2AGZA

Crystal structure of the carbinolamine intermediate in the reductive half-reaction of aromatic amine dehydrogenase (aadh) with tryptamine. f222 form
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
361
structure length
361
Chain Sequence
b'REVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGGT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase
publication title Atomic description of an enzyme reaction dominated by proton tunneling
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 101
structure length 361
sequence length 361
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2agzA01
5IGOA 2OIZA 5IJ7E 2I3TA 3N0EA 5FKRA 3EI3B 3C75H 3I8EA 4GGAA 3VA6A 1QNIA 1B9XA 4NSXA 3EG6A 2B5NA 5IT9g 5GXIA 4QT8A 3UVOA 3MZKA 4I79A 3J80g 2H3XA 4IMMA 2UZXB 4ZOXA 3FM0A 2I0SA 2G99A 2I0TA 4CY3A 2P9KC 5IGQA 5CYKA 2AGXA 2IUPA 2HESX 4ERZA 2H47A 4CC9A 3GREA 3I7PA 4FA4D 3I2NA 2P9NC 4CI8A 2CN3A 3RFHA 5EMJB 5EAMA 3OKTA 3W15A 3P4FA 3SCYA 4GMBA 1N6FA 5FQDA 5I5MA 3JAMg 4GM8A 3HFQA 2AH1A 3A0FA 4ZN4A 1MDAH 4GM9A 4A11A 3IJCA 3DM0A 4JD2C 3SFZA 3FRXA 1XHMA 2I3SA 1SQJA 5EMLB 1JMXB 5KDOB 4X61B 2H68A 4A0BA 3OL2A 1PEVA 2GNQA 2OJYA 5FKQA 3AL8A 4J77A 3EI1B 2Z2OA 2OK6A 4L3HD 2B5MA 4JXMA 2H9NA 1JJUB 3ULEC 2GC4A 2P9IC 4YVDA 1MG3A 2OK4A 4CZVA 3JROA 4J79A 1VYHC 4JSXC 2YBAA 3EI4B 3SHFA 4J8GA 1R5MA 2P9UC 2UZYB 3EU7A 4E54A 3MKQA 5TEEA 5B4WA 2YNPA 3V9FA 2P9SC 4J84A 2H14A 2TRCB 3AH8B 4A08B 3DWLC 2XU7A 5CXBB 1PGUA 3BG0A 3L4MD 4ZOYA 1A0RB 5C2WB 3EI2A 2QXVA 5SXMA 3K27A 4Y7RA 3I7NA 3I7LA 3IIWA 3PE7A 4JSVC 3RSEC 2BCJB 4A09B 2AGZA 5TEFA 1SHYB 4LG9A 3RFGA 5EAPA 5EMMB 2J56H 3E0CA 5GMKn 5H14A 3FGBA 3PVWB 2B4EA 4ZOZA 2O9KA 4FWWA 3V5WB 4U1EI 3U4YA 2IAAA 4E5ZA 2HKRA 1K32A 4GZ8A 1RI6A 3GFCA 5K1CC 5EMKB 4O3UB 3SJLD 3SBPA 2AH0A 2XYIA 5AJAA 1TBGA 5CXCA 2EBSA 4ZOVA 3SVWD 4O3TB 4A0AA 2IURA 4J8BA 4BH6A 1U4CA 2PBIB 5H17A 4D0KA 4A7JA 2H6KA 3I7KA 4AEZA 4K3JB 4OWRA 5CYKB 3J81g 1B9YA 4FA5D 4A2MA 2IWKA 3NVXA 5FKTA 4J81A 4PSWB 3MKSB 2YNNA 2PM9B 2HYEA 2CN2A 4Y5RD 3NVNA 5I5IA 1S4UX 5C2VB 4J82A 3MZLA 5I5JA 4ESGA 2H6QA 5AMSA 4MK0B 4CI2A 3K26A 3F3FA 1MG2A 5GSAA 4J87A 4BUJC 3AL9A 3UR4A 4ERYA 1ERJA 3I7OA 4KFMB 1N6DA 5EARA 3RRMC 2AGLA 2CE8A 3I8CA 4O45A 2I0RA 4J73A 2HJBA 1PI6A 5K19A 3JRPA 3OTTA 5JWZA 5FKSA 5HE0B 2MTAH 3OL2B 5TDHB 1NR0A 4XYIA 4PSXB 4OZUA 3KRXB 4CZYA 2PM6B 1YFQA 3C9CA 4GGDA 5A2Qg 3UVLA 3N0DA 4GGCA 4X60B 3ZWLB 5IC7A 2BBKH 4GQ1A 1P22A 4H5JA 4HDJA 4H5IA 3IKOA 4O9DA 4U7AA 2W18A 2H9MA 2YB8B 2P9PC 2YMUA 5GXHA 3C5MA 3AFCA 5H1MA 3UKUC 3NVQA 4XEIC 1U2VC 4FHLA 3BG1A 4AOWA 4L3GD 3RN0D 2OVRB 3V7DB 3VH0A 2AGYA 3KRWB 3PSCB 4GM3A 3MMYA 3DSMA 4TZ4A 3SBQA 4FB1D 4GQ2P 4CY1A 4O1QD 2AGWA 5CXBA 4QRJA 2Z2PA 5EM2B 1GXRA 5HE2B 5FXYA 3UVKA 1GOTB 4G56B 4LGNA 3VGZA 3IJ1A 4A09A 3RLMD 2GC7A 1JOFA 1PBYB 2Z2NA 2HKMA 2XL2A 4CY5A 3OKYA 3B7FA 4L1QD 4JSNC 1XKSA 2H9PA 2G9AA 4JSPC 5EALA 5CXCB 3SWSD 3JB9L 4A0AB 3ODTA 3EI3A 1OMWB 2AQ5A 4UI9R 4R7AB 2J55H 4JT6C 4QL1A 5AFU3 5C9ZB 3BWSA 3SXTD 2H6NA 3IIYA 2J57G 3F3PA 1Q47A 3PXWD 3SLED 3PVUB 2IWFA 5HQGA 5THAA 3PXSD 5HE3B 1L0QA 4ERQA 4ES0A 3DXKC 3RN1D 1XIPA 3EWEA 2PM9A 4CI1A 4PBZA 2HXCA 1GG2B 3UVNA 3OKWA 4A11B 4FAVD 4L9OA 4LG8A 2QC5A 4FA9D 4J86A 5HYNB 3UKRC 2CE9A 2B5LA 4PXWA 4A0BB 2P9LC 4K3ID 3IJ0A 1JMZB 3CFVA 4J78A 2CO0C 3AL8B 2XL3A 3I89A 4EWRA 2CNXA 4J0WA 2OVPB 1TYQC 3SN6B 5FLXg 1N6EA 2HJ4A 3DXMC 4CI3A 2IUVA 4XYHA 3I7HA 1GP2B 2Q7QA 3ORVD 4X3EA 3EI1A 2H9LA 1K8KC 4E54B 3EMHA 4J0XA 2IUQA 4D6VA 4FAND 4QQEA 3PXTD 3EI4A 4CY2A 4PNKB 2OVQB 4JT5C 3UVMA 4PBYA 3MXXA 3OW8A 4Z8LA 3JZGA 3EI2B 3JPXA 4IA9A 4PC0A 4FA1D 2H13A 5IJ8E 4A08A 5HE1B 3PSLA 3SBRA 3CIKB 1OLZA 4CZXA 4X63B 4BL0A 3F3GA 3SMRA 4E5ZB 4GQBB 1NEXB 2PM7B 3L4OD 4A2LA 3JZHA 1FWXA 4N14A 3OKYB 2CO0A 3C99A 5EM2A 2YNOA 5TF2A 3CFSB 3JZNA 3RMZD 5FA5B 1SQ9A
