3RLMD

Structure of the w199f maug/pre-methylamine dehydrogenase complex after treatment with hydrogen peroxide
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Mutagenesis of tryptophan199 suggests that hopping is required for MauG-dependent tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 93
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3rlmD00
2H6QA 5EM2A 2H14A 2H9PA 5KDOB 5EMJB 3PSCB 2IUVA 5FKTA 4TZ4A 1SQ9A 1PGUA 3JAMg 1PEVA 2AGYA 5THAA 3I89A 4GZ8A 3SCYA 3EI2B 4ZN4A 4A7JA 4G56B 4HDJA 4GM9A 1L0QA 1Q47A 1NEXB 4XEIC 3KRXB 3OL2A 5I5MA 3F3PA 3PVWB 2TRCB 4YVDA 5TF2A 4OWRA 4XYHA 4GQ1A 3GREA 3ODTA 1ERJA 3UVLA 2GC7A 3F3GA 3DXMC 4CC9A 5EM2B 4JSNC 2G99A 4IMMA 3IJ0A 2H6KA 5GMKn 4X60B 1QNIA 4CZXA 2HJBA 4J73A 4FB1D 3OTTA 2B5MA 3ORVD 3AL9A 4GM8A 3SBRA 4QT8A 4ERZA 3PSLA 5HE2B 4FWWA 4UI9R 1NR0A 3FM0A 3BG1A 5CXCA 2Z2NA 4E5ZA 2H9NA 5K19A 4FA5D 4JT5C 5A2Qg 4Z8LA 3EU7A 3JB9L 2AGZA 2HJ4A 1SHYB 3OKYA 4L3HD 3V9FA 2H9LA 2PBIB 3RN0D 4LG8A 4GQBB 4QRJA 3OL2B 4CY3A 1GP2B 4A09A 1N6EA 4IA9A 3SN6B 3SVWD 4CI8A 3A0FA 4N14A 3IIYA 4O9DA 4CZVA 5AFU3 2YNPA 2J55H 3IJ1A 5EARA 3SFZA 5EAMA 5AJAA 2QC5A 3ZWLB 4EWRA 2HESX 2IUQA 3IIWA 3RFHA 4AEZA 3IKOA 4JT6C 3DSMA 1YFQA 3MXXA 4U1EI 2PM7B 5GSAA 3RSEC 3ULEC 2W18A 3DXKC 4O1QD 3MMYA 3UVMA 4PNKB 3EI1B 5K1CC 2I3TA 3RN1D 3GFCA 5CXCB 3RLMD 4JD2C 3CIKB 2IURA 4E5ZB 2Z2PA 4GGDA 4ESGA 2MTAH 2OVRB 1MG2A 3OKYB 1MG3A 4LG9A 4O3TB 3PXWD 2YB8B 4J77A 1TYQC 5HE3B 5IJ8E 2IAAA 2I0RA 4Y5RD 3NVXA 5TEFA 4BUJC 2OVPB 4A2MA 3VA6A 2PM9A 5FLXg 4A09B 1XKSA 1N6FA 3RRMC 4J0XA 4JSXC 2H3XA 4ERQA 3K26A 5GXHA 3C75H 4BL0A 5EMKB 3OW8A 4ZOXA 3I8CA 3IJCA 5EAPA 2IUPA 2OIZA 4QQEA 1JOFA 3I7KA 2YBAA 5EMMB 2I0SA 5EALA 4BH6A 3I8EA 2CO0C 3RMZD 2IWKA 4A2LA 2B4EA 3NVQA 3V5WB 3JROA 4ZOYA 5SXMA 5FKQA 4CY1A 3SJLD 3EI4A 1SQJA 4R7AB 3MKQA 2Z2OA 3VGZA 3PXSD 1B9YA 1R5MA 2I3SA 3EWEA 4JXMA 4J84A 1N6DA 5B4WA 2PM9B 3PVUB 2HKMA 1XHMA 4J79A 2J56H 3K27A 5HYNB 3J81g 3EI1A 3BWSA 3MKSB 4CZYA 3C9CA 4PC0A 3CFSB 4JSPC 3N0DA 1RI6A 4NSXA 3SBQA 3JRPA 1GOTB 2YMUA 3UKUC 4H5IA 3C99A 1K32A 1P22A 2OJYA 4K3ID 5C2WB 2B5NA 3EG6A 3MZKA 3EI4B 3UR4A 4CI2A 4I79A 4MK0B 4QL1A 2PM6B 5IGOA 5IT9g 2H47A 4X61B 2CN2A 1JMZB 4A08A 4A11A 3PXTD 4E54B 2IWFA 5CXBA 4LGNA 3C5MA 5FKRA 1XIPA 4ES0A 3FRXA 5HQGA 4FAVD 1GXRA 2P9LC 5C2VB 3V7DB 2G9AA 5CYKA 4CY5A 5H1MA 2P9NC 5IJ7E 4CI3A 2H9MA 3JZHA 2OK4A 2AH1A 4J0WA 4FA9D 3HFQA 3I7HA 3E0CA 3OKWA 1TBGA 3NVNA 3JZNA 4PSXB 2UZXB 2P9IC 2H13A 5AMSA 4Y7RA 5H14A 4CY2A 3VH0A 1A0RB 3I2NA 4GM3A 3L4OD 3EMHA 2B5LA 4J8GA 2AH0A 4ZOZA 4A08B 5TEEA 4A11B 5IC7A 2HXCA 3SLED 5CXBB 2H6NA 3PE7A 4PBYA 1U4CA 2P9UC 3W15A 4O3UB 5FKSA 1GG2B 5FXYA 1S4UX 4XYIA 3KRWB 2CE9A 5I5IA 3SXTD 3JPXA 2OVQB 3J80g 5EMLB 5CYKB 3UKRC 2XL2A 4GMBA 2YNNA 4A0BA 2AGWA 4OZUA 5TDHB 3UVKA 1B9XA 4CI1A 2AGXA 3UVNA 3I7PA 4E54A 2HYEA 2GNQA 3SMRA 2I0TA 2H68A 2BBKH 2UZYB 1MDAH 4GGCA 4L1QD 4D6VA 3DWLC 3EI3A 5I5JA 4ERYA 4A0AA 3JZGA 3UVOA 3SHFA 4J81A 5H17A 2QXVA 4D0KA 2P9PC 3AFCA 5IGQA 4U7AA 5HE1B 4X3EA 2P9KC 5C9ZB 1PBYB 3F3FA 3I7NA 3AL8A 3AH8B 5GXIA 3N0EA 1VYHC 1JJUB 4H5JA 3U4YA 4J82A 5JWZA 4J87A 2EBSA 3MZLA 4A0BB 4FA1D 1JMXB 3FGBA 2J57G 4FAND 3OKTA 1U2VC 3CFVA 2XYIA 4ZOVA 2O9KA 4PBZA 4JSVC 3B7FA 4L9OA 3I7OA 2XL3A 4FHLA 4X63B 4J78A 2CNXA 3SWSD 2CE8A 1OLZA 3EI3B 2BCJB 4A0AB 2CO0A 4PSWB 1OMWB 2P9SC 4J86A 3SBPA 2HKRA 3EI2A 1K8KC 4J8BA 4O45A 3DM0A 4FA4D 2XU7A 2Q7QA 1PI6A 4GQ2P 5FA5B 5FQDA 5HE0B 4GGAA 4AOWA 3AL8B 4PXWA 3L4MD 3P4FA 4L3GD 2CN3A 3RFGA 3BG0A 2OK6A 2YNOA 4K3JB 2AQ5A 3I7LA 1FWXA 4KFMB 2GC4A 2AGLA
