3RLMD

Structure of the w199f maug/pre-methylamine dehydrogenase complex after treatment with hydrogen peroxide
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutagenesis of tryptophan199 suggests that hopping is required for MauG-dependent tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
molecule keywords Methylamine utilization protein MauG
total genus 93
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3rlmD00
3JRPA 5HE1B 2H6QA 3N0DA 1XIPA 3RFGA 3PE7A 2H9LA 3MZKA 2OK6A 5IGOA 2BBKH 3BWSA 4Y7RA 3V9FA 3PXTD 2I3TA 5CYKB 3L4OD 2B5LA 5IJ7E 3PVWB 2PM6B 3JB9L 4PNKB 4ZN4A 4ES0A 2QXVA 3UKRC 4ZOYA 5FA5B 1SQ9A 4OZUA 2XL3A 4A0BA 1TYQC 2CO0C 3C9CA 1XKSA 3HFQA 2I0RA 3SMRA 2H47A 3RFHA 2YMUA 4XYHA 2Z2PA 2H3XA 4QT8A 5EAPA 3ULEC 4ERYA 3AL8A 3RN1D 2I3SA 3EI4A 2I0TA 2P9PC 3MKSB 2O9KA 3BG0A 4J79A 4UI9R 3ODTA 3PVUB 1K8KC 2G99A 3JAMg 3I7NA 2AH1A 2CN3A 2YBAA 4D6VA 3IIYA 2HJBA 3PSCB 5TDHB 3AL9A 4X63B 4JSVC 4CZXA 4A2LA 1MG3A 4L9OA 4CI8A 5IGQA 4A2MA 3J80g 4A0BB 5EMKB 4HDJA 4U1EI 3FRXA 4FA5D 3I7KA 5AMSA 3KRXB 1SHYB 1B9XA 3KRWB 2H14A 2YNNA 4LGNA 1P22A 5FKRA 2Z2NA 4GGAA 3VH0A 5TEEA 4GM3A 2G9AA 3AL8B 1RI6A 4GQ2P 3E0CA 2UZYB 4FB1D 5AFU3 3SHFA 1N6EA 3MMYA 2OVRB 2YNOA 2H68A 4R7AB 4CI1A 3I7PA 5EM2B 2J57G 1NR0A 3FM0A 5AJAA 4D0KA 4NSXA 4KFMB 3GFCA 4ERQA 5GXHA 2UZXB 5EARA 3DM0A 4G56B 3I7LA 4YVDA 1QNIA 2HKMA 4JSXC 5H1MA 2OIZA 4JD2C 3UR4A 4A7JA 2XL2A 4GQBB 4L1QD 3I7HA 3SBQA 3MZLA 3GREA 5I5JA 4Z8LA 1MDAH 2IWKA 5K19A 3IJCA 4QL1A 2OVQB 2GC4A 5B4WA 5A2Qg 3DWLC 3I7OA 2IAAA 4IMMA 4Y5RD 4CY3A 3F3PA 2Z2OA 3OKTA 1YFQA 5HE3B 4JXMA 2IWFA 5EMJB 3ORVD 1Q47A 3F3FA 4I79A 5IJ8E 1A0RB 3IIWA 3JPXA 3U4YA 3RLMD 2YNPA 4QRJA 4ZOZA 5FXYA 3OTTA 3SJLD 4PXWA 5EM2A 4ZOVA 4CY1A 3EI2A 3MXXA 3NVNA 3I2NA 3I89A 2YB8B 4CY2A 3BG1A 5CXBA 3IKOA 3EWEA 4LG8A 2OJYA 2XYIA 3CIKB 4J0XA 2P9LC 4BUJC 4EWRA 3RMZD 4JSPC 5I5MA 1TBGA 2B5NA 4PSXB 5IC7A 2IUQA 3SBRA 4E54B 2CE9A 3V7DB 5H14A 4GM8A 1PGUA 4AOWA 2GNQA 4JSNC 2QC5A 3AH8B 2H13A 2IURA 3SBPA 4GMBA 4E5ZB 3K27A 4GM9A 2H6NA 4K3ID 3VA6A 4U7AA 4QQEA 1MG2A 3I8CA 5IT9g 2HXCA 3RN0D 5C2WB 1GXRA 2PBIB 1GOTB 4IA9A 2PM7B 2CNXA 1NEXB 4J82A 4OWRA 1R5MA 3EI2B 4FWWA 5GSAA 4CC9A 5CXBB 3OL2A 4ERZA 2AGLA 3UVOA 3EMHA 1B9YA 3EU7A 4GGCA 1PEVA 3I8EA 5EMLB 2AGZA 3SN6B 4J0WA 4GGDA 3EG6A 3B7FA 3F3GA 3IJ0A 2J56H 5HE2B 5HYNB 4FA9D 4E54A 5CXCA 4H5JA 5TF2A 4O1QD 4E5ZA 4FHLA 2MTAH 2Q7QA 3OKYA 3DXMC 3OKWA 2AGXA 2EBSA 4JT5C 4ESGA 3P4FA 4XYIA 1K32A 2TRCB 4PSWB 2B4EA 4AEZA 4FAND 4ZOXA 3JZGA 4J77A 4H5IA 4A11B 4J84A 3PSLA 4O3UB 4BH6A 3RSEC 4O3TB 4FA1D 2PM9A 4X60B 3OL2B 4CI2A 1VYHC 1JOFA 3C5MA 2OK4A 4GQ1A 5HQGA 5K1CC 2HESX 3SCYA 4PC0A 2AQ5A 2OVPB 5FQDA 5JWZA 1S4UX 4J8BA 4O45A 4JT6C 5H17A 5C9ZB 3SXTD 5CXCB 3K26A 3UVMA 4J81A 5C2VB 3OKYB 4X61B 1SQJA 4XEIC 5EAMA 3J81g 4LG9A 4J87A 3N0EA 5HE0B 3EI1A 2IUVA 5FKTA 4K3JB 2AGWA 2GC7A 2AGYA 2CO0A 2HKRA 2I0SA 2P9SC 4A11A 1OLZA 2H9PA 4CZVA 2CE8A 3SWSD 2W18A 3DSMA 3L4MD 3NVXA 3FGBA 3C75H 4L3GD 4A0AA 3EI3A 2XU7A 2PM9B 4X3EA 3UVNA 2IUPA 1JMZB 4A09B 3SFZA 3VGZA 2P9IC 5EALA 2HJ4A 4J86A 3JZNA 5GMKn 3ZWLB 5GXIA 3RRMC 1PBYB 5FKQA 3IJ1A 5EMMB 3PXSD 2P9NC 1JMXB 3NVQA 1N6DA 2P9KC 2HYEA 4A08B 3MKQA 5FLXg 1U4CA 3UKUC 3W15A 3JZHA 2CN2A 3UVLA 2H9NA 1U2VC 4N14A 4BL0A 3AFCA 5THAA 4FA4D 5KDOB 3EI1B 4J78A 4GZ8A 1JJUB 1XHMA 4CZYA 5I5IA 5TEFA 3SLED 2H6KA 5CYKA 2BCJB 1GG2B 2AH0A 4A0AB 3EI3B 3SVWD 4J73A 4A09A 3PXWD 1PI6A 2J55H 1FWXA 1N6FA 4MK0B 3JROA 4CY5A 3V5WB 5FKSA 4TZ4A 3DXKC 3A0FA 3OW8A 5SXMA 3CFVA 4FAVD 4L3HD 3C99A 4J8GA 2H9MA 1L0QA 2B5MA 3UVKA 4O9DA 3CFSB 4CI3A 4A08A 1ERJA 4PBZA 2P9UC 1GP2B 3EI4B 4PBYA 1OMWB
