3RLMD

Structure of the w199f maug/pre-methylamine dehydrogenase complex after treatment with hydrogen peroxide
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Methylamine utilization protein MauG
publication title Mutagenesis of tryptophan199 suggests that hopping is required for MauG-dependent tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 93
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3rlmD00
3F3PA 3EMHA 3C5MA 4JSNC 3DSMA 2UZXB 5IGOA 2CN2A 3EI4B 3F3GA 4ZOYA 3SBRA 2CO0A 3I2NA 2QC5A 3W15A 4CY1A 4E54B 2QXVA 3OKYA 3UR4A 2J57G 3RMZD 3OL2A 4X3EA 4QT8A 3OKWA 1SQJA 3F3FA 2H9NA 4L9OA 2I0SA 4ERQA 4CZXA 1PBYB 5AFU3 2H6NA 4Y5RD 4J77A 4X63B 2GNQA 3IIYA 5FQDA 3ODTA 4J84A 3K26A 2H9PA 3UKRC 3CFSB 3UVMA 4ESGA 3SBPA 2GC4A 1VYHC 4O1QD 3SHFA 2IUQA 5I5IA 2P9LC 3EI3A 1XIPA 5FKRA 4Y7RA 3PSLA 3C99A 1JMXB 3EI2B 1GP2B 4GGAA 2MTAH 1P22A 1U2VC 4J8GA 3UVKA 2B5LA 3RN1D 2I0RA 5EMKB 1MDAH 5FXYA 4EWRA 1OLZA 2HXCA 2AGXA 5CYKA 4PSXB 3V5WB 4PXWA 2BBKH 4AEZA 4ZN4A 1SHYB 4K3ID 4XYIA 3NVQA 5TDHB 2AGLA 2H13A 3ORVD 4GM8A 4QRJA 3PXWD 3NVNA 1JMZB 5GSAA 4R7AB 5H1MA 4J81A 3SBQA 3CFVA 3L4OD 4PNKB 4GZ8A 3OKYB 2IWFA 4JSPC 2I3SA 3AH8B 3OL2B 4G56B 3SVWD 4FWWA 4L1QD 3UKUC 3JROA 2W18A 4BUJC 3MZKA 3EU7A 3IJ1A 4U7AA 5H17A 4CZVA 2YMUA 4ZOXA 1GOTB 5EAPA 4FAVD 2CE9A 3L4MD 2AGYA 4JT5C 5HE1B 5AJAA 5CXCB 4A08A 4E5ZA 3SCYA 5TEEA 5SXMA 3EI3B 3SXTD 5EALA 5CXBB 5I5MA 3N0EA 2P9KC 3MMYA 2P9PC 3IJ0A 3OKTA 3CIKB 3SWSD 4CI8A 2H68A 4GM3A 4X60B 2OK6A 5EAMA 4FA4D 1B9YA 2P9UC 5C2VB 4J87A 2IURA 4OWRA 5EMJB 4I79A 3EG6A 4PBYA 2B5NA 5THAA 3I8EA 1N6DA 3AL8A 1SQ9A 2Q7QA 3HFQA 5CYKB 4JXMA 3B7FA 4IA9A 5C9ZB 4QQEA 2H3XA 1NEXB 3JB9L 3KRXB 5IT9g 5HE0B 3PE7A 3BG1A 3I7HA 3RSEC 4A11A 1PEVA 2AQ5A 4O3TB 4CI3A 4BH6A 1FWXA 5EMLB 3JRPA 5CXCA 3ZWLB 3BG0A 2OVPB 4GMBA 2XL2A 3JZNA 2G9AA 5CXBA 4A2MA 4D6VA 4O3UB 4JT6C 2OJYA 4O9DA 3P4FA 1GXRA 4JD2C 5HE2B 3DM0A 5A2Qg 2H6QA 4TZ4A 4GQ1A 4A08B 4E5ZB 4A0AA 3K27A 4D0KA 1R5MA 3MKSB 5FKQA 3SFZA 2OVRB 4A09B 2XL3A 4MK0B 3GREA 3JPXA 4CY2A 5IJ7E 1S4UX 4J73A 5EARA 2IAAA 3I7PA 2J56H 5IC7A 2YNNA 3IIWA 4HDJA 3DWLC 4A2LA 5IJ8E 4ERZA 3V9FA 3PXTD 2OIZA 3AL8B 4K3JB 4CI1A 1N6EA 3UVNA 3J80g 3N0DA 4J86A 2PBIB 3SN6B 3FGBA 3V7DB 3IJCA 2B4EA 3RFHA 1N6FA 3KRWB 4A0BA 4A11B 2Z2NA 4ZOZA 5GXHA 2H9MA 2J55H 2CNXA 3PVUB 2P9IC 1MG3A 1K8KC 1NR0A 5GMKn 5GXIA 3SLED 3UVLA 3EI1A 4YVDA 3FRXA 2IUVA 1B9XA 2PM9A 2UZYB 3JAMg 2OVQB 3U4YA 4A09A 4N14A 2AH0A 4PBZA 3PXSD 3OW8A 3MZLA 1U4CA 1QNIA 4UI9R 5TEFA 4NSXA 4PSWB 2IWKA 2OK4A 4GQ2P 4X61B 5EM2A 3RRMC 3VA6A 1XKSA 2I3TA 3I8CA 5AMSA 4A0AB 5FA5B 5JWZA 2Z2OA 5K19A 1YFQA 2HKRA 4BL0A 3RLMD 3JZHA 1PGUA 3PVWB 4J0WA 4L3GD 4O45A 4J0XA 4CZYA 3I89A 2H14A 4IMMA 1PI6A 2CN3A 3FM0A 4FA1D 5HQGA 4AOWA 3RFGA 2AH1A 1TYQC 1Q47A 4ZOVA 4J78A 3RN0D 2EBSA 3J81g 2O9KA 4JSXC 3I7OA 1A0RB 4H5JA 4GGDA 1OMWB 1XHMA 4FA9D 1TBGA 5EMMB 3NVXA 4U1EI 2BCJB 2XYIA 5K1CC 1ERJA 4L3HD 5FKSA 2YB8B 4A0BB 2I0TA 4J82A 4JSVC 3A0FA 3SJLD 3ULEC 2CE8A 3E0CA 5TF2A 3EI1B 2CO0C 3SMRA 3AL9A 5I5JA 4GGCA 2HJBA 4CC9A 2P9SC 2AGZA 3IKOA 2PM9B 4J8BA 4Z8LA 4CY3A 3I7LA 2YBAA 4LG9A 3EI4A 2IUPA 3VGZA 3JZGA 3PSCB 4PC0A 2B5MA 3DXMC 4LG8A 5EM2B 2H9LA 4GM9A 4KFMB 5IGQA 3EWEA 1RI6A 4E54A 4GQBB 2HJ4A 3C9CA 3C75H 4A7JA 4ES0A 5FLXg 1JOFA 5HYNB 5FKTA 4J79A 1MG2A 3OTTA 4FAND 1GG2B 2PM6B 2HKMA 4CI2A 3AFCA 5B4WA 4OZUA 3VH0A 4XEIC 4H5IA 2GC7A 4ERYA 2H6KA 3MKQA 2HYEA 4LGNA 2Z2PA 5C2WB 3BWSA 1K32A 2G99A 2P9NC 2TRCB 3EI2A 1JJUB 3GFCA 2YNOA 5HE3B 3DXKC 3MXXA 2PM7B 2XU7A 4XYHA 3I7KA 4CY5A 4FA5D 2AGWA 4FHLA 2YNPA 4QL1A 3I7NA 3UVOA 4FB1D 5KDOB 1L0QA 2HESX 2H47A 5H14A
