2AGZA

Crystal structure of the carbinolamine intermediate in the reductive half-reaction of aromatic amine dehydrogenase (aadh) with tryptamine. f222 form
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
361
structure length
361
Chain Sequence
REVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase
publication title Atomic description of an enzyme reaction dominated by proton tunneling
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 101
structure length 361
sequence length 361
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2agzA01
3BG0A 2P9IC 2BCJB 3RN1D 4FB1D 3UVKA 2PM9A 2H13A 4XYIA 1L0QA 4A08A 2IWKA 4AEZA 4J8BA 5CXCA 1R5MA 1XHMA 3HFQA 3JZNA 4KFMB 4GGAA 2PM9B 3EI3B 4L3GD 3MXXA 1MG2A 3JPXA 5CXCB 4J78A 4PSWB 5FXYA 3F3FA 3DM0A 4GM9A 4X61B 1XKSA 3I7NA 3OTTA 4FA4D 4L9OA 4O45A 2OVPB 3NVXA 4X3EA 4NSXA 3EG6A 1PEVA 1Q47A 4IA9A 4GQBB 4ZOZA 2BBKH 4J81A 3AH8B 1RI6A 5CXBA 3UVNA 4FA5D 4JXMA 1TBGA 1SQ9A 2OIZA 3MKSB 1TYQC 3PSCB 5THAA 2J57G 3GREA 4CY5A 1JMZB 3SBQA 2AGXA 5CXBB 1XIPA 2J55H 1PGUA 3OW8A 4JSXC 3V5WB 2Z2OA 2CN2A 3K26A 4XEIC 5EARA 4J77A 4GM8A 4J0WA 1A0RB 1N6DA 3SJLD 1MDAH 4X63B 4Y5RD 3SBRA 3ODTA 4CZXA 2UZYB 5EMJB 1NEXB 3I8EA 3EI2B 4ZOVA 5FKTA 3FGBA 3DWLC 5GXHA 3SFZA 4ZOYA 2Q7QA 4FA9D 1QNIA 5HQGA 2YB8B 3OKYA 1PBYB 3OKWA 5EMMB 3J81g 1SHYB 4PC0A 3JROA 3N0EA 4GZ8A 5HE2B 3CIKB 5TF2A 3I7PA 3OKYB 2TRCB 4JT5C 5EAPA 3DXMC 4IMMA 5IJ8E 1JOFA 3NVQA 2IAAA 2H6KA 2I3TA 2YNOA 4CY3A 4PBZA 3SN6B 5GSAA 3AL8A 3RSEC 3JZHA 3SMRA 5FLXg 4A11A 2AGLA 3RN0D 4O1QD 3MZLA 3L4OD 3NVNA 3RLMD 3UVLA 2HJ4A 4A11B 3AL9A 1YFQA 2OVRB 2OVQB 2CNXA 4A0AA 1K32A 2P9NC 1JJUB 2IURA 2CE9A 2I0SA 4A08B 4GGDA 4L3HD 5HE3B 4A0AB 5C2VB 3SXTD 5FKSA 4J86A 4BUJC 4D6VA 2I0RA 3OL2A 4QT8A 2P9PC 4J79A 5HE1B 4O9DA 3EU7A 1MG3A 2PM7B 3SHFA 3SCYA 3UVOA 5JWZA 5TEEA 2XL3A 4CI3A 4ES0A 1GP2B 5C9ZB 3F3GA 4E54A 2P9SC 3IJ0A 1S4UX 2HXCA 3B7FA 3SWSD 4GQ2P 5FQDA 3JAMg 2H3XA 3IKOA 1NR0A 3C75H 3V7DB 3SVWD 4E54B 3EI4A 2P9LC 4OZUA 4Y7RA 3VA6A 1VYHC 4ERZA 2O9KA 3FM0A 2B5MA 2I0TA 3RRMC 4OWRA 4FAVD 4FWWA 5K19A 2XYIA 1JMXB 4X60B 2H6QA 3IIWA 5K1CC 3PXSD 2GC7A 2HESX 4BH6A 2AQ5A 4YVDA 5CYKA 3KRWB 4AOWA 3RFHA 4Z8LA 3OKTA 5FKQA 2XL2A 2P9UC 4GM3A 4U1EI 2AH1A 3UKUC 3F3PA 4A0BA 4UI9R 4QL1A 5I5MA 3FRXA 1GOTB 3EMHA 2QXVA 2IUQA 4K3ID 1FWXA 2H9MA 4MK0B 4PXWA 3UVMA 3I7OA 4A0BB 2H9PA 4G56B 3RMZD 4XYHA 5B4WA 3IJ1A 2IWFA 3VH0A 1K8KC 2HYEA 4J87A 4H5IA 3EWEA 1P22A 4CY1A 1ERJA 2H47A 3PSLA 4JSNC 3IJCA 3JRPA 4LG9A 5GMKn 3JZGA 5EMKB 1GXRA 1SQJA 2YMUA 3VGZA 5C2WB 1GG2B 5IT9g 3N0DA 2H9LA 3DXKC 