chains in the Genus database with same CATH superfamily
5FFGA 2H6QA 5EM2A 1UOQA 2H14A 5C92A 4RE5A 2H9PA 5KDOB 5EMJB 3PSCB 2IUVA 5FKTA 4TZ4A 3IVMA 1SQ9A 1PGUA 3JAMg 1PEVA 2AGYA 5THAA 3I89A 4GZ8A 2VZ3A 3SCYA 3EI2B 2VZ1A 4ZN4A 4A7JA 3IUJA 4G56B 4IRZA 4HDJA 3T3MA 4GM9A 1L0QA 1Q47A 1NEXB 4NAAA 4XEIC 3KRXB 4G55A 3OL2A 4DNVA 5I5MA 3F3PA 2HU7A 3MUNA 3PVWB 2TRCB 3IJEA 4YVDA 5TF2A 3IUMA 2XE4A 4OWRA 4GQ1A 4XYHA 3GREA 3ODTA 4BCBA 1BPOA 1ERJA 3VI3A 3K6SA 3UVLA 2GC7A 3F3GA 3DXMC 4CC9A 5EM2B 4JSNC 2G99A 4IMMA 3ZDZA 3IJ0A 2H6KA 3T3PA 5GMKn 4X60B 1QNIA 4CZXA 2BKLA 2HJBA 4J73A 4FB1D 3OTTA 2B5MA 3ORVD 1QFMA 1E8NA 1K3IA 3AL9A 4GM8A 3SBRA 4QT8A 4ERZA 3PSLA 1U8CA 5HE2B 1H2XA 4FWWA 1JV2A 4UI9R 1NR0A 3ZE0A 3FM0A 2XZGA 3BG1A 5CXCA 2Z2NA 4E5ZA 2H9NA 5K19A 4FA5D 4JT5C 5A2Qg 4Z8LA 3EU7A 3EQ8A 3JB9L 2AGZA 2HJ4A 1SHYB 3OKYA 4L3HD 3V9FA 2H9LA 2PBIB 1O6GA 1JTDB 1TYEA 4NBMA 3RN0D 4LG8A 3ZE2A 2XDWA 3OF7A 4GQBB 4QRJA 3EQ9A 3OL2B 2WQ8A 4CY3A 4DNWA 1GP2B 4A09A 1N6EA 4IA9A 3SN6B 3SVWD 4CI8A 5M5TA 3A0FA 4N14A 3IIYA 4O9DA 4CZVA 5AFU3 4MMYA 1GOHA 2YNPA 2J55H 3IJ1A 5EARA 3SFZA 5EAMA 2EIEA 1E8MA 2QC5A 5AJAA 3ZWLB 4EWRA 2HESX 5E6SA 2IUQA 3ZDYA 3IIWA 3RFHA 4AEZA 3IKOA 1C9LA 4JT6C 3DSMA 1YFQA 3QI0A 3MXXA 4U1EI 2PM7B 5GSAA 3RSEC 3ULEC 2W18A 3DXKC 1O6FA 4O1QD 3MMYA 3UVMA 4PNKB 3EI1B 5K1CC 4JHPC 2I3TA 3RN1D 3GFCA 5CXCB 3RLMD 4JD2C 3CIKB 2IURA 4E5ZB 2Z2PA 4GGDA 4ESGA 2MTAH 2OVRB 1MG2A 2VDQA 3OKYB 1MG3A 4LG9A 4O3TB 3PXWD 2YB8B 4J77A 1TYQC 5HE3B 5IJ8E 2IAAA 2I0RA 4Y5RD 3NVXA 5TEFA 4BUJC 2OVPB 4A2MA 3VA6A 2PM9A 5FLXg 1VE6A 1VE7A 3K71A 4A09B 4L1MA 1XKSA 1N6FA 3RRMC 1E5TA 4J0XA 4JSXC 2H3XA 4ERQA 3K26A 5GXHA 3C75H 4BL0A 1UTCA 5EMKB 3OW8A 4ZOXA 3I8CA 3IJCA 5EAPA 2IUPA 2OIZA 4QQEA 1JOFA 3I7KA 2YBAA 5EMMB 2I0SA 5EALA 4BH6A 3I8EA 2CO0C 3RMZD 4NENA 2IWKA 2QR5A 2EIDA 3EQ7A 4A2LA 2B4EA 3NVQA 3MVDK 3V5WB 1GOFA 3JROA 1I2MB 1VZ2A 4DNUA 4ZOYA 5M5VA 5SXMA 4WK2A 5FKQA 4CY1A 3KCIA 3SJLD 3EI4A 1SQJA 4R7AB 3MKQA 2Z2OA 3VGZA 3PXSD 1B9YA 1R5MA 2I3SA 3EWEA 4JXMA 4J84A 1N6DA 5B4WA 2PM9B 4G1EA 3PVUB 2HKMA 1XHMA 5HDBA 4J79A 3IURA 2J56H 3K27A 4BP9A 5HYNB 3V4VA 3J81g 3EI1A 3BWSA 3MKSB 4CZYA 3C9CA 4PC0A 3CFSB 4JSPC 4BP8A 3N0DA 1RI6A 2VDPA 4NSXA 3SBQA 3JRPA 1GOTB 2YMUA 3NIDA 3UKUC 4H5IA 1H2ZA 3GD1I 1T2XA 3C99A 1K32A 1P22A 2OJYA 4K3ID 5C2WB 2B5NA 5E6RA 3IUQA 3EG6A 3MZKA 3EI4B 3UR4A 4CI2A 3IULA 4I79A 4MK0B 4QL1A 2PM6B 2VDOA 5IGOA 5IT9g 2H47A 4X61B 2CN2A 1JMZB 4A08A 2VDKA 4A11A 3PXTD 4E54B 2QZPA 2IWFA 5CXBA 1QFSA 4LGNA 3C5MA 5FKRA 3O4IA 1XIPA 4ES0A 3FRXA 5HQGA 3V4PA 4FAVD 3DDUA 1GXRA 2P9LC 5C2VB 3V7DB 5M5UA 2G9AA 5CYKA 2VC2A 4JHNA 5H1MA 2P9NC 4CY5A 4CI3A 5IJ7E 2H9MA 3O4GA 3JZHA 4BCCA 2OK4A 4Z7QA 2AH1A 4J0WA 3MUOA 4O02A 4FA9D 3HFQA 3I7HA 3E0CA 2VDRA 3OKWA 1TBGA 3NVNA 1UOOA 3JZNA 4PSXB 4AX4A 2UZXB 2P9IC 2H13A 5AMSA 4Y7RA 3O4JA 4QAMA 2VDMA 4D9SA 5H14A 3IUNA 4WJKA 4CY2A 3VH0A 1A0RB 3I2NA 3NIFA 4GM3A 3L4OD 3EMHA 2B5LA 2VDLA 4RE6A 4J8GA 2AH0A 2EIBA 3QHYB 4ZOZA 2JKXA 4A08B 5TEEA 4A11B 5IC7A 2HXCA 1H2YA 3SLED 5CXBB 2HU8A 2H6NA 3PE7A 4PBYA 1U4CA 1GOGA 2P9UC 3W15A 4O3UB 5FKSA 3ZE1A 1GG2B 5FXYA 1S4UX 4XYIA 3KRWB 2CE9A 3FCSA 5I5IA 3SXTD 3JPXA 2OVQB 1YR2A 3J80g 5EMLB 5CYKB 4MMXA 3UKRC 