chains in the Genus database with same CATH superfamily
3F3PA 3EMHA 1VE7A 3C5MA 4JSNC 3DSMA 2UZXB 5IGOA 2CN2A 3EI4B 3F3GA 4O2WA 4ZOYA 3SBRA 2CO0A 3I2NA 2QC5A 3W15A 4CY1A 2WQ8A 4E54B 4AMYA 2QXVA 3OKYA 4AX4A 3UR4A 2J57G 3RMZD 3OL2A 4X3EA 4NAAA 4QT8A 3OF7A 3OKWA 1SQJA 3F3FA 2H9NA 4L9OA 2I0SA 4MMZA 2EICA 4ERQA 2HU5A 4CZXA 1PBYB 1VZ2A 5AFU3 2H6NA 4Y5RD 1GOFA 1VZ3A 4J77A 4X63B 1O6GA 2GNQA 3IIYA 5FQDA 4DNWA 3MVDK 3ODTA 1C9LA 4J84A 3K26A 2H9PA 1GOHA 3MUNA 3CFSB 3UKRC 2VDKA 3UVMA 4ESGA 3SBPA 3ZE1A 2GC4A 1VYHC 4O1QD 3SHFA 2IUQA 5I5IA 2P9LC 3EI3A 1XIPA 5FKRA 4Y7RA 3PSLA 3IUQA 3C99A 1JMXB 3EI2B 1GP2B 3IUJA 4GGAA 2MTAH 1P22A 1E8NA 1U2VC 3NIDA 4J8GA 3UVKA 2B5LA 3RN1D 2I0RA 5EMKB 3K72A 1MDAH 5FXYA 4EWRA 1VE6A 1OLZA 2HXCA 4RE6A 2AGXA 2VZ3A 5CYKA 4PSXB 3V5WB 3O4JA 4PXWA 2BBKH 4NENA 2EIDA 4AEZA 4ZN4A 1SHYB 4K3ID 4XYIA 3NVQA 5TDHB 3ZE2A 2AGLA 2H13A 3ORVD 3O4HA 4GM8A 1YR2A 4QRJA 3PXWD 3NVNA 4O02A 4WJKA 1JMZB 5M5TA 4D9SA 5GSAA 4R7AB 5H1MA 4AMZA 4J81A 4JHNA 3CFVA 3SBQA 3L4OD 4PNKB 4GZ8A 3OKYB 2IWFA 4JSPC 2I3SA 3AH8B 1C9IA 3OL2B 4G56B 3SVWD 1UTCA 4FWWA 4L1QD 3UKUC 5C92A 3JROA 2W18A 1H2ZA 4BUJC 3K71A 4WK2A 3MZKA 3EU7A 3IJ1A 4U7AA 4QAMA 5H17A 4CZVA 2YMUA 4ZOXA 1GOTB 5EAPA 4FAVD 2VC2A 2CE9A 3L4MD 2AGYA 4JT5C 5HE1B 5AJAA 5CXCB 4A08A 4E5ZA 2VDNA 3SCYA 5TEEA 5SXMA 3EI3B 3SXTD 5EALA 5CXBB 5I5MA 3N0EA 2P9KC 3ZDZA 3MMYA 2P9PC 3IJ0A 3OKTA 3CIKB 3SWSD 4CI8A 2H68A 4GM3A 4X60B 2VDOA 2OK6A 5EAMA 4Z7OA 4FA4D 1B9YA 2P9UC 3EQ8A 5C2VB 4J87A 2IURA 4OWRA 5EMJB 1H2WA 4I79A 3EG6A 4PBYA 2B5NA 5THAA 3I8EA 4Z7QA 1N6DA 2VDLA 3AL8A 1SQ9A 2Q7QA 3HFQA 5CYKB 4JXMA 5M5UA 3B7FA 4IA9A 5C9ZB 4QQEA 1UOQA 4L1MA 5E6UA 2H3XA 1NEXB 3JB9L 4G1EA 3KRXB 5IT9g 5HE0B 3PE7A 1K3IA 4NC4A 3BG1A 3V4VA 3ZE0A 3I7HA 3RSEC 1O6FA 4A11A 2JKXA 1PEVA 2AQ5A 4O3TB 4CI3A 1T2XA 3MUOA 4BH6A 1FWXA 5EMLB 3JRPA 1UOPA 4BCBA 5CXCA 3ZWLB 3BG0A 2OVPB 4GMBA 1I2MB 1E8MA 2XL2A 3JZNA 2G9AA 5CXBA 4A2MA 1JV2A 4AN0A 4UM8A 4D6VA 4O3UB 4JT6C 4BCCA 2OJYA 4O9DA 3P4FA 4IRZA 1GXRA 4JD2C 5HE2B 4G1MA 1GOGA 3DM0A 5A2Qg 2H6QA 2VDMA 4TZ4A 3K6SA 4GQ1A 1H2YA 4A08B 4E5ZB 5M5RA 4A0AA 3K27A 4WK0A 1A12A 4D0KA 4Z7NA 1R5MA 3MKSB 5FKQA 3SFZA 2OVRB 4A09B 2XL3A 4MK0B 3GREA 3JPXA 4CY2A 5IJ7E 1S4UX 4J73A 5EARA 2IAAA 3I7PA 2J56H 5IC7A 2YNNA 3T3MA 3IIWA 4MMXA 2HU7A 4WK4A 4HDJA 3DWLC 1E5TA 4A2LA 5IJ8E 4ERZA 3V9FA 3PXTD 2OIZA 3AL8B 4K3JB 2VDPA 4CI1A 1N6EA 3UVNA 3J80g 3KCIA 3O4GA 3IULA 3N0DA 4J86A 2PBIB 3SN6B 3FGBA 1UOOA 2QR5A 3V7DB 3FCUA 3IVMA 1H2XA 2EIEA 3IJCA 3GD1I 2B4EA 3RFHA 1N6FA 3KRWB 4A0BA 4A11B 2Z2NA 4ZOZA 5GXHA 2H9MA 2J55H 2CNXA 3PVUB 2BKLA 2P9IC 1MG3A 1K8KC 1NR0A 5GMKn 5GXIA 3SLED 3UVLA 3EI1A 4YVDA 3FRXA 2IUVA 5C86A 1B9XA 4NBMA 2PM9A 2UZYB 3JAMg 2OVQB 3U4YA 3QHYB 4N14A 4A09A 2AH0A 4PBZA 3PXSD 3OW8A 3NIFA 3MZLA 1U4CA 1QNIA 4UI9R 5TEFA 2XE4A 3VI4A 4NSXA 4PSWB 2IWKA 2OK4A 4GQ2P 4X61B 5EM2A 3RRMC 3IURA 3VA6A 1XKSA 2I3TA 3I8CA 5AMSA 4A0AB 5FA5B 4BP8A 5JWZA 2Z2OA 4G55A 5K19A 1YFQA 2HKRA 4BL0A 2VDQA 3RLMD 2VDRA 3JZHA 1PGUA 3PVWB 4J0WA 4L3GD 4O45A 4J0XA 4CZYA 3IUNA 3I89A 2H14A 4IMMA 1PI6A 2CN3A 3FM0A 4FA1D 4RE5A 5HQGA 4AOWA 1JTDB 4DNUA 3RFGA 2AH1A 1TYQC 1Q47A 4ZOVA 4J78A 3RN0D 