3ULEC 1B9YA 4ERQA 5I5JA 4GMBA 5GXIA 2QC5A 5A2Qg 2YNNA 3E0CA 3IIYA 2H68A 3A0FA 2CE8A 3C99A 3MMYA 3MKQA 5HYNB 4J8GA 4FA1D 3AL8B 3K27A 4LGNA 2AGYA 4E5ZA 1PI6A 2OJYA 2GC4A 2J56H 5H17A 5FKRA 5IGQA 3BWSA 2Z2NA 3I8CA 4L1QD 3C5MA 2UZXB 1OMWB 3PVUB 2IUVA 4J82A 5IC7A 3EI3A 4H5JA 2P9KC 3UKRC 4CI1A 4J0XA 3RFGA 4I79A 4JT6C 4A09A 4CC9A 3OL2B 4FHLA 4JSPC 2AGWA 2B5NA 2CN3A 4A09B 4R7AB 4CZYA 4CI2A 3J80g 3BG1A 3JB9L 3W15A 1N6FA 4LG8A 5I5IA 1OLZA 4JD2C 4U7AA 4QQEA 4PBYA 2OK6A 3I7HA 3KRXB 2I3SA 5FA5B 3PE7A 4HDJA 2Z2PA 2CO0C 3EI1A 3EI4B 2XU7A 5IJ7E 4CZVA 5H1MA 3I7LA 5EAMA 3C9CA 2HKMA 5AFU3 3I89A 3PXWD 4D0KA 3EI1B 5KDOB 3I2NA 2CO0A 4O3TB 5CYKB 3PXTD 2EBSA 4EWRA 4CI8A 4K3JB 3AFCA 5H14A 5EM2A 3V9FA 4ZN4A 2GNQA 4QRJA 4ZOXA 2W18A 3P4FA 4J73A 4J84A 4CY2A 1U4CA 5EMLB 4FAND 4ESGA 3DSMA 4BL0A 5EM2B 3EI2A 2G99A 4JSVC 4TZ4A 2IUPA 4A2LA 2AGZA 5TEFA 5EALA 2MTAH 5SXMA 3CFSB 3UR4A 2HJBA 1B9XA 1N6EA 2PBIB 5AJAA 2B4EA 2AH0A 2YNPA 5HE0B 4A7JA 3ORVD 4PNKB 3L4MD 3GFCA 5TDHB 3PVWB 4GGCA 2G9AA 4O3UB 2OK4A 4N14A 2HKRA 3SLED 2YBAA 3CFVA 3MZKA 4GQ1A 2H6NA 4PSXB 3SBPA 3I7KA 5IGOA 3U4YA 3ZWLB 4E5ZB 2H14A 2B5LA 4A2MA 4ERYA 2PM6B 2H9NA 5AMSA 1U2VC
chains in the Genus database with same CATH superfamily
3BG0A 2P9IC 2BCJB 3RN1D 4FB1D 3UVKA 2PM9A 2H13A 3IURA 4XYIA 1L0QA 4AN1A 3T3PA 4A08A 1VE6A 1GOGA 2IWKA 4AEZA 4J8BA 5CXCA 5M5VA 1R5MA 1XHMA 3HFQA 3JZNA 4KFMB 4GGAA 2PM9B 3EI3B 4L3GD 5FFGA 2EICA 4Z7QA 1H2ZA 3MXXA 1MG2A 3JPXA 5CXCB 4J78A 4PSWB 5FXYA 3F3FA 3DM0A 4GM9A 4X61B 5M5UA 1XKSA 5HDBA 3I7NA 3OTTA 4FA4D 4L9OA 3IJEA 2VDQA 2HU7A 4O45A 2OVPB 2VDKA 2VZ1A 3NVXA 3IUMA 4X3EA 4NSXA 1H2YA 3EG6A 1PEVA 1Q47A 2HU5A 3VI4A 3V4VA 2EIBA 3MUNA 1YR2A 4IA9A 4O02A 4GQBB 4WJKA 4ZOZA 2BBKH 4J81A 3AH8B 1RI6A 5CXBA 3UVNA 4FA5D 4JXMA 1TBGA 1SQ9A 2OIZA 3MKSB 1TYQC 3PSCB 3QI0A 5THAA 2J57G 3GREA 4CY5A 1JMZB 3SBQA 2AGXA 5CXBB 1XIPA 2J55H 1PGUA 3O4IA 3OW8A 4JSXC 1E5TA 5C92A 1JV2A 3V5WB 2Z2OA 3GC3B 2CN2A 3K26A 4XEIC 5EARA 4J77A 4NENA 4GM8A 4J0WA 1A0RB 1N6DA 3SJLD 1MDAH 3EQ7A 4X63B 4Y5RD 3SBRA 3ODTA 4CZXA 4MMYA 2UZYB 5EMJB 1NEXB 1UOQA 3I8EA 3EI2B 3IULA 4ZOVA 5FKTA 3FGBA 3DWLC 5GXHA 3EQ9A 3SFZA 4ZOYA 2Q7QA 4FA9D 1QNIA 5HQGA 2YB8B 1U8CA 3OKYA 1PBYB 3OKWA 5M5RA 5EMMB 1SHYB 3J81g 1E8NA 4PC0A 3JROA 3N0EA 1VE7A 4GZ8A 5HE2B 3CIKB 5TF2A 3I7PA 4RE6A 3OKYB 2TRCB 4JT5C 5EAPA 3DXMC 4IMMA 5IJ8E 1JOFA 5E6UA 1BPOA 3NVQA 2IAAA 2H6KA 2I3TA 2YNOA 4CY3A 3MUOA 4PBZA 3IUQA 3SN6B 5GSAA 3AL8A 3RSEC 1I2MB 3JZHA 3SMRA 5FLXg 4A11A 2AGLA 3RN0D 4D9SA 4O1QD 3MZLA 2HU8A 4NAAA 4BCBA 3L4OD 3NVNA 3RLMD 3UVLA 4DNWA 2HJ4A 