3ZDXA 2XL2A 4Z7NA 4GMBA 2YNNA 4A0BA 2AGWA 4OZUA 5TDHB 3UVKA 1B9XA 3VI4A 4CI1A 2AGXA 3UVNA 3I7PA 4AMZA 4E54A 2HYEA 2GNQA 3SMRA 2I0TA 2H68A 2BBKH 2UZYB 1MDAH 4GGCA 4L1QD 4D6VA 3DWLC 1L5GA 3EI3A 5I5JA 4ERYA 4A0AA 3K72A 3JZGA 3UVOA 3SHFA 4J81A 5H17A 2QXVA 4D0KA 2P9PC 2VDNA 3AFCA 5IGQA 4MMZA 4U7AA 5HE1B 5M5SA 4X3EA 4NC4A 2P9KC 5C9ZB 1PBYB 4BCDA 1C9IA 3F3FA 1M1XA 3I7NA 3AL8A 3AH8B 4WK0A 5GXIA 3N0EA 1VYHC 1JJUB 4H5JA 3U4YA 4J82A 5JWZA 4J87A 2EBSA 3MZLA 4A0BB 4FA1D 1JMXB 3FGBA 3NIGA 2J57G 4FAND 1A12A 3OKTA 2HU5A 1U2VC 3CFVA 2XYIA 4ZOVA 2O9KA 5FFOA 5M61A 4PBZA 4JSVC 3B7FA 4L9OA 5E6UA 3I7OA 1H2WA 2XL3A 4FHLA 4X63B 4J78A 1UOPA 2CNXA 4O2WA 3SWSD 2CE8A 1OLZA 3EI3B 2BCJB 4A0AB 2CO0A 3FCUA 4PSWB 1OMWB 2P9SC 3GC3B 4J86A 3SBPA 2HKRA 3EI2A 1K8KC 1VZ3A 2EICA 4AMYA 4J8BA 4O45A 3O4HA 4WK4A 3DM0A 4FA4D 2XU7A 4G1MA 4AN0A 2Q7QA 1PI6A 4GQ2P 5FA5B 5FQDA 5HE0B 4GGAA 4AOWA 3AL8B 4PXWA 3L4MD 3P4FA 5M5RA 4L3GD 2CN3A 3RFGA 3BG0A 2OK6A 2YNOA 4K3JB 2AQ5A 3I7LA 1FWXA 4UM9A 4KFMB 4AN1A 5C86A 2GC4A 2AGLA 4UM8A 4Z7OA
chains in the Genus database with same CATH topology
2H6QA 5EM2A 2H14A 2H9PA 5KDOB 5EMJB 3PSCB 2IUVA 5FKTA 4TZ4A 1SQ9A 1PGUA 3JAMg 1PEVA 2AGYA 5THAA 3I89A 4GZ8A 3SCYA 3EI2B 4ZN4A 4A7JA 4G56B 4HDJA 4GM9A 1L0QA 1Q47A 1NEXB 4XEIC 3KRXB 3OL2A 5I5MA 3F3PA 3PVWB 2TRCB 4YVDA 5TF2A 4OWRA 4XYHA 4GQ1A 3GREA 3ODTA 1ERJA 3UVLA 2GC7A 3F3GA 3DXMC 4CC9A 5EM2B 4JSNC 2G99A 4IMMA 3IJ0A 2H6KA 5GMKn 4X60B 1QNIA 4CZXA 2HJBA 4J73A 4FB1D 3OTTA 2B5MA 3ORVD 3AL9A 4GM8A 3SBRA 4QT8A 4ERZA 3PSLA 5HE2B 4FWWA 4UI9R 1NR0A 3FM0A 3BG1A 5CXCA 2Z2NA 4E5ZA 2H9NA 5K19A 4FA5D 4JT5C 5A2Qg 4Z8LA 3EU7A 3JB9L 2AGZA 2HJ4A 1SHYB 3OKYA 4L3HD 3V9FA 2H9LA 2PBIB 3RN0D 4LG8A 4GQBB 4QRJA 3OL2B 4CY3A 1GP2B 4A09A 1N6EA 4IA9A 3SN6B 3SVWD 4CI8A 3A0FA 4N14A 3IIYA 4O9DA 4CZVA 5AFU3 2YNPA 2J55H 3IJ1A 5EARA 3SFZA 5EAMA 5AJAA 2QC5A 3ZWLB 4EWRA 2HESX 2IUQA 3IIWA 3RFHA 4AEZA 3IKOA 4JT6C 3DSMA 1YFQA 3MXXA 4U1EI 2PM7B 5GSAA 3RSEC 3ULEC 2W18A 3DXKC 4O1QD 3MMYA 3UVMA 4PNKB 3EI1B 5K1CC 2I3TA 3RN1D 3GFCA 5CXCB 3RLMD 4JD2C 3CIKB 2IURA 4E5ZB 2Z2PA 4GGDA 4ESGA 2MTAH 2OVRB 1MG2A 3OKYB 1MG3A 4LG9A 4O3TB 3PXWD 2YB8B 4J77A 1TYQC 5HE3B 5IJ8E 2IAAA 2I0RA 4Y5RD 3NVXA 5TEFA 4BUJC 2OVPB 4A2MA 3VA6A 2PM9A 5FLXg 4A09B 1XKSA 1N6FA 3RRMC 4J0XA 4JSXC 2H3XA 4ERQA 3K26A 5GXHA 3C75H 4BL0A 5EMKB 3OW8A 4ZOXA 3I8CA 3IJCA 5EAPA 2IUPA 2OIZA 4QQEA 1JOFA 3I7KA 2YBAA 5EMMB 2I0SA 5EALA 4BH6A 3I8EA 2CO0C 3RMZD 2IWKA 4A2LA 2B4EA 3NVQA 3V5WB 3JROA 4ZOYA 5SXMA 5FKQA 4CY1A 3SJLD 3EI4A 1SQJA 4R7AB 3MKQA 2Z2OA 3VGZA 3PXSD 1B9YA 1R5MA 2I3SA 3EWEA 4JXMA 4J84A 1N6DA 5B4WA 2PM9B 3PVUB 2HKMA 1XHMA 4J79A 2J56H 3K27A 5HYNB 3J81g 3EI1A 3BWSA 3MKSB 4CZYA 3C9CA 4PC0A 3CFSB 4JSPC 3N0DA 1RI6A 4NSXA 3SBQA 3JRPA 1GOTB 2YMUA 3UKUC 4H5IA 3C99A 1K32A 1P22A 2OJYA 4K3ID 5C2WB 2B5NA 3EG6A 3MZKA 3EI4B 3UR4A 4CI2A 4I79A 4MK0B 4QL1A 2PM6B 5IGOA 5IT9g 2H47A 4X61B 2CN2A 1JMZB 4A08A 4A11A 3PXTD 4E54B 2IWFA 5CXBA 4LGNA 3C5MA 5FKRA 1XIPA 4ES0A 3FRXA 5HQGA 4FAVD 1GXRA 2P9LC 5C2VB 3V7DB 2G9AA 5CYKA 4CY5A 5H1MA 2P9NC 5IJ7E 4CI3A 2H9MA 3JZHA 2OK4A 2AH1A 4J0WA 4FA9D 3HFQA 3I7HA 3E0CA 3OKWA 1TBGA 3NVNA 3JZNA 4PSXB 2UZXB 2P9IC 2H13A 5AMSA 4Y7RA 5H14A 4CY2A 3VH0A 1A0RB 3I2NA 4GM3A 3L4OD 3EMHA 2B5LA 4J8GA 2AH0A 4ZOZA 4A08B 5TEEA 4A11B 5IC7A 2HXCA 3SLED 5CXBB 2H6NA 3PE7A 4PBYA 1U4CA 2P9UC 3W15A 4O3UB 5FKSA 1GG2B 