chains in the Genus database with same CATH superfamily
4NENA 5IGOA 2OIZA 5IJ7E 2I3TA 3N0EA 1UOQA 5FKRA 3EI3B 3C75H 3I8EA 4GGAA 3VA6A 1QNIA 2XE4A 1B9XA 1H2XA 4NSXA 3EG6A 2B5NA 5IT9g 2WQ8A 5GXIA 4QT8A 3UVOA 3MZKA 2QZPA 5M5UA 1VE7A 4I79A 3J80g 3ZE2A 2H3XA 4IMMA 2UZXB 4ZOXA 3FM0A 2I0SA 2G99A 2I0TA 4CY3A 2P9KC 5IGQA 3MUOA 5CYKA 2AGXA 2IUPA 2HESX 4ERZA 2VDOA 2H47A 4CC9A 3FCUA 3QHYB 3GREA 3I7PA 4FA4D 3I2NA 1E8MA 2P9NC 4CI8A 2CN3A 5M5VA 3RFHA 4JHNA 5M61A 5EMJB 5EAMA 3OKTA 3W15A 4NC4A 3P4FA 4BP9A 4G55A 3SCYA 4GMBA 1N6FA 5FQDA 5I5MA 3JAMg 4WJKA 3OF7A 4GM8A 1GOGA 3HFQA 2AH1A 3EQ9A 3VI4A 3A0FA 4BCCA 4ZN4A 1MDAH 4GM9A 4BCDA 3K71A 4A11A 3IJCA 3DM0A 2VDLA 4JD2C 3SFZA 1E8NA 3NIDA 3FRXA 1XHMA 2I3SA 1SQJA 1U8CA 5EMLB 1UOPA 1JMXB 3K6SA 5KDOB 4X61B 2EIDA 2H68A 4A0BA 1E5TA 3OL2A 1PEVA 2GNQA 3IUQA 2OJYA 5FKQA 3AL8A 4J77A 3EI1B 2Z2OA 2OK6A 4L3HD 2B5MA 4JXMA 4AX4A 2H9NA 1JJUB 3ULEC 2GC4A 2P9IC 4YVDA 1MG3A 2OK4A 4CZVA 3JROA 4J79A 1VYHC 5M5SA 4JSXC 2YBAA 3EI4B 3SHFA 4J8GA 1R5MA 2P9UC 2UZYB 3EU7A 4E54A 3MKQA 1H2YA 5TEEA 5B4WA 3MVDK 2HU7A 2YNPA 3IVMA 3V9FA 2P9SC 4J84A 1JV2A 2H14A 2TRCB 3AH8B 4A08B 3DWLC 1O6GA 2XU7A 5CXBB 1PGUA 3BG0A 3L4MD 4ZOYA 1A0RB 5C2WB 3EI2A 2QXVA 5SXMA 3K27A 4Y7RA 3I7NA 3I7LA 3IIWA 3IUMA 3PE7A 4JSVC 3RSEC 2BCJB 4A09B 2AGZA 5TEFA 1SHYB 4LG9A 3RFGA 5EAPA 4AN1A 5EMMB 2J56H 3E0CA 5GMKn 5H14A 3FGBA 3PVWB 2B4EA 3ZDXA 4ZOZA 3V4PA 2O9KA 4FWWA 3V5WB 4U1EI 3U4YA 2HU8A 2IAAA 4E5ZA 2HKRA 1K32A 1H2WA 1TYEA 4WK2A 4GZ8A 1RI6A 3GFCA 5K1CC 5EMKB 4O3UB 3SJLD 3SBPA 5FFOA 2AH0A 2XYIA 5AJAA 1TBGA 5CXCA 2EBSA 4ZOVA 3SVWD 4O3TB 4A0AA 3IJEA 4NAAA 2IURA 4J8BA 4BH6A 1U4CA 2PBIB 5H17A 4RE6A 4A7JA 4D0KA 4UM8A 2H6KA 3FCSA 3I7KA 4AEZA 4K3JB 4OWRA 5CYKB 3J81g 1B9YA 4FA5D 4A2MA 2IWKA 3NVXA 5FKTA 4J81A 4PSWB 3MKSB 2YNNA 2PM9B 2HYEA 2CN2A 4Y5RD 3NVNA 5I5IA 1S4UX 5C2VB 4J82A 3MZLA 5I5JA 4ESGA 2H6QA 5AMSA 4MK0B 4CI2A 3K26A 3F3FA 1MG2A 5GSAA 4J87A 4BUJC 3AL9A 4UM9A 4Z7NA 3UR4A 4ERYA 1ERJA 3I7OA 4KFMB 1N6DA 5EARA 3RRMC 5FFGA 4WK0A 2AGLA 2CE8A 3I8CA 4O45A 2I0RA 4BCBA 1UTCA 4J73A 2HJBA 1PI6A 1H2ZA 5K19A 3K72A 3JRPA 4AN0A 3OTTA 4IRZA 5JWZA 4MMZA 5FKSA 5HE0B 1VZ2A 2MTAH 3OL2B 1NR0A 4XYIA 5TDHB 4PSXB 4OZUA 3KRXB 4CZYA 2PM6B 1YFQA 2VDRA 3C9CA 1I2MB 2EICA 4GGDA 5A2Qg 3UVLA 3N0DA 4GGCA 4X60B 3ZWLB 5IC7A 2BBKH 1T2XA 4GQ1A 4JHPC 1P22A 4H5JA 5C92A 4HDJA 4H5IA 3IKOA 4O9DA 1GOFA 4U7AA 2W18A 2H9MA 2YB8B 2P9PC 2YMUA 1VE6A 3VI3A 5GXHA 3C5MA 3AFCA 5H1MA 3UKUC 4DNVA 3NVQA 4DNUA 4XEIC 1U2VC 4FHLA 3BG1A 4AOWA 4L3GD 3RN0D 2OVRB 3KCIA 4Z7OA 3V7DB 3VH0A 2EIEA 2AGYA 3KRWB 3PSCB 3IUJA 4GM3A 3MMYA 3DSMA 4TZ4A 3SBQA 4FB1D 4GQ2P 4CY1A 4O1QD 2AGWA 5CXBA 4DNWA 4QRJA 5E6UA 2Z2PA 3DDUA 4BP8A 2QR5A 3ZDYA 5EM2B 1GXRA 1VZ3A 4G1MA 5HE2B 5FXYA 3UVKA 1GOTB 4G56B 4LGNA 3VGZA 2VDMA 3IJ1A 4A09A 3RLMD 2GC7A 3O4HA 4NBMA 1JOFA 1PBYB 1A12A 2BKLA 2Z2NA 2HKMA 2XL2A 4CY5A 3OKYA 3B7FA 4L1QD 4JSNC 1XKSA 2H9PA 2G9AA 4JSPC 5EALA 4AMZA 5CXCB 3ZDZA 3SWSD 3JB9L 3O4IA 3ZE0A 3ODTA 4A0AB 3EI3A 1OMWB 2AQ5A 