5C2WB

Kuenenia stuttgartiensis hydrazine synthase pressurized with 20 bar xenon
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
352
structure length
352
Chain Sequence
GYIQGTHVKTDLPGPFHITMSPDGSTLFISNQSGHSVTFVDARTQKVTGEVAVRVQPEASAVTPDGAFLYVCNAESDSVSVVDIQRKQEIKEIKVGDWPSGIKISPDGKTAYVACSGCMWNAIDVIDTGRMEKVRSIYTSDYGPRMVEISPDGKTLVAILDTVGSINRSVDFIDIASGRVVENRVIHESSNLRDVVYTPDGKYIAVTHQTPKNWLPVCEAENGQVFTNNVTIIETKAGGKVARLPLDDLNNYDGNPYGMAMDPKGKYLYIGVRGMHRVTILDMDKVLGLVRSSTQEELDYLRDDLGLVRDYLVARVPTGLGPSSVCLSPDGKFCYAANYFSNNVTVIRTAVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords HYDRAZINE SYNTHASE ALPHA SUBUNIT
publication title The inner workings of the hydrazine synthase multiprotein complex.
pubmed doi rcsb
total genus 84
structure length 352
sequence length 352
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02239 Cytochrom_D1 Cytochrome D1 heme domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5c2wB00
3PXSD 3EI2A 1JMXB 4J82A 5C2VB 5IJ8E 3JAMg 2AGZA 4N14A 4A2MA 4X61B 4GZ8A 2H6KA 3I7PA 2P9KC 3SBPA 4J78A 3I8CA 3IJ0A 4J81A 3SBRA 4I79A 5FKRA 2H6QA 3N0EA 4PXWA 3OKYB 5EAMA 4Z8LA 4D0KA 2H9NA 2YNPA 1A0RB 4O9DA 5IGQA 1PI6A 3RLMD 4A08B 4QRJA 4X60B 3CFVA 3NVQA 5IJ7E 4TZ4A 3SJLD 4A09B 2OJYA 5GXIA 3FM0A 4J87A 2H14A 3RMZD 2AGXA 2QC5A 5C9ZB 3A0FA 5CXBB 2QXVA 4X3EA 4O3UB 2BCJB 2MTAH 2I0TA 2J57G 4QT8A 2H9LA 1PBYB 5CYKB 3L4MD 4EWRA 1N6DA 4AOWA 3GREA 2OVPB 3EG6A 4X63B 3EU7A 4CI2A 3EI1A 3UR4A 5I5MA 2O9KA 4JXMA 4LG9A 4FA4D 3EI4A 2PBIB 4JT6C 3E0CA 3UVNA 4BUJC 2XL3A 3DM0A 4U1EI 3VA6A 5EAPA 5K19A 4A0AB 3UVKA 3P4FA 4JSNC 2PM6B 3EI3A 4CI8A 2OIZA 3F3GA 4GMBA 3V7DB 4E5ZA 2HESX 4BH6A 4R7AB 5HE1B 3JRPA 2CE8A 4JT5C 3I7OA 1MDAH 4XYIA 1XKSA 5EMLB 5B4WA 4CY2A 2YMUA 5H14A 2CO0C 1XHMA 4A0BB 1JMZB 5HE2B 2AGWA 2IURA 1GG2B 3MKSB 3EWEA 1RI6A 4QL1A 4CY5A 3V5WB 5HYNB 3SFZA 3HFQA 3OKYA 1JOFA 3J80g 3SMRA 3C99A 3DXKC 4OZUA 4PBZA 4A08A 4J0XA 2H6NA 2P9SC 3UKUC 2G99A 3MMYA 4A09A 5SXMA 4UI9R 4ESGA 3AFCA 5JWZA 2YB8B 2UZXB 2IUPA 4E54B 5EARA 4XYHA 3AL8B 4O45A 3OL2A 1XIPA 2Z2OA 4L3GD 4FAND 3IKOA 5GXHA 4JSVC 5HQGA 5CYKA 3JZGA 5FKTA 2I0SA 2AGLA 2PM9A 5K1CC 3IJCA 2H47A 5EMKB 1U4CA 5AMSA 1Q47A 2J55H 4CY3A 4O1QD 5EMMB 4BL0A 1R5MA 2B5NA 2UZYB 2YNOA 3NVNA 3ORVD 4ZOXA 1S4UX 5IC7A 2I3SA 4HDJA 4GM9A 3J81g 4CY1A 4A7JA 3KRXB 2P9PC 4A0AA 2IAAA 2BBKH 1SQ9A 3FRXA 1OMWB 2P9UC 4K3JB 3RRMC 2HJBA 2OK4A 2IWKA 2XL2A 3MXXA 3SHFA 2P9IC 5FXYA 4CZYA 4U7AA 2YBAA 4J77A 4ZOYA 2CO0A 1YFQA 5EALA 3C75H 3L4OD 2Z2PA 3CIKB 1PEVA 2GC7A 3DWLC 3BG0A 3OW8A 3UVMA 1TBGA 5TEEA 5A2Qg 3I7NA 4FA9D 5C2WB 5HE0B 4ZN4A 5I5IA 2AH1A 2B5MA 1GXRA 4GGCA 3C9CA 4Y7RA 4GQ2P 3SXTD 4ERYA 2IWFA 4XEIC 4D6VA 4ES0A 1MG2A 3SN6B 3SLED 4PC0A 4J73A 3MZLA 3UKRC 3F3PA 4A2LA 2HXCA 4E54A 5FKQA 3AL8A 1N6FA 3PE7A 1VYHC 2CE9A 1N6EA 3ZWLB 4QQEA 1JJUB 4JSXC 2CN3A 4GM8A 3RN0D 3EI1B 4ERQA 4J86A 3NVXA 5EMJB 4GGAA 1FWXA 3AH8B 3SCYA 4OWRA 2CNXA 1GOTB 2Q7QA 3SVWD 4K3ID 4J8GA 5FKSA 3VGZA 4FA1D 1MG3A 3PXTD 3I7KA 4FA5D 3MKQA 3GFCA 4LGNA 3RN1D 1SQJA 3IIWA 5I5JA 1NEXB 1P22A 3ODTA 3EI3B 5IGOA 2GC4A 4JSPC 5CXBA 2OVRB 4H5JA 4PBYA 3U4YA 3EMHA 3I7HA 3JPXA 5CXCB 2H68A 2EBSA 2OK6A 2H9MA 3I7LA 3FGBA 5EM2B 4IMMA 3UVOA 3IJ1A 2P9LC 4GQBB 4L1QD 3PSLA 3W15A 2IUVA 4CI1A 4J0WA 1L0QA 3VH0A 4A11B 3SBQA 5TDHB 3JZHA 3I89A 3F3FA 4PSWB 2W18A 5FLXg 2J56H 2CN2A 2H9PA 3K27A 4NSXA 2B5LA 3PSCB 5H17A 1K32A 4FB1D 2AGYA 4CC9A 3EI2B 3RFHA 3IIYA 2HJ4A 5AJAA 3KRWB 3DXMC 2XU7A 