  4A09 B;  3BWS A;  1JMZ B;  1XHM A;  3OKT A;  2P9P C;  4LG9 A;  3ULE C;  4Y5R D;  3OKY A;  3K26 A;  2B4E A;  2I0R A;  5AFU 3;  5JWZ A;  2H9M A;  2P9S C;  1JJU B;  2YNP A;  3SXT D;  1B9X A;  4CI8 A;  1TYQ C;  5FKT A;  3ODT A;  4TZ4 A;  5TEE A;  4O9D A;  2I0T A;  4GM3 A;  2Z2N A;  3UR4 A;  4U1E I;  3CIK B;  5SXM A;  2UZY B;  2XU7 A;  2QC5 A;  5H1M A;  2B5N A;  4J87 A;  4JSP C;  3ZWL B;  4L1Q D;  1U2V C;  5EM2 A;  4FA1 D;  3I7L A;  2I0S A;  1XKS A;  3PXS D;  5AJA A;  2H13 A;  2AGY A;  4CY2 A;  4GQ2 P;  3SHF A;  2H68 A;  3PE7 A;  4JD2 C;  4IA9 A;  4E5Z B;  3SMR A;  5K1C C;  1GP2 B;  4A0B A;  3UVM A;  4JSN C;  5EAM A;  3EU7 A;  3V7D B;  3IIW A;  3L4M D;  4Y7R A;  3AFC A;  5A2Q g;  4GQB B;  4O3U B;  4J8B A;  3MKQ A;  2J56 H;  3JRP A;  2H9P A;  2HJB A;  1Q47 A;  5IJ7 E;  4J78 A;  4Z8L A;  2AGX A;  5HE0 B;  4BL0 A;  2IAA A;  2OIZ A;  4J86 A;  1FWX A;  4PBZ A;  4J77 A;  4XYH A;  2BBK H;  1XIP A;  5HE2 B;  5K19 A;  1PBY B;  5EAP A;  5EML B;  3EI1 B;  4HDJ A;  2H6Q A;  3JPX A;  5AMS A;  2B5M A;  3MXX A;  2PBI B;  1NR0 A;  3JZH A;  3NVX A;  2CN2 A;  5FKQ A;  3V5W B;  3SFZ A;  1GG2 B;  2UZX B;  3HFQ A;  4A2L A;  5FLX g;  2J55 H;  3SVW D;  3UVO A;  2H6N A;  2Q7Q A;  5IGO A;  4O3T B;  4BH6 A;  3J81 g;  4ZOV A;  1U4C A;  2Z2P A;  3DSM A;  4QT8 A;  3N0D A;  3EI3 A;  1ERJ A;  2AH1 A;  2J57 G;  4X60 B;  3RFG A;  3RSE C;  2GNQ A;  4J79 A;  3GRE A;  3MZK A;  2G9A A;  3KRX B;  4X63 B;  3EI3 B;  4XEI C;  4JXM A;  4CI1 A;  5C9Z B;  3RN1 D;  4KFM B;  5IGQ A;  2P9L C;  3JRO A;  2IUP A;  4K3I D;  2CN3 A;  3DWL C;  2TRC B;  4R7A B;  4PXW A;  4AOW A;  3RRM C;  3OTT A;  4GMB A;  3JB9 L;  2CNX A;  4GQ1 A;  5I5I A;  3PXW D;  4MK0 B;  5EMJ B;  4A2M A;  3JZN A;  4L3H D;  4ERQ A;  4FAV D;  1A0R B;  4GGC A;  4ZOX A;  5EMM B;  1PEV A;  4ZOZ A;  5H17 A;  3N0E A;  4PNK B;  2H14 A;  4I79 A;  2XL2 A;  4JSV C;  2XYI A;  3U4Y A;  2W18 A;  2IUQ A;  2H9L A;  3VA6 A;  2H6K A;  3RMZ D;  1B9Y A;  3FGB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...