5FXYA 1S4UX 4XYIA 3KRWB 2CE9A 5I5IA 3SXTD 3JPXA 2OVQB 3J80g 5EMLB 5CYKB 3UKRC 2XL2A 4GMBA 2YNNA 4A0BA 2AGWA 4OZUA 5TDHB 3UVKA 1B9XA 4CI1A 2AGXA 3UVNA 3I7PA 4E54A 2HYEA 2GNQA 3SMRA 2I0TA 2H68A 2BBKH 2UZYB 1MDAH 4GGCA 4L1QD 4D6VA 3DWLC 3EI3A 5I5JA 4ERYA 4A0AA 3JZGA 3UVOA 3SHFA 4J81A 5H17A 2QXVA 4D0KA 2P9PC 3AFCA 5IGQA 4U7AA 5HE1B 4X3EA 2P9KC 5C9ZB 1PBYB 3F3FA 3I7NA 3AL8A 3AH8B 5GXIA 3N0EA 1VYHC 1JJUB 4H5JA 3U4YA 4J82A 5JWZA 4J87A 2EBSA 3MZLA 4A0BB 4FA1D 1JMXB 3FGBA 2J57G 4FAND 3OKTA 1U2VC 3CFVA 2XYIA 4ZOVA 2O9KA 4PBZA 4JSVC 3B7FA 4L9OA 3I7OA 2XL3A 4FHLA 4X63B 4J78A 2CNXA 3SWSD 2CE8A 1OLZA 3EI3B 2BCJB 4A0AB 2CO0A 4PSWB 1OMWB 2P9SC 4J86A 3SBPA 2HKRA 3EI2A 1K8KC 4J8BA 4O45A 3DM0A 4FA4D 2XU7A 2Q7QA 1PI6A 4GQ2P 5FA5B 5FQDA 5HE0B 4GGAA 4AOWA 3AL8B 4PXWA 3L4MD 3P4FA 4L3GD 2CN3A 3RFGA 3BG0A 2OK6A 2YNOA 4K3JB 2AQ5A 3I7LA 1FWXA 4KFMB 2GC4A 2AGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H6Q A;  5EM2 A;  2H14 A;  2H9P A;  5KDO B;  5EMJ B;  3PSC B;  2IUV A;  5FKT A;  4TZ4 A;  1SQ9 A;  1PGU A;  3JAM g;  1PEV A;  2AGY A;  5THA A;  3I89 A;  4GZ8 A;  3SCY A;  3EI2 B;  4ZN4 A;  4A7J A;  4G56 B;  4HDJ A;  4GM9 A;  1L0Q A;  1Q47 A;  1NEX B;  4XEI C;  3KRX B;  3OL2 A;  5I5M A;  3F3P A;  3PVW B;  2TRC B;  4YVD A;  5TF2 A;  4OWR A;  4XYH A;  4GQ1 A;  3GRE A;  3ODT A;  1ERJ A;  3UVL A;  2GC7 A;  3F3G A;  3DXM C;  4CC9 A;  5EM2 B;  4JSN C;  2G99 A;  4IMM A;  3IJ0 A;  2H6K A;  5GMK n;  4X60 B;  1QNI A;  4CZX A;  2HJB A;  4J73 A;  4FB1 D;  3OTT A;  2B5M A;  3ORV D;  3AL9 A;  4GM8 A;  3SBR A;  4QT8 A;  4ERZ A;  3PSL A;  5HE2 B;  4FWW A;  4UI9 R;  1NR0 A;  3FM0 A;  3BG1 A;  5CXC A;  2Z2N A;  4E5Z A;  2H9N A;  5K19 A;  4FA5 D;  4JT5 C;  5A2Q g;  4Z8L A;  3EU7 A;  3JB9 L;  2AGZ A;  2HJ4 A;  1SHY B;  3OKY A;  4L3H D;  3V9F A;  2H9L A;  2PBI B;  3RN0 D;  4LG8 A;  4GQB B;  4QRJ A;  3OL2 B;  4CY3 A;  1GP2 B;  4A09 A;  1N6E A;  4IA9 A;  3SN6 B;  3SVW D;  4CI8 A;  3A0F A;  4N14 A;  3IIY A;  4O9D A;  4CZV A;  5AFU 3;  2YNP A;  2J55 H;  3IJ1 A;  5EAR A;  3SFZ A;  5EAM A;  5AJA A;  2QC5 A;  3ZWL B;  4EWR A;  2HES X;  2IUQ A;  3IIW A;  3RFH A;  4AEZ A;  3IKO A;  4JT6 C;  3DSM A;  1YFQ A;  3MXX A;  4U1E I;  2PM7 B;  5GSA A;  3RSE C;  3ULE C;  2W18 A;  3DXK C;  4O1Q D;  3MMY A;  3UVM A;  4PNK B;  3EI1 B;  5K1C C;  2I3T A;  3RN1 D;  3GFC A;  5CXC B;  3RLM D;  4JD2 C;  3CIK B;  2IUR A;  4E5Z B;  2Z2P A;  4GGD A;  4ESG A;  2MTA H;  2OVR B;  1MG2 A;  3OKY B;  1MG3 A;  4LG9 A;  4O3T B;  3PXW D;  2YB8 B;  4J77 A;  1TYQ C;  5HE3 B;  5IJ8 E;  2IAA A;  2I0R A;  4Y5R D;  3NVX A;  5TEF A;  4BUJ C;  2OVP B;  4A2M A;  3VA6 A;  2PM9 A;  5FLX g;  4A09 B;  1XKS A;  1N6F A;  3RRM C;  4J0X A;  4JSX C;  2H3X A;  4ERQ A;  3K26 A;  5GXH A;  3C75 H;  4BL0 A;  5EMK B;  3OW8 A;  4ZOX A;  3I8C A;  3IJC A;  5EAP A;  2IUP A;  2OIZ A;  4QQE A;  1JOF A;  3I7K A;  2YBA A;  5EMM B;  2I0S A;  5EAL A;  4BH6 A;  3I8E A;  2CO0 C;  3RMZ D;  2IWK A;  4A2L A;  2B4E A;  3NVQ A;  3V5W B;  3JRO A;  4ZOY A;  5SXM A;  5FKQ A;  4CY1 A;  3SJL D;  3EI4 A;  1SQJ A;  4R7A B;  3MKQ A;  2Z2O A;  3VGZ A;  3PXS D;  1B9Y A;  1R5M A;  2I3S A;  3EWE A;  4JXM A;  4J84 A;  1N6D A;  5B4W A;  2PM9 B;  3PVU B;  2HKM A;  1XHM A;  4J79 A;  2J56 H;  3K27 A;  5HYN B;  3J81 g;  3EI1 A;  3BWS A;  3MKS B;  4CZY A;  3C9C A;  4PC0 A;  3CFS B;  4JSP C;  3N0D