3OL2B 4CZXA 1SHYB 4IA9A 3UVLA 1QNIA 1ERJA 3OTTA 4A0BA 3OKTA 3CFSB 4H5IA 5HE3B 3I8EA 2GNQA 2PM9B 3BWSA 5AFU3 3N0DA 1U2VC 2G9AA 4ZOZA 2YNNA 3PVWB 3JB9L 1PGUA 3SWSD 4CZVA 1OLZA 4G56B 4LG8A 2Z2NA 4L3HD 2XYIA 4PSXB 5THAA 4YVDA 4KFMB 2PM7B 4MK0B 3MZKA 4GQ1A 1GP2B 3PVUB 2H13A 4FWWA 4GGDA 3ULEC 2P9NC 4O3TB 5CXCA 4FAVD 3I2NA 5FQDA 2I0RA 4FHLA 5IT9g 4ERZA 4JD2C 2H3XA 4ZOVA 5EM2A 5GSAA 4L9OA 3C5MA 2I3TA 3JROA 1NR0A 4GM3A 3EI4B 3BG1A 3RSEC 2AH0A 3RFGA 5TF2A 2TRCB 3V9FA 2B4EA 4AEZA 4A11A 4Y5RD 3B7FA 3PXWD 2HYEA 4CI3A 5KDOB 1TYQC 4J79A 3OKWA 4J8BA 2IUQA 5GMKn 3AL9A 2AQ5A 5TEFA 2OVQB 4E5ZB 2HKMA 2HKRA 3JZNA 4PNKB 3K26A 3DSMA 1B9XA 5FA5B 1K8KC 1B9YA 5H1MA 4J84A
chains in the Genus database with same CATH superfamily
3PXSD 3EI2A 1JMXB 2HU7A 4J82A 4RE6A 5C2VB 5IJ8E 3JAMg 2AGZA 2VDPA 4N14A 2VDLA 4A2MA 4X61B 4GZ8A 4G55A 2H6KA 3I7PA 2P9KC 2EICA 3ZE0A 3K72A 3SBPA 4JHPC 4J78A 4Z7NA 3NIDA 3I8CA 5M5VA 4BP9A 3IJ0A 4J81A 3SBRA 2BKLA 4I79A 5FKRA 2WQ8A 1I2MB 4IRZA 2H6QA 3N0EA 3VI4A 4PXWA 3OKYB 5EAMA 4AMZA 4Z8LA 4D0KA 2H9NA 2YNPA 1A0RB 4O9DA 3EQ9A 5IGQA 1PI6A 3RLMD 4A08B 4QRJA 1JV2A 3CFVA 4X60B 3NVQA 5IJ7E 4AN0A 4TZ4A 3SJLD 4O02A 4A09B 2OJYA 5GXIA 3FM0A 4J87A 2H14A 3RMZD 4UM8A 3V4VA 2AGXA 2QC5A 3QHYB 5C9ZB 3A0FA 5CXBB 2QXVA 3QI0A 4X3EA 4O3UB 2BCJB 1BPOA 3MUOA 2MTAH 2HU8A 2I0TA 2J57G 4QT8A 2H9LA 1PBYB 3NIGA 3OF7A 3L4MD 5CYKB 4EWRA 1N6DA 4AOWA 3GREA 2OVPB 3EG6A 4X63B 1E8NA 1UOPA 3EU7A 4CI2A 5M61A 4G1EA 3EI1A 3UR4A 5I5MA 4NENA 2O9KA 4JXMA 4LG9A 4FA4D 3EI4A 2PBIB 5C86A 4RE5A 4JT6C 3ZDZA 3GC3B 4BCBA 3E0CA 3UVNA 4BUJC 2XL3A 3DM0A 4U1EI 3VA6A 5EAPA 2XE4A 4NBMA 5K19A 4A0AB 4MMXA 3UVKA 3P4FA 2VZ3A 4JSNC 2PM6B 3EI3A 4CI8A 2OIZA 3F3GA 4GMBA 4WK2A 3V7DB 4E5ZA 2HESX 4BH6A 4R7AB 5HE1B 3JRPA 2CE8A 4JT5C 3I7OA 1MDAH 4XYIA 1XKSA 5EMLB 5B4WA 4CY2A 4NAAA 2YMUA 1QFMA 3K6SA 3K71A 4UM9A 1H2YA 1GOGA 5H14A 3NIFA 2QR5A 2CO0C 1XHMA 4A0BB 2HU5A 3O4HA 1JMZB 5HE2B 2AGWA 2IURA 1GG2B 3MKSB 3EWEA 1RI6A 4QL1A 4CY5A 3V5WB 5HYNB 3EQ8A 3SFZA 3HFQA 3OKYA 4QAMA 1JOFA 2VC2A 3J80g 3SMRA 3C99A 3DXKC 4OZUA 3IUNA 4PBZA 4AN1A 1VZ3A 4A08A 2XDWA 1K3IA 4J0XA 2H6NA 2P9SC 3UKUC 2G99A 3MMYA 4A09A 5SXMA 4UI9R 4DNWA 3AFCA 4ESGA 2EIEA 5JWZA 2YB8B 2UZXB 2IUPA 4E54B 5EARA 1TYEA 4XYHA 1QFSA 3AL8B 5FFGA 4O45A 4MMZA 1M1XA 3OL2A 1XIPA 2VDNA 1C9IA 2Z2OA 4L3GD 4FAND 3IKOA 5GXHA 4JSVC 5HQGA 5CYKA 3JZGA 2EIBA 2I0SA 2AGLA 2PM9A 5FKTA 5K1CC 2VZ1A 2H47A 3IJCA 5EMKB 3FCUA 1U4CA 5AMSA 1Q47A 2J55H 4CY3A 4O1QD 5E6RA 5EMMB 4BL0A 1R5MA 2B5NA 2UZYB 2YNOA 3NVNA 3ORVD 4ZOXA 3IVMA 3V4PA 1S4UX 5IC7A 3O4JA 2I3SA 4HDJA 4GM9A 2EIDA 3J81g 4CY1A 4O2WA 4A7JA 3KRXB 2P9PC 4A0AA 1H2XA 2IAAA 2BBKH 1SQ9A 3FRXA 1OMWB 2P9UC 4K3JB 3RRMC 3O4IA 2HJBA 2OK4A 2IWKA 2XL2A 3MXXA 3SHFA 2P9IC 5FXYA 4CZYA 4U7AA 2YBAA 4J77A 4ZOYA 2CO0A 1YFQA 5EALA 3C75H 3L4OD 2Z2PA 3CIKB 1PEVA 2GC7A 3DWLC 3BG0A 2QZPA 2VDKA 3OW8A 1O6FA 3UVMA 1TBGA 3T3PA 3IJEA 5TEEA 5A2Qg 3IUQA 3GD1I 3I7NA 4FA9D 5C2WB 5HE0B 4ZN4A 5I5IA 4AMYA 1H2ZA 2AH1A 2B5MA 1GXRA 4GGCA 5M5TA 3C9CA 3IUJA 4Y7RA 4GQ2P 3SXTD 4AX4A 4ERYA 1VE6A 1UOOA 2IWFA 4XEIC 4D6VA 4ES0A 1MG2A 5M5RA 3SN6B 3SLED 4BCCA 4PC0A 4J73A 3MZLA 3UKRC 3F3PA 1GOFA 1O6GA 4A2LA 2VDQA 2HXCA 4E54A 5FKQA 3AL8A 1N6FA 3PE7A 1VYHC 2CE9A 1N6EA 3ZWLB 3ZDXA 4QQEA 1JJUB 4JSXC 5E6UA 2CN3A 4GM8A 3RN0D 3EI1B 4ERQA 4J86A 3NVXA 1VE7A 5EMJB 4GGAA 1FWXA 3AH8B 3O4GA 3SCYA 4OWRA 2CNXA 1GOTB 2Q7QA 3SVWD 4K3ID 4J8GA 1E5TA 5FKSA 3VGZA 4FA1D 1UOQA 1MG3A 