2EBSA 5E6SA 3J81g 2O9KA 4JSXC 5HDBA 3I7OA 3O4IA 1A0RB 4H5JA 4GGDA 1OMWB 1XHMA 4FA9D 1TBGA 5EMMB 5FFOA 2XDWA 3QI0A 3NVXA 4U1EI 2BCJB 2XYIA 5K1CC 1ERJA 4L3HD 5FKSA 2YB8B 4A0BB 5M5VA 2I0TA 4J82A 4JSVC 3A0FA 1QFMA 5M61A 2HU8A 3SJLD 3ULEC 2CE8A 2EIBA 1TYEA 3E0CA 5TF2A 3EI1B 2CO0C 3IUMA 3SMRA 3AL9A 5I5JA 4GGCA 2HJBA 4CC9A 2P9SC 2AGZA 3ZDXA 3IKOA 2PM9B 4J8BA 5M5SA 4Z8LA 2VZ1A 4CY3A 2QZPA 3I7LA 2YBAA 4LG9A 3VI3A 3EQ9A 3EI4A 2IUPA 3VGZA 3JZGA 3PSCB 4AN1A 4PC0A 2B5MA 3DXMC 4LG8A 5EM2B 2H9LA 4GM9A 4KFMB 5IGQA 3EWEA 1RI6A 4E54A 4GQBB 2HJ4A 3GC3B 3C9CA 1M1XA 3C75H 4A7JA 4ES0A 5FLXg 1JOFA 5HYNB 4BP9A 5FKTA 4J79A 4UM9A 1MG2A 3OTTA 3NIGA 4FAND 1GG2B 2PM6B 2HKMA 4CI2A 1L5GA 3AFCA 5B4WA 4OZUA 3VH0A 1BPOA 4JHPC 5FFGA 4XEIC 4H5IA 3FCSA 2GC7A 3V4PA 4ERYA 2H6KA 3MKQA 5E6RA 2HYEA 4LGNA 2Z2PA 5C2WB 3DDUA 2XZGA 3BWSA 1K32A 2G99A 2P9NC 2TRCB 3EI2A 1U8CA 1JJUB 3GFCA 2YNOA 5HE3B 3T3PA 3DXKC 3MXXA 2PM7B 2XU7A 4XYHA 3I7KA 4CY5A 4FA5D 2AGWA 4FHLA 2YNPA 4BCDA 4QL1A 3I7NA 3UVOA 3ZDYA 4FB1D 5KDOB 1QFSA 4DNVA 3IJEA 3EQ7A 1L0QA 4MMYA 2HESX 2H47A 5H14A
chains in the Genus database with same CATH topology
3F3PA 3EMHA 3C5MA 4JSNC 3DSMA 2UZXB 5IGOA 2CN2A 3EI4B 3F3GA 4ZOYA 3SBRA 2CO0A 3I2NA 2QC5A 3W15A 4CY1A 4E54B 2QXVA 3OKYA 3UR4A 2J57G 3RMZD 3OL2A 4X3EA 4QT8A 3OKWA 1SQJA 3F3FA 2H9NA 4L9OA 2I0SA 4ERQA 4CZXA 1PBYB 5AFU3 2H6NA 4Y5RD 4J77A 4X63B 2GNQA 3IIYA 5FQDA 3ODTA 4J84A 3K26A 2H9PA 3UKRC 3CFSB 3UVMA 4ESGA 3SBPA 2GC4A 1VYHC 4O1QD 3SHFA 2IUQA 5I5IA 2P9LC 3EI3A 1XIPA 5FKRA 4Y7RA 3PSLA 3C99A 1JMXB 3EI2B 1GP2B 4GGAA 2MTAH 1P22A 1U2VC 4J8GA 3UVKA 2B5LA 3RN1D 2I0RA 5EMKB 1MDAH 5FXYA 4EWRA 1OLZA 2HXCA 2AGXA 5CYKA 4PSXB 3V5WB 4PXWA 2BBKH 4AEZA 4ZN4A 1SHYB 4K3ID 4XYIA 3NVQA 5TDHB 2AGLA 2H13A 3ORVD 4GM8A 4QRJA 3PXWD 3NVNA 1JMZB 5GSAA 4R7AB 5H1MA 4J81A 3SBQA 3CFVA 3L4OD 4PNKB 4GZ8A 3OKYB 2IWFA 4JSPC 2I3SA 3AH8B 3OL2B 4G56B 3SVWD 4FWWA 4L1QD 3UKUC 3JROA 2W18A 4BUJC 3MZKA 3EU7A 3IJ1A 4U7AA 5H17A 4CZVA 2YMUA 4ZOXA 1GOTB 5EAPA 4FAVD 2CE9A 3L4MD 2AGYA 4JT5C 5HE1B 5AJAA 5CXCB 4A08A 4E5ZA 3SCYA 5TEEA 5SXMA 3EI3B 3SXTD 5EALA 5CXBB 5I5MA 3N0EA 2P9KC 3MMYA 2P9PC 3IJ0A 3OKTA 3CIKB 3SWSD 4CI8A 2H68A 4GM3A 4X60B 2OK6A 5EAMA 4FA4D 1B9YA 2P9UC 5C2VB 4J87A 2IURA 4OWRA 5EMJB 4I79A 3EG6A 4PBYA 2B5NA 5THAA 3I8EA 1N6DA 3AL8A 1SQ9A 2Q7QA 3HFQA 5CYKB 4JXMA 3B7FA 4IA9A 5C9ZB 4QQEA 2H3XA 1NEXB 3JB9L 3KRXB 5IT9g 5HE0B 3PE7A 3BG1A 3I7HA 3RSEC 4A11A 1PEVA 2AQ5A 4O3TB 4CI3A 4BH6A 1FWXA 5EMLB 3JRPA 5CXCA 3ZWLB 3BG0A 2OVPB 4GMBA 2XL2A 3JZNA 2G9AA 5CXBA 4A2MA 4D6VA 4O3UB 4JT6C 2OJYA 4O9DA 3P4FA 1GXRA 4JD2C 5HE2B 3DM0A 5A2Qg 2H6QA 4TZ4A 4GQ1A 4A08B 4E5ZB 4A0AA 3K27A 4D0KA 1R5MA 3MKSB 5FKQA 3SFZA 2OVRB 4A09B 2XL3A 4MK0B 3GREA 3JPXA 4CY2A 5IJ7E 1S4UX 4J73A 5EARA 2IAAA 3I7PA 2J56H 5IC7A 2YNNA 3IIWA 4HDJA 3DWLC 4A2LA 5IJ8E 4ERZA 3V9FA 3PXTD 2OIZA 3AL8B 4K3JB 4CI1A 1N6EA 3UVNA 3J80g 3N0DA 4J86A 2PBIB 3SN6B 3FGBA 3V7DB 3IJCA 2B4EA 3RFHA 1N6FA 3KRWB 4A0BA 4A11B 2Z2NA 4ZOZA 5GXHA 2H9MA 2J55H 2CNXA 3PVUB 2P9IC 1MG3A 1K8KC 1NR0A 5GMKn 5GXIA 3SLED 3UVLA 3EI1A 4YVDA 3FRXA 2IUVA 1B9XA 2PM9A 2UZYB 3JAMg 2OVQB 3U4YA 4A09A 4N14A 2AH0A 4PBZA 3PXSD 3OW8A 3MZLA 1U4CA 1QNIA 4UI9R 5TEFA 4NSXA 4PSWB 2IWKA 2OK4A 4GQ2P 4X61B 5EM2A 3RRMC 3VA6A 1XKSA 2I3TA 3I8CA 5AMSA 4A0AB 5FA5B 5JWZA 2Z2OA 5K19A 1YFQA 2HKRA 4BL0A 3RLMD 3JZHA 1PGUA 3PVWB 4J0WA 4L3GD 4O45A 4J0XA 