chains in the Genus database with same CATH superfamily
3JRPA 5HE1B 2H6QA 3N0DA 4BCDA 1XIPA 3RFGA 3PE7A 3DDUA 2H9LA 3MZKA 2OK6A 4DNWA 5IGOA 2BBKH 3MVDK 1VZ2A 3BWSA 4Y7RA 3V9FA 4NAAA 3VI3A 3PXTD 2I3TA 5CYKB 3L4OD 3ZDXA 2B5LA 5IJ7E 3PVWB 2PM6B 4QAMA 2VDNA 4AMZA 4Z7OA 3JB9L 4PNKB 4ZN4A 4JHPC 4ES0A 2QXVA 3UKRC 4ZOYA 5FA5B 1SQ9A 4OZUA 2QZPA 1O6GA 2VDLA 2XL3A 4A0BA 1TYQC 2CO0C 4BCBA 3C9CA 1XKSA 3HFQA 1H2WA 2I0RA 3SMRA 2EIEA 2H47A 1O6FA 4AX4A 3RFHA 2YMUA 4XYHA 3VI4A 2Z2PA 4G55A 2H3XA 4QT8A 5EAPA 3ULEC 4ERYA 3AL8A 4JHNA 2I3SA 3EI4A 2I0TA 2P9PC 3RN1D 3IUQA 1K3IA 3MKSB 2O9KA 3BG0A 4J79A 4UI9R 3ODTA 3PVUB 1K8KC 2G99A 3JAMg 3I7NA 1A12A 2AH1A 2CN3A 2YBAA 4D6VA 3IIYA 2HJBA 3PSCB 5TDHB 3AL9A 4X63B 4JSVC 4AMYA 4CZXA 4L1MA 4A2LA 1MG3A 4L9OA 4CI8A 4NBMA 5IGQA 4A2MA 3J80g 4A0BB 5EMKB 4HDJA 5M5TA 4U1EI 3V4PA 3FRXA 4FA5D 3V4VA 3I7KA 5AMSA 3KRXB 1SHYB 1B9XA 3KRWB 2H14A 2YNNA 4LGNA 1P22A 5FKRA 2Z2NA 4GGAA 1UOPA 3IUJA 4D9SA 3VH0A 5TEEA 4GM3A 2G9AA 2XZGA 3AL8B 1RI6A 3ZDZA 4GQ2P 3E0CA 5M5UA 4NENA 2UZYB 4FB1D 5AFU3 3SHFA 1N6EA 3MMYA 2OVRB 2YNOA 2H68A 4R7AB 4CI1A 3I7PA 5EM2B 5M5SA 1H2YA 1NR0A 2J57G 3FM0A 5M5VA 2WQ8A 5AJAA 4D0KA 4NSXA 4KFMB 4WK4A 5FFOA 3GFCA 4ERQA 5GXHA 2UZXB 2JKXA 5EARA 3DM0A 2VZ1A 4G56B 3I7LA 3NIFA 4YVDA 1QNIA 2HKMA 4JSXC 5H1MA 1T2XA 2OIZA 4JD2C 3UR4A 1UOOA 4A7JA 2XL2A 4GQBB 4L1QD 3I7HA 3SBQA 3MZLA 1C9IA 3GREA 2HU8A 3O4JA 4Z7QA 5I5JA 4Z8LA 1MDAH 1VE6A 2IWKA 5K19A 3IJCA 2EICA 4QL1A 2OVQB 2GC4A 4BP8A 5B4WA 3FCUA 5A2Qg 3DWLC 3I7OA 3NIGA 2IAAA 4IMMA 4Y5RD 4CY3A 3F3PA 3EQ9A 2Z2OA 4IRZA 3OKTA 1YFQA 5FFGA 5HE3B 3O4IA 3NIDA 4JXMA 2IWFA 5EMJB 3ORVD 1Q47A 3F3FA 4I79A 5IJ8E 1A0RB 3IIWA 3JPXA 3U4YA 3K6SA 3RLMD 2YNPA 4QRJA 4ZOZA 5FXYA 3OTTA 3SJLD 4PXWA 5EM2A 4ZOVA 3IUMA 4CY1A 2VDRA 3EI2A 3MXXA 3NVNA 3I2NA 3I89A 2EIDA 2YB8B 4CY2A 3BG1A 5CXBA 3IKOA 3EWEA 4LG8A 2OJYA 2XYIA 4O02A 3CIKB 4J0XA 1U8CA 2P9LC 4BUJC 4EWRA 3RMZD 4JSPC 3ZE0A 5I5MA 1TBGA 4G1MA 2B5NA 4PSXB 5IC7A 4BCCA 2IUQA 3SBRA 3QI0A 4E54B 2CE9A 3V7DB 4RE6A 5H14A 4GM8A 1PGUA 4AOWA 2GNQA 2VDPA 4JSNC 2QC5A 3FCSA 3AH8B 3QHYB 2H13A 2IURA 3SBPA 4GMBA 4E5ZB 3MUOA 3K27A 4GM9A 2H6NA 4K3ID 3VA6A 2HU5A 4U7AA 1H2XA 4Z7NA 4QQEA 1MG2A 3I8CA 4DNUA 5IT9g 3EQ8A 2HXCA 3RN0D 4UM9A 5C2WB 1GXRA 3IUNA 3IVMA 1QFMA 2EIBA 2PBIB 1GOTB 4IA9A 1I2MB 2PM7B 2CNXA 1NEXB 1UOQA 4J82A 4OWRA 1R5MA 3EI2B 4FWWA 3O4HA 5GSAA 4CC9A 5CXBB 3OL2A 4ERZA 2AGLA 3UVOA 3EMHA 1B9YA 1C9LA 3EU7A 4GGCA 1PEVA 3I8EA 2XDWA 4G1EA 5EMLB 2AGZA 3SN6B 4J0WA 4GGDA 2VDQA 3EG6A 1E5TA 2BKLA 3B7FA 3F3GA 4MMYA 3IJ0A 2J56H 5HE2B 1GOFA 5HYNB 4FA9D 4E54A 1YR2A 1VZ3A 5CXCA 4H5JA 5TF2A 4O1QD 4E5ZA 4FHLA 2MTAH 2Q7QA 3OKYA 3DXMC 3OKWA 2AGXA 2EBSA 4JT5C 4ESGA 3P4FA 4XYIA 1K32A 2TRCB 4PSWB 2B4EA 4AEZA 4FAND 4ZOXA 3JZGA 3K72A 4J77A 4H5IA 4A11B 4O2WA 4J84A 3PSLA 4NC4A 4DNVA 4O3UB 1BPOA 3ZDYA 3GC3B 4BH6A 4AN0A 1QFSA 3RSEC 4O3TB 4FA1D 2PM9A 4X60B 3OL2B 3OF7A 4WK0A 4CI2A 1VYHC 5C86A 1JOFA 3C5MA 1M1XA 2OK4A 4GQ1A 5HQGA 5K1CC 1VE7A 2HESX 1E8NA 4PC0A 3SCYA 4AN1A 2AQ5A 2OVPB 5FQDA 5JWZA 1S4UX 4J8BA 4O45A 4JT6C 1GOHA 5H17A 5C9ZB 3SXTD 5CXCB 3K26A 3UVMA 4J81A 3GD1I 5E6UA 3OKYB 5C2VB 4X61B 1SQJA 