2VDMA 3I7KA 2JKXA 3PXTD 4FA5D 3MKQA 3GFCA 4LGNA 1T2XA 1SQJA 3RN1D 3IIWA 3IULA 5I5JA 1NEXB 1P22A 3FCSA 3ODTA 3MUNA 1E8MA 3EI3B 5IGOA 2GC4A 4JSPC 5CXBA 2OVRB 4H5JA 4PBYA 3U4YA 3EMHA 3I7HA 3JPXA 5CXCB 4L1MA 2H68A 2EBSA 2OK6A 5E6SA 3ZE1A 2H9MA 3I7LA 3FGBA 5EM2B 4IMMA 3UVOA 3IJ1A 2P9LC 4GQBB 4L1QD 3PSLA 3W15A 2IUVA 1UTCA 4CI1A 4J0WA 1L0QA 3VH0A 4A11B 5M5UA 3SBQA 5TDHB 4MMYA 3JZHA 3I89A 3F3FA 4PSWB 5M5SA 2W18A 4WK4A 5FLXg 2J56H 2CN2A 2H9PA 3K27A 4WJKA 4NSXA 2B5LA 3PSCB 5H17A 1K32A 4FB1D 2AGYA 1VZ2A 5HDBA 4CC9A 3EI2B 3RFHA 5FFOA 3IIYA 1A12A 4G1MA 3ZDYA 1JTDB 3DDUA 2HJ4A 5AJAA 3KRWB 4WK0A 3T3MA 3DXMC 2XU7A 3OL2B 4CZXA 1SHYB 1H2WA 3KCIA 4IA9A 4DNUA 3UVLA 1QNIA 1ERJA 1GOHA 2VDRA 3OTTA 4A0BA 3OKTA 3CFSB 4H5IA 5HE3B 3I8EA 2GNQA 2PM9B 3BWSA 2VDOA 5AFU3 3N0DA 1U2VC 4BP8A 2G9AA 4ZOZA 2YNNA 3PVWB 5C92A 3JB9L 1PGUA 3SWSD 4CZVA 1OLZA 4G56B 4LG8A 2Z2NA 4L3HD 2XYIA 4PSXB 5THAA 3VI3A 3IURA 1C9LA 4YVDA 1YR2A 3EQ7A 4JHNA 4KFMB 2PM7B 4NC4A 4MK0B 3MZKA 4GQ1A 1GP2B 3PVUB 2H13A 3MVDK 4FWWA 4GGDA 4Z7QA 3ULEC 2P9NC 4O3TB 5CXCA 4FAVD 3I2NA 5FQDA 2I0RA 4FHLA 5IT9g 4ERZA 4JD2C 3IUMA 2H3XA 4ZOVA 5EM2A 5GSAA 4L9OA 3C5MA 2I3TA 3JROA 1NR0A 4DNVA 4GM3A 3EI4B 3BG1A 3RSEC 2AH0A 3RFGA 5TF2A 2TRCB 3V9FA 2B4EA 3ZE2A 4AEZA 4A11A 4Y5RD 3B7FA 3PXWD 2HYEA 4CI3A 5KDOB 1TYQC 4J79A 3OKWA 4J8BA 1L5GA 2XZGA 2IUQA 5GMKn 3AL9A 2AQ5A 1U8CA 5TEFA 2OVQB 4E5ZB 2HKMA 2HKRA 3JZNA 4PNKB 3K26A 3DSMA 1B9XA 4BCDA 5FA5B 1K8KC 1B9YA 5H1MA 4D9SA 4J84A 4Z7OA
chains in the Genus database with same CATH topology
3PXSD 3EI2A 1JMXB 4J82A 5C2VB 5IJ8E 3JAMg 2AGZA 4N14A 4A2MA 4X61B 4GZ8A 2H6KA 3I7PA 2P9KC 3SBPA 4J78A 3I8CA 3IJ0A 4J81A 3SBRA 4I79A 5FKRA 2H6QA 3N0EA 4PXWA 3OKYB 5EAMA 4Z8LA 4D0KA 2H9NA 2YNPA 1A0RB 4O9DA 5IGQA 1PI6A 3RLMD 4A08B 4QRJA 4X60B 3CFVA 3NVQA 5IJ7E 4TZ4A 3SJLD 4A09B 2OJYA 5GXIA 3FM0A 4J87A 2H14A 3RMZD 2AGXA 2QC5A 5C9ZB 3A0FA 5CXBB 2QXVA 4X3EA 4O3UB 2BCJB 2MTAH 2I0TA 2J57G 4QT8A 2H9LA 1PBYB 5CYKB 3L4MD 4EWRA 1N6DA 4AOWA 3GREA 2OVPB 3EG6A 4X63B 3EU7A 4CI2A 3EI1A 3UR4A 5I5MA 2O9KA 4JXMA 4LG9A 4FA4D 3EI4A 2PBIB 4JT6C 3E0CA 3UVNA 4BUJC 2XL3A 3DM0A 4U1EI 3VA6A 5EAPA 5K19A 4A0AB 3UVKA 3P4FA 4JSNC 2PM6B 3EI3A 4CI8A 2OIZA 3F3GA 4GMBA 3V7DB 4E5ZA 2HESX 4BH6A 4R7AB 5HE1B 3JRPA 2CE8A 4JT5C 3I7OA 1MDAH 4XYIA 1XKSA 5EMLB 5B4WA 4CY2A 2YMUA 5H14A 2CO0C 1XHMA 4A0BB 1JMZB 5HE2B 2AGWA 2IURA 1GG2B 3MKSB 3EWEA 1RI6A 4QL1A 4CY5A 3V5WB 5HYNB 3SFZA 3HFQA 3OKYA 1JOFA 3J80g 3SMRA 3C99A 3DXKC 4OZUA 4PBZA 4A08A 4J0XA 2H6NA 2P9SC 3UKUC 2G99A 3MMYA 4A09A 5SXMA 4UI9R 4ESGA 3AFCA 5JWZA 2YB8B 2UZXB 2IUPA 4E54B 5EARA 4XYHA 3AL8B 4O45A 3OL2A 1XIPA 2Z2OA 4L3GD 4FAND 3IKOA 5GXHA 4JSVC 5HQGA 5CYKA 3JZGA 5FKTA 2I0SA 2AGLA 2PM9A 5K1CC 3IJCA 2H47A 5EMKB 1U4CA 5AMSA 1Q47A 2J55H 4CY3A 4O1QD 5EMMB 4BL0A 1R5MA 2B5NA 2UZYB 2YNOA 3NVNA 3ORVD 4ZOXA 1S4UX 5IC7A 2I3SA 4HDJA 4GM9A 3J81g 4CY1A 4A7JA 3KRXB 2P9PC 4A0AA 2IAAA 2BBKH 1SQ9A 3FRXA 1OMWB 2P9UC 4K3JB 3RRMC 2HJBA 2OK4A 2IWKA 2XL2A 3MXXA 3SHFA 2P9IC 5FXYA 4CZYA 4U7AA 2YBAA 4J77A 4ZOYA 2CO0A 1YFQA 5EALA 3C75H 3L4OD 2Z2PA 3CIKB 1PEVA 2GC7A 3DWLC 3BG0A 3OW8A 3UVMA 1TBGA 5TEEA 5A2Qg 3I7NA 4FA9D 5C2WB 5HE0B 4ZN4A 5I5IA 2AH1A 2B5MA 1GXRA 4GGCA 3C9CA 4Y7RA 4GQ2P 3SXTD 4ERYA 2IWFA 4XEIC 4D6VA 4ES0A 1MG2A 3SN6B 3SLED 4PC0A 4J73A 3MZLA 3UKRC 3F3PA 4A2LA 2HXCA 4E54A 5FKQA 3AL8A 1N6FA 3PE7A 1VYHC 2CE9A 1N6EA 3ZWLB 4QQEA 1JJUB 4JSXC 2CN3A 4GM8A 3RN0D 3EI1B 4ERQA 4J86A 3NVXA 5EMJB 