3NIFA 3MUNA 4D9SA 4UI9R 4R7AB 2J55H 2JKXA 3V4VA 1BPOA 4JT6C 2XZGA 4QL1A 3O4GA 5AFU3 2VDNA 1K3IA 4O2WA 5C9ZB 3BWSA 3SXTD 2H6NA 3IIYA 2J57G 3F3PA 5E6SA 3ZE1A 3T3PA 1Q47A 2VZ3A 3PXWD 3IULA 3SLED 3PVUB 1L5GA 2IWFA 5HQGA 5THAA 3PXSD 5M5RA 5HE3B 1L0QA 4ERQA 1JTDB 4ES0A 3DXKC 3RN1D 1XIPA 3EWEA 1C9IA 2PM9A 2XDWA 1C9LA 4CI1A 4PBZA 2HXCA 1GG2B 3GC3B 3UVNA 3OKWA 4A11B 5HDBA 4QAMA 1UOOA 4FAVD 4L9OA 4LG8A 2QC5A 5C86A 4FA9D 4J86A 5HYNB 3UKRC 1QFMA 2CE9A 4G1EA 2B5LA 2VDQA 4PXWA 4A0BB 2P9LC 3EQ8A 4K3ID 3IJ0A 3O4JA 1JMZB 3CFVA 4J78A 2CO0C 3AL8B 4O02A 2XL3A 3I89A 4EWRA 2CNXA 4J0WA 2OVPB 1TYQC 3SN6B 5FLXg 1N6EA 2HJ4A 4RE5A 4Z7QA 4MMYA 3DXMC 4CI3A 2IUVA 3IUNA 3IURA 4XYHA 4L1MA 3I7HA 1GP2B 2Q7QA 3ORVD 4X3EA 3EI1A 2H9LA 1K8KC 4E54B 3EMHA 4J0XA 2IUQA 3NIGA 4D6VA 4FAND 1QFSA 4QQEA 3EQ7A 3PXTD 3EI4A 4CY2A 4MMXA 2EIBA 4PNKB 2OVQB 4JT5C 3UVMA 2VDPA 4PBYA 4AMYA 3MXXA 3OW8A 4Z8LA 1GOHA 3QI0A 3JZGA 3EI2B 2HU5A 3JPXA 4IA9A 4PC0A 4FA1D 2H13A 5IJ8E 4A08A 5HE1B 3PSLA 3SBRA 3T3MA 3CIKB 1OLZA 1O6FA 4CZXA 4X63B 5E6RA 4BL0A 3F3GA 3SMRA 5M5TA 4E5ZB 4GQBB 1NEXB 1YR2A 2PM7B 3L4OD 2VDKA 4A2LA 3JZHA 1FWXA 4N14A 3OKYB 2CO0A 3C99A 3GD1I 4WK4A 5EM2A 2VZ1A 2VC2A 2YNOA 5TF2A 3CFSB 3JZNA 1M1XA 3RMZD 5FA5B 1SQ9A
chains in the Genus database with same CATH topology
5IGOA 2OIZA 5IJ7E 2I3TA 3N0EA 5FKRA 3EI3B 3C75H 3I8EA 4GGAA 3VA6A 1QNIA 1B9XA 4NSXA 3EG6A 2B5NA 5IT9g 5GXIA 4QT8A 3UVOA 3MZKA 4I79A 3J80g 2H3XA 4IMMA 2UZXB 4ZOXA 3FM0A 2I0SA 2G99A 2I0TA 4CY3A 2P9KC 5IGQA 5CYKA 2AGXA 2IUPA 2HESX 4ERZA 2H47A 4CC9A 3GREA 3I7PA 4FA4D 3I2NA 2P9NC 4CI8A 2CN3A 3RFHA 5EMJB 5EAMA 3OKTA 3W15A 3P4FA 3SCYA 4GMBA 1N6FA 5FQDA 5I5MA 3JAMg 4GM8A 3HFQA 2AH1A 3A0FA 4ZN4A 1MDAH 4GM9A 4A11A 3IJCA 3DM0A 4JD2C 3SFZA 3FRXA 1XHMA 2I3SA 1SQJA 5EMLB 1JMXB 5KDOB 4X61B 2H68A 4A0BA 3OL2A 1PEVA 2GNQA 2OJYA 5FKQA 3AL8A 4J77A 3EI1B 2Z2OA 2OK6A 4L3HD 2B5MA 4JXMA 2H9NA 1JJUB 3ULEC 2GC4A 2P9IC 4YVDA 1MG3A 2OK4A 4CZVA 3JROA 4J79A 1VYHC 4JSXC 2YBAA 3EI4B 3SHFA 4J8GA 1R5MA 2P9UC 2UZYB 3EU7A 4E54A 3MKQA 5TEEA 5B4WA 2YNPA 3V9FA 2P9SC 4J84A 2H14A 2TRCB 3AH8B 4A08B 3DWLC 2XU7A 5CXBB 1PGUA 3BG0A 3L4MD 4ZOYA 1A0RB 5C2WB 3EI2A 2QXVA 5SXMA 3K27A 4Y7RA 3I7NA 3I7LA 3IIWA 3PE7A 4JSVC 3RSEC 2BCJB 4A09B 2AGZA 5TEFA 1SHYB 4LG9A 3RFGA 5EAPA 5EMMB 2J56H 3E0CA 5GMKn 5H14A 3FGBA 3PVWB 2B4EA 4ZOZA 2O9KA 4FWWA 3V5WB 4U1EI 3U4YA 2IAAA 4E5ZA 2HKRA 1K32A 4GZ8A 1RI6A 3GFCA 5K1CC 5EMKB 4O3UB 3SJLD 3SBPA 2AH0A 2XYIA 5AJAA 1TBGA 5CXCA 2EBSA 4ZOVA 3SVWD 4O3TB 4A0AA 2IURA 4J8BA 4BH6A 1U4CA 2PBIB 5H17A 4D0KA 4A7JA 2H6KA 3I7KA 4AEZA 4K3JB 4OWRA 5CYKB 3J81g 1B9YA 4FA5D 4A2MA 2IWKA 3NVXA 5FKTA 4J81A 4PSWB 3MKSB 2YNNA 2PM9B 2HYEA 2CN2A 4Y5RD 3NVNA 5I5IA 1S4UX 5C2VB 4J82A 3MZLA 5I5JA 4ESGA 2H6QA 5AMSA 4MK0B 4CI2A 3K26A 3F3FA 1MG2A 5GSAA 4J87A 4BUJC 3AL9A 3UR4A 4ERYA 1ERJA 3I7OA 4KFMB 1N6DA 5EARA 3RRMC 2AGLA 2CE8A 3I8CA 4O45A 2I0RA 4J73A 2HJBA 1PI6A 5K19A 3JRPA 3OTTA 5JWZA 5FKSA 5HE0B 2MTAH 3OL2B 5TDHB 1NR0A 4XYIA 4PSXB 4OZUA 3KRXB 4CZYA 2PM6B 1YFQA 3C9CA 4GGDA 5A2Qg 3UVLA 3N0DA 4GGCA 4X60B 3ZWLB 5IC7A 2BBKH 4GQ1A 1P22A 4H5JA 4HDJA 4H5IA 3IKOA 4O9DA 4U7AA 2W18A 2H9MA 2YB8B 2P9PC 2YMUA 5GXHA 3C5MA 3AFCA 5H1MA 3UKUC 3NVQA 4XEIC 1U2VC 4FHLA 3BG1A 4AOWA 4L3GD 3RN0D 2OVRB 3V7DB 3VH0A 2AGYA 3KRWB 3PSCB 4GM3A 3MMYA 3DSMA 4TZ4A 3SBQA 4FB1D 4GQ2P 4CY1A 4O1QD 2AGWA 5CXBA 4QRJA 2Z2PA 5EM2B 1GXRA 5HE2B 5FXYA 3UVKA 1GOTB 