4CZYA 3I89A 2H14A 4IMMA 1PI6A 2CN3A 3FM0A 4FA1D 5HQGA 4AOWA 3RFGA 2AH1A 1TYQC 1Q47A 4ZOVA 4J78A 3RN0D 2EBSA 3J81g 2O9KA 4JSXC 3I7OA 1A0RB 4H5JA 4GGDA 1OMWB 1XHMA 4FA9D 1TBGA 5EMMB 3NVXA 4U1EI 2BCJB 2XYIA 5K1CC 1ERJA 4L3HD 5FKSA 2YB8B 4A0BB 2I0TA 4J82A 4JSVC 3A0FA 3SJLD 3ULEC 2CE8A 3E0CA 5TF2A 3EI1B 2CO0C 3SMRA 3AL9A 5I5JA 4GGCA 2HJBA 4CC9A 2P9SC 2AGZA 3IKOA 2PM9B 4J8BA 4Z8LA 4CY3A 3I7LA 2YBAA 4LG9A 3EI4A 2IUPA 3VGZA 3JZGA 3PSCB 4PC0A 2B5MA 3DXMC 4LG8A 5EM2B 2H9LA 4GM9A 4KFMB 5IGQA 3EWEA 1RI6A 4E54A 4GQBB 2HJ4A 3C9CA 3C75H 4A7JA 4ES0A 5FLXg 1JOFA 5HYNB 5FKTA 4J79A 1MG2A 3OTTA 4FAND 1GG2B 2PM6B 2HKMA 4CI2A 3AFCA 5B4WA 4OZUA 3VH0A 4XEIC 4H5IA 2GC7A 4ERYA 2H6KA 3MKQA 2HYEA 4LGNA 2Z2PA 5C2WB 3BWSA 1K32A 2G99A 2P9NC 2TRCB 3EI2A 1JJUB 3GFCA 2YNOA 5HE3B 3DXKC 3MXXA 2PM7B 2XU7A 4XYHA 3I7KA 4CY5A 4FA5D 2AGWA 4FHLA 2YNPA 4QL1A 3I7NA 3UVOA 4FB1D 5KDOB 1L0QA 2HESX 2H47A 5H14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F3P A;  3EMH A;  3C5M A;  4JSN C;  3DSM A;  2UZX B;  5IGO A;  2CN2 A;  3EI4 B;  3F3G A;  4ZOY A;  3SBR A;  2CO0 A;  3I2N A;  2QC5 A;  3W15 A;  4CY1 A;  4E54 B;  2QXV A;  3OKY A;  3UR4 A;  2J57 G;  3RMZ D;  3OL2 A;  4X3E A;  4QT8 A;  3OKW A;  1SQJ A;  3F3F A;  2H9N A;  4L9O A;  2I0S A;  4ERQ A;  4CZX A;  1PBY B;  5AFU 3;  2H6N A;  4Y5R D;  4J77 A;  4X63 B;  2GNQ A;  3IIY A;  5FQD A;  3ODT A;  4J84 A;  3K26 A;  2H9P A;  3UKR C;  3CFS B;  3UVM A;  4ESG A;  3SBP A;  2GC4 A;  1VYH C;  4O1Q D;  3SHF A;  2IUQ A;  5I5I A;  2P9L C;  3EI3 A;  1XIP A;  5FKR A;  4Y7R A;  3PSL A;  3C99 A;  1JMX B;  3EI2 B;  1GP2 B;  4GGA A;  2MTA H;  1P22 A;  1U2V C;  4J8G A;  3UVK A;  2B5L A;  3RN1 D;  2I0R A;  5EMK B;  1MDA H;  5FXY A;  4EWR A;  1OLZ A;  2HXC A;  2AGX A;  5CYK A;  4PSX B;  3V5W B;  4PXW A;  2BBK H;  4AEZ A;  4ZN4 A;  1SHY B;  4K3I D;  4XYI A;  3NVQ A;  5TDH B;  2AGL A;  2H13 A;  3ORV D;  4GM8 A;  4QRJ A;  3PXW D;  3NVN A;  1JMZ B;  5GSA A;  4R7A B;  5H1M A;  4J81 A;  3SBQ A;  3CFV A;  3L4O D;  4PNK B;  4GZ8 A;  3OKY B;  2IWF A;  4JSP C;  2I3S A;  3AH8 B;  3OL2 B;  4G56 B;  3SVW D;  4FWW A;  4L1Q D;  3UKU C;  3JRO A;  2W18 A;  4BUJ C;  3MZK A;  3EU7 A;  3IJ1 A;  4U7A A;  5H17 A;  4CZV A;  2YMU A;  4ZOX A;  1GOT B;  5EAP A;  4FAV D;  2CE9 A;  3L4M D;  2AGY A;  4JT5 C;  5HE1 B;  5AJA A;  5CXC B;  4A08 A;  4E5Z A;  3SCY A;  5TEE A;  5SXM A;  3EI3 B;  3SXT D;  5EAL A;  5CXB B;  5I5M A;  3N0E A;  2P9K C;  3MMY A;  2P9P C;  3IJ0 A;  3OKT A;  3CIK B;  3SWS D;  4CI8 A;  2H68 A;  4GM3 A;  4X60 B;  2OK6 A;  5EAM A;  4FA4 D;  1B9Y A;  2P9U C;  5C2V B;  4J87 A;  2IUR A;  4OWR A;  5EMJ B;  4I79 A;  3EG6 A;  4PBY A;  2B5N A;  5THA A;  3I8E A;  1N6D A;  3AL8 A;  1SQ9 A;  2Q7Q A;  3HFQ A;  5CYK B;  4JXM A;  3B7F A;  4IA9 A;  5C9Z B;  4QQE A;  2H3X A;  1NEX B;  3JB9 L;  3KRX B;  5IT9 g;  5HE0 B;  3PE7 A;  3BG1 A;  3I7H A;  3RSE C;  4A11 A;  1PEV A;  2AQ5 A;  4O3T B;  4CI3 A;  4BH6 A;  1FWX A;  5EML B;  3JRP A;  5CXC A;  3ZWL B;  3BG0 A;  2OVP B;  4GMB A;  2XL2 A;  3JZN A;  2G9A A;  5CXB A;  4A2M A;  4D6V A;  4O3U B;  4JT6 C;  2OJY A;  4O9D A;  3P4F A;  1GXR A;  4JD2 C;  5HE2 B;  3DM0 A;  5A2Q g;  2H6Q A;  4TZ4 A;  4GQ1 A;  4A08 B;  4E5Z B;  4A0A A;  3K27 A;  4D0K A;  1R5M A;  3MKS B;  5FKQ A;  3SFZ A;  2OVR B;  4A09 B;  2XL3 A;  4MK0 B;  3GRE A;  3JPX A;  4CY2 A;  5IJ7 E;  1S4U