4GGAA 1FWXA 3AH8B 3SCYA 4OWRA 2CNXA 1GOTB 2Q7QA 3SVWD 4K3ID 4J8GA 5FKSA 3VGZA 4FA1D 1MG3A 3PXTD 3I7KA 4FA5D 3MKQA 3GFCA 4LGNA 3RN1D 1SQJA 3IIWA 5I5JA 1NEXB 1P22A 3ODTA 3EI3B 5IGOA 2GC4A 4JSPC 5CXBA 2OVRB 4H5JA 4PBYA 3U4YA 3EMHA 3I7HA 3JPXA 5CXCB 2H68A 2EBSA 2OK6A 2H9MA 3I7LA 3FGBA 5EM2B 4IMMA 3UVOA 3IJ1A 2P9LC 4GQBB 4L1QD 3PSLA 3W15A 2IUVA 4CI1A 4J0WA 1L0QA 3VH0A 4A11B 3SBQA 5TDHB 3JZHA 3I89A 3F3FA 4PSWB 2W18A 5FLXg 2J56H 2CN2A 2H9PA 3K27A 4NSXA 2B5LA 3PSCB 5H17A 1K32A 4FB1D 2AGYA 4CC9A 3EI2B 3RFHA 3IIYA 2HJ4A 5AJAA 3KRWB 3DXMC 2XU7A 3OL2B 4CZXA 1SHYB 4IA9A 3UVLA 1QNIA 1ERJA 3OTTA 4A0BA 3OKTA 3CFSB 4H5IA 5HE3B 3I8EA 2GNQA 2PM9B 3BWSA 5AFU3 3N0DA 1U2VC 2G9AA 4ZOZA 2YNNA 3PVWB 3JB9L 1PGUA 3SWSD 4CZVA 1OLZA 4G56B 4LG8A 2Z2NA 4L3HD 2XYIA 4PSXB 5THAA 4YVDA 4KFMB 2PM7B 4MK0B 3MZKA 4GQ1A 1GP2B 3PVUB 2H13A 4FWWA 4GGDA 3ULEC 2P9NC 4O3TB 5CXCA 4FAVD 3I2NA 5FQDA 2I0RA 4FHLA 5IT9g 4ERZA 4JD2C 2H3XA 4ZOVA 5EM2A 5GSAA 4L9OA 3C5MA 2I3TA 3JROA 1NR0A 4GM3A 3EI4B 3BG1A 3RSEC 2AH0A 3RFGA 5TF2A 2TRCB 3V9FA 2B4EA 4AEZA 4A11A 4Y5RD 3B7FA 3PXWD 2HYEA 4CI3A 5KDOB 1TYQC 4J79A 3OKWA 4J8BA 2IUQA 5GMKn 3AL9A 2AQ5A 5TEFA 2OVQB 4E5ZB 2HKMA 2HKRA 3JZNA 4PNKB 3K26A 3DSMA 1B9XA 5FA5B 1K8KC 1B9YA 5H1MA 4J84A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PXS D;  3EI2 A;  1JMX B;  4J82 A;  5C2V B;  5IJ8 E;  3JAM g;  2AGZ A;  4N14 A;  4A2M A;  4X61 B;  4GZ8 A;  2H6K A;  3I7P A;  2P9K C;  3SBP A;  4J78 A;  3I8C A;  3IJ0 A;  4J81 A;  3SBR A;  4I79 A;  5FKR A;  2H6Q A;  3N0E A;  4PXW A;  3OKY B;  5EAM A;  4Z8L A;  4D0K A;  2H9N A;  2YNP A;  1A0R B;  4O9D A;  5IGQ A;  1PI6 A;  3RLM D;  4A08 B;  4QRJ A;  4X60 B;  3CFV A;  3NVQ A;  5IJ7 E;  4TZ4 A;  3SJL D;  4A09 B;  2OJY A;  5GXI A;  3FM0 A;  4J87 A;  2H14 A;  3RMZ D;  2AGX A;  2QC5 A;  5C9Z B;  3A0F A;  5CXB B;  2QXV A;  4X3E A;  4O3U B;  2BCJ B;  2MTA H;  2I0T A;  2J57 G;  4QT8 A;  2H9L A;  1PBY B;  5CYK B;  3L4M D;  4EWR A;  1N6D A;  4AOW A;  3GRE A;  2OVP B;  3EG6 A;  4X63 B;  3EU7 A;  4CI2 A;  3EI1 A;  3UR4 A;  5I5M A;  2O9K A;  4JXM A;  4LG9 A;  4FA4 D;  3EI4 A;  2PBI B;  4JT6 C;  3E0C A;  3UVN A;  4BUJ C;  2XL3 A;  3DM0 A;  4U1E I;  3VA6 A;  5EAP A;  5K19 A;  4A0A B;  3UVK A;  3P4F A;  4JSN C;  2PM6 B;  3EI3 A;  4CI8 A;  2OIZ A;  3F3G A;  4GMB A;  3V7D B;  4E5Z A;  2HES X;  4BH6 A;  4R7A B;  5HE1 B;  3JRP A;  2CE8 A;  4JT5 C;  3I7O A;  1MDA H;  4XYI A;  1XKS A;  5EML B;  5B4W A;  4CY2 A;  2YMU A;  5H14 A;  2CO0 C;  1XHM A;  4A0B B;  1JMZ B;  5HE2 B;  2AGW A;  2IUR A;  1GG2 B;  3MKS B;  3EWE A;  1RI6 A;  4QL1 A;  4CY5 A;  3V5W B;  5HYN B;  3SFZ A;  3HFQ A;  3OKY A;  1JOF A;  3J80 g;  3SMR A;  3C99 A;  3DXK C;  4OZU A;  4PBZ A;  4A08 A;  4J0X A;  2H6N A;  2P9S C;  3UKU C;  2G99 A;  3MMY A;  4A09 A;  5SXM A;  4UI9 R;  4ESG A;  3AFC A;  5JWZ A;  2YB8 B;  2UZX B;  2IUP A;  4E54 B;  5EAR A;  4XYH A;  3AL8 B;  4O45 A;  3OL2 A;  1XIP A;  2Z2O A;  4L3G D;  4FAN D;  3IKO A;  5GXH A;  4JSV C;  5HQG A;  5CYK A;  3JZG A;  5FKT A;  2I0S A;  2AGL A;  2PM9 A;  5K1C C;  3IJC A;  2H47 A;  5EMK B;  1U4C A;  5AMS A;  1Q47 A;  2J55 H;  4CY3 A;  4O1Q D;  5EMM B;  4BL0 A;  1R5M A;  2B5N A;  2UZY B;  2YNO A;  3NVN A;  3ORV D;  4ZOX A;  1S4U X;  5IC7 A;  2I3S A;  4HDJ A;  4GM9 A;  3J81 g;  4CY1 A;  4A7J A;  3KRX B;  2P9P C;  4A0A A;  2IAA A;  2BBK H;  1SQ9 A;  3FRX A;  1OMW B;  2P9U C;  4K3J B;  3RRM C;  2HJB A;  2OK4 A;  