4A11B 3AL9A 1YFQA 2OVRB 2OVQB 3VI3A 1JTDB 2CNXA 4A0AA 1K32A 2P9NC 4Z7OA 1JJUB 2IURA 2CE9A 2I0SA 4A08B 4GGDA 3GD1I 4L3HD 1O6GA 5HE3B 4A0AB 5C2VB 1H2WA 3SXTD 5FKSA 4J86A 4BUJC 4D6VA 4BP8A 2I0RA 3OL2A 4QT8A 2P9PC 4J79A 5HE1B 4O9DA 3EU7A 1MG3A 2PM7B 3SHFA 3SCYA 1GOFA 3UVOA 5JWZA 5TEEA 2XL3A 4CI3A 4ES0A 1GP2B 5C9ZB 3F3GA 4E54A 2P9SC 3IJ0A 1S4UX 2HXCA 3B7FA 3SWSD 4GQ2P 4AN0A 3NIGA 5FQDA 3JAMg 5E6RA 2H3XA 3IKOA 1NR0A 3C75H 3V7DB 3SVWD 4QAMA 4E54B 3EI4A 2P9LC 4OZUA 4Y7RA 3VA6A 1VYHC 4ERZA 2O9KA 3FM0A 2B5MA 2I0TA 3RRMC 4OWRA 4FAVD 4FWWA 5K19A 2XYIA 1JMXB 4X60B 2H6QA 3IIWA 4AMZA 5K1CC 3PXSD 2GC7A 2HESX 4BH6A 2AQ5A 4YVDA 5CYKA 5FFOA 3KRWB 4Z7NA 4AOWA 3RFHA 5M5TA 2VDRA 4Z8LA 2JKXA 2XDWA 4MMZA 3OKTA 4O2WA 5FKQA 2XL2A 2P9UC 4MMXA 4GM3A 4U1EI 2AH1A 3UKUC 3F3PA 4A0BA 4UI9R 4G1MA 3ZDZA 4QL1A 5I5MA 3FRXA 1GOTB 1UOOA 3EMHA 2QXVA 2IUQA 4K3ID 5M61A 1FWXA 2H9MA 3EQ8A 4MK0B 4PXWA 3UVMA 2VDPA 3I7OA 4UM9A 2H9PA 4A0BB 4G56B 3RMZD 4XYHA 5B4WA 3IJ1A 2IWFA 3VH0A 1K8KC 2HYEA 4J87A 4H5IA 3EWEA 1P22A 4CY1A 1ERJA 2H47A 3PSLA 4JSNC 3IJCA 3JRPA 4LG9A 5GMKn 4RE5A 3JZGA 4JHNA 5EMKB 1GXRA 1SQJA 1VZ2A 3IUNA 1TYEA 2YMUA 3VGZA 1UOPA 5C2WB 1GG2B 3K6SA 5IT9g 3N0DA 1K3IA 1L5GA 2H9LA 3DXKC 3K72A 3ULEC 1B9YA 3NIFA 4ERQA 4WK0A 5I5JA 4GMBA 5GXIA 2QC5A 5A2Qg 2YNNA 3E0CA 3IIYA 2H68A 3A0FA 2CE8A 3C99A 3MMYA 3MKQA 5HYNB 4J8GA 4FA1D 3AL8B 3K27A 4LGNA 2AGYA 4E5ZA 3K71A 1PI6A 2OJYA 2GC4A 3FCSA 3ZDYA 2J56H 1E8MA 1C9IA 5H17A 5FKRA 5IGQA 3BWSA 2Z2NA 3I8CA 4L1QD 3C5MA 2UZXB 2VDLA 1OMWB 3PVUB 2IUVA 4J82A 3QHYB 5IC7A 3EI3A 4H5JA 2P9KC 3UKRC 1QFMA 4CI1A 4J0XA 3RFGA 4I79A 3KCIA 4JT6C 5E6SA 4A09A 4CC9A 1UTCA 3IUJA 1O6FA 3OL2B 4FHLA 4JSPC 2AGWA 2B5NA 1GOHA 2CN3A 4A09B 1T2XA 2VDMA 4R7AB 4CZYA 4CI2A 3J80g 3BG1A 3JB9L 4NC4A 3W15A 1N6FA 4LG8A 2VC2A 4NBMA 5I5IA 1OLZA 4JD2C 4U7AA 1C9LA 2EIDA 4QQEA 4PBYA 2OK6A 4AMYA 3I7HA 2VDOA 3KRXB 2I3SA 5FA5B 3PE7A 4HDJA 4BCCA 4AX4A 2Z2PA 2CO0C 3EI1A 3EI4B 2XU7A 3FCUA 5IJ7E 4CZVA 5H1MA 4WK4A 3I7LA 5EAMA 3C9CA 2HKMA 5AFU3 3I89A 3PXWD 4D0KA 3EI1B 4DNVA 5KDOB 3I2NA 3ZE1A 2CO0A 4O3TB 5CYKB 3PXTD 2EIEA 2EBSA 2VDNA 4WK2A 3OF7A 4EWRA 4G55A 4CI8A 2VZ3A 3AFCA 4G1EA 4K3JB 3O4GA 5H14A 2QR5A 5EM2A 3V9FA 4ZN4A 2GNQA 4QRJA 4ZOXA 2W18A 3P4FA 4J73A 4J84A 4CY2A 1U4CA 4L1MA 5EMLB 4FAND 3O4JA 3DSMA 4ESGA 3ZDXA 4BL0A 5EM2B 3EI2A 2G99A 4JSVC 4TZ4A 4JHPC 2IUPA 3IVMA 4A2LA 2AGZA 5TEFA 5EALA 2MTAH 2QZPA 1H2XA 3NIDA 5SXMA 3CFSB 3UR4A 2HJBA 1B9XA 1N6EA 2PBIB 5AJAA 2B4EA 2AH0A 2YNPA 5HE0B 4BCDA 4A7JA 1QFSA 3ORVD 4PNKB 3L4MD 3GFCA 5C86A 5TDHB 3PVWB 4IRZA 4GGCA 2G9AA 4BP9A 4O3UB 4UM8A 1VZ3A 5M5SA 2BKLA 2OK4A 3DDUA 4N14A 2HKRA 3SLED 2YBAA 3CFVA 3MZKA 3V4PA 1A12A 4GQ1A 2H6NA 4PSXB 2XZGA 3SBPA 3I7KA 2XE4A 5IGOA 3MVDK 3U4YA 3ZWLB 4E5ZB 3O4HA 1M1XA 2H14A 3T3MA 4DNUA 2B5LA 2WQ8A 3ZE2A 4A2MA 4ERYA 2PM6B 2H9NA 3ZE0A 5AMSA 1U2VC