X;  4J73 A;  5EAR A;  2IAA A;  3I7P A;  2J56 H;  5IC7 A;  2YNN A;  3IIW A;  4HDJ A;  3DWL C;  4A2L A;  5IJ8 E;  4ERZ A;  3V9F A;  3PXT D;  2OIZ A;  3AL8 B;  4K3J B;  4CI1 A;  1N6E A;  3UVN A;  3J80 g;  3N0D A;  4J86 A;  2PBI B;  3SN6 B;  3FGB A;  3V7D B;  3IJC A;  2B4E A;  3RFH A;  1N6F A;  3KRW B;  4A0B A;  4A11 B;  2Z2N A;  4ZOZ A;  5GXH A;  2H9M A;  2J55 H;  2CNX A;  3PVU B;  2P9I C;  1MG3 A;  1K8K C;  1NR0 A;  5GMK n;  5GXI A;  3SLE D;  3UVL A;  3EI1 A;  4YVD A;  3FRX A;  2IUV A;  1B9X A;  2PM9 A;  2UZY B;  3JAM g;  2OVQ B;  3U4Y A;  4A09 A;  4N14 A;  2AH0 A;  4PBZ A;  3PXS D;  3OW8 A;  3MZL A;  1U4C A;  1QNI A;  4UI9 R;  5TEF A;  4NSX A;  4PSW B;  2IWK A;  2OK4 A;  4GQ2 P;  4X61 B;  5EM2 A;  3RRM C;  3VA6 A;  1XKS A;  2I3T A;  3I8C A;  5AMS A;  4A0A B;  5FA5 B;  5JWZ A;  2Z2O A;  5K19 A;  1YFQ A;  2HKR A;  4BL0 A;  3RLM D;  3JZH A;  1PGU A;  3PVW B;  4J0W A;  4L3G D;  4O45 A;  4J0X A;  4CZY A;  3I89 A;  2H14 A;  4IMM A;  1PI6 A;  2CN3 A;  3FM0 A;  4FA1 D;  5HQG A;  4AOW A;  3RFG A;  2AH1 A;  1TYQ C;  1Q47 A;  4ZOV A;  4J78 A;  3RN0 D;  2EBS A;  3J81 g;  2O9K A;  4JSX C;  3I7O A;  1A0R B;  4H5J A;  4GGD A;  1OMW B;  1XHM A;  4FA9 D;  1TBG A;  5EMM B;  3NVX A;  4U1E I;  2BCJ B;  2XYI A;  5K1C C;  1ERJ A;  4L3H D;  5FKS A;  2YB8 B;  4A0B B;  2I0T A;  4J82 A;  4JSV C;  3A0F A;  3SJL D;  3ULE C;  2CE8 A;  3E0C A;  5TF2 A;  3EI1 B;  2CO0 C;  3SMR A;  3AL9 A;  5I5J A;  4GGC A;  2HJB A;  4CC9 A;  2P9S C;  2AGZ A;  3IKO A;  2PM9 B;  4J8B A;  4Z8L A;  4CY3 A;  3I7L A;  2YBA A;  4LG9 A;  3EI4 A;  2IUP A;  3VGZ A;  3JZG A;  3PSC B;  4PC0 A;  2B5M A;  3DXM C;  4LG8 A;  5EM2 B;  2H9L A;  4GM9 A;  4KFM B;  5IGQ A;  3EWE A;  1RI6 A;  4E54 A;  4GQB B;  2HJ4 A;  3C9C A;  3C75 H;  4A7J A;  4ES0 A;  5FLX g;  1JOF A;  5HYN B;  5FKT A;  4J79 A;  1MG2 A;  3OTT A;  4FAN D;  1GG2 B;  2PM6 B;  2HKM A;  4CI2 A;  3AFC A;  5B4W A;  4OZU A;  3VH0 A;  4XEI C;  4H5I A;  2GC7 A;  4ERY A;  2H6K A;  3MKQ A;  2HYE A;  4LGN A;  2Z2P A;  5C2W B;  3BWS A;  1K32 A;  2G99 A;  2P9N C;  2TRC B;  3EI2 A;  1JJU B;  3GFC A;  2YNO A;  5HE3 B;  3DXK C;  3MXX A;  2PM7 B;  2XU7 A;  4XYH A;  3I7K A;  4CY5 A;  4FA5 D;  2AGW A;  4FHL A;  2YNP A;  4QL1 A;  3I7N A;  3UVO A;  4FB1 D;  5KDO B;  1L0Q A;  2HES X;  2H47 A;  5H14 A; 
#chains in the Genus database with same CATH topology
 3F3P A;  3EMH A;  1VE7 A;  3C5M A;  4JSN C;  3DSM A;  2UZX B;  5IGO A;  2CN2 A;  3EI4 B;  3F3G A;  4O2W A;  4ZOY A;  3SBR A;  2CO0 A;  3I2N A;  2QC5 A;  3W15 A;  4CY1 A;  2WQ8 A;  4E54 B;  4AMY A;  2QXV A;  3OKY A;  4AX4 A;  3UR4 A;  2J57 G;  3RMZ D;  3OL2 A;  4X3E A;  4NAA A;  4QT8 A;  3OF7 A;  3OKW A;  1SQJ A;  3F3F A;  2H9N A;  4L9O A;  2I0S A;  4MMZ A;  2EIC A;  4ERQ A;  2HU5 A;  4CZX A;  1PBY B;  1VZ2 A;  5AFU 3;  2H6N A;  4Y5R D;  1GOF A;  1VZ3 A;  4J77 A;  4X63 B;  1O6G A;  2GNQ A;  3IIY A;  5FQD A;  4DNW A;  3MVD K;  3ODT A;  1C9L A;  4J84 A;  3K26 A;  2H9P A;  1GOH A;  3MUN A;  3CFS B;  3UKR C;  2VDK A;  3UVM A;  4ESG A;  3SBP A;  3ZE1 A;  2GC4 A;  1VYH C;  4O1Q D;  3SHF A;  2IUQ A;  5I5I A;  2P9L C;  3EI3 A;  1XIP A;  5FKR A;  4Y7R A;  3PSL A;  3IUQ A;  3C99 A;  1JMX B;  3EI2 B;  1GP2 B;  3IUJ A;  4GGA A;  2MTA H;  1P22 A;  1E8N A;  1U2V C;  3NID A;  4J8G A;  3UVK A;  2B5L A;  3RN1 D;  2I0R A;  5EMK B;  3K72 A;  1MDA