2IWK A;  2XL2 A;  3MXX A;  3SHF A;  2P9I C;  5FXY A;  4CZY A;  4U7A A;  2YBA A;  4J77 A;  4ZOY A;  2CO0 A;  1YFQ A;  5EAL A;  3C75 H;  3L4O D;  2Z2P A;  3CIK B;  1PEV A;  2GC7 A;  3DWL C;  3BG0 A;  3OW8 A;  3UVM A;  1TBG A;  5TEE A;  5A2Q g;  3I7N A;  4FA9 D;  5C2W B;  5HE0 B;  4ZN4 A;  5I5I A;  2AH1 A;  2B5M A;  1GXR A;  4GGC A;  3C9C A;  4Y7R A;  4GQ2 P;  3SXT D;  4ERY A;  2IWF A;  4XEI C;  4D6V A;  4ES0 A;  1MG2 A;  3SN6 B;  3SLE D;  4PC0 A;  4J73 A;  3MZL A;  3UKR C;  3F3P A;  4A2L A;  2HXC A;  4E54 A;  5FKQ A;  3AL8 A;  1N6F A;  3PE7 A;  1VYH C;  2CE9 A;  1N6E A;  3ZWL B;  4QQE A;  1JJU B;  4JSX C;  2CN3 A;  4GM8 A;  3RN0 D;  3EI1 B;  4ERQ A;  4J86 A;  3NVX A;  5EMJ B;  4GGA A;  1FWX A;  3AH8 B;  3SCY A;  4OWR A;  2CNX A;  1GOT B;  2Q7Q A;  3SVW D;  4K3I D;  4J8G A;  5FKS A;  3VGZ A;  4FA1 D;  1MG3 A;  3PXT D;  3I7K A;  4FA5 D;  3MKQ A;  3GFC A;  4LGN A;  3RN1 D;  1SQJ A;  3IIW A;  5I5J A;  1NEX B;  1P22 A;  3ODT A;  3EI3 B;  5IGO A;  2GC4 A;  4JSP C;  5CXB A;  2OVR B;  4H5J A;  4PBY A;  3U4Y A;  3EMH A;  3I7H A;  3JPX A;  5CXC B;  2H68 A;  2EBS A;  2OK6 A;  2H9M A;  3I7L A;  3FGB A;  5EM2 B;  4IMM A;  3UVO A;  3IJ1 A;  2P9L C;  4GQB B;  4L1Q D;  3PSL A;  3W15 A;  2IUV A;  4CI1 A;  4J0W A;  1L0Q A;  3VH0 A;  4A11 B;  3SBQ A;  5TDH B;  3JZH A;  3I89 A;  3F3F A;  4PSW B;  2W18 A;  5FLX g;  2J56 H;  2CN2 A;  2H9P A;  3K27 A;  4NSX A;  2B5L A;  3PSC B;  5H17 A;  1K32 A;  4FB1 D;  2AGY A;  4CC9 A;  3EI2 B;  3RFH A;  3IIY A;  2HJ4 A;  5AJA A;  3KRW B;  3DXM C;  2XU7 A;  3OL2 B;  4CZX A;  1SHY B;  4IA9 A;  3UVL A;  1QNI A;  1ERJ A;  3OTT A;  4A0B A;  3OKT A;  3CFS B;  4H5I A;  5HE3 B;  3I8E A;  2GNQ A;  2PM9 B;  3BWS A;  5AFU 3;  3N0D A;  1U2V C;  2G9A A;  4ZOZ A;  2YNN A;  3PVW B;  3JB9 L;  1PGU A;  3SWS D;  4CZV A;  1OLZ A;  4G56 B;  4LG8 A;  2Z2N A;  4L3H D;  2XYI A;  4PSX B;  5THA A;  4YVD A;  4KFM B;  2PM7 B;  4MK0 B;  3MZK A;  4GQ1 A;  1GP2 B;  3PVU B;  2H13 A;  4FWW A;  4GGD A;  3ULE C;  2P9N C;  4O3T B;  5CXC A;  4FAV D;  3I2N A;  5FQD A;  2I0R A;  4FHL A;  5IT9 g;  4ERZ A;  4JD2 C;  2H3X A;  4ZOV A;  5EM2 A;  5GSA A;  4L9O A;  3C5M A;  2I3T A;  3JRO A;  1NR0 A;  4GM3 A;  3EI4 B;  3BG1 A;  3RSE C;  2AH0 A;  3RFG A;  5TF2 A;  2TRC B;  3V9F A;  2B4E A;  4AEZ A;  4A11 A;  4Y5R D;  3B7F A;  3PXW D;  2HYE A;  4CI3 A;  5KDO B;  1TYQ C;  4J79 A;  3OKW A;  4J8B A;  2IUQ A;  5GMK n;  3AL9 A;  2AQ5 A;  5TEF A;  2OVQ B;  4E5Z B;  2HKM A;  2HKR A;  3JZN A;  4PNK B;  3K26 A;  3DSM A;  1B9X A;  5FA5 B;  1K8K C;  1B9Y A;  5H1M A;  4J84 A; 
#chains in the Genus database with same CATH topology
 3PXS D;  3EI2 A;  1JMX B;  2HU7 A;  4J82 A;  4RE6 A;  5C2V B;  5IJ8 E;  3JAM g;  2AGZ A;  2VDP A;  4N14 A;  2VDL A;  4A2M A;  4X61 B;  4GZ8 A;  4G55 A;  2H6K A;  3I7P A;  2P9K C;  2EIC A;  3ZE0 A;  3K72 A;  3SBP A;  4JHP C;  4J78 A;  4Z7N A;  3NID A;  3I8C A;  5M5V A;  4BP9 A;  3IJ0 A;  4J81 A;  3SBR A;  2BKL A;  4I79 A;  5FKR A;  2WQ8 A;  1I2M B;  4IRZ A;  2H6Q A;  3N0E A;  3VI4 A;  4PXW A;  3OKY B;  5EAM A;  4AMZ A;  4Z8L A;  4D0K A;  2H9N A;  2YNP A;  1A0R B;  4O9D A;  3EQ9 A;  5IGQ A;  1PI6 A;  3RLM D;  4A08 B;  4QRJ A;  1JV2 A;  3CFV A;  4X60 B;  3NVQ A;  5IJ7 E;  4AN0 A;  4TZ4 A;  3SJL D;  4O02 A;  4A09 B;  2OJY A;  5GXI A;  3FM0 A;  4J87 A;  2H14 A;  3RMZ D;  4UM8 A;  3V4V A;  2AGX A;  2QC5 A;  3QHY B;  5C9Z B;  3A0F A;  5CXB B;  2QXV