chains in the Genus database with same CATH topology
3BG0A 2P9IC 2BCJB 3RN1D 4FB1D 3UVKA 2PM9A 2H13A 4XYIA 1L0QA 4A08A 2IWKA 4AEZA 4J8BA 5CXCA 1R5MA 1XHMA 3HFQA 3JZNA 4KFMB 4GGAA 2PM9B 3EI3B 4L3GD 3MXXA 1MG2A 3JPXA 5CXCB 4J78A 4PSWB 5FXYA 3F3FA 3DM0A 4GM9A 4X61B 1XKSA 3I7NA 3OTTA 4FA4D 4L9OA 4O45A 2OVPB 3NVXA 4X3EA 4NSXA 3EG6A 1PEVA 1Q47A 4IA9A 4GQBB 4ZOZA 2BBKH 4J81A 3AH8B 1RI6A 5CXBA 3UVNA 4FA5D 4JXMA 1TBGA 1SQ9A 2OIZA 3MKSB 1TYQC 3PSCB 5THAA 2J57G 3GREA 4CY5A 1JMZB 3SBQA 2AGXA 5CXBB 1XIPA 2J55H 1PGUA 3OW8A 4JSXC 3V5WB 2Z2OA 2CN2A 3K26A 4XEIC 5EARA 4J77A 4GM8A 4J0WA 1A0RB 1N6DA 3SJLD 1MDAH 4X63B 4Y5RD 3SBRA 3ODTA 4CZXA 2UZYB 5EMJB 1NEXB 3I8EA 3EI2B 4ZOVA 5FKTA 3FGBA 3DWLC 5GXHA 3SFZA 4ZOYA 2Q7QA 4FA9D 1QNIA 5HQGA 2YB8B 3OKYA 1PBYB 3OKWA 5EMMB 3J81g 1SHYB 4PC0A 3JROA 3N0EA 4GZ8A 5HE2B 3CIKB 5TF2A 3I7PA 3OKYB 2TRCB 4JT5C 5EAPA 3DXMC 4IMMA 5IJ8E 1JOFA 3NVQA 2IAAA 2H6KA 2I3TA 2YNOA 4CY3A 4PBZA 3SN6B 5GSAA 3AL8A 3RSEC 3JZHA 3SMRA 5FLXg 4A11A 2AGLA 3RN0D 4O1QD 3MZLA 3L4OD 3NVNA 3RLMD 3UVLA 2HJ4A 4A11B 3AL9A 1YFQA 2OVRB 2OVQB 2CNXA 4A0AA 1K32A 2P9NC 1JJUB 2IURA 2CE9A 2I0SA 4A08B 4GGDA 4L3HD 5HE3B 4A0AB 5C2VB 3SXTD 5FKSA 4J86A 4BUJC 4D6VA 2I0RA 3OL2A 4QT8A 2P9PC 4J79A 5HE1B 4O9DA 3EU7A 1MG3A 2PM7B 3SHFA 3SCYA 3UVOA 5JWZA 5TEEA 2XL3A 4CI3A 4ES0A 1GP2B 5C9ZB 3F3GA 4E54A 2P9SC 3IJ0A 1S4UX 2HXCA 3B7FA 3SWSD 4GQ2P 5FQDA 3JAMg 2H3XA 3IKOA 1NR0A 3C75H 3V7DB 3SVWD 4E54B 3EI4A 2P9LC 4OZUA 4Y7RA 3VA6A 1VYHC 4ERZA 2O9KA 3FM0A 2B5MA 2I0TA 3RRMC 4OWRA 4FAVD 4FWWA 5K19A 2XYIA 1JMXB 4X60B 2H6QA 3IIWA 5K1CC 3PXSD 2GC7A 2HESX 4BH6A 2AQ5A 4YVDA 5CYKA 3KRWB 4AOWA 3RFHA 4Z8LA 3OKTA 5FKQA 2XL2A 2P9UC 4GM3A 4U1EI 2AH1A 3UKUC 3F3PA 4A0BA 4UI9R 4QL1A 5I5MA 3FRXA 1GOTB 3EMHA 2QXVA 2IUQA 4K3ID 1FWXA 2H9MA 4MK0B 4PXWA 3UVMA 3I7OA 4A0BB 2H9PA 4G56B 3RMZD 4XYHA 5B4WA 3IJ1A 2IWFA 3VH0A 1K8KC 2HYEA 4J87A 4H5IA 3EWEA 1P22A 4CY1A 1ERJA 2H47A 3PSLA 4JSNC 3IJCA 3JRPA 4LG9A 5GMKn 3JZGA 5EMKB 1GXRA 1SQJA 2YMUA 3VGZA 5C2WB 1GG2B 5IT9g 3N0DA 2H9LA 3DXKC 3ULEC 1B9YA 4ERQA 5I5JA 4GMBA 5GXIA 2QC5A 5A2Qg 2YNNA 3E0CA 3IIYA 2H68A 3A0FA 2CE8A 3C99A 3MMYA 3MKQA 5HYNB 4J8GA 4FA1D 3AL8B 3K27A 4LGNA 2AGYA 4E5ZA 1PI6A 2OJYA 2GC4A 2J56H 5H17A 5FKRA 5IGQA 3BWSA 2Z2NA 3I8CA 4L1QD 3C5MA 2UZXB 1OMWB 3PVUB 2IUVA 4J82A 