H;  5FXY A;  4EWR A;  1VE6 A;  1OLZ A;  2HXC A;  4RE6 A;  2AGX A;  2VZ3 A;  5CYK A;  4PSX B;  3V5W B;  3O4J A;  4PXW A;  2BBK H;  4NEN A;  2EID A;  4AEZ A;  4ZN4 A;  1SHY B;  4K3I D;  4XYI A;  3NVQ A;  5TDH B;  3ZE2 A;  2AGL A;  2H13 A;  3ORV D;  3O4H A;  4GM8 A;  1YR2 A;  4QRJ A;  3PXW D;  3NVN A;  4O02 A;  4WJK A;  1JMZ B;  5M5T A;  4D9S A;  5GSA A;  4R7A B;  5H1M A;  4AMZ A;  4J81 A;  4JHN A;  3CFV A;  3SBQ A;  3L4O D;  4PNK B;  4GZ8 A;  3OKY B;  2IWF A;  4JSP C;  2I3S A;  3AH8 B;  1C9I A;  3OL2 B;  4G56 B;  3SVW D;  1UTC A;  4FWW A;  4L1Q D;  3UKU C;  5C92 A;  3JRO A;  2W18 A;  1H2Z A;  4BUJ C;  3K71 A;  4WK2 A;  3MZK A;  3EU7 A;  3IJ1 A;  4U7A A;  4QAM A;  5H17 A;  4CZV A;  2YMU A;  4ZOX A;  1GOT B;  5EAP A;  4FAV D;  2VC2 A;  2CE9 A;  3L4M D;  2AGY A;  4JT5 C;  5HE1 B;  5AJA A;  5CXC B;  4A08 A;  4E5Z A;  2VDN A;  3SCY A;  5TEE A;  5SXM A;  3EI3 B;  3SXT D;  5EAL A;  5CXB B;  5I5M A;  3N0E A;  2P9K C;  3ZDZ A;  3MMY A;  2P9P C;  3IJ0 A;  3OKT A;  3CIK B;  3SWS D;  4CI8 A;  2H68 A;  4GM3 A;  4X60 B;  2VDO A;  2OK6 A;  5EAM A;  4Z7O A;  4FA4 D;  1B9Y A;  2P9U C;  3EQ8 A;  5C2V B;  4J87 A;  2IUR A;  4OWR A;  5EMJ B;  1H2W A;  4I79 A;  3EG6 A;  4PBY A;  2B5N A;  5THA A;  3I8E A;  4Z7Q A;  1N6D A;  2VDL A;  3AL8 A;  1SQ9 A;  2Q7Q A;  3HFQ A;  5CYK B;  4JXM A;  5M5U A;  3B7F A;  4IA9 A;  5C9Z B;  4QQE A;  1UOQ A;  4L1M A;  5E6U A;  2H3X A;  1NEX B;  3JB9 L;  4G1E A;  3KRX B;  5IT9 g;  5HE0 B;  3PE7 A;  1K3I A;  4NC4 A;  3BG1 A;  3V4V A;  3ZE0 A;  3I7H A;  3RSE C;  1O6F A;  4A11 A;  2JKX A;  1PEV A;  2AQ5 A;  4O3T B;  4CI3 A;  1T2X A;  3MUO A;  4BH6 A;  1FWX A;  5EML B;  3JRP A;  1UOP A;  4BCB A;  5CXC A;  3ZWL B;  3BG0 A;  2OVP B;  4GMB A;  1I2M B;  1E8M A;  2XL2 A;  3JZN A;  2G9A A;  5CXB A;  4A2M A;  1JV2 A;  4AN0 A;  4UM8 A;  4D6V A;  4O3U B;  4JT6 C;  4BCC A;  2OJY A;  4O9D A;  3P4F A;  4IRZ A;  1GXR A;  4JD2 C;  5HE2 B;  4G1M A;  1GOG A;  3DM0 A;  5A2Q g;  2H6Q A;  2VDM A;  4TZ4 A;  3K6S A;  4GQ1 A;  1H2Y A;  4A08 B;  4E5Z B;  5M5R A;  4A0A A;  3K27 A;  4WK0 A;  1A12 A;  4D0K A;  4Z7N A;  1R5M A;  3MKS B;  5FKQ A;  3SFZ A;  2OVR B;  4A09 B;  2XL3 A;  4MK0 B;  3GRE A;  3JPX A;  4CY2 A;  5IJ7 E;  1S4U X;  4J73 A;  5EAR A;  2IAA A;  3I7P A;  2J56 H;  5IC7 A;  2YNN A;  3T3M A;  3IIW A;  4MMX A;  2HU7 A;  4WK4 A;  4HDJ A;  3DWL C;  1E5T A;  4A2L A;  5IJ8 E;  4ERZ A;  3V9F A;  3PXT D;  2OIZ A;  3AL8 B;  4K3J B;  2VDP A;  4CI1 A;  1N6E A;  3UVN A;  3J80 g;  3KCI A;  3O4G A;  3IUL A;  3N0D A;  4J86 A;  2PBI B;  3SN6 B;  3FGB A;  1UOO A;  2QR5 A;  3V7D B;  3FCU A;  3IVM A;  1H2X A;  2EIE A;  3IJC A;  3GD1 I;  2B4E A;  3RFH A;  1N6F A;  3KRW B;  4A0B A;  4A11 B;  2Z2N A;  4ZOZ A;  5GXH A;  2H9M A;  2J55 H;  2CNX A;  3PVU B;  2BKL A;  2P9I C;  1MG3 A;  1K8K C;  1NR0 A;  5GMK n;  5GXI A;  3SLE D;  3UVL A;  3EI1 A;  4YVD A;  3FRX A;  2IUV A;  5C86 A;  1B9X A;  4NBM A;  2PM9 A;  2UZY B;  3JAM g;  2OVQ B;  3U4Y A;  3QHY B;  4N14 A;  4A09 A;  2AH0 A;  4PBZ A;  3PXS D;  3OW8 A;  3NIF A;  3MZL A;  1U4C A;  1QNI A;  4UI9 R;  5TEF A;  2XE4 A;  3VI4 A;  4NSX A;  4PSW B;  2IWK A;  2OK4 A;  4GQ2 P;  4X61 B;  5EM2 A;  3RRM C;  3IUR A;  3VA6 A;  1XKS A;  2I3T A;  3I8C A;  5AMS A;  4A0A B;  5FA5 B;  4BP8 A;  5JWZ A;  2Z2O A;  4G55 A;  5K19 A;  1YFQ A;  2HKR A;  4BL0 A;  2VDQ A;  