A;  1RI6 A;  4NSX A;  3SBQ A;  3JRP A;  1GOT B;  2YMU A;  3UKU C;  4H5I A;  3C99 A;  1K32 A;  1P22 A;  2OJY A;  4K3I D;  5C2W B;  2B5N A;  3EG6 A;  3MZK A;  3EI4 B;  3UR4 A;  4CI2 A;  4I79 A;  4MK0 B;  4QL1 A;  2PM6 B;  5IGO A;  5IT9 g;  2H47 A;  4X61 B;  2CN2 A;  1JMZ B;  4A08 A;  4A11 A;  3PXT D;  4E54 B;  2IWF A;  5CXB A;  4LGN A;  3C5M A;  5FKR A;  1XIP A;  4ES0 A;  3FRX A;  5HQG A;  4FAV D;  1GXR A;  2P9L C;  5C2V B;  3V7D B;  2G9A A;  5CYK A;  4CY5 A;  5H1M A;  2P9N C;  5IJ7 E;  4CI3 A;  2H9M A;  3JZH A;  2OK4 A;  2AH1 A;  4J0W A;  4FA9 D;  3HFQ A;  3I7H A;  3E0C A;  3OKW A;  1TBG A;  3NVN A;  3JZN A;  4PSX B;  2UZX B;  2P9I C;  2H13 A;  5AMS A;  4Y7R A;  5H14 A;  4CY2 A;  3VH0 A;  1A0R B;  3I2N A;  4GM3 A;  3L4O D;  3EMH A;  2B5L A;  4J8G A;  2AH0 A;  4ZOZ A;  4A08 B;  5TEE A;  4A11 B;  5IC7 A;  2HXC A;  3SLE D;  5CXB B;  2H6N A;  3PE7 A;  4PBY A;  1U4C A;  2P9U C;  3W15 A;  4O3U B;  5FKS A;  1GG2 B;  5FXY A;  1S4U X;  4XYI A;  3KRW B;  2CE9 A;  5I5I A;  3SXT D;  3JPX A;  2OVQ B;  3J80 g;  5EML B;  5CYK B;  3UKR C;  2XL2 A;  4GMB A;  2YNN A;  4A0B A;  2AGW A;  4OZU A;  5TDH B;  3UVK A;  1B9X A;  4CI1 A;  2AGX A;  3UVN A;  3I7P A;  4E54 A;  2HYE A;  2GNQ A;  3SMR A;  2I0T A;  2H68 A;  2BBK H;  2UZY B;  1MDA H;  4GGC A;  4L1Q D;  4D6V A;  3DWL C;  3EI3 A;  5I5J A;  4ERY A;  4A0A A;  3JZG A;  3UVO A;  3SHF A;  4J81 A;  5H17 A;  2QXV A;  4D0K A;  2P9P C;  3AFC A;  5IGQ A;  4U7A A;  5HE1 B;  4X3E A;  2P9K C;  5C9Z B;  1PBY B;  3F3F A;  3I7N A;  3AL8 A;  3AH8 B;  5GXI A;  3N0E A;  1VYH C;  1JJU B;  4H5J A;  3U4Y A;  4J82 A;  5JWZ A;  4J87 A;  2EBS A;  3MZL A;  4A0B B;  4FA1 D;  1JMX B;  3FGB A;  2J57 G;  4FAN D;  3OKT A;  1U2V C;  3CFV A;  2XYI A;  4ZOV A;  2O9K A;  4PBZ A;  4JSV C;  3B7F A;  4L9O A;  3I7O A;  2XL3 A;  4FHL A;  4X63 B;  4J78 A;  2CNX A;  3SWS D;  2CE8 A;  1OLZ A;  3EI3 B;  2BCJ B;  4A0A B;  2CO0 A;  4PSW B;  1OMW B;  2P9S C;  4J86 A;  3SBP A;  2HKR A;  3EI2 A;  1K8K C;  4J8B A;  4O45 A;  3DM0 A;  4FA4 D;  2XU7 A;  2Q7Q A;  1PI6 A;  4GQ2 P;  5FA5 B;  5FQD A;  5HE0 B;  4GGA A;  4AOW A;  3AL8 B;  4PXW A;  3L4M D;  3P4F A;  4L3G D;  2CN3 A;  3RFG A;  3BG0 A;  2OK6 A;  2YNO A;  4K3J B;  2AQ5 A;  3I7L A;  1FWX A;  4KFM B;  2GC4 A;  2AGL A; 
#chains in the Genus database with same CATH topology
 5FFG A;  2H6Q A;  5EM2 A;  1UOQ A;  2H14 A;  5C92 A;  4RE5 A;  2H9P A;  5KDO B;  5EMJ B;  3PSC B;  2IUV A;  5FKT A;  4TZ4 A;  3IVM A;  1SQ9 A;  1PGU A;  3JAM g;  1PEV A;  2AGY A;  5THA A;  3I89 A;  4GZ8 A;  2VZ3 A;  3SCY A;  3EI2 B;  2VZ1 A;  4ZN4 A;  4A7J A;  3IUJ A;  4G56 B;  4IRZ A;  4HDJ A;  3T3M A;  4GM9 A;  1L0Q A;  1Q47 A;  1NEX B;  4NAA A;  4XEI C;  3KRX B;  4G55 A;  3OL2 A;  4DNV A;  5I5M A;  3F3P A;  2HU7 A;  3MUN A;  3PVW B;  2TRC B;  3IJE A;  4YVD A;  5TF2 A;  3IUM A;  2XE4 A;  4OWR A;  4GQ1 A;  4XYH A;  3GRE A;  3ODT A;  4BCB A;  1BPO A;  1ERJ A;  3VI3 A;  3K6S A;  3UVL A;  2GC7 A;  3F3G A;  3DXM C;  4CC9 A;  5EM2 B;  4JSN C;  2G99 A;  4IMM A;  3ZDZ A;  3IJ0 A;  2H6K A;  3T3P A;  5GMK n;  4X60 B;  1QNI A;  4CZX A;  2BKL A;  2HJB A;  4J73 A;  4FB1 D;  3OTT A;  2B5M A;  3ORV D;  1QFM A;  1E8N A;  1K3I A;  3AL9 A;  4GM8 A;  3SBR A;  4QT8 A;  4ERZ A;  3PSL A;  1U8C A;  5HE2 B;  1H2X A;  4FWW A;  1JV2 A;  4UI9 R;  1NR0 A;  3ZE0 A;  3FM0 A;  