5IC7A 3EI3A 4H5JA 2P9KC 3UKRC 4CI1A 4J0XA 3RFGA 4I79A 4JT6C 4A09A 4CC9A 3OL2B 4FHLA 4JSPC 2AGWA 2B5NA 2CN3A 4A09B 4R7AB 4CZYA 4CI2A 3J80g 3BG1A 3JB9L 3W15A 1N6FA 4LG8A 5I5IA 1OLZA 4JD2C 4U7AA 4QQEA 4PBYA 2OK6A 3I7HA 3KRXB 2I3SA 5FA5B 3PE7A 4HDJA 2Z2PA 2CO0C 3EI1A 3EI4B 2XU7A 5IJ7E 4CZVA 5H1MA 3I7LA 5EAMA 3C9CA 2HKMA 5AFU3 3I89A 3PXWD 4D0KA 3EI1B 5KDOB 3I2NA 2CO0A 4O3TB 5CYKB 3PXTD 2EBSA 4EWRA 4CI8A 4K3JB 3AFCA 5H14A 5EM2A 3V9FA 4ZN4A 2GNQA 4QRJA 4ZOXA 2W18A 3P4FA 4J73A 4J84A 4CY2A 1U4CA 5EMLB 4FAND 4ESGA 3DSMA 4BL0A 5EM2B 3EI2A 2G99A 4JSVC 4TZ4A 2IUPA 4A2LA 2AGZA 5TEFA 5EALA 2MTAH 5SXMA 3CFSB 3UR4A 2HJBA 1B9XA 1N6EA 2PBIB 5AJAA 2B4EA 2AH0A 2YNPA 5HE0B 4A7JA 3ORVD 4PNKB 3L4MD 3GFCA 5TDHB 3PVWB 4GGCA 2G9AA 4O3UB 2OK4A 4N14A 2HKRA 3SLED 2YBAA 3CFVA 3MZKA 4GQ1A 2H6NA 4PSXB 3SBPA 3I7KA 5IGOA 3U4YA 3ZWLB 4E5ZB 2H14A 2B5LA 4A2MA 4ERYA 2PM6B 2H9NA 5AMSA 1U2VC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BG0 A;  2P9I C;  2BCJ B;  3RN1 D;  4FB1 D;  3UVK A;  2PM9 A;  2H13 A;  4XYI A;  1L0Q A;  4A08 A;  2IWK A;  4AEZ A;  4J8B A;  5CXC A;  1R5M A;  1XHM A;  3HFQ A;  3JZN A;  4KFM B;  4GGA A;  2PM9 B;  3EI3 B;  4L3G D;  3MXX A;  1MG2 A;  3JPX A;  5CXC B;  4J78 A;  4PSW B;  5FXY A;  3F3F A;  3DM0 A;  4GM9 A;  4X61 B;  1XKS A;  3I7N A;  3OTT A;  4FA4 D;  4L9O A;  4O45 A;  2OVP B;  3NVX A;  4X3E A;  4NSX A;  3EG6 A;  1PEV A;  1Q47 A;  4IA9 A;  4GQB B;  4ZOZ A;  2BBK H;  4J81 A;  3AH8 B;  1RI6 A;  5CXB A;  3UVN A;  4FA5 D;  4JXM A;  1TBG A;  1SQ9 A;  2OIZ A;  3MKS B;  1TYQ C;  3PSC B;  5THA A;  2J57 G;  3GRE A;  4CY5 A;  1JMZ B;  3SBQ A;  2AGX A;  5CXB B;  1XIP A;  2J55 H;  1PGU A;  3OW8 A;  4JSX C;  3V5W B;  2Z2O A;  2CN2 A;  3K26 A;  4XEI C;  5EAR A;  4J77 A;  4GM8 A;  4J0W A;  1A0R B;  1N6D A;  3SJL D;  1MDA H;  4X63 B;  4Y5R D;  3SBR A;  3ODT A;  4CZX A;  2UZY B;  5EMJ B;  1NEX B;  3I8E A;  3EI2 B;  4ZOV A;  5FKT A;  3FGB A;  3DWL C;  5GXH A;  3SFZ A;  4ZOY A;  2Q7Q A;  4FA9 D;  1QNI A;  5HQG A;  2YB8 B;  3OKY A;  1PBY B;  3OKW A;  5EMM B;  3J81 g;  1SHY B;  4PC0 A;  3JRO A;  3N0E A;  4GZ8 A;  5HE2 B;  3CIK B;  5TF2 A;  3I7P A;  3OKY B;  2TRC B;  4JT5 C;  5EAP A;  3DXM C;  4IMM A;  5IJ8 E;  1JOF A;  3NVQ A;  2IAA A;  2H6K A;  2I3T A;  2YNO A;  4CY3 A;  4PBZ A;  3SN6 B;  5GSA A;  3AL8 A;  3RSE C;  3JZH A;  3SMR A;  5FLX g;  4A11 A;  2AGL A;  3RN0 D;  4O1Q D;  3MZL A;  3L4O D;  3NVN A;  3RLM D;  3UVL A;  2HJ4 A;  4A11 B;  3AL9 A;  1YFQ A;  2OVR B;  2OVQ B;  2CNX A;  4A0A A;  1K32 A;  2P9N C;  1JJU B;  2IUR A;  2CE9 