4XEIC 5EAMA 3J81g 4LG9A 3N0EA 4J87A 5HE0B 3MUNA 3EI1A 2IUVA 1E8MA 1H2ZA 5FKTA 4K3JB 2AGWA 4WK2A 2GC7A 2AGYA 2CO0A 2HKRA 2I0SA 2P9SC 4A11A 1JV2A 1OLZA 5E6RA 2H9PA 4CZVA 2CE8A 3K71A 3SWSD 2W18A 5M5RA 3DSMA 3L4MD 3NVXA 3FGBA 3C75H 3IURA 4L3GD 3EI3A 3O4GA 4A0AA 1UTCA 2XU7A 2PM9B 4X3EA 3UVNA 2IUPA 1JMZB 4A09B 3SFZA 4BP9A 3T3PA 3VGZA 2P9IC 5EALA 2HJ4A 4J86A 2VDOA 3JZNA 5GMKn 3ZWLB 5GXIA 3RRMC 1PBYB 4MMXA 5C92A 4WJKA 5FKQA 3IJ1A 5EMMB 3PXSD 3ZE1A 2P9NC 1JMXB 3NVQA 2XE4A 1N6DA 2P9KC 4MMZA 2HYEA 4A08B 3MKQA 2QR5A 5FLXg 1U4CA 3UKUC 3W15A 3JZHA 2CN2A 3UVLA 3KCIA 2H9NA 1U2VC 4N14A 4BL0A 3IJEA 3AFCA 5THAA 2VZ3A 1TYEA 4FA4D 4J78A 5KDOB 3EI1B 4GZ8A 1JJUB 2VDMA 1XHMA 4CZYA 5I5IA 1JTDB 3EQ7A 5TEFA 1GOGA 1L5GA 2HU7A 3SLED 2H6KA 5CYKA 2BCJB 1GG2B 2AH0A 4A0AB 3EI3B 2VDKA 3SVWD 4RE5A 4J73A 4A09A 3PXWD 1PI6A 2J55H 3IULA 1FWXA 1N6FA 4MK0B 5HDBA 3JROA 4CY5A 3V5WB 5FKSA 4TZ4A 3T3MA 3DXKC 5E6SA 4UM8A 3A0FA 3OW8A 5SXMA 3CFVA 4FAVD 4L3HD 3C99A 4J8GA 2H9MA 1L0QA 2B5MA 3UVKA 4O9DA 3CFSB 4CI3A 4A08A 3ZE2A 1ERJA 4PBZA 2P9UC 1GP2B 3EI4B 5M61A 4PBYA 2VC2A 1OMWB
chains in the Genus database with same CATH topology
3JRPA 5HE1B 2H6QA 3N0DA 1XIPA 3RFGA 3PE7A 2H9LA 3MZKA 2OK6A 5IGOA 2BBKH 3BWSA 4Y7RA 3V9FA 3PXTD 2I3TA 5CYKB 3L4OD 2B5LA 5IJ7E 3PVWB 2PM6B 3JB9L 4PNKB 4ZN4A 4ES0A 2QXVA 3UKRC 4ZOYA 5FA5B 1SQ9A 4OZUA 2XL3A 4A0BA 1TYQC 2CO0C 3C9CA 1XKSA 3HFQA 2I0RA 3SMRA 2H47A 3RFHA 2YMUA 4XYHA 2Z2PA 2H3XA 4QT8A 5EAPA 3ULEC 4ERYA 3AL8A 3RN1D 2I3SA 3EI4A 2I0TA 2P9PC 3MKSB 2O9KA 3BG0A 4J79A 4UI9R 3ODTA 3PVUB 1K8KC 2G99A 3JAMg 3I7NA 2AH1A 2CN3A 2YBAA 4D6VA 3IIYA 2HJBA 3PSCB 5TDHB 3AL9A 4X63B 4JSVC 4CZXA 4A2LA 1MG3A 4L9OA 4CI8A 5IGQA 4A2MA 3J80g 4A0BB 5EMKB 4HDJA 4U1EI 3FRXA 4FA5D 3I7KA 5AMSA 3KRXB 1SHYB 1B9XA 3KRWB 2H14A 2YNNA 4LGNA 1P22A 5FKRA 2Z2NA 4GGAA 3VH0A 5TEEA 4GM3A 2G9AA 3AL8B 1RI6A 4GQ2P 3E0CA 2UZYB 4FB1D 5AFU3 3SHFA 1N6EA 3MMYA 2OVRB 2YNOA 2H68A 4R7AB 4CI1A 3I7PA 5EM2B 2J57G 1NR0A 3FM0A 5AJAA 4D0KA 4NSXA 4KFMB 3GFCA 4ERQA 5GXHA 2UZXB 5EARA 3DM0A 4G56B 3I7LA 4YVDA 1QNIA 2HKMA 4JSXC 5H1MA 2OIZA 4JD2C 3UR4A 4A7JA 2XL2A 4GQBB 4L1QD 3I7HA 3SBQA 3MZLA 3GREA 5I5JA 4Z8LA 1MDAH 2IWKA 5K19A 3IJCA 4QL1A 2OVQB 2GC4A 5B4WA 5A2Qg 3DWLC 3I7OA 2IAAA 4IMMA 4Y5RD 4CY3A 3F3PA 2Z2OA 3OKTA 1YFQA 5HE3B 4JXMA 2IWFA 5EMJB 3ORVD 1Q47A 3F3FA 4I79A 5IJ8E 1A0RB 3IIWA 3JPXA 3U4YA 3RLMD 2YNPA 4QRJA 4ZOZA 5FXYA 3OTTA 3SJLD 4PXWA 5EM2A 4ZOVA 4CY1A 3EI2A 3MXXA 3NVNA 3I2NA 3I89A 2YB8B 4CY2A 3BG1A 5CXBA 3IKOA 3EWEA 4LG8A 2OJYA 2XYIA 3CIKB 4J0XA 2P9LC 4BUJC 4EWRA 3RMZD 4JSPC 5I5MA 1TBGA 2B5NA 4PSXB 5IC7A 2IUQA 3SBRA 4E54B 2CE9A 3V7DB 5H14A 4GM8A 1PGUA 4AOWA 2GNQA 4JSNC 2QC5A 3AH8B 2H13A 2IURA 3SBPA 4GMBA 4E5ZB 3K27A 4GM9A 2H6NA 4K3ID 3VA6A 4U7AA 4QQEA 1MG2A 3I8CA 5IT9g 2HXCA 3RN0D 5C2WB 1GXRA 2PBIB 1GOTB 4IA9A 2PM7B 2CNXA 1NEXB 4J82A 4OWRA 1R5MA 3EI2B 4FWWA 5GSAA 4CC9A 5CXBB 3OL2A 4ERZA 2AGLA 3UVOA 3EMHA 1B9YA 3EU7A 4GGCA 1PEVA 3I8EA 5EMLB 2AGZA 3SN6B 4J0WA 4GGDA 3EG6A 3B7FA 3F3GA 3IJ0A 2J56H 5HE2B 5HYNB 4FA9D 4E54A 5CXCA 4H5JA 5TF2A 4O1QD 4E5ZA 4FHLA 2MTAH 2Q7QA 3OKYA 3DXMC 3OKWA 2AGXA 2EBSA 4JT5C 4ESGA 3P4FA 4XYIA 1K32A 2TRCB 4PSWB 2B4EA 4AEZA 4FAND 4ZOXA 3JZGA 4J77A 4H5IA 4A11B 4J84A 3PSLA 4O3UB 4BH6A 3RSEC 4O3TB 4FA1D 2PM9A 4X60B 3OL2B 4CI2A 1VYHC 1JOFA 3C5MA 2OK4A 4GQ1A 5HQGA 5K1CC 2HESX 3SCYA 4PC0A 2AQ5A 2OVPB 5FQDA 5JWZA 1S4UX 