4G56B 4LGNA 3VGZA 3IJ1A 4A09A 3RLMD 2GC7A 1JOFA 1PBYB 2Z2NA 2HKMA 2XL2A 4CY5A 3OKYA 3B7FA 4L1QD 4JSNC 1XKSA 2H9PA 2G9AA 4JSPC 5EALA 5CXCB 3SWSD 3JB9L 4A0AB 3ODTA 3EI3A 1OMWB 2AQ5A 4UI9R 4R7AB 2J55H 4JT6C 4QL1A 5AFU3 5C9ZB 3BWSA 3SXTD 2H6NA 3IIYA 2J57G 3F3PA 1Q47A 3PXWD 3SLED 3PVUB 2IWFA 5HQGA 5THAA 3PXSD 5HE3B 1L0QA 4ERQA 4ES0A 3DXKC 3RN1D 1XIPA 3EWEA 2PM9A 4CI1A 4PBZA 2HXCA 1GG2B 3UVNA 3OKWA 4A11B 4FAVD 4L9OA 4LG8A 2QC5A 4FA9D 4J86A 5HYNB 3UKRC 2CE9A 2B5LA 4PXWA 4A0BB 2P9LC 4K3ID 3IJ0A 1JMZB 3CFVA 4J78A 2CO0C 3AL8B 2XL3A 3I89A 4EWRA 2CNXA 4J0WA 2OVPB 1TYQC 3SN6B 5FLXg 1N6EA 2HJ4A 3DXMC 4CI3A 2IUVA 4XYHA 3I7HA 1GP2B 2Q7QA 3ORVD 4X3EA 3EI1A 2H9LA 1K8KC 4E54B 3EMHA 4J0XA 2IUQA 4D6VA 4FAND 4QQEA 3PXTD 3EI4A 4CY2A 4PNKB 2OVQB 4JT5C 3UVMA 4PBYA 3MXXA 3OW8A 4Z8LA 3JZGA 3EI2B 3JPXA 4IA9A 4PC0A 4FA1D 2H13A 5IJ8E 4A08A 5HE1B 3PSLA 3SBRA 3CIKB 1OLZA 4CZXA 4X63B 4BL0A 3F3GA 3SMRA 4E5ZB 4GQBB 1NEXB 2PM7B 3L4OD 4A2LA 3JZHA 1FWXA 4N14A 3OKYB 2CO0A 3C99A 5EM2A 2YNOA 5TF2A 3CFSB 3JZNA 3RMZD 5FA5B 1SQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IGO A;  2OIZ A;  5IJ7 E;  2I3T A;  3N0E A;  5FKR A;  3EI3 B;  3C75 H;  3I8E A;  4GGA A;  3VA6 A;  1QNI A;  1B9X A;  4NSX A;  3EG6 A;  2B5N A;  5IT9 g;  5GXI A;  4QT8 A;  3UVO A;  3MZK A;  4I79 A;  3J80 g;  2H3X A;  4IMM A;  2UZX B;  4ZOX A;  3FM0 A;  2I0S A;  2G99 A;  2I0T A;  4CY3 A;  2P9K C;  5IGQ A;  5CYK A;  2AGX A;  2IUP A;  2HES X;  4ERZ A;  2H47 A;  4CC9 A;  3GRE A;  3I7P A;  4FA4 D;  3I2N A;  2P9N C;  4CI8 A;  2CN3 A;  3RFH A;  5EMJ B;  5EAM A;  3OKT A;  3W15 A;  3P4F A;  3SCY A;  4GMB A;  1N6F A;  5FQD A;  5I5M A;  3JAM g;  4GM8 A;  3HFQ A;  2AH1 A;  3A0F A;  4ZN4 A;  1MDA H;  4GM9 A;  4A11 A;  3IJC A;  3DM0 A;  4JD2 C;  3SFZ A;  3FRX A;  1XHM A;  2I3S A;  1SQJ A;  5EML B;  1JMX B;  5KDO B;  4X61 B;  2H68 A;  4A0B A;  3OL2 A;  1PEV A;  2GNQ A;  2OJY A;  5FKQ A;  3AL8 A;  4J77 A;  3EI1 B;  2Z2O A;  2OK6 A;  4L3H D;  2B5M A;  4JXM A;  2H9N A;  1JJU B;  3ULE C;  2GC4 A;  2P9I C;  4YVD A;  1MG3 A;  2OK4 A;  4CZV A;  3JRO A;  4J79 A;  1VYH C;  4JSX C;  2YBA A;  3EI4 B;  3SHF A;  4J8G A;  1R5M A;  2P9U C;  2UZY B;  3EU7 A;  4E54 A;  3MKQ A;  5TEE A;  5B4W A;  2YNP A;  3V9F A;  2P9S C;  4J84 A;  2H14 A;  2TRC B;  3AH8 B;  4A08 B;  3DWL C;  2XU7 A;  5CXB B;  1PGU A;  3BG0 A;  3L4M D;  4ZOY A;  1A0R B;  5C2W B;  3EI2 A;  2QXV A;  5SXM A;  3K27 A;  4Y7R A;  3I7N A;  3I7L A;  3IIW A;  3PE7 A;  4JSV C;  3RSE C;  2BCJ B;  4A09 B;  2AGZ A;  5TEF A;  1SHY B;  4LG9 A;  3RFG A;  5EAP A;  5EMM B;  2J56 H;  3E0C A;  5GMK n;  5H14 A;  3FGB A;  3PVW B;  2B4E A;  4ZOZ A;  2O9K A;  4FWW A;  3V5W B;  4U1E I;  3U4Y A;  2IAA A;  4E5Z A;  2HKR A;  1K32 A;  4GZ8 A;  1RI6 A;  3GFC A;  5K1C C;  5EMK B;  4O3U B;  3SJL D;  3SBP A;  2AH0 A;  2XYI A;  5AJA A;  1TBG A;  5CXC A;  2EBS A;  4ZOV A;  3SVW D;  4O3T B;  4A0A A;  2IUR A;  4J8B A;  4BH6 A;  1U4C A;  2PBI B;  5H17 A;  4D0K A;  4A7J A;  2H6K A;  3I7K A;  4AEZ A;  4K3J B;  4OWR A;  5CYK B;  3J81 g;  1B9Y A;  4FA5 D;  4A2M A;  2IWK A;  3NVX A;  5FKT A;  4J81 A;  4PSW B;  3MKS B;  2YNN A;  2PM9 B;  2HYE A;  2CN2 A;  4Y5R D;  3NVN A;  5I5I A;  1S4U X;  5C2V B;  4J82 A;  3MZL A;  5I5J A;  4ESG A;  2H6Q A;  5AMS A;  4MK0 B;  4CI2 A;  3K26 A;  3F3F A;  1MG2 A;  5GSA A;  4J87 A;  4BUJ C;  3AL9 A;  3UR4 A;  4ERY A;  1ERJ A;  3I7O