A;  2I0S A;  4A08 B;  4GGD A;  4L3H D;  5HE3 B;  4A0A B;  5C2V B;  3SXT D;  5FKS A;  4J86 A;  4BUJ C;  4D6V A;  2I0R A;  3OL2 A;  4QT8 A;  2P9P C;  4J79 A;  5HE1 B;  4O9D A;  3EU7 A;  1MG3 A;  2PM7 B;  3SHF A;  3SCY A;  3UVO A;  5JWZ A;  5TEE A;  2XL3 A;  4CI3 A;  4ES0 A;  1GP2 B;  5C9Z B;  3F3G A;  4E54 A;  2P9S C;  3IJ0 A;  1S4U X;  2HXC A;  3B7F A;  3SWS D;  4GQ2 P;  5FQD A;  3JAM g;  2H3X A;  3IKO A;  1NR0 A;  3C75 H;  3V7D B;  3SVW D;  4E54 B;  3EI4 A;  2P9L C;  4OZU A;  4Y7R A;  3VA6 A;  1VYH C;  4ERZ A;  2O9K A;  3FM0 A;  2B5M A;  2I0T A;  3RRM C;  4OWR A;  4FAV D;  4FWW A;  5K19 A;  2XYI A;  1JMX B;  4X60 B;  2H6Q A;  3IIW A;  5K1C C;  3PXS D;  2GC7 A;  2HES X;  4BH6 A;  2AQ5 A;  4YVD A;  5CYK A;  3KRW B;  4AOW A;  3RFH A;  4Z8L A;  3OKT A;  5FKQ A;  2XL2 A;  2P9U C;  4GM3 A;  4U1E I;  2AH1 A;  3UKU C;  3F3P A;  4A0B A;  4UI9 R;  4QL1 A;  5I5M A;  3FRX A;  1GOT B;  3EMH A;  2QXV A;  2IUQ A;  4K3I D;  1FWX A;  2H9M A;  4MK0 B;  4PXW A;  3UVM A;  3I7O A;  4A0B B;  2H9P A;  4G56 B;  3RMZ D;  4XYH A;  5B4W A;  3IJ1 A;  2IWF A;  3VH0 A;  1K8K C;  2HYE A;  4J87 A;  4H5I A;  3EWE A;  1P22 A;  4CY1 A;  1ERJ A;  2H47 A;  3PSL A;  4JSN C;  3IJC A;  3JRP A;  4LG9 A;  5GMK n;  3JZG A;  5EMK B;  1GXR A;  1SQJ A;  2YMU A;  3VGZ A;  5C2W B;  1GG2 B;  5IT9 g;  3N0D A;  2H9L A;  3DXK C;  3ULE C;  1B9Y A;  4ERQ A;  5I5J A;  4GMB A;  5GXI A;  2QC5 A;  5A2Q g;  2YNN A;  3E0C A;  3IIY A;  2H68 A;  3A0F A;  2CE8 A;  3C99 A;  3MMY A;  3MKQ A;  5HYN B;  4J8G A;  4FA1 D;  3AL8 B;  3K27 A;  4LGN A;  2AGY A;  4E5Z A;  1PI6 A;  2OJY A;  2GC4 A;  2J56 H;  5H17 A;  5FKR A;  5IGQ A;  3BWS A;  2Z2N A;  3I8C A;  4L1Q D;  3C5M A;  2UZX B;  1OMW B;  3PVU B;  2IUV A;  4J82 A;  5IC7 A;  3EI3 A;  4H5J A;  2P9K C;  3UKR C;  4CI1 A;  4J0X A;  3RFG A;  4I79 A;  4JT6 C;  4A09 A;  4CC9 A;  3OL2 B;  4FHL A;  4JSP C;  2AGW A;  2B5N A;  2CN3 A;  4A09 B;  4R7A B;  4CZY A;  4CI2 A;  3J80 g;  3BG1 A;  3JB9 L;  3W15 A;  1N6F A;  4LG8 A;  5I5I A;  1OLZ A;  4JD2 C;  4U7A A;  4QQE A;  4PBY A;  2OK6 A;  3I7H A;  3KRX B;  2I3S A;  5FA5 B;  3PE7 A;  4HDJ A;  2Z2P A;  2CO0 C;  3EI1 A;  3EI4 B;  2XU7 A;  5IJ7 E;  4CZV A;  5H1M A;  3I7L A;  5EAM A;  3C9C A;  2HKM A;  5AFU 3;  3I89 A;  3PXW D;  4D0K A;  3EI1 B;  5KDO B;  3I2N A;  2CO0 A;  4O3T B;  5CYK B;  3PXT D;  2EBS A;  4EWR A;  4CI8 A;  4K3J B;  3AFC A;  5H14 A;  5EM2 A;  3V9F A;  4ZN4 A;  2GNQ A;  4QRJ A;  4ZOX A;  2W18 A;  3P4F A;  4J73 A;  4J84 A;  4CY2 A;  1U4C A;  5EML B;  4FAN D;  4ESG A;  3DSM