4J8BA 4O45A 4JT6C 5H17A 5C9ZB 3SXTD 5CXCB 3K26A 3UVMA 4J81A 5C2VB 3OKYB 4X61B 1SQJA 4XEIC 5EAMA 3J81g 4LG9A 4J87A 3N0EA 5HE0B 3EI1A 2IUVA 5FKTA 4K3JB 2AGWA 2GC7A 2AGYA 2CO0A 2HKRA 2I0SA 2P9SC 4A11A 1OLZA 2H9PA 4CZVA 2CE8A 3SWSD 2W18A 3DSMA 3L4MD 3NVXA 3FGBA 3C75H 4L3GD 4A0AA 3EI3A 2XU7A 2PM9B 4X3EA 3UVNA 2IUPA 1JMZB 4A09B 3SFZA 3VGZA 2P9IC 5EALA 2HJ4A 4J86A 3JZNA 5GMKn 3ZWLB 5GXIA 3RRMC 1PBYB 5FKQA 3IJ1A 5EMMB 3PXSD 2P9NC 1JMXB 3NVQA 1N6DA 2P9KC 2HYEA 4A08B 3MKQA 5FLXg 1U4CA 3UKUC 3W15A 3JZHA 2CN2A 3UVLA 2H9NA 1U2VC 4N14A 4BL0A 3AFCA 5THAA 4FA4D 5KDOB 3EI1B 4J78A 4GZ8A 1JJUB 1XHMA 4CZYA 5I5IA 5TEFA 3SLED 2H6KA 5CYKA 2BCJB 1GG2B 2AH0A 4A0AB 3EI3B 3SVWD 4J73A 4A09A 3PXWD 1PI6A 2J55H 1FWXA 1N6FA 4MK0B 3JROA 4CY5A 3V5WB 5FKSA 4TZ4A 3DXKC 3A0FA 3OW8A 5SXMA 3CFVA 4FAVD 4L3HD 3C99A 4J8GA 2H9MA 1L0QA 2B5MA 3UVKA 4O9DA 3CFSB 4CI3A 4A08A 1ERJA 4PBZA 2P9UC 1GP2B 3EI4B 4PBYA 1OMWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JRP A;  5HE1 B;  2H6Q A;  3N0D A;  1XIP A;  3RFG A;  3PE7 A;  2H9L A;  3MZK A;  2OK6 A;  5IGO A;  2BBK H;  3BWS A;  4Y7R A;  3V9F A;  3PXT D;  2I3T A;  5CYK B;  3L4O D;  2B5L A;  5IJ7 E;  3PVW B;  2PM6 B;  3JB9 L;  4PNK B;  4ZN4 A;  4ES0 A;  2QXV A;  3UKR C;  4ZOY A;  5FA5 B;  1SQ9 A;  4OZU A;  2XL3 A;  4A0B A;  1TYQ C;  2CO0 C;  3C9C A;  1XKS A;  3HFQ A;  2I0R A;  3SMR A;  2H47 A;  3RFH A;  2YMU A;  4XYH A;  2Z2P A;  2H3X A;  4QT8 A;  5EAP A;  3ULE C;  4ERY A;  3AL8 A;  3RN1 D;  2I3S A;  3EI4 A;  2I0T A;  2P9P C;  3MKS B;  2O9K A;  3BG0 A;  4J79 A;  4UI9 R;  3ODT A;  3PVU B;  1K8K C;  2G99 A;  3JAM g;  3I7N A;  2AH1 A;  2CN3 A;  2YBA A;  4D6V A;  3IIY A;  2HJB A;  3PSC B;  5TDH B;  3AL9 A;  4X63 B;  4JSV C;  4CZX A;  4A2L A;  1MG3 A;  4L9O A;  4CI8 A;  5IGQ A;  4A2M A;  3J80 g;  4A0B B;  5EMK B;  4HDJ A;  4U1E I;  3FRX A;  4FA5 D;  3I7K A;  5AMS A;  3KRX B;  1SHY B;  1B9X A;  3KRW B;  2H14 A;  2YNN A;  4LGN A;  1P22 A;  5FKR A;  2Z2N A;  4GGA A;  3VH0 A;  5TEE A;  4GM3 A;  2G9A A;  3AL8 B;  1RI6 A;  4GQ2 P;  3E0C A;  2UZY B;  4FB1 D;  5AFU 3;  3SHF A;  1N6E A;  3MMY A;  2OVR B;  2YNO A;  2H68 A;  4R7A B;  4CI1 A;  3I7P A;  5EM2 B;  2J57 G;  1NR0 A;  3FM0 A;  5AJA A;  4D0K A;  4NSX A;  4KFM B;  3GFC A;  4ERQ A;  5GXH A;  2UZX B;  5EAR A;  3DM0 A;  4G56 B;  3I7L A;  4YVD A;  1QNI A;  2HKM A;  4JSX C;  5H1M A;  2OIZ A;  4JD2 C;  3UR4 A;  4A7J A;  2XL2 A;  4GQB B;  4L1Q D;  3I7H A;  3SBQ A;  3MZL A;  3GRE A;  5I5J A;  4Z8L A;  1MDA H;  2IWK A;  5K19 A;  3IJC A;  4QL1 A;  2OVQ B;  2GC4 A;  5B4W A;  5A2Q g;  3DWL C;  3I7O A;  2IAA A;  4IMM A;  4Y5R D;  4CY3 A;  3F3P A;  2Z2O A;  3OKT A;  1YFQ A;  5HE3 B;  4JXM A;  2IWF A;  5EMJ B;  3ORV D;  1Q47 A;  3F3F A;  4I79 A;  5IJ8 E;  1A0R B;  3IIW A;  3JPX A;  3U4Y A;  3RLM D;  2YNP A;  4QRJ A;  4ZOZ A;  5FXY A;  3OTT A;  3SJL D;  4PXW A;  5EM2 A;  4ZOV A;  4CY1 A;  3EI2 A;  3MXX A;  3NVN A;  3I2N A;  3I89 A;  2YB8 B;  4CY2 A;  3BG1 A;  5CXB A;  3IKO A;  3EWE A;  4LG8 A;  2OJY A;  2XYI A;  3CIK B;  4J0X A;  2P9L C;  4BUJ C;  4EWR A;  3RMZ D;  4JSP C;  5I5M A;  1TBG A;  2B5N A;  4PSX B;  5IC7 A;  2IUQ A;  3SBR A;  4E54 B;  2CE9 A;  3V7D B;  5H14 A;  4GM8 A;  1PGU A;  4AOW A;  2GNQ A;  4JSN C;  2QC5 A;  3AH8 B;  2H13 A;  2IUR A;  3SBP A;  4GMB A;  4E5Z B;  3K27 A;  4GM9 A;  2H6N A;  4K3I D;  3VA6 A;  4U7A