2XZG A;  3BG1 A;  5CXC A;  2Z2N A;  4E5Z A;  2H9N A;  5K19 A;  4FA5 D;  4JT5 C;  5A2Q g;  4Z8L A;  3EU7 A;  3EQ8 A;  3JB9 L;  2AGZ A;  2HJ4 A;  1SHY B;  3OKY A;  4L3H D;  3V9F A;  2H9L A;  2PBI B;  1O6G A;  1JTD B;  1TYE A;  4NBM A;  3RN0 D;  4LG8 A;  3ZE2 A;  2XDW A;  3OF7 A;  4GQB B;  4QRJ A;  3EQ9 A;  3OL2 B;  2WQ8 A;  4CY3 A;  4DNW A;  1GP2 B;  4A09 A;  1N6E A;  4IA9 A;  3SN6 B;  3SVW D;  4CI8 A;  5M5T A;  3A0F A;  4N14 A;  3IIY A;  4O9D A;  4CZV A;  5AFU 3;  4MMY A;  1GOH A;  2YNP A;  2J55 H;  3IJ1 A;  5EAR A;  3SFZ A;  5EAM A;  2EIE A;  1E8M A;  2QC5 A;  5AJA A;  3ZWL B;  4EWR A;  2HES X;  5E6S A;  2IUQ A;  3ZDY A;  3IIW A;  3RFH A;  4AEZ A;  3IKO A;  1C9L A;  4JT6 C;  3DSM A;  1YFQ A;  3QI0 A;  3MXX A;  4U1E I;  2PM7 B;  5GSA A;  3RSE C;  3ULE C;  2W18 A;  3DXK C;  1O6F A;  4O1Q D;  3MMY A;  3UVM A;  4PNK B;  3EI1 B;  5K1C C;  4JHP C;  2I3T A;  3RN1 D;  3GFC A;  5CXC B;  3RLM D;  4JD2 C;  3CIK B;  2IUR A;  4E5Z B;  2Z2P A;  4GGD A;  4ESG A;  2MTA H;  2OVR B;  1MG2 A;  2VDQ A;  3OKY B;  1MG3 A;  4LG9 A;  4O3T B;  3PXW D;  2YB8 B;  4J77 A;  1TYQ C;  5HE3 B;  5IJ8 E;  2IAA A;  2I0R A;  4Y5R D;  3NVX A;  5TEF A;  4BUJ C;  2OVP B;  4A2M A;  3VA6 A;  2PM9 A;  5FLX g;  1VE6 A;  1VE7 A;  3K71 A;  4A09 B;  4L1M A;  1XKS A;  1N6F A;  3RRM C;  1E5T A;  4J0X A;  4JSX C;  2H3X A;  4ERQ A;  3K26 A;  5GXH A;  3C75 H;  4BL0 A;  1UTC A;  5EMK B;  3OW8 A;  4ZOX A;  3I8C A;  3IJC A;  5EAP A;  2IUP A;  2OIZ A;  4QQE A;  1JOF A;  3I7K A;  2YBA A;  5EMM B;  2I0S A;  5EAL A;  4BH6 A;  3I8E A;  2CO0 C;  3RMZ D;  4NEN A;  2IWK A;  2QR5 A;  2EID A;  3EQ7 A;  4A2L A;  2B4E A;  3NVQ A;  3MVD K;  3V5W B;  1GOF A;  3JRO A;  1I2M B;  1VZ2 A;  4DNU A;  4ZOY A;  5M5V A;  5SXM A;  4WK2 A;  5FKQ A;  4CY1 A;  3KCI A;  3SJL D;  3EI4 A;  1SQJ A;  4R7A B;  3MKQ A;  2Z2O A;  3VGZ A;  3PXS D;  1B9Y A;  1R5M A;  2I3S A;  3EWE A;  4JXM A;  4J84 A;  1N6D A;  5B4W A;  2PM9 B;  4G1E A;  3PVU B;  2HKM A;  1XHM A;  5HDB A;  4J79 A;  3IUR A;  2J56 H;  3K27 A;  4BP9 A;  5HYN B;  3V4V A;  3J81 g;  3EI1 A;  3BWS A;  3MKS B;  4CZY A;  3C9C A;  4PC0 A;  3CFS B;  4JSP C;  4BP8 A;  3N0D A;  1RI6 A;  2VDP A;  4NSX A;  3SBQ A;  3JRP A;  1GOT B;  2YMU A;  3NID A;  3UKU C;  4H5I A;  1H2Z A;  3GD1 I;  1T2X A;  3C99 A;  1K32 A;  1P22 A;  2OJY A;  4K3I D;  5C2W B;  2B5N A;  5E6R A;  3IUQ A;  3EG6 A;  3MZK A;  3EI4 B;  3UR4 A;  4CI2 A;  3IUL A;  4I79 A;  4MK0 B;  4QL1 A;  2PM6 B;  2VDO A;  5IGO A;  5IT9 g;  2H47 A;  4X61 B;  2CN2 A;  1JMZ B;  4A08 A;  2VDK A;  4A11 A;  3PXT D;  4E54 B;  2QZP A;  2IWF A;  5CXB A;  1QFS A;  4LGN A;  3C5M A;  5FKR A;  3O4I A;  1XIP A;  4ES0 A;  3FRX A;  5HQG A;  3V4P A;  4FAV D;  3DDU A;  1GXR A;  2P9L C;  5C2V B;  3V7D B;  5M5U A;  2G9A A;  5CYK A;  2VC2 A;  4JHN A;  5H1M A;  2P9N C;  4CY5 A;  4CI3 A;  5IJ7 E;  2H9M A;  3O4G A;  3JZH A;  4BCC A;  2OK4 A;  4Z7Q A;  2AH1 A;  4J0W A;  3MUO A;  4O02 A;  4FA9 D;  3HFQ A;  3I7H A;  3E0C A;  2VDR A;  3OKW A;  1TBG A;  3NVN A;  1UOO A;  3JZN A;  4PSX B;  4AX4 A;  2UZX B;  2P9I C;  2H13 A;  5AMS A;  4Y7R A;  3O4J A;  4QAM A;  2VDM A;  4D9S A;  5H14 A;  3IUN A;  4WJK A;  4CY2 A;  3VH0 A;  1A0R B;  3I2N A;  3NIF A;  4GM3 A;  3L4O D;  3EMH A;  2B5L A;  2VDL A;  4RE6 A;  4J8G A;  2AH0 A;  2EIB A;  3QHY B;  4ZOZ A;  2JKX A;  4A08 B;  5TEE