A;  4KFM B;  1N6D A;  5EAR A;  3RRM C;  2AGL A;  2CE8 A;  3I8C A;  4O45 A;  2I0R A;  4J73 A;  2HJB A;  1PI6 A;  5K19 A;  3JRP A;  3OTT A;  5JWZ A;  5FKS A;  5HE0 B;  2MTA H;  3OL2 B;  5TDH B;  1NR0 A;  4XYI A;  4PSX B;  4OZU A;  3KRX B;  4CZY A;  2PM6 B;  1YFQ A;  3C9C A;  4GGD A;  5A2Q g;  3UVL A;  3N0D A;  4GGC A;  4X60 B;  3ZWL B;  5IC7 A;  2BBK H;  4GQ1 A;  1P22 A;  4H5J A;  4HDJ A;  4H5I A;  3IKO A;  4O9D A;  4U7A A;  2W18 A;  2H9M A;  2YB8 B;  2P9P C;  2YMU A;  5GXH A;  3C5M A;  3AFC A;  5H1M A;  3UKU C;  3NVQ A;  4XEI C;  1U2V C;  4FHL A;  3BG1 A;  4AOW A;  4L3G D;  3RN0 D;  2OVR B;  3V7D B;  3VH0 A;  2AGY A;  3KRW B;  3PSC B;  4GM3 A;  3MMY A;  3DSM A;  4TZ4 A;  3SBQ A;  4FB1 D;  4GQ2 P;  4CY1 A;  4O1Q D;  2AGW A;  5CXB A;  4QRJ A;  2Z2P A;  5EM2 B;  1GXR A;  5HE2 B;  5FXY A;  3UVK A;  1GOT B;  4G56 B;  4LGN A;  3VGZ A;  3IJ1 A;  4A09 A;  3RLM D;  2GC7 A;  1JOF A;  1PBY B;  2Z2N A;  2HKM A;  2XL2 A;  4CY5 A;  3OKY A;  3B7F A;  4L1Q D;  4JSN C;  1XKS A;  2H9P A;  2G9A A;  4JSP C;  5EAL A;  5CXC B;  3SWS D;  3JB9 L;  4A0A B;  3ODT A;  3EI3 A;  1OMW B;  2AQ5 A;  4UI9 R;  4R7A B;  2J55 H;  4JT6 C;  4QL1 A;  5AFU 3;  5C9Z B;  3BWS A;  3SXT D;  2H6N A;  3IIY A;  2J57 G;  3F3P A;  1Q47 A;  3PXW D;  3SLE D;  3PVU B;  2IWF A;  5HQG A;  5THA A;  3PXS D;  5HE3 B;  1L0Q A;  4ERQ A;  4ES0 A;  3DXK C;  3RN1 D;  1XIP A;  3EWE A;  2PM9 A;  4CI1 A;  4PBZ A;  2HXC A;  1GG2 B;  3UVN A;  3OKW A;  4A11 B;  4FAV D;  4L9O A;  4LG8 A;  2QC5 A;  4FA9 D;  4J86 A;  5HYN B;  3UKR C;  2CE9 A;  2B5L A;  4PXW A;  4A0B B;  2P9L C;  4K3I D;  3IJ0 A;  1JMZ B;  3CFV A;  4J78 A;  2CO0 C;  3AL8 B;  2XL3 A;  3I89 A;  4EWR A;  2CNX A;  4J0W A;  2OVP B;  1TYQ C;  3SN6 B;  5FLX g;  1N6E A;  2HJ4 A;  3DXM C;  4CI3 A;  2IUV A;  4XYH A;  3I7H A;  1GP2 B;  2Q7Q A;  3ORV D;  4X3E A;  3EI1 A;  2H9L A;  1K8K C;  4E54 B;  3EMH A;  4J0X A;  2IUQ A;  4D6V A;  4FAN D;  4QQE A;  3PXT D;  3EI4 A;  4CY2 A;  4PNK B;  2OVQ B;  4JT5 C;  3UVM A;  4PBY A;  3MXX A;  3OW8 A;  4Z8L A;  3JZG A;  3EI2 B;  3JPX A;  4IA9 A;  4PC0 A;  4FA1 D;  2H13 A;  5IJ8 E;  4A08 A;  5HE1 B;  3PSL A;  3SBR A;  3CIK B;  1OLZ A;  4CZX A;  4X63 B;  4BL0 A;  3F3G A;  3SMR A;  4E5Z B;  4GQB B;  1NEX B;  2PM7 B;  3L4O D;  4A2L A;  3JZH A;  1FWX A;  4N14 A;  3OKY B;  2CO0 A;  3C99 A;  5EM2 A;  2YNO A;  5TF2 A;  3CFS B;  3JZN A;  3RMZ D;  5FA5 B;  1SQ9 A; 
#chains in the Genus database with same CATH topology
 4NEN A;  5IGO A;  2OIZ A;  5IJ7 E;  2I3T A;  3N0E A;  1UOQ A;  5FKR A;  3EI3 B;  3C75 H;  3I8E A;  4GGA A;  3VA6 A;  1QNI A;  2XE4 A;  1B9X A;  1H2X A;  4NSX A;  3EG6 A;  2B5N A;  5IT9 g;  2WQ8 A;  5GXI A;  4QT8 A;  3UVO A;  3MZK A;  2QZP A;  5M5U A;  1VE7 A;  4I79 A;  3J80 g;  3ZE2 A;  2H3X A;  4IMM A;  2UZX B;  4ZOX A;  3FM0 A;  2I0S A;  2G99 A;  2I0T A;  4CY3 A;  2P9K C;  5IGQ A;  3MUO A;  5CYK A;  2AGX A;  2IUP A;  2HES X;  4ERZ A;  2VDO A;  2H47 A;  4CC9 A;  3FCU A;  3QHY B;  3GRE A;  3I7P A;  4FA4 D;  3I2N A;  1E8M A;  2P9N C;  4CI8 A;  2CN3 A;  5M5V A;  3RFH A;  4JHN A;  5M61 A;  5EMJ B;  5EAM A;  3OKT A;  3W15 A;  4NC4 A;  3P4F A;  4BP9 A;  4G55 A;  3SCY A;  4GMB A;  1N6F A;  5FQD A;  5I5M A;  3JAM g;  4WJK A;  3OF7 A;  4GM8 A;  1GOG A;  3HFQ A;  2AH1 A;  3EQ9 A;  3VI4 A;  3A0F A;  4BCC A;  4ZN4 A;  1MDA H;  4GM9 A;  4BCD A;  3K71 A;  4A11 A;  3IJC