A;  4QQE A;  1MG2 A;  3I8C A;  5IT9 g;  2HXC A;  3RN0 D;  5C2W B;  1GXR A;  2PBI B;  1GOT B;  4IA9 A;  2PM7 B;  2CNX A;  1NEX B;  4J82 A;  4OWR A;  1R5M A;  3EI2 B;  4FWW A;  5GSA A;  4CC9 A;  5CXB B;  3OL2 A;  4ERZ A;  2AGL A;  3UVO A;  3EMH A;  1B9Y A;  3EU7 A;  4GGC A;  1PEV A;  3I8E A;  5EML B;  2AGZ A;  3SN6 B;  4J0W A;  4GGD A;  3EG6 A;  3B7F A;  3F3G A;  3IJ0 A;  2J56 H;  5HE2 B;  5HYN B;  4FA9 D;  4E54 A;  5CXC A;  4H5J A;  5TF2 A;  4O1Q D;  4E5Z A;  4FHL A;  2MTA H;  2Q7Q A;  3OKY A;  3DXM C;  3OKW A;  2AGX A;  2EBS A;  4JT5 C;  4ESG A;  3P4F A;  4XYI A;  1K32 A;  2TRC B;  4PSW B;  2B4E A;  4AEZ A;  4FAN D;  4ZOX A;  3JZG A;  4J77 A;  4H5I A;  4A11 B;  4J84 A;  3PSL A;  4O3U B;  4BH6 A;  3RSE C;  4O3T B;  4FA1 D;  2PM9 A;  4X60 B;  3OL2 B;  4CI2 A;  1VYH C;  1JOF A;  3C5M A;  2OK4 A;  4GQ1 A;  5HQG A;  5K1C C;  2HES X;  3SCY A;  4PC0 A;  2AQ5 A;  2OVP B;  5FQD A;  5JWZ A;  1S4U X;  4J8B A;  4O45 A;  4JT6 C;  5H17 A;  5C9Z B;  3SXT D;  5CXC B;  3K26 A;  3UVM A;  4J81 A;  5C2V B;  3OKY B;  4X61 B;  1SQJ A;  4XEI C;  5EAM A;  3J81 g;  4LG9 A;  4J87 A;  3N0E A;  5HE0 B;  3EI1 A;  2IUV A;  5FKT A;  4K3J B;  2AGW A;  2GC7 A;  2AGY A;  2CO0 A;  2HKR A;  2I0S A;  2P9S C;  4A11 A;  1OLZ A;  2H9P A;  4CZV A;  2CE8 A;  3SWS D;  2W18 A;  3DSM A;  3L4M D;  3NVX A;  3FGB A;  3C75 H;  4L3G D;  4A0A A;  3EI3 A;  2XU7 A;  2PM9 B;  4X3E A;  3UVN A;  2IUP A;  1JMZ B;  4A09 B;  3SFZ A;  3VGZ A;  2P9I C;  5EAL A;  2HJ4 A;  4J86 A;  3JZN A;  5GMK n;  3ZWL B;  5GXI A;  3RRM C;  1PBY B;  5FKQ A;  3IJ1 A;  5EMM B;  3PXS D;  2P9N C;  1JMX B;  3NVQ A;  1N6D A;  2P9K C;  2HYE A;  4A08 B;  3MKQ A;  5FLX g;  1U4C A;  3UKU C;  3W15 A;  3JZH A;  2CN2 A;  3UVL A;  2H9N A;  1U2V C;  4N14 A;  4BL0 A;  3AFC A;  5THA A;  4FA4 D;  5KDO B;  3EI1 B;  4J78 A;  4GZ8 A;  1JJU B;  1XHM A;  4CZY A;  5I5I A;  5TEF A;  3SLE D;  2H6K A;  5CYK A;  2BCJ B;  1GG2 B;  2AH0 A;  4A0A B;  3EI3 B;  3SVW D;  4J73 A;  4A09 A;  3PXW D;  1PI6 A;  2J55 H;  1FWX A;  1N6F A;  4MK0 B;  3JRO A;  4CY5 A;  3V5W B;  5FKS A;  4TZ4 A;  3DXK C;  3A0F A;  3OW8 A;  5SXM A;  3CFV A;  4FAV D;  4L3H D;  3C99 A;  4J8G A;  2H9M A;  1L0Q A;  2B5M A;  3UVK A;  4O9D A;  3CFS B;  4CI3 A;  4A08 A;  1ERJ A;  4PBZ A;  2P9U C;  1GP2 B;  3EI4 B;  4PBY A;  1OMW B; 
#chains in the Genus database with same CATH topology
 3JRP A;  5HE1 B;  2H6Q A;  3N0D A;  4BCD A;  1XIP A;  3RFG A;  3PE7 A;  3DDU A;  2H9L A;  3MZK A;  2OK6 A;  4DNW A;  5IGO A;  2BBK H;  3MVD K;  1VZ2 A;  3BWS A;  4Y7R A;  3V9F A;  4NAA A;  3VI3 A;  3PXT D;  2I3T A;  5CYK B;  3L4O D;  3ZDX A;  2B5L A;  5IJ7 E;  3PVW B;  2PM6 B;  4QAM A;  2VDN A;  4AMZ A;  4Z7O A;  3JB9 L;  4PNK B;  4ZN4 A;  4JHP C;  4ES0 A;  2QXV A;  3UKR C;  4ZOY A;  5FA5 B;  1SQ9 A;  4OZU A;  2QZP A;  1O6G A;  2VDL A;  2XL3 A;  4A0B A;  1TYQ C;  2CO0 C;  4BCB A;  3C9C A;  1XKS A;  3HFQ A;  1H2W A;  2I0R A;  3SMR A;  2EIE A;  2H47 A;  1O6F A;  4AX4 A;  3RFH A;  2YMU A;  4XYH A;  3VI4 A;  2Z2P A;  4G55 A;  2H3X A;  4QT8 A;  5EAP A;  3ULE C;  4ERY A;  3AL8 A;  4JHN A;  2I3S A;  3EI4 A;  2I0T A;  2P9P C;  3RN1 D;  3IUQ A;  1K3I A;  3MKS B;  2O9K A;  3BG0 A;  4J79 A;  4UI9 R;  3ODT A;  3PVU B;  1K8K C;  2G99 A;  3JAM g;  3I7N A;  1A12 A;  2AH1 A;  2CN3 A;  2YBA A;  4D6V A;  3IIY A;  2HJB A;  3PSC B;  5TDH B;  