3RLM D;  2VDR A;  3JZH A;  1PGU A;  3PVW B;  4J0W A;  4L3G D;  4O45 A;  4J0X A;  4CZY A;  3IUN A;  3I89 A;  2H14 A;  4IMM A;  1PI6 A;  2CN3 A;  3FM0 A;  4FA1 D;  4RE5 A;  5HQG A;  4AOW A;  1JTD B;  4DNU A;  3RFG A;  2AH1 A;  1TYQ C;  1Q47 A;  4ZOV A;  4J78 A;  3RN0 D;  2EBS A;  5E6S A;  3J81 g;  2O9K A;  4JSX C;  5HDB A;  3I7O A;  3O4I A;  1A0R B;  4H5J A;  4GGD A;  1OMW B;  1XHM A;  4FA9 D;  1TBG A;  5EMM B;  5FFO A;  2XDW A;  3QI0 A;  3NVX A;  4U1E I;  2BCJ B;  2XYI A;  5K1C C;  1ERJ A;  4L3H D;  5FKS A;  2YB8 B;  4A0B B;  5M5V A;  2I0T A;  4J82 A;  4JSV C;  3A0F A;  1QFM A;  5M61 A;  2HU8 A;  3SJL D;  3ULE C;  2CE8 A;  2EIB A;  1TYE A;  3E0C A;  5TF2 A;  3EI1 B;  2CO0 C;  3IUM A;  3SMR A;  3AL9 A;  5I5J A;  4GGC A;  2HJB A;  4CC9 A;  2P9S C;  2AGZ A;  3ZDX A;  3IKO A;  2PM9 B;  4J8B A;  5M5S A;  4Z8L A;  2VZ1 A;  4CY3 A;  2QZP A;  3I7L A;  2YBA A;  4LG9 A;  3VI3 A;  3EQ9 A;  3EI4 A;  2IUP A;  3VGZ A;  3JZG A;  3PSC B;  4AN1 A;  4PC0 A;  2B5M A;  3DXM C;  4LG8 A;  5EM2 B;  2H9L A;  4GM9 A;  4KFM B;  5IGQ A;  3EWE A;  1RI6 A;  4E54 A;  4GQB B;  2HJ4 A;  3GC3 B;  3C9C A;  1M1X A;  3C75 H;  4A7J A;  4ES0 A;  5FLX g;  1JOF A;  5HYN B;  4BP9 A;  5FKT A;  4J79 A;  4UM9 A;  1MG2 A;  3OTT A;  3NIG A;  4FAN D;  1GG2 B;  2PM6 B;  2HKM A;  4CI2 A;  1L5G A;  3AFC A;  5B4W A;  4OZU A;  3VH0 A;  1BPO A;  4JHP C;  5FFG A;  4XEI C;  4H5I A;  3FCS A;  2GC7 A;  3V4P A;  4ERY A;  2H6K A;  3MKQ A;  5E6R A;  2HYE A;  4LGN A;  2Z2P A;  5C2W B;  3DDU A;  2XZG A;  3BWS A;  1K32 A;  2G99 A;  2P9N C;  2TRC B;  3EI2 A;  1U8C A;  1JJU B;  3GFC A;  2YNO A;  5HE3 B;  3T3P A;  3DXK C;  3MXX A;  2PM7 B;  2XU7 A;  4XYH A;  3I7K A;  4CY5 A;  4FA5 D;  2AGW A;  4FHL A;  2YNP A;  4BCD A;  4QL1 A;  3I7N A;  3UVO A;  3ZDY A;  4FB1 D;  5KDO B;  1QFS A;  4DNV A;  3IJE A;  3EQ7 A;  1L0Q A;  4MMY A;  2HES X;  2H47 A;  5H14 A; 
#chains in the Genus database with same CATH homology
 3F3P A;  3EMH A;  3C5M A;  4JSN C;  3DSM A;  2UZX B;  5IGO A;  2CN2 A;  3EI4 B;  3F3G A;  4ZOY A;  3SBR A;  2CO0 A;  3I2N A;  2QC5 A;  3W15 A;  4CY1 A;  4E54 B;  2QXV A;  3OKY A;  3UR4 A;  2J57 G;  3RMZ D;  3OL2 A;  4X3E A;  4QT8 A;  3OKW A;  1SQJ A;  3F3F A;  2H9N A;  4L9O A;  2I0S A;  4ERQ A;  4CZX A;  1PBY B;  5AFU 3;  2H6N A;  4Y5R D;  4J77 A;  4X63 B;  2GNQ A;  3IIY A;  5FQD A;  3ODT A;  4J84 A;  3K26 A;  2H9P A;  3UKR C;  3CFS B;  3UVM A;  4ESG A;  3SBP A;  2GC4 A;  1VYH C;  4O1Q D;  3SHF A;  2IUQ A;  5I5I A;  2P9L C;  3EI3 A;  1XIP A;  5FKR A;  4Y7R A;  3PSL A;  3C99 A;  1JMX B;  3EI2 B;  1GP2 B;  4GGA A;  2MTA H;  1P22 A;  1U2V C;  4J8G A;  3UVK A;  2B5L A;  3RN1 D;  2I0R A;  5EMK B;  1MDA H;  5FXY A;  4EWR A;  1OLZ A;  2HXC A;  2AGX A;  5CYK A;  4PSX B;  3V5W B;  4PXW A;  2BBK H;  4AEZ A;  4ZN4 A;  1SHY B;  4K3I D;  4XYI A;  3NVQ A;  5TDH B;  2AGL A;  2H13 A;  3ORV D;  4GM8 A;  4QRJ A;  3PXW D;  3NVN A;  1JMZ B;  5GSA A;  4R7A B;  5H1M A;  4J81 A;  3SBQ A;  3CFV A;  3L4O D;  4PNK B;  4GZ8 A;  3OKY B;  2IWF A;  4JSP C;  2I3S A;  3AH8 B;  3OL2 B;  4G56 B;  3SVW D;  4FWW A;  4L1Q D;  3UKU C;  3JRO A;  2W18 A;  4BUJ C;  3MZK A;  3EU7 A;  3IJ1 A;  4U7A A;  5H17 A;  4CZV A;  2YMU A;  4ZOX A;  1GOT B;  5EAP A;  4FAV D;  2CE9 A;  3L4M D;  2AGY A;  4JT5 C;  5HE1 B;  5AJA A;  5CXC B;  4A08 A;  4E5Z A;  3SCY A;  5TEE A;  5SXM