A;  4A11 B;  5IC7 A;  2HXC A;  1H2Y A;  3SLE D;  5CXB B;  2HU8 A;  2H6N A;  3PE7 A;  4PBY A;  1U4C A;  1GOG A;  2P9U C;  3W15 A;  4O3U B;  5FKS A;  3ZE1 A;  1GG2 B;  5FXY A;  1S4U X;  4XYI A;  3KRW B;  2CE9 A;  3FCS A;  5I5I A;  3SXT D;  3JPX A;  2OVQ B;  1YR2 A;  3J80 g;  5EML B;  5CYK B;  4MMX A;  3UKR C;  3ZDX A;  2XL2 A;  4Z7N A;  4GMB A;  2YNN A;  4A0B A;  2AGW A;  4OZU A;  5TDH B;  3UVK A;  1B9X A;  3VI4 A;  4CI1 A;  2AGX A;  3UVN A;  3I7P A;  4AMZ A;  4E54 A;  2HYE A;  2GNQ A;  3SMR A;  2I0T A;  2H68 A;  2BBK H;  2UZY B;  1MDA H;  4GGC A;  4L1Q D;  4D6V A;  3DWL C;  1L5G A;  3EI3 A;  5I5J A;  4ERY A;  4A0A A;  3K72 A;  3JZG A;  3UVO A;  3SHF A;  4J81 A;  5H17 A;  2QXV A;  4D0K A;  2P9P C;  2VDN A;  3AFC A;  5IGQ A;  4MMZ A;  4U7A A;  5HE1 B;  5M5S A;  4X3E A;  4NC4 A;  2P9K C;  5C9Z B;  1PBY B;  4BCD A;  1C9I A;  3F3F A;  1M1X A;  3I7N A;  3AL8 A;  3AH8 B;  4WK0 A;  5GXI A;  3N0E A;  1VYH C;  1JJU B;  4H5J A;  3U4Y A;  4J82 A;  5JWZ A;  4J87 A;  2EBS A;  3MZL A;  4A0B B;  4FA1 D;  1JMX B;  3FGB A;  3NIG A;  2J57 G;  4FAN D;  1A12 A;  3OKT A;  2HU5 A;  1U2V C;  3CFV A;  2XYI A;  4ZOV A;  2O9K A;  5FFO A;  5M61 A;  4PBZ A;  4JSV C;  3B7F A;  4L9O A;  5E6U A;  3I7O A;  1H2W A;  2XL3 A;  4FHL A;  4X63 B;  4J78 A;  1UOP A;  2CNX A;  4O2W A;  3SWS D;  2CE8 A;  1OLZ A;  3EI3 B;  2BCJ B;  4A0A B;  2CO0 A;  3FCU A;  4PSW B;  1OMW B;  2P9S C;  3GC3 B;  4J86 A;  3SBP A;  2HKR A;  3EI2 A;  1K8K C;  1VZ3 A;  2EIC A;  4AMY A;  4J8B A;  4O45 A;  3O4H A;  4WK4 A;  3DM0 A;  4FA4 D;  2XU7 A;  4G1M A;  4AN0 A;  2Q7Q A;  1PI6 A;  4GQ2 P;  5FA5 B;  5FQD A;  5HE0 B;  4GGA A;  4AOW A;  3AL8 B;  4PXW A;  3L4M D;  3P4F A;  5M5R A;  4L3G D;  2CN3 A;  3RFG A;  3BG0 A;  2OK6 A;  2YNO A;  4K3J B;  2AQ5 A;  3I7L A;  1FWX A;  4UM9 A;  4KFM B;  4AN1 A;  5C86 A;  2GC4 A;  2AGL A;  4UM8 A;  4Z7O A; 
#chains in the Genus database with same CATH homology
 2H6Q A;  5EM2 A;  2H14 A;  2H9P A;  5KDO B;  5EMJ B;  3PSC B;  2IUV A;  5FKT A;  4TZ4 A;  1SQ9 A;  1PGU A;  3JAM g;  1PEV A;  2AGY A;  5THA A;  3I89 A;  4GZ8 A;  3SCY A;  3EI2 B;  4ZN4 A;  4A7J A;  4G56 B;  4HDJ A;  4GM9 A;  1L0Q A;  1Q47 A;  1NEX B;  4XEI C;  3KRX B;  3OL2 A;  5I5M A;  3F3P A;  3PVW B;  2TRC B;  4YVD A;  5TF2 A;  4OWR A;  4XYH A;  4GQ1 A;  3GRE A;  3ODT A;  1ERJ A;  3UVL A;  2GC7 A;  3F3G A;  3DXM C;  4CC9 A;  5EM2 B;  4JSN C;  2G99 A;  4IMM A;  3IJ0 A;  2H6K A;  5GMK n;  4X60 B;  1QNI A;  4CZX A;  2HJB A;  4J73 A;  4FB1 D;  3OTT A;  2B5M A;  3ORV D;  3AL9 A;  4GM8 A;  3SBR A;  4QT8 A;  4ERZ A;  3PSL A;  5HE2 B;  4FWW A;  4UI9 R;  1NR0 A;  3FM0 A;  3BG1 A;  5CXC A;  2Z2N A;  4E5Z A;  2H9N A;  5K19 A;  4FA5 D;  4JT5 C;  5A2Q g;  4Z8L A;  3EU7 A;  3JB9 L;  2AGZ A;  2HJ4 A;  1SHY B;  3OKY A;  4L3H D;  3V9F A;  2H9L A;  2PBI B;  3RN0 D;  4LG8 A;  4GQB B;  4QRJ A;  3OL2 B;  4CY3 A;  1GP2 B;  4A09 A;  1N6E A;  4IA9 A;  3SN6 B;  3SVW D;  4CI8 A;  3A0F A;  4N14 A;  3IIY A;  4O9D A;  4CZV A;  5AFU 3;  2YNP A;  2J55 H;  3IJ1 A;  5EAR A;  3SFZ A;  5EAM A;  5AJA A;  2QC5 A;  3ZWL B;  4EWR A;  2HES X;  2IUQ A;  3IIW A;  3RFH A;  4AEZ A;  3IKO A;  4JT6 C;  3DSM A;  1YFQ A;  3MXX A;  4U1E I;  2PM7 B;  5GSA A;  3RSE C;  3ULE C;  2W18 A;  3DXK C;  4O1Q D;  3MMY A;  3UVM A;  4PNK B;  3EI1 B;  5K1C C;  2I3T A;  3RN1 D;  3GFC A;  