A;  4BL0 A;  5EM2 B;  3EI2 A;  2G99 A;  4JSV C;  4TZ4 A;  2IUP A;  4A2L A;  2AGZ A;  5TEF A;  5EAL A;  2MTA H;  5SXM A;  3CFS B;  3UR4 A;  2HJB A;  1B9X A;  1N6E A;  2PBI B;  5AJA A;  2B4E A;  2AH0 A;  2YNP A;  5HE0 B;  4A7J A;  3ORV D;  4PNK B;  3L4M D;  3GFC A;  5TDH B;  3PVW B;  4GGC A;  2G9A A;  4O3U B;  2OK4 A;  4N14 A;  2HKR A;  3SLE D;  2YBA A;  3CFV A;  3MZK A;  4GQ1 A;  2H6N A;  4PSX B;  3SBP A;  3I7K A;  5IGO A;  3U4Y A;  3ZWL B;  4E5Z B;  2H14 A;  2B5L A;  4A2M A;  4ERY A;  2PM6 B;  2H9N A;  5AMS A;  1U2V C; 
#chains in the Genus database with same CATH topology
 3BG0 A;  2P9I C;  2BCJ B;  3RN1 D;  4FB1 D;  3UVK A;  2PM9 A;  2H13 A;  3IUR A;  4XYI A;  1L0Q A;  4AN1 A;  3T3P A;  4A08 A;  1VE6 A;  1GOG A;  2IWK A;  4AEZ A;  4J8B A;  5CXC A;  5M5V A;  1R5M A;  1XHM A;  3HFQ A;  3JZN A;  4KFM B;  4GGA A;  2PM9 B;  3EI3 B;  4L3G D;  5FFG A;  2EIC A;  4Z7Q A;  1H2Z A;  3MXX A;  1MG2 A;  3JPX A;  5CXC B;  4J78 A;  4PSW B;  5FXY A;  3F3F A;  3DM0 A;  4GM9 A;  4X61 B;  5M5U A;  1XKS A;  5HDB A;  3I7N A;  3OTT A;  4FA4 D;  4L9O A;  3IJE A;  2VDQ A;  2HU7 A;  4O45 A;  2OVP B;  2VDK A;  2VZ1 A;  3NVX A;  3IUM A;  4X3E A;  4NSX A;  1H2Y A;  3EG6 A;  1PEV A;  1Q47 A;  2HU5 A;  3VI4 A;  3V4V A;  2EIB A;  3MUN A;  1YR2 A;  4IA9 A;  4O02 A;  4GQB B;  4WJK A;  4ZOZ A;  2BBK H;  4J81 A;  3AH8 B;  1RI6 A;  5CXB A;  3UVN A;  4FA5 D;  4JXM A;  1TBG A;  1SQ9 A;  2OIZ A;  3MKS B;  1TYQ C;  3PSC B;  3QI0 A;  5THA A;  2J57 G;  3GRE A;  4CY5 A;  1JMZ B;  3SBQ A;  2AGX A;  5CXB B;  1XIP A;  2J55 H;  1PGU A;  3O4I A;  3OW8 A;  4JSX C;  1E5T A;  5C92 A;  1JV2 A;  3V5W B;  2Z2O A;  3GC3 B;  2CN2 A;  3K26 A;  4XEI C;  5EAR A;  4J77 A;  4NEN A;  4GM8 A;  4J0W A;  1A0R B;  1N6D A;  3SJL D;  1MDA H;  3EQ7 A;  4X63 B;  4Y5R D;  3SBR A;  3ODT A;  4CZX A;  4MMY A;  2UZY B;  5EMJ B;  1NEX B;  1UOQ A;  3I8E A;  3EI2 B;  3IUL A;  4ZOV A;  5FKT A;  3FGB A;  3DWL C;  5GXH A;  3EQ9 A;  3SFZ A;  4ZOY A;  2Q7Q A;  4FA9 D;  1QNI A;  5HQG A;  2YB8 B;  1U8C A;  3OKY A;  1PBY B;  3OKW A;  5M5R A;  5EMM B;  1SHY B;  3J81 g;  1E8N A;  4PC0 A;  3JRO A;  3N0E A;  1VE7 A;  4GZ8 A;  5HE2 B;  3CIK B;  5TF2 A;  3I7P A;  4RE6 A;  3OKY B;  2TRC B;  4JT5 C;  5EAP A;  3DXM C;  4IMM A;  5IJ8 E;  1JOF A;  5E6U A;  1BPO A;  3NVQ A;  2IAA A;  2H6K A;  2I3T A;  2YNO A;  4CY3 A;  3MUO A;  4PBZ A;  3IUQ A;  3SN6 B;  5GSA A;  3AL8 A;  3RSE C;  1I2M B;  3JZH A;  3SMR A;  5FLX g;  4A11 A;  2AGL A;  3RN0 D;  4D9S A;  4O1Q D;  3MZL A;  2HU8 A;  4NAA A;  4BCB A;  3L4O D;  