A;  3QI0 A;  4X3E A;  4O3U B;  2BCJ B;  1BPO A;  3MUO A;  2MTA H;  2HU8 A;  2I0T A;  2J57 G;  4QT8 A;  2H9L A;  1PBY B;  3NIG A;  3OF7 A;  3L4M D;  5CYK B;  4EWR A;  1N6D A;  4AOW A;  3GRE A;  2OVP B;  3EG6 A;  4X63 B;  1E8N A;  1UOP A;  3EU7 A;  4CI2 A;  5M61 A;  4G1E A;  3EI1 A;  3UR4 A;  5I5M A;  4NEN A;  2O9K A;  4JXM A;  4LG9 A;  4FA4 D;  3EI4 A;  2PBI B;  5C86 A;  4RE5 A;  4JT6 C;  3ZDZ A;  3GC3 B;  4BCB A;  3E0C A;  3UVN A;  4BUJ C;  2XL3 A;  3DM0 A;  4U1E I;  3VA6 A;  5EAP A;  2XE4 A;  4NBM A;  5K19 A;  4A0A B;  4MMX A;  3UVK A;  3P4F A;  2VZ3 A;  4JSN C;  2PM6 B;  3EI3 A;  4CI8 A;  2OIZ A;  3F3G A;  4GMB A;  4WK2 A;  3V7D B;  4E5Z A;  2HES X;  4BH6 A;  4R7A B;  5HE1 B;  3JRP A;  2CE8 A;  4JT5 C;  3I7O A;  1MDA H;  4XYI A;  1XKS A;  5EML B;  5B4W A;  4CY2 A;  4NAA A;  2YMU A;  1QFM A;  3K6S A;  3K71 A;  4UM9 A;  1H2Y A;  1GOG A;  5H14 A;  3NIF A;  2QR5 A;  2CO0 C;  1XHM A;  4A0B B;  2HU5 A;  3O4H A;  1JMZ B;  5HE2 B;  2AGW A;  2IUR A;  1GG2 B;  3MKS B;  3EWE A;  1RI6 A;  4QL1 A;  4CY5 A;  3V5W B;  5HYN B;  3EQ8 A;  3SFZ A;  3HFQ A;  3OKY A;  4QAM A;  1JOF A;  2VC2 A;  3J80 g;  3SMR A;  3C99 A;  3DXK C;  4OZU A;  3IUN A;  4PBZ A;  4AN1 A;  1VZ3 A;  4A08 A;  2XDW A;  1K3I A;  4J0X A;  2H6N A;  2P9S C;  3UKU C;  2G99 A;  3MMY A;  4A09 A;  5SXM A;  4UI9 R;  4DNW A;  3AFC A;  4ESG A;  2EIE A;  5JWZ A;  2YB8 B;  2UZX B;  2IUP A;  4E54 B;  5EAR A;  1TYE A;  4XYH A;  1QFS A;  3AL8 B;  5FFG A;  4O45 A;  4MMZ A;  1M1X A;  3OL2 A;  1XIP A;  2VDN A;  1C9I A;  2Z2O A;  4L3G D;  4FAN D;  3IKO A;  5GXH A;  4JSV C;  5HQG A;  5CYK A;  3JZG A;  2EIB A;  2I0S A;  2AGL A;  2PM9 A;  5FKT A;  5K1C C;  2VZ1 A;  2H47 A;  3IJC A;  5EMK B;  3FCU A;  1U4C A;  5AMS A;  1Q47 A;  2J55 H;  4CY3 A;  4O1Q D;  5E6R A;  5EMM B;  4BL0 A;  1R5M A;  2B5N A;  2UZY B;  2YNO A;  3NVN A;  3ORV D;  4ZOX A;  3IVM A;  3V4P A;  1S4U X;  5IC7 A;  3O4J A;  2I3S A;  4HDJ A;  4GM9 A;  2EID A;  3J81 g;  4CY1 A;  4O2W A;  4A7J A;  3KRX B;  2P9P C;  4A0A A;  1H2X A;  2IAA A;  2BBK H;  1SQ9 A;  3FRX A;  1OMW B;  2P9U C;  4K3J B;  3RRM C;  3O4I A;  2HJB A;  2OK4 A;  2IWK A;  2XL2 A;  3MXX A;  3SHF A;  2P9I C;  5FXY A;  4CZY A;  4U7A A;  2YBA A;  4J77 A;  4ZOY A;  2CO0 A;  1YFQ A;  5EAL A;  3C75 H;  3L4O D;  2Z2P A;  3CIK B;  1PEV A;  2GC7 A;  3DWL C;  3BG0 A;  2QZP A;  2VDK A;  3OW8 A;  1O6F A;  3UVM A;  1TBG A;  3T3P A;  3IJE A;  5TEE A;  5A2Q g;  3IUQ A;  3GD1 I;  3I7N A;  4FA9 D;  5C2W B;  5HE0 B;  4ZN4 A;  5I5I A;  4AMY A;  1H2Z A;  2AH1 A;  2B5M A;  1GXR A;  4GGC A;  5M5T A;  3C9C A;  3IUJ A;  4Y7R A;  4GQ2 P;  3SXT D;  4AX4 A;  4ERY A;  1VE6 A;  1UOO A;  2IWF A;  4XEI C;  4D6V A;  4ES0 A;  1MG2 A;  5M5R A;  3SN6 B;  3SLE D;  4BCC A;  4PC0 A;  4J73 A;  3MZL A;  3UKR C;  3F3P A;  1GOF A;  1O6G A;  4A2L A;  2VDQ A;  2HXC A;  4E54 A;  5FKQ A;  3AL8 A;  1N6F A;  3PE7 A;  1VYH C;  2CE9 A;  1N6E A;  3ZWL B;  3ZDX A;  4QQE A;  1JJU B;  4JSX C;  5E6U A;  2CN3 A;  4GM8 A;  3RN0 D;  3EI1 B;  4ERQ A;  4J86 A;  3NVX A;  1VE7 A;  5EMJ B;  4GGA A;  1FWX A;  3AH8 B;  3O4G A;  3SCY A;  4OWR A;  2CNX A;  1GOT B;  2Q7Q A;  3SVW D;  4K3I D;  4J8G A;  1E5T A;  5FKS A;  3VGZ A;  4FA1 D;  1UOQ A;  1MG3 A;  2VDM A;  3I7K A;  2JKX A;  3PXT D;  4FA5 D;  3MKQ A;  3GFC A;  4LGN A;  1T2X A;  1SQJ A;  3RN1 D;  3IIW A;  3IUL A;  5I5J A;  1NEX B;  1P22 A;  3FCS A;  3ODT A;  3MUN A;  1E8M A;  