3AL9 A;  4X63 B;  4JSV C;  4AMY A;  4CZX A;  4L1M A;  4A2L A;  1MG3 A;  4L9O A;  4CI8 A;  4NBM A;  5IGQ A;  4A2M A;  3J80 g;  4A0B B;  5EMK B;  4HDJ A;  5M5T A;  4U1E I;  3V4P A;  3FRX A;  4FA5 D;  3V4V A;  3I7K A;  5AMS A;  3KRX B;  1SHY B;  1B9X A;  3KRW B;  2H14 A;  2YNN A;  4LGN A;  1P22 A;  5FKR A;  2Z2N A;  4GGA A;  1UOP A;  3IUJ A;  4D9S A;  3VH0 A;  5TEE A;  4GM3 A;  2G9A A;  2XZG A;  3AL8 B;  1RI6 A;  3ZDZ A;  4GQ2 P;  3E0C A;  5M5U A;  4NEN A;  2UZY B;  4FB1 D;  5AFU 3;  3SHF A;  1N6E A;  3MMY A;  2OVR B;  2YNO A;  2H68 A;  4R7A B;  4CI1 A;  3I7P A;  5EM2 B;  5M5S A;  1H2Y A;  1NR0 A;  2J57 G;  3FM0 A;  5M5V A;  2WQ8 A;  5AJA A;  4D0K A;  4NSX A;  4KFM B;  4WK4 A;  5FFO A;  3GFC A;  4ERQ A;  5GXH A;  2UZX B;  2JKX A;  5EAR A;  3DM0 A;  2VZ1 A;  4G56 B;  3I7L A;  3NIF A;  4YVD A;  1QNI A;  2HKM A;  4JSX C;  5H1M A;  1T2X A;  2OIZ A;  4JD2 C;  3UR4 A;  1UOO A;  4A7J A;  2XL2 A;  4GQB B;  4L1Q D;  3I7H A;  3SBQ A;  3MZL A;  1C9I A;  3GRE A;  2HU8 A;  3O4J A;  4Z7Q A;  5I5J A;  4Z8L A;  1MDA H;  1VE6 A;  2IWK A;  5K19 A;  3IJC A;  2EIC A;  4QL1 A;  2OVQ B;  2GC4 A;  4BP8 A;  5B4W A;  3FCU A;  5A2Q g;  3DWL C;  3I7O A;  3NIG A;  2IAA A;  4IMM A;  4Y5R D;  4CY3 A;  3F3P A;  3EQ9 A;  2Z2O A;  4IRZ A;  3OKT A;  1YFQ A;  5FFG A;  5HE3 B;  3O4I A;  3NID A;  4JXM A;  2IWF A;  5EMJ B;  3ORV D;  1Q47 A;  3F3F A;  4I79 A;  5IJ8 E;  1A0R B;  3IIW A;  3JPX A;  3U4Y A;  3K6S A;  3RLM D;  2YNP A;  4QRJ A;  4ZOZ A;  5FXY A;  3OTT A;  3SJL D;  4PXW A;  5EM2 A;  4ZOV A;  3IUM A;  4CY1 A;  2VDR A;  3EI2 A;  3MXX A;  3NVN A;  3I2N A;  3I89 A;  2EID A;  2YB8 B;  4CY2 A;  3BG1 A;  5CXB A;  3IKO A;  3EWE A;  4LG8 A;  2OJY A;  2XYI A;  4O02 A;  3CIK B;  4J0X A;  1U8C A;  2P9L C;  4BUJ C;  4EWR A;  3RMZ D;  4JSP C;  3ZE0 A;  5I5M A;  1TBG A;  4G1M A;  2B5N A;  4PSX B;  5IC7 A;  4BCC A;  2IUQ A;  3SBR A;  3QI0 A;  4E54 B;  2CE9 A;  3V7D B;  4RE6 A;  5H14 A;  4GM8 A;  1PGU A;  4AOW A;  2GNQ A;  2VDP A;  4JSN C;  2QC5 A;  3FCS A;  3AH8 B;  3QHY B;  2H13 A;  2IUR A;  3SBP A;  4GMB A;  4E5Z B;  3MUO A;  3K27 A;  4GM9 A;  2H6N A;  4K3I D;  3VA6 A;  2HU5 A;  4U7A A;  1H2X A;  4Z7N A;  4QQE A;  1MG2 A;  3I8C A;  4DNU A;  5IT9 g;  3EQ8 A;  2HXC A;  3RN0 D;  4UM9 A;  5C2W B;  1GXR A;  3IUN A;  3IVM A;  1QFM A;  2EIB A;  2PBI B;  1GOT B;  4IA9 A;  1I2M B;  2PM7 B;  2CNX A;  1NEX B;  1UOQ A;  4J82 A;  4OWR A;  1R5M A;  3EI2 B;  4FWW A;  3O4H A;  5GSA A;  4CC9 A;  5CXB B;  3OL2 A;  4ERZ A;  2AGL A;  3UVO A;  3EMH A;  1B9Y A;  1C9L A;  3EU7 A;  4GGC A;  1PEV A;  3I8E A;  2XDW A;  4G1E A;  5EML B;  2AGZ A;  3SN6 B;  4J0W A;  4GGD A;  2VDQ A;  3EG6 A;  1E5T A;  2BKL A;  3B7F A;  3F3G A;  4MMY A;  3IJ0 A;  2J56 H;  5HE2 B;  1GOF A;  5HYN B;  4FA9 D;  4E54 A;  1YR2 A;  1VZ3 A;  5CXC A;  4H5J A;  5TF2 A;  4O1Q D;  4E5Z A;  4FHL A;  2MTA H;  2Q7Q A;  3OKY A;  3DXM C;  3OKW A;  2AGX A;  2EBS A;  4JT5 C;  4ESG A;  3P4F A;  4XYI A;  1K32 A;  2TRC B;  4PSW B;  2B4E A;  4AEZ A;  4FAN D;  4ZOX A;  3JZG A;  3K72 A;  4J77 A;  4H5I A;  4A11 B;  4O2W A;  4J84 A;  3PSL A;  4NC4 A;  4DNV A;  4O3U B;  1BPO A;  3ZDY A;  3GC3 B;  4BH6 A;  4AN0 A;  1QFS A;  3RSE C;  4O3T B;  4FA1 D;  2PM9 A;  4X60 B;  3OL2 B;  3OF7 A;  4WK0 A;  4CI2 A;  1VYH C;  5C86 A;  1JOF A;  3C5M A;  1M1X A;  2OK4 A;  4GQ1 A;  5HQG A;  5K1C