A;  3DM0 A;  2VDL A;  4JD2 C;  3SFZ A;  1E8N A;  3NID A;  3FRX A;  1XHM A;  2I3S A;  1SQJ A;  1U8C A;  5EML B;  1UOP A;  1JMX B;  3K6S A;  5KDO B;  4X61 B;  2EID A;  2H68 A;  4A0B A;  1E5T A;  3OL2 A;  1PEV A;  2GNQ A;  3IUQ A;  2OJY A;  5FKQ A;  3AL8 A;  4J77 A;  3EI1 B;  2Z2O A;  2OK6 A;  4L3H D;  2B5M A;  4JXM A;  4AX4 A;  2H9N A;  1JJU B;  3ULE C;  2GC4 A;  2P9I C;  4YVD A;  1MG3 A;  2OK4 A;  4CZV A;  3JRO A;  4J79 A;  1VYH C;  5M5S A;  4JSX C;  2YBA A;  3EI4 B;  3SHF A;  4J8G A;  1R5M A;  2P9U C;  2UZY B;  3EU7 A;  4E54 A;  3MKQ A;  1H2Y A;  5TEE A;  5B4W A;  3MVD K;  2HU7 A;  2YNP A;  3IVM A;  3V9F A;  2P9S C;  4J84 A;  1JV2 A;  2H14 A;  2TRC B;  3AH8 B;  4A08 B;  3DWL C;  1O6G A;  2XU7 A;  5CXB B;  1PGU A;  3BG0 A;  3L4M D;  4ZOY A;  1A0R B;  5C2W B;  3EI2 A;  2QXV A;  5SXM A;  3K27 A;  4Y7R A;  3I7N A;  3I7L A;  3IIW A;  3IUM A;  3PE7 A;  4JSV C;  3RSE C;  2BCJ B;  4A09 B;  2AGZ A;  5TEF A;  1SHY B;  4LG9 A;  3RFG A;  5EAP A;  4AN1 A;  5EMM B;  2J56 H;  3E0C A;  5GMK n;  5H14 A;  3FGB A;  3PVW B;  2B4E A;  3ZDX A;  4ZOZ A;  3V4P A;  2O9K A;  4FWW A;  3V5W B;  4U1E I;  3U4Y A;  2HU8 A;  2IAA A;  4E5Z A;  2HKR A;  1K32 A;  1H2W A;  1TYE A;  4WK2 A;  4GZ8 A;  1RI6 A;  3GFC A;  5K1C C;  5EMK B;  4O3U B;  3SJL D;  3SBP A;  5FFO A;  2AH0 A;  2XYI A;  5AJA A;  1TBG A;  5CXC A;  2EBS A;  4ZOV A;  3SVW D;  4O3T B;  4A0A A;  3IJE A;  4NAA A;  2IUR A;  4J8B A;  4BH6 A;  1U4C A;  2PBI B;  5H17 A;  4RE6 A;  4A7J A;  4D0K A;  4UM8 A;  2H6K A;  3FCS A;  3I7K A;  4AEZ A;  4K3J B;  4OWR A;  5CYK B;  3J81 g;  1B9Y A;  4FA5 D;  4A2M A;  2IWK A;  3NVX A;  5FKT A;  4J81 A;  4PSW B;  3MKS B;  2YNN A;  2PM9 B;  2HYE A;  2CN2 A;  4Y5R D;  3NVN A;  5I5I A;  1S4U X;  5C2V B;  4J82 A;  3MZL A;  5I5J A;  4ESG A;  2H6Q A;  5AMS A;  4MK0 B;  4CI2 A;  3K26 A;  3F3F A;  1MG2 A;  5GSA A;  4J87 A;  4BUJ C;  3AL9 A;  4UM9 A;  4Z7N A;  3UR4 A;  4ERY A;  1ERJ A;  3I7O A;  4KFM B;  1N6D A;  5EAR A;  3RRM C;  5FFG A;  4WK0 A;  2AGL A;  2CE8 A;  3I8C A;  4O45 A;  2I0R A;  4BCB A;  1UTC A;  4J73 A;  2HJB A;  1PI6 A;  1H2Z A;  5K19 A;  3K72 A;  3JRP A;  4AN0 A;  3OTT A;  4IRZ A;  5JWZ A;  4MMZ A;  5FKS A;  5HE0 B;  1VZ2 A;  2MTA H;  3OL2 B;  1NR0 A;  4XYI A;  5TDH B;  4PSX B;  4OZU A;  3KRX B;  4CZY A;  2PM6 B;  1YFQ A;  2VDR A;  3C9C A;  1I2M B;  2EIC A;  4GGD A;  5A2Q g;  3UVL A;  3N0D A;  4GGC A;  4X60 B;  3ZWL B;  5IC7 A;  2BBK H;  1T2X A;  4GQ1 A;  4JHP C;  1P22 A;  4H5J A;  5C92 A;  4HDJ A;  4H5I A;  3IKO A;  4O9D A;  1GOF A;  4U7A A;  2W18 A;  2H9M A;  2YB8 B;  2P9P C;  2YMU A;  1VE6 A;  3VI3 A;  5GXH A;  3C5M A;  3AFC A;  5H1M A;  3UKU C;  4DNV A;  3NVQ A;  4DNU A;  4XEI C;  1U2V C;  4FHL A;  3BG1 A;  4AOW A;  4L3G D;  3RN0 D;  2OVR B;  3KCI A;  4Z7O A;  3V7D B;  3VH0 A;  2EIE A;  2AGY A;  3KRW B;  3PSC B;  3IUJ A;  4GM3 A;  3MMY A;  3DSM A;  4TZ4 A;  3SBQ A;  4FB1 D;  4GQ2 P;  4CY1 A;  4O1Q D;  2AGW A;  5CXB A;  4DNW A;  4QRJ A;  5E6U A;  2Z2P A;  3DDU A;  4BP8 A;  2QR5 A;  3ZDY A;  5EM2 B;  1GXR A;  1VZ3 A;  4G1M A;  5HE2 B;  5FXY A;  3UVK A;  1GOT B;  4G56 B;  4LGN A;  3VGZ A;  2VDM A;  3IJ1 A;  4A09 A;  3RLM D;  2GC7 A;  3O4H A;  4NBM A;  1JOF A;  1PBY B;  1A12 A;  2BKL A;  2Z2N A;  2HKM A;  2XL2 A;  4CY5 A;  3OKY A;  3B7F A;  4L1Q D;  4JSN C;  1XKS A;  2H9P A;  2G9A A;  4JSP C;  5EAL A;  4AMZ A;  5CXC