3EI3 B;  5IGO A;  2GC4 A;  4JSP C;  5CXB A;  2OVR B;  4H5J A;  4PBY A;  3U4Y A;  3EMH A;  3I7H A;  3JPX A;  5CXC B;  4L1M A;  2H68 A;  2EBS A;  2OK6 A;  5E6S A;  3ZE1 A;  2H9M A;  3I7L A;  3FGB A;  5EM2 B;  4IMM A;  3UVO A;  3IJ1 A;  2P9L C;  4GQB B;  4L1Q D;  3PSL A;  3W15 A;  2IUV A;  1UTC A;  4CI1 A;  4J0W A;  1L0Q A;  3VH0 A;  4A11 B;  5M5U A;  3SBQ A;  5TDH B;  4MMY A;  3JZH A;  3I89 A;  3F3F A;  4PSW B;  5M5S A;  2W18 A;  4WK4 A;  5FLX g;  2J56 H;  2CN2 A;  2H9P A;  3K27 A;  4WJK A;  4NSX A;  2B5L A;  3PSC B;  5H17 A;  1K32 A;  4FB1 D;  2AGY A;  1VZ2 A;  5HDB A;  4CC9 A;  3EI2 B;  3RFH A;  5FFO A;  3IIY A;  1A12 A;  4G1M A;  3ZDY A;  1JTD B;  3DDU A;  2HJ4 A;  5AJA A;  3KRW B;  4WK0 A;  3T3M A;  3DXM C;  2XU7 A;  3OL2 B;  4CZX A;  1SHY B;  1H2W A;  3KCI A;  4IA9 A;  4DNU A;  3UVL A;  1QNI A;  1ERJ A;  1GOH A;  2VDR A;  3OTT A;  4A0B A;  3OKT A;  3CFS B;  4H5I A;  5HE3 B;  3I8E A;  2GNQ A;  2PM9 B;  3BWS A;  2VDO A;  5AFU 3;  3N0D A;  1U2V C;  4BP8 A;  2G9A A;  4ZOZ A;  2YNN A;  3PVW B;  5C92 A;  3JB9 L;  1PGU A;  3SWS D;  4CZV A;  1OLZ A;  4G56 B;  4LG8 A;  2Z2N A;  4L3H D;  2XYI A;  4PSX B;  5THA A;  3VI3 A;  3IUR A;  1C9L A;  4YVD A;  1YR2 A;  3EQ7 A;  4JHN A;  4KFM B;  2PM7 B;  4NC4 A;  4MK0 B;  3MZK A;  4GQ1 A;  1GP2 B;  3PVU B;  2H13 A;  3MVD K;  4FWW A;  4GGD A;  4Z7Q A;  3ULE C;  2P9N C;  4O3T B;  5CXC A;  4FAV D;  3I2N A;  5FQD A;  2I0R A;  4FHL A;  5IT9 g;  4ERZ A;  4JD2 C;  3IUM A;  2H3X A;  4ZOV A;  5EM2 A;  5GSA A;  4L9O A;  3C5M A;  2I3T A;  3JRO A;  1NR0 A;  4DNV A;  4GM3 A;  3EI4 B;  3BG1 A;  3RSE C;  2AH0 A;  3RFG A;  5TF2 A;  2TRC B;  3V9F A;  2B4E A;  3ZE2 A;  4AEZ A;  4A11 A;  4Y5R D;  3B7F A;  3PXW D;  2HYE A;  4CI3 A;  5KDO B;  1TYQ C;  4J79 A;  3OKW A;  4J8B A;  1L5G A;  2XZG A;  2IUQ A;  5GMK n;  3AL9 A;  2AQ5 A;  1U8C A;  5TEF A;  2OVQ B;  4E5Z B;  2HKM A;  2HKR A;  3JZN A;  4PNK B;  3K26 A;  3DSM A;  1B9X A;  4BCD A;  5FA5 B;  1K8K C;  1B9Y A;  5H1M A;  4D9S A;  4J84 A;  4Z7O A; 
#chains in the Genus database with same CATH homology
 3PXS D;  3EI2 A;  1JMX B;  4J82 A;  5C2V B;  5IJ8 E;  3JAM g;  2AGZ A;  4N14 A;  4A2M A;  4X61 B;  4GZ8 A;  2H6K A;  3I7P A;  2P9K C;  3SBP A;  4J78 A;  3I8C A;  3IJ0 A;  4J81 A;  3SBR A;  4I79 A;  5FKR A;  2H6Q A;  3N0E A;  4PXW A;  3OKY B;  5EAM A;  4Z8L A;  4D0K A;  2H9N A;  2YNP A;  1A0R B;  4O9D A;  5IGQ A;  1PI6 A;  3RLM D;  4A08 B;  4QRJ A;  4X60 B;  3CFV A;  3NVQ A;  5IJ7 E;  4TZ4 A;  3SJL D;  4A09 B;  2OJY A;  5GXI A;  3FM0 A;  4J87 A;  2H14 A;  3RMZ D;  2AGX A;  2QC5 A;  5C9Z B;  3A0F A;  5CXB B;  2QXV A;  4X3E A;  4O3U B;  2BCJ B;  2MTA H;  2I0T A;  2J57 G;  4QT8 A;  2H9L A;  1PBY B;  5CYK B;  3L4M D;  4EWR A;  1N6D A;  4AOW A;  3GRE A;  2OVP B;  3EG6 A;  4X63 B;  3EU7 A;  4CI2 A;  3EI1 A;  3UR4 A;  5I5M A;  2O9K A;  4JXM A;  4LG9 A;  4FA4 D;  3EI4 A;  2PBI B;  4JT6 C;  3E0C A;  3UVN A;  4BUJ C;  2XL3 A;  3DM0 A;  4U1E I;  3VA6 A;  5EAP A;  5K19 A;  4A0A B;  3UVK A;  3P4F A;  4JSN C;  2PM6 B;  3EI3 A;  4CI8 A;  2OIZ A;  3F3G A;  4GMB A;  3V7D B;  4E5Z A;  2HES X;  4BH6 A;  4R7A B;  5HE1 B;  3JRP A;  2CE8 A;  4JT5 C;  3I7O A;  1MDA H;  4XYI A;  1XKS A;  5EML B;  5B4W A;  4CY2 A;  2YMU A;  5H14 A;  2CO0 C;  1XHM A;  4A0B B;  1JMZ B;  5HE2 B;  2AGW A;  2IUR A;  1GG2 B;  3MKS B;  3EWE A;  1RI6 A;  4QL1 A;  4CY5 A;  3V5W B;  5HYN B;  3SFZ A;  3HFQ A;  3OKY