C;  1VE7 A;  2HES X;  1E8N A;  4PC0 A;  3SCY A;  4AN1 A;  2AQ5 A;  2OVP B;  5FQD A;  5JWZ A;  1S4U X;  4J8B A;  4O45 A;  4JT6 C;  1GOH A;  5H17 A;  5C9Z B;  3SXT D;  5CXC B;  3K26 A;  3UVM A;  4J81 A;  3GD1 I;  5E6U A;  3OKY B;  5C2V B;  4X61 B;  1SQJ A;  4XEI C;  5EAM A;  3J81 g;  4LG9 A;  3N0E A;  4J87 A;  5HE0 B;  3MUN A;  3EI1 A;  2IUV A;  1E8M A;  1H2Z A;  5FKT A;  4K3J B;  2AGW A;  4WK2 A;  2GC7 A;  2AGY A;  2CO0 A;  2HKR A;  2I0S A;  2P9S C;  4A11 A;  1JV2 A;  1OLZ A;  5E6R A;  2H9P A;  4CZV A;  2CE8 A;  3K71 A;  3SWS D;  2W18 A;  5M5R A;  3DSM A;  3L4M D;  3NVX A;  3FGB A;  3C75 H;  3IUR A;  4L3G D;  3EI3 A;  3O4G A;  4A0A A;  1UTC A;  2XU7 A;  2PM9 B;  4X3E A;  3UVN A;  2IUP A;  1JMZ B;  4A09 B;  3SFZ A;  4BP9 A;  3T3P A;  3VGZ A;  2P9I C;  5EAL A;  2HJ4 A;  4J86 A;  2VDO A;  3JZN A;  5GMK n;  3ZWL B;  5GXI A;  3RRM C;  1PBY B;  4MMX A;  5C92 A;  4WJK A;  5FKQ A;  3IJ1 A;  5EMM B;  3PXS D;  3ZE1 A;  2P9N C;  1JMX B;  3NVQ A;  2XE4 A;  1N6D A;  2P9K C;  4MMZ A;  2HYE A;  4A08 B;  3MKQ A;  2QR5 A;  5FLX g;  1U4C A;  3UKU C;  3W15 A;  3JZH A;  2CN2 A;  3UVL A;  3KCI A;  2H9N A;  1U2V C;  4N14 A;  4BL0 A;  3IJE A;  3AFC A;  5THA A;  2VZ3 A;  1TYE A;  4FA4 D;  4J78 A;  5KDO B;  3EI1 B;  4GZ8 A;  1JJU B;  2VDM A;  1XHM A;  4CZY A;  5I5I A;  1JTD B;  3EQ7 A;  5TEF A;  1GOG A;  1L5G A;  2HU7 A;  3SLE D;  2H6K A;  5CYK A;  2BCJ B;  1GG2 B;  2AH0 A;  4A0A B;  3EI3 B;  2VDK A;  3SVW D;  4RE5 A;  4J73 A;  4A09 A;  3PXW D;  1PI6 A;  2J55 H;  3IUL A;  1FWX A;  1N6F A;  4MK0 B;  5HDB A;  3JRO A;  4CY5 A;  3V5W B;  5FKS A;  4TZ4 A;  3T3M A;  3DXK C;  5E6S A;  4UM8 A;  3A0F A;  3OW8 A;  5SXM A;  3CFV A;  4FAV D;  4L3H D;  3C99 A;  4J8G A;  2H9M A;  1L0Q A;  2B5M A;  3UVK A;  4O9D A;  3CFS B;  4CI3 A;  4A08 A;  3ZE2 A;  1ERJ A;  4PBZ A;  2P9U C;  1GP2 B;  3EI4 B;  5M61 A;  4PBY A;  2VC2 A;  1OMW B; 
#chains in the Genus database with same CATH homology
 3JRP A;  5HE1 B;  2H6Q A;  3N0D A;  1XIP A;  3RFG A;  3PE7 A;  2H9L A;  3MZK A;  2OK6 A;  5IGO A;  2BBK H;  3BWS A;  4Y7R A;  3V9F A;  3PXT D;  2I3T A;  5CYK B;  3L4O D;  2B5L A;  5IJ7 E;  3PVW B;  2PM6 B;  3JB9 L;  4PNK B;  4ZN4 A;  4ES0 A;  2QXV A;  3UKR C;  4ZOY A;  5FA5 B;  1SQ9 A;  4OZU A;  2XL3 A;  4A0B A;  1TYQ C;  2CO0 C;  3C9C A;  1XKS A;  3HFQ A;  2I0R A;  3SMR A;  2H47 A;  3RFH A;  2YMU A;  4XYH A;  2Z2P A;  2H3X A;  4QT8 A;  5EAP A;  3ULE C;  4ERY A;  3AL8 A;  3RN1 D;  2I3S A;  3EI4 A;  2I0T A;  2P9P C;  3MKS B;  2O9K A;  3BG0 A;  4J79 A;  4UI9 R;  3ODT A;  3PVU B;  1K8K C;  2G99 A;  3JAM g;  3I7N A;  2AH1 A;  2CN3 A;  2YBA A;  4D6V A;  3IIY A;  2HJB A;  3PSC B;  5TDH B;  3AL9 A;  4X63 B;  4JSV C;  4CZX A;  4A2L A;  1MG3 A;  4L9O A;  4CI8 A;  5IGQ A;  4A2M A;  3J80 g;  4A0B B;  5EMK B;  4HDJ A;  4U1E I;  3FRX A;  4FA5 D;  3I7K A;  5AMS A;  3KRX B;  1SHY B;  1B9X A;  3KRW B;  2H14 A;  2YNN A;  4LGN A;  1P22 A;  5FKR A;  2Z2N A;  4GGA A;  3VH0 A;  5TEE A;  4GM3 A;  2G9A A;  3AL8 B;  1RI6 A;  4GQ2 P;  3E0C A;  2UZY B;  4FB1 D;  5AFU 3;  3SHF A;  1N6E A;  3MMY A;  2OVR B;  2YNO A;  2H68 A;  4R7A B;  4CI1 A;  3I7P A;  5EM2 B;  2J57 G;  1NR0 A;  3FM0 A;  5AJA A;  4D0K A;  4NSX A;  4KFM B;  3GFC A;  4ERQ A;  5GXH A;  2UZX B;  5EAR A;  3DM0 A;  4G56 B;  3I7L A;  4YVD A;  1QNI A;  2HKM A;  4JSX C;  5H1M A;  2OIZ A;  