A;  3EI3 B;  3SXT D;  5EAL A;  5CXB B;  5I5M A;  3N0E A;  2P9K C;  3MMY A;  2P9P C;  3IJ0 A;  3OKT A;  3CIK B;  3SWS D;  4CI8 A;  2H68 A;  4GM3 A;  4X60 B;  2OK6 A;  5EAM A;  4FA4 D;  1B9Y A;  2P9U C;  5C2V B;  4J87 A;  2IUR A;  4OWR A;  5EMJ B;  4I79 A;  3EG6 A;  4PBY A;  2B5N A;  5THA A;  3I8E A;  1N6D A;  3AL8 A;  1SQ9 A;  2Q7Q A;  3HFQ A;  5CYK B;  4JXM A;  3B7F A;  4IA9 A;  5C9Z B;  4QQE A;  2H3X A;  1NEX B;  3JB9 L;  3KRX B;  5IT9 g;  5HE0 B;  3PE7 A;  3BG1 A;  3I7H A;  3RSE C;  4A11 A;  1PEV A;  2AQ5 A;  4O3T B;  4CI3 A;  4BH6 A;  1FWX A;  5EML B;  3JRP A;  5CXC A;  3ZWL B;  3BG0 A;  2OVP B;  4GMB A;  2XL2 A;  3JZN A;  2G9A A;  5CXB A;  4A2M A;  4D6V A;  4O3U B;  4JT6 C;  2OJY A;  4O9D A;  3P4F A;  1GXR A;  4JD2 C;  5HE2 B;  3DM0 A;  5A2Q g;  2H6Q A;  4TZ4 A;  4GQ1 A;  4A08 B;  4E5Z B;  4A0A A;  3K27 A;  4D0K A;  1R5M A;  3MKS B;  5FKQ A;  3SFZ A;  2OVR B;  4A09 B;  2XL3 A;  4MK0 B;  3GRE A;  3JPX A;  4CY2 A;  5IJ7 E;  1S4U X;  4J73 A;  5EAR A;  2IAA A;  3I7P A;  2J56 H;  5IC7 A;  2YNN A;  3IIW A;  4HDJ A;  3DWL C;  4A2L A;  5IJ8 E;  4ERZ A;  3V9F A;  3PXT D;  2OIZ A;  3AL8 B;  4K3J B;  4CI1 A;  1N6E A;  3UVN A;  3J80 g;  3N0D A;  4J86 A;  2PBI B;  3SN6 B;  3FGB A;  3V7D B;  3IJC A;  2B4E A;  3RFH A;  1N6F A;  3KRW B;  4A0B A;  4A11 B;  2Z2N A;  4ZOZ A;  5GXH A;  2H9M A;  2J55 H;  2CNX A;  3PVU B;  2P9I C;  1MG3 A;  1K8K C;  1NR0 A;  5GMK n;  5GXI A;  3SLE D;  3UVL A;  3EI1 A;  4YVD A;  3FRX A;  2IUV A;  1B9X A;  2PM9 A;  2UZY B;  3JAM g;  2OVQ B;  3U4Y A;  4A09 A;  4N14 A;  2AH0 A;  4PBZ A;  3PXS D;  3OW8 A;  3MZL A;  1U4C A;  1QNI A;  4UI9 R;  5TEF A;  4NSX A;  4PSW B;  2IWK A;  2OK4 A;  4GQ2 P;  4X61 B;  5EM2 A;  3RRM C;  3VA6 A;  1XKS A;  2I3T A;  3I8C A;  5AMS A;  4A0A B;  5FA5 B;  5JWZ A;  2Z2O A;  5K19 A;  1YFQ A;  2HKR A;  4BL0 A;  3RLM D;  3JZH A;  1PGU A;  3PVW B;  4J0W A;  4L3G D;  4O45 A;  4J0X A;  4CZY A;  3I89 A;  2H14 A;  4IMM A;  1PI6 A;  2CN3 A;  3FM0 A;  4FA1 D;  5HQG A;  4AOW A;  3RFG A;  2AH1 A;  1TYQ C;  1Q47 A;  4ZOV A;  4J78 A;  3RN0 D;  2EBS A;  3J81 g;  2O9K A;  4JSX C;  3I7O A;  1A0R B;  4H5J A;  4GGD A;  1OMW B;  1XHM A;  4FA9 D;  1TBG A;  5EMM B;  3NVX A;  4U1E I;  2BCJ B;  2XYI A;  5K1C C;  1ERJ A;  4L3H D;  5FKS A;  2YB8 B;  4A0B B;  2I0T A;  4J82 A;  4JSV C;  3A0F A;  3SJL D;  3ULE C;  2CE8 A;  3E0C A;  5TF2 A;  3EI1 B;  2CO0 C;  3SMR A;  3AL9 A;  5I5J A;  4GGC A;  2HJB A;  4CC9 A;  2P9S C;  2AGZ A;  3IKO A;  2PM9 B;  4J8B A;  4Z8L A;  4CY3 A;  3I7L A;  2YBA A;  4LG9 A;  3EI4 A;  2IUP A;  3VGZ A;  3JZG A;  3PSC B;  4PC0 A;  2B5M A;  3DXM C;  4LG8 A;  5EM2 B;  2H9L A;  4GM9 A;  4KFM B;  5IGQ A;  3EWE A;  1RI6 A;  4E54 A;  4GQB B;  2HJ4 A;  3C9C A;  3C75 H;  4A7J A;  4ES0 A;  5FLX g;  1JOF A;  5HYN B;  5FKT A;  4J79 A;  1MG2 A;  3OTT A;  4FAN D;  1GG2 B;  2PM6 B;  2HKM A;  4CI2 A;  3AFC A;  5B4W A;  4OZU A;  3VH0 A;  4XEI C;  4H5I A;  2GC7 A;  4ERY A;  2H6K A;  3MKQ A;  2HYE A;  4LGN A;  2Z2P A;  5C2W B;  3BWS A;  1K32 A;  2G99 A;  2P9N C;  2TRC B;  3EI2 A;  1JJU B;  3GFC A;  2YNO A;  5HE3 B;  3DXK C;  3MXX A;  2PM7 B;  2XU7 A;  4XYH A;  3I7K A;  4CY5 A;  4FA5 D;  2AGW A;  4FHL A;  2YNP A;  4QL1 A;  3I7N A;  3UVO A;  4FB1 D;  5KDO B;  1L0Q A;  2HES X;  2H47 A;  5H14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...