5CXC B;  3RLM D;  4JD2 C;  3CIK B;  2IUR A;  4E5Z B;  2Z2P A;  4GGD A;  4ESG A;  2MTA H;  2OVR B;  1MG2 A;  3OKY B;  1MG3 A;  4LG9 A;  4O3T B;  3PXW D;  2YB8 B;  4J77 A;  1TYQ C;  5HE3 B;  5IJ8 E;  2IAA A;  2I0R A;  4Y5R D;  3NVX A;  5TEF A;  4BUJ C;  2OVP B;  4A2M A;  3VA6 A;  2PM9 A;  5FLX g;  4A09 B;  1XKS A;  1N6F A;  3RRM C;  4J0X A;  4JSX C;  2H3X A;  4ERQ A;  3K26 A;  5GXH A;  3C75 H;  4BL0 A;  5EMK B;  3OW8 A;  4ZOX A;  3I8C A;  3IJC A;  5EAP A;  2IUP A;  2OIZ A;  4QQE A;  1JOF A;  3I7K A;  2YBA A;  5EMM B;  2I0S A;  5EAL A;  4BH6 A;  3I8E A;  2CO0 C;  3RMZ D;  2IWK A;  4A2L A;  2B4E A;  3NVQ A;  3V5W B;  3JRO A;  4ZOY A;  5SXM A;  5FKQ A;  4CY1 A;  3SJL D;  3EI4 A;  1SQJ A;  4R7A B;  3MKQ A;  2Z2O A;  3VGZ A;  3PXS D;  1B9Y A;  1R5M A;  2I3S A;  3EWE A;  4JXM A;  4J84 A;  1N6D A;  5B4W A;  2PM9 B;  3PVU B;  2HKM A;  1XHM A;  4J79 A;  2J56 H;  3K27 A;  5HYN B;  3J81 g;  3EI1 A;  3BWS A;  3MKS B;  4CZY A;  3C9C A;  4PC0 A;  3CFS B;  4JSP C;  3N0D A;  1RI6 A;  4NSX A;  3SBQ A;  3JRP A;  1GOT B;  2YMU A;  3UKU C;  4H5I A;  3C99 A;  1K32 A;  1P22 A;  2OJY A;  4K3I D;  5C2W B;  2B5N A;  3EG6 A;  3MZK A;  3EI4 B;  3UR4 A;  4CI2 A;  4I79 A;  4MK0 B;  4QL1 A;  2PM6 B;  5IGO A;  5IT9 g;  2H47 A;  4X61 B;  2CN2 A;  1JMZ B;  4A08 A;  4A11 A;  3PXT D;  4E54 B;  2IWF A;  5CXB A;  4LGN A;  3C5M A;  5FKR A;  1XIP A;  4ES0 A;  3FRX A;  5HQG A;  4FAV D;  1GXR A;  2P9L C;  5C2V B;  3V7D B;  2G9A A;  5CYK A;  4CY5 A;  5H1M A;  2P9N C;  5IJ7 E;  4CI3 A;  2H9M A;  3JZH A;  2OK4 A;  2AH1 A;  4J0W A;  4FA9 D;  3HFQ A;  3I7H A;  3E0C A;  3OKW A;  1TBG A;  3NVN A;  3JZN A;  4PSX B;  2UZX B;  2P9I C;  2H13 A;  5AMS A;  4Y7R A;  5H14 A;  4CY2 A;  3VH0 A;  1A0R B;  3I2N A;  4GM3 A;  3L4O D;  3EMH A;  2B5L A;  4J8G A;  2AH0 A;  4ZOZ A;  4A08 B;  5TEE A;  4A11 B;  5IC7 A;  2HXC A;  3SLE D;  5CXB B;  2H6N A;  3PE7 A;  4PBY A;  1U4C A;  2P9U C;  3W15 A;  4O3U B;  5FKS A;  1GG2 B;  5FXY A;  1S4U X;  4XYI A;  3KRW B;  2CE9 A;  5I5I A;  3SXT D;  3JPX A;  2OVQ B;  3J80 g;  5EML B;  5CYK B;  3UKR C;  2XL2 A;  4GMB A;  2YNN A;  4A0B A;  2AGW A;  4OZU A;  5TDH B;  3UVK A;  1B9X A;  4CI1 A;  2AGX A;  3UVN A;  3I7P A;  4E54 A;  2HYE A;  2GNQ A;  3SMR A;  2I0T A;  2H68 A;  2BBK H;  2UZY B;  1MDA H;  4GGC A;  4L1Q D;  4D6V A;  3DWL C;  3EI3 A;  5I5J A;  4ERY A;  4A0A A;  3JZG A;  3UVO A;  3SHF A;  4J81 A;  5H17 A;  2QXV A;  4D0K A;  2P9P C;  3AFC A;  5IGQ A;  4U7A A;  5HE1 B;  4X3E A;  2P9K C;  5C9Z B;  1PBY B;  3F3F A;  3I7N A;  3AL8 A;  3AH8 B;  5GXI A;  3N0E A;  1VYH C;  1JJU B;  4H5J A;  3U4Y A;  4J82 A;  5JWZ A;  4J87 A;  2EBS A;  3MZL A;  4A0B B;  4FA1 D;  1JMX B;  3FGB A;  2J57 G;  4FAN D;  3OKT A;  1U2V C;  3CFV A;  2XYI A;  4ZOV A;  2O9K A;  4PBZ A;  4JSV C;  3B7F A;  4L9O A;  3I7O A;  2XL3 A;  4FHL A;  4X63 B;  4J78 A;  2CNX A;  3SWS D;  2CE8 A;  1OLZ A;  3EI3 B;  2BCJ B;  4A0A B;  2CO0 A;  4PSW B;  1OMW B;  2P9S C;  4J86 A;  3SBP A;  2HKR A;  3EI2 A;  1K8K C;  4J8B A;  4O45 A;  3DM0 A;  4FA4 D;  2XU7 A;  2Q7Q A;  1PI6 A;  4GQ2 P;  5FA5 B;  5FQD A;  5HE0 B;  4GGA A;  4AOW A;  3AL8 B;  4PXW A;  3L4M D;  3P4F A;  4L3G D;  2CN3 A;  3RFG A;  3BG0 A;  2OK6 A;  2YNO A;  4K3J B;  2AQ5 A;  3I7L A;  1FWX A;  4KFM B;  2GC4 A;  2AGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...