B;  3ZDZ A;  3SWS D;  3JB9 L;  3O4I A;  3ZE0 A;  3ODT A;  4A0A B;  3EI3 A;  1OMW B;  2AQ5 A;  3NIF A;  3MUN A;  4D9S A;  4UI9 R;  4R7A B;  2J55 H;  2JKX A;  3V4V A;  1BPO A;  4JT6 C;  2XZG A;  4QL1 A;  3O4G A;  5AFU 3;  2VDN A;  1K3I A;  4O2W A;  5C9Z B;  3BWS A;  3SXT D;  2H6N A;  3IIY A;  2J57 G;  3F3P A;  5E6S A;  3ZE1 A;  3T3P A;  1Q47 A;  2VZ3 A;  3PXW D;  3IUL A;  3SLE D;  3PVU B;  1L5G A;  2IWF A;  5HQG A;  5THA A;  3PXS D;  5M5R A;  5HE3 B;  1L0Q A;  4ERQ A;  1JTD B;  4ES0 A;  3DXK C;  3RN1 D;  1XIP A;  3EWE A;  1C9I A;  2PM9 A;  2XDW A;  1C9L A;  4CI1 A;  4PBZ A;  2HXC A;  1GG2 B;  3GC3 B;  3UVN A;  3OKW A;  4A11 B;  5HDB A;  4QAM A;  1UOO A;  4FAV D;  4L9O A;  4LG8 A;  2QC5 A;  5C86 A;  4FA9 D;  4J86 A;  5HYN B;  3UKR C;  1QFM A;  2CE9 A;  4G1E A;  2B5L A;  2VDQ A;  4PXW A;  4A0B B;  2P9L C;  3EQ8 A;  4K3I D;  3IJ0 A;  3O4J A;  1JMZ B;  3CFV A;  4J78 A;  2CO0 C;  3AL8 B;  4O02 A;  2XL3 A;  3I89 A;  4EWR A;  2CNX A;  4J0W A;  2OVP B;  1TYQ C;  3SN6 B;  5FLX g;  1N6E A;  2HJ4 A;  4RE5 A;  4Z7Q A;  4MMY A;  3DXM C;  4CI3 A;  2IUV A;  3IUN A;  3IUR A;  4XYH A;  4L1M A;  3I7H A;  1GP2 B;  2Q7Q A;  3ORV D;  4X3E A;  3EI1 A;  2H9L A;  1K8K C;  4E54 B;  3EMH A;  4J0X A;  2IUQ A;  3NIG A;  4D6V A;  4FAN D;  1QFS A;  4QQE A;  3EQ7 A;  3PXT D;  3EI4 A;  4CY2 A;  4MMX A;  2EIB A;  4PNK B;  2OVQ B;  4JT5 C;  3UVM A;  2VDP A;  4PBY A;  4AMY A;  3MXX A;  3OW8 A;  4Z8L A;  1GOH A;  3QI0 A;  3JZG A;  3EI2 B;  2HU5 A;  3JPX A;  4IA9 A;  4PC0 A;  4FA1 D;  2H13 A;  5IJ8 E;  4A08 A;  5HE1 B;  3PSL A;  3SBR A;  3T3M A;  3CIK B;  1OLZ A;  1O6F A;  4CZX A;  4X63 B;  5E6R A;  4BL0 A;  3F3G A;  3SMR A;  5M5T A;  4E5Z B;  4GQB B;  1NEX B;  1YR2 A;  2PM7 B;  3L4O D;  2VDK A;  4A2L A;  3JZH A;  1FWX A;  4N14 A;  3OKY B;  2CO0 A;  3C99 A;  3GD1 I;  4WK4 A;  5EM2 A;  2VZ1 A;  2VC2 A;  2YNO A;  5TF2 A;  3CFS B;  3JZN A;  1M1X A;  3RMZ D;  5FA5 B;  1SQ9 A; 
#chains in the Genus database with same CATH homology
 5IGO A;  2OIZ A;  5IJ7 E;  2I3T A;  3N0E A;  5FKR A;  3EI3 B;  3C75 H;  3I8E A;  4GGA A;  3VA6 A;  1QNI A;  1B9X A;  4NSX A;  3EG6 A;  2B5N A;  5IT9 g;  5GXI A;  4QT8 A;  3UVO A;  3MZK A;  4I79 A;  3J80 g;  2H3X A;  4IMM A;  2UZX B;  4ZOX A;  3FM0 A;  2I0S A;  2G99 A;  2I0T A;  4CY3 A;  2P9K C;  5IGQ A;  5CYK A;  2AGX A;  2IUP A;  2HES X;  4ERZ A;  2H47 A;  4CC9 A;  3GRE A;  3I7P A;  4FA4 D;  3I2N A;  2P9N C;  4CI8 A;  2CN3 A;  3RFH A;  5EMJ B;  5EAM A;  3OKT A;  3W15 A;  3P4F A;  3SCY A;  4GMB A;  1N6F A;  5FQD A;  5I5M A;  3JAM g;  4GM8 A;  3HFQ A;  2AH1 A;  3A0F A;  4ZN4 A;  1MDA H;  4GM9 A;  4A11 A;  3IJC A;  3DM0 A;  4JD2 C;  3SFZ A;  3FRX A;  1XHM A;  2I3S A;  1SQJ A;  5EML B;  1JMX B;  5KDO B;  4X61 B;  2H68 A;  4A0B A;  3OL2 A;  1PEV A;  2GNQ A;  2OJY A;  5FKQ A;  3AL8 A;  4J77 A;  3EI1 B;  2Z2O A;  2OK6 A;  4L3H D;  2B5M A;  4JXM A;  2H9N A;  1JJU B;  3ULE C;  2GC4 A;  2P9I C;  4YVD A;  1MG3 A;  2OK4 A;  4CZV A;  3JRO A;  4J79 A;  1VYH C;  4JSX C;  2YBA A;  3EI4 B;  3SHF A;  4J8G A;  1R5M A;  2P9U C;  2UZY B;  3EU7 A;  4E54 A;  3MKQ A;  5TEE A;  5B4W A;  2YNP A;  3V9F A;  2P9S C;  4J84 A;  2H14 A;  2TRC B;  3AH8 B;  4A08 B;  3DWL C;  2XU7 A;  5CXB B;  1PGU A;  3BG0 A;  3L4M D;  4ZOY A;  1A0R B;  5C2W B;  3EI2 A;  2QXV A;  5SXM A;  3K27 A;  4Y7R A;  3I7N A;  3I7L A;  3IIW A;  3PE7 A;  4JSV