A;  1JOF A;  3J80 g;  3SMR A;  3C99 A;  3DXK C;  4OZU A;  4PBZ A;  4A08 A;  4J0X A;  2H6N A;  2P9S C;  3UKU C;  2G99 A;  3MMY A;  4A09 A;  5SXM A;  4UI9 R;  4ESG A;  3AFC A;  5JWZ A;  2YB8 B;  2UZX B;  2IUP A;  4E54 B;  5EAR A;  4XYH A;  3AL8 B;  4O45 A;  3OL2 A;  1XIP A;  2Z2O A;  4L3G D;  4FAN D;  3IKO A;  5GXH A;  4JSV C;  5HQG A;  5CYK A;  3JZG A;  5FKT A;  2I0S A;  2AGL A;  2PM9 A;  5K1C C;  3IJC A;  2H47 A;  5EMK B;  1U4C A;  5AMS A;  1Q47 A;  2J55 H;  4CY3 A;  4O1Q D;  5EMM B;  4BL0 A;  1R5M A;  2B5N A;  2UZY B;  2YNO A;  3NVN A;  3ORV D;  4ZOX A;  1S4U X;  5IC7 A;  2I3S A;  4HDJ A;  4GM9 A;  3J81 g;  4CY1 A;  4A7J A;  3KRX B;  2P9P C;  4A0A A;  2IAA A;  2BBK H;  1SQ9 A;  3FRX A;  1OMW B;  2P9U C;  4K3J B;  3RRM C;  2HJB A;  2OK4 A;  2IWK A;  2XL2 A;  3MXX A;  3SHF A;  2P9I C;  5FXY A;  4CZY A;  4U7A A;  2YBA A;  4J77 A;  4ZOY A;  2CO0 A;  1YFQ A;  5EAL A;  3C75 H;  3L4O D;  2Z2P A;  3CIK B;  1PEV A;  2GC7 A;  3DWL C;  3BG0 A;  3OW8 A;  3UVM A;  1TBG A;  5TEE A;  5A2Q g;  3I7N A;  4FA9 D;  5C2W B;  5HE0 B;  4ZN4 A;  5I5I A;  2AH1 A;  2B5M A;  1GXR A;  4GGC A;  3C9C A;  4Y7R A;  4GQ2 P;  3SXT D;  4ERY A;  2IWF A;  4XEI C;  4D6V A;  4ES0 A;  1MG2 A;  3SN6 B;  3SLE D;  4PC0 A;  4J73 A;  3MZL A;  3UKR C;  3F3P A;  4A2L A;  2HXC A;  4E54 A;  5FKQ A;  3AL8 A;  1N6F A;  3PE7 A;  1VYH C;  2CE9 A;  1N6E A;  3ZWL B;  4QQE A;  1JJU B;  4JSX C;  2CN3 A;  4GM8 A;  3RN0 D;  3EI1 B;  4ERQ A;  4J86 A;  3NVX A;  5EMJ B;  4GGA A;  1FWX A;  3AH8 B;  3SCY A;  4OWR A;  2CNX A;  1GOT B;  2Q7Q A;  3SVW D;  4K3I D;  4J8G A;  5FKS A;  3VGZ A;  4FA1 D;  1MG3 A;  3PXT D;  3I7K A;  4FA5 D;  3MKQ A;  3GFC A;  4LGN A;  3RN1 D;  1SQJ A;  3IIW A;  5I5J A;  1NEX B;  1P22 A;  3ODT A;  3EI3 B;  5IGO A;  2GC4 A;  4JSP C;  5CXB A;  2OVR B;  4H5J A;  4PBY A;  3U4Y A;  3EMH A;  3I7H A;  3JPX A;  5CXC B;  2H68 A;  2EBS A;  2OK6 A;  2H9M A;  3I7L A;  3FGB A;  5EM2 B;  4IMM A;  3UVO A;  3IJ1 A;  2P9L C;  4GQB B;  4L1Q D;  3PSL A;  3W15 A;  2IUV A;  4CI1 A;  4J0W A;  1L0Q A;  3VH0 A;  4A11 B;  3SBQ A;  5TDH B;  3JZH A;  3I89 A;  3F3F A;  4PSW B;  2W18 A;  5FLX g;  2J56 H;  2CN2 A;  2H9P A;  3K27 A;  4NSX A;  2B5L A;  3PSC B;  5H17 A;  1K32 A;  4FB1 D;  2AGY A;  4CC9 A;  3EI2 B;  3RFH A;  3IIY A;  2HJ4 A;  5AJA A;  3KRW B;  3DXM C;  2XU7 A;  3OL2 B;  4CZX A;  1SHY B;  4IA9 A;  3UVL A;  1QNI A;  1ERJ A;  3OTT A;  4A0B A;  3OKT A;  3CFS B;  4H5I A;  5HE3 B;  3I8E A;  2GNQ A;  2PM9 B;  3BWS A;  5AFU 3;  3N0D A;  1U2V C;  2G9A A;  4ZOZ A;  2YNN A;  3PVW B;  3JB9 L;  1PGU A;  3SWS D;  4CZV A;  1OLZ A;  4G56 B;  4LG8 A;  2Z2N A;  4L3H D;  2XYI A;  4PSX B;  5THA A;  4YVD A;  4KFM B;  2PM7 B;  4MK0 B;  3MZK A;  4GQ1 A;  1GP2 B;  3PVU B;  2H13 A;  4FWW A;  4GGD A;  3ULE C;  2P9N C;  4O3T B;  5CXC A;  4FAV D;  3I2N A;  5FQD A;  2I0R A;  4FHL A;  5IT9 g;  4ERZ A;  4JD2 C;  2H3X A;  4ZOV A;  5EM2 A;  5GSA A;  4L9O A;  3C5M A;  2I3T A;  3JRO A;  1NR0 A;  4GM3 A;  3EI4 B;  3BG1 A;  3RSE C;  2AH0 A;  3RFG A;  5TF2 A;  2TRC B;  3V9F A;  2B4E A;  4AEZ A;  4A11 A;  4Y5R D;  3B7F A;  3PXW D;  2HYE A;  4CI3 A;  5KDO B;  1TYQ C;  4J79 A;  3OKW A;  4J8B A;  2IUQ A;  5GMK n;  3AL9 A;  2AQ5 A;  5TEF A;  2OVQ B;  4E5Z B;  2HKM A;  2HKR A;  3JZN A;  4PNK B;  3K26 A;  3DSM A;  1B9X A;  5FA5 B;  1K8K C;  1B9Y A;  5H1M A;  4J84 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...