4JD2 C;  3UR4 A;  4A7J A;  2XL2 A;  4GQB B;  4L1Q D;  3I7H A;  3SBQ A;  3MZL A;  3GRE A;  5I5J A;  4Z8L A;  1MDA H;  2IWK A;  5K19 A;  3IJC A;  4QL1 A;  2OVQ B;  2GC4 A;  5B4W A;  5A2Q g;  3DWL C;  3I7O A;  2IAA A;  4IMM A;  4Y5R D;  4CY3 A;  3F3P A;  2Z2O A;  3OKT A;  1YFQ A;  5HE3 B;  4JXM A;  2IWF A;  5EMJ B;  3ORV D;  1Q47 A;  3F3F A;  4I79 A;  5IJ8 E;  1A0R B;  3IIW A;  3JPX A;  3U4Y A;  3RLM D;  2YNP A;  4QRJ A;  4ZOZ A;  5FXY A;  3OTT A;  3SJL D;  4PXW A;  5EM2 A;  4ZOV A;  4CY1 A;  3EI2 A;  3MXX A;  3NVN A;  3I2N A;  3I89 A;  2YB8 B;  4CY2 A;  3BG1 A;  5CXB A;  3IKO A;  3EWE A;  4LG8 A;  2OJY A;  2XYI A;  3CIK B;  4J0X A;  2P9L C;  4BUJ C;  4EWR A;  3RMZ D;  4JSP C;  5I5M A;  1TBG A;  2B5N A;  4PSX B;  5IC7 A;  2IUQ A;  3SBR A;  4E54 B;  2CE9 A;  3V7D B;  5H14 A;  4GM8 A;  1PGU A;  4AOW A;  2GNQ A;  4JSN C;  2QC5 A;  3AH8 B;  2H13 A;  2IUR A;  3SBP A;  4GMB A;  4E5Z B;  3K27 A;  4GM9 A;  2H6N A;  4K3I D;  3VA6 A;  4U7A A;  4QQE A;  1MG2 A;  3I8C A;  5IT9 g;  2HXC A;  3RN0 D;  5C2W B;  1GXR A;  2PBI B;  1GOT B;  4IA9 A;  2PM7 B;  2CNX A;  1NEX B;  4J82 A;  4OWR A;  1R5M A;  3EI2 B;  4FWW A;  5GSA A;  4CC9 A;  5CXB B;  3OL2 A;  4ERZ A;  2AGL A;  3UVO A;  3EMH A;  1B9Y A;  3EU7 A;  4GGC A;  1PEV A;  3I8E A;  5EML B;  2AGZ A;  3SN6 B;  4J0W A;  4GGD A;  3EG6 A;  3B7F A;  3F3G A;  3IJ0 A;  2J56 H;  5HE2 B;  5HYN B;  4FA9 D;  4E54 A;  5CXC A;  4H5J A;  5TF2 A;  4O1Q D;  4E5Z A;  4FHL A;  2MTA H;  2Q7Q A;  3OKY A;  3DXM C;  3OKW A;  2AGX A;  2EBS A;  4JT5 C;  4ESG A;  3P4F A;  4XYI A;  1K32 A;  2TRC B;  4PSW B;  2B4E A;  4AEZ A;  4FAN D;  4ZOX A;  3JZG A;  4J77 A;  4H5I A;  4A11 B;  4J84 A;  3PSL A;  4O3U B;  4BH6 A;  3RSE C;  4O3T B;  4FA1 D;  2PM9 A;  4X60 B;  3OL2 B;  4CI2 A;  1VYH C;  1JOF A;  3C5M A;  2OK4 A;  4GQ1 A;  5HQG A;  5K1C C;  2HES X;  3SCY A;  4PC0 A;  2AQ5 A;  2OVP B;  5FQD A;  5JWZ A;  1S4U X;  4J8B A;  4O45 A;  4JT6 C;  5H17 A;  5C9Z B;  3SXT D;  5CXC B;  3K26 A;  3UVM A;  4J81 A;  5C2V B;  3OKY B;  4X61 B;  1SQJ A;  4XEI C;  5EAM A;  3J81 g;  4LG9 A;  4J87 A;  3N0E A;  5HE0 B;  3EI1 A;  2IUV A;  5FKT A;  4K3J B;  2AGW A;  2GC7 A;  2AGY A;  2CO0 A;  2HKR A;  2I0S A;  2P9S C;  4A11 A;  1OLZ A;  2H9P A;  4CZV A;  2CE8 A;  3SWS D;  2W18 A;  3DSM A;  3L4M D;  3NVX A;  3FGB A;  3C75 H;  4L3G D;  4A0A A;  3EI3 A;  2XU7 A;  2PM9 B;  4X3E A;  3UVN A;  2IUP A;  1JMZ B;  4A09 B;  3SFZ A;  3VGZ A;  2P9I C;  5EAL A;  2HJ4 A;  4J86 A;  3JZN A;  5GMK n;  3ZWL B;  5GXI A;  3RRM C;  1PBY B;  5FKQ A;  3IJ1 A;  5EMM B;  3PXS D;  2P9N C;  1JMX B;  3NVQ A;  1N6D A;  2P9K C;  2HYE A;  4A08 B;  3MKQ A;  5FLX g;  1U4C A;  3UKU C;  3W15 A;  3JZH A;  2CN2 A;  3UVL A;  2H9N A;  1U2V C;  4N14 A;  4BL0 A;  3AFC A;  5THA A;  4FA4 D;  5KDO B;  3EI1 B;  4J78 A;  4GZ8 A;  1JJU B;  1XHM A;  4CZY A;  5I5I A;  5TEF A;  3SLE D;  2H6K A;  5CYK A;  2BCJ B;  1GG2 B;  2AH0 A;  4A0A B;  3EI3 B;  3SVW D;  4J73 A;  4A09 A;  3PXW D;  1PI6 A;  2J55 H;  1FWX A;  1N6F A;  4MK0 B;  3JRO A;  4CY5 A;  3V5W B;  5FKS A;  4TZ4 A;  3DXK C;  3A0F A;  3OW8 A;  5SXM A;  3CFV A;  4FAV D;  4L3H D;  3C99 A;  4J8G A;  2H9M A;  1L0Q A;  2B5M A;  3UVK A;  4O9D A;  3CFS B;  4CI3 A;  4A08 A;  1ERJ A;  4PBZ A;  2P9U C;  1GP2 B;  3EI4 B;  4PBY A;  1OMW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...