C;  3RSE C;  2BCJ B;  4A09 B;  2AGZ A;  5TEF A;  1SHY B;  4LG9 A;  3RFG A;  5EAP A;  5EMM B;  2J56 H;  3E0C A;  5GMK n;  5H14 A;  3FGB A;  3PVW B;  2B4E A;  4ZOZ A;  2O9K A;  4FWW A;  3V5W B;  4U1E I;  3U4Y A;  2IAA A;  4E5Z A;  2HKR A;  1K32 A;  4GZ8 A;  1RI6 A;  3GFC A;  5K1C C;  5EMK B;  4O3U B;  3SJL D;  3SBP A;  2AH0 A;  2XYI A;  5AJA A;  1TBG A;  5CXC A;  2EBS A;  4ZOV A;  3SVW D;  4O3T B;  4A0A A;  2IUR A;  4J8B A;  4BH6 A;  1U4C A;  2PBI B;  5H17 A;  4D0K A;  4A7J A;  2H6K A;  3I7K A;  4AEZ A;  4K3J B;  4OWR A;  5CYK B;  3J81 g;  1B9Y A;  4FA5 D;  4A2M A;  2IWK A;  3NVX A;  5FKT A;  4J81 A;  4PSW B;  3MKS B;  2YNN A;  2PM9 B;  2HYE A;  2CN2 A;  4Y5R D;  3NVN A;  5I5I A;  1S4U X;  5C2V B;  4J82 A;  3MZL A;  5I5J A;  4ESG A;  2H6Q A;  5AMS A;  4MK0 B;  4CI2 A;  3K26 A;  3F3F A;  1MG2 A;  5GSA A;  4J87 A;  4BUJ C;  3AL9 A;  3UR4 A;  4ERY A;  1ERJ A;  3I7O A;  4KFM B;  1N6D A;  5EAR A;  3RRM C;  2AGL A;  2CE8 A;  3I8C A;  4O45 A;  2I0R A;  4J73 A;  2HJB A;  1PI6 A;  5K19 A;  3JRP A;  3OTT A;  5JWZ A;  5FKS A;  5HE0 B;  2MTA H;  3OL2 B;  5TDH B;  1NR0 A;  4XYI A;  4PSX B;  4OZU A;  3KRX B;  4CZY A;  2PM6 B;  1YFQ A;  3C9C A;  4GGD A;  5A2Q g;  3UVL A;  3N0D A;  4GGC A;  4X60 B;  3ZWL B;  5IC7 A;  2BBK H;  4GQ1 A;  1P22 A;  4H5J A;  4HDJ A;  4H5I A;  3IKO A;  4O9D A;  4U7A A;  2W18 A;  2H9M A;  2YB8 B;  2P9P C;  2YMU A;  5GXH A;  3C5M A;  3AFC A;  5H1M A;  3UKU C;  3NVQ A;  4XEI C;  1U2V C;  4FHL A;  3BG1 A;  4AOW A;  4L3G D;  3RN0 D;  2OVR B;  3V7D B;  3VH0 A;  2AGY A;  3KRW B;  3PSC B;  4GM3 A;  3MMY A;  3DSM A;  4TZ4 A;  3SBQ A;  4FB1 D;  4GQ2 P;  4CY1 A;  4O1Q D;  2AGW A;  5CXB A;  4QRJ A;  2Z2P A;  5EM2 B;  1GXR A;  5HE2 B;  5FXY A;  3UVK A;  1GOT B;  4G56 B;  4LGN A;  3VGZ A;  3IJ1 A;  4A09 A;  3RLM D;  2GC7 A;  1JOF A;  1PBY B;  2Z2N A;  2HKM A;  2XL2 A;  4CY5 A;  3OKY A;  3B7F A;  4L1Q D;  4JSN C;  1XKS A;  2H9P A;  2G9A A;  4JSP C;  5EAL A;  5CXC B;  3SWS D;  3JB9 L;  4A0A B;  3ODT A;  3EI3 A;  1OMW B;  2AQ5 A;  4UI9 R;  4R7A B;  2J55 H;  4JT6 C;  4QL1 A;  5AFU 3;  5C9Z B;  3BWS A;  3SXT D;  2H6N A;  3IIY A;  2J57 G;  3F3P A;  1Q47 A;  3PXW D;  3SLE D;  3PVU B;  2IWF A;  5HQG A;  5THA A;  3PXS D;  5HE3 B;  1L0Q A;  4ERQ A;  4ES0 A;  3DXK C;  3RN1 D;  1XIP A;  3EWE A;  2PM9 A;  4CI1 A;  4PBZ A;  2HXC A;  1GG2 B;  3UVN A;  3OKW A;  4A11 B;  4FAV D;  4L9O A;  4LG8 A;  2QC5 A;  4FA9 D;  4J86 A;  5HYN B;  3UKR C;  2CE9 A;  2B5L A;  4PXW A;  4A0B B;  2P9L C;  4K3I D;  3IJ0 A;  1JMZ B;  3CFV A;  4J78 A;  2CO0 C;  3AL8 B;  2XL3 A;  3I89 A;  4EWR A;  2CNX A;  4J0W A;  2OVP B;  1TYQ C;  3SN6 B;  5FLX g;  1N6E A;  2HJ4 A;  3DXM C;  4CI3 A;  2IUV A;  4XYH A;  3I7H A;  1GP2 B;  2Q7Q A;  3ORV D;  4X3E A;  3EI1 A;  2H9L A;  1K8K C;  4E54 B;  3EMH A;  4J0X A;  2IUQ A;  4D6V A;  4FAN D;  4QQE A;  3PXT D;  3EI4 A;  4CY2 A;  4PNK B;  2OVQ B;  4JT5 C;  3UVM A;  4PBY A;  3MXX A;  3OW8 A;  4Z8L A;  3JZG A;  3EI2 B;  3JPX A;  4IA9 A;  4PC0 A;  4FA1 D;  2H13 A;  5IJ8 E;  4A08 A;  5HE1 B;  3PSL A;  3SBR A;  3CIK B;  1OLZ A;  4CZX A;  4X63 B;  4BL0 A;  3F3G A;  3SMR A;  4E5Z B;  4GQB B;  1NEX B;  2PM7 B;  3L4O D;  4A2L A;  3JZH A;  1FWX A;  4N14 A;  3OKY B;  2CO0 A;  3C99 A;  5EM2 A;  2YNO A;  5TF2 A;  3CFS B;  3JZN A;  3RMZ D;  5FA5 B;  1SQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...