3NVN A;  3RLM D;  3UVL A;  4DNW A;  2HJ4 A;  4A11 B;  3AL9 A;  1YFQ A;  2OVR B;  2OVQ B;  3VI3 A;  1JTD B;  2CNX A;  4A0A A;  1K32 A;  2P9N C;  4Z7O A;  1JJU B;  2IUR A;  2CE9 A;  2I0S A;  4A08 B;  4GGD A;  3GD1 I;  4L3H D;  1O6G A;  5HE3 B;  4A0A B;  5C2V B;  1H2W A;  3SXT D;  5FKS A;  4J86 A;  4BUJ C;  4D6V A;  4BP8 A;  2I0R A;  3OL2 A;  4QT8 A;  2P9P C;  4J79 A;  5HE1 B;  4O9D A;  3EU7 A;  1MG3 A;  2PM7 B;  3SHF A;  3SCY A;  1GOF A;  3UVO A;  5JWZ A;  5TEE A;  2XL3 A;  4CI3 A;  4ES0 A;  1GP2 B;  5C9Z B;  3F3G A;  4E54 A;  2P9S C;  3IJ0 A;  1S4U X;  2HXC A;  3B7F A;  3SWS D;  4GQ2 P;  4AN0 A;  3NIG A;  5FQD A;  3JAM g;  5E6R A;  2H3X A;  3IKO A;  1NR0 A;  3C75 H;  3V7D B;  3SVW D;  4QAM A;  4E54 B;  3EI4 A;  2P9L C;  4OZU A;  4Y7R A;  3VA6 A;  1VYH C;  4ERZ A;  2O9K A;  3FM0 A;  2B5M A;  2I0T A;  3RRM C;  4OWR A;  4FAV D;  4FWW A;  5K19 A;  2XYI A;  1JMX B;  4X60 B;  2H6Q A;  3IIW A;  4AMZ A;  5K1C C;  3PXS D;  2GC7 A;  2HES X;  4BH6 A;  2AQ5 A;  4YVD A;  5CYK A;  5FFO A;  3KRW B;  4Z7N A;  4AOW A;  3RFH A;  5M5T A;  2VDR A;  4Z8L A;  2JKX A;  2XDW A;  4MMZ A;  3OKT A;  4O2W A;  5FKQ A;  2XL2 A;  2P9U C;  4MMX A;  4GM3 A;  4U1E I;  2AH1 A;  3UKU C;  3F3P A;  4A0B A;  4UI9 R;  4G1M A;  3ZDZ A;  4QL1 A;  5I5M A;  3FRX A;  1GOT B;  1UOO A;  3EMH A;  2QXV A;  2IUQ A;  4K3I D;  5M61 A;  1FWX A;  2H9M A;  3EQ8 A;  4MK0 B;  4PXW A;  3UVM A;  2VDP A;  3I7O A;  4UM9 A;  2H9P A;  4A0B B;  4G56 B;  3RMZ D;  4XYH A;  5B4W A;  3IJ1 A;  2IWF A;  3VH0 A;  1K8K C;  2HYE A;  4J87 A;  4H5I A;  3EWE A;  1P22 A;  4CY1 A;  1ERJ A;  2H47 A;  3PSL A;  4JSN C;  3IJC A;  3JRP A;  4LG9 A;  5GMK n;  4RE5 A;  3JZG A;  4JHN A;  5EMK B;  1GXR A;  1SQJ A;  1VZ2 A;  3IUN A;  1TYE A;  2YMU A;  3VGZ A;  1UOP A;  5C2W B;  1GG2 B;  3K6S A;  5IT9 g;  3N0D A;  1K3I A;  1L5G A;  2H9L A;  3DXK C;  3K72 A;  3ULE C;  1B9Y A;  3NIF A;  4ERQ A;  4WK0 A;  5I5J A;  4GMB A;  5GXI A;  2QC5 A;  5A2Q g;  2YNN A;  3E0C A;  3IIY A;  2H68 A;  3A0F A;  2CE8 A;  3C99 A;  3MMY A;  3MKQ A;  5HYN B;  4J8G A;  4FA1 D;  3AL8 B;  3K27 A;  4LGN A;  2AGY A;  4E5Z A;  3K71 A;  1PI6 A;  2OJY A;  2GC4 A;  3FCS A;  3ZDY A;  2J56 H;  1E8M A;  1C9I A;  5H17 A;  5FKR A;  5IGQ A;  3BWS A;  2Z2N A;  3I8C A;  4L1Q D;  3C5M A;  2UZX B;  2VDL A;  1OMW B;  3PVU B;  2IUV A;  4J82 A;  3QHY B;  5IC7 A;  3EI3 A;  4H5J A;  2P9K C;  3UKR C;  1QFM A;  4CI1 A;  4J0X A;  3RFG A;  4I79 A;  3KCI A;  4JT6 C;  5E6S A;  4A09 A;  4CC9 A;  1UTC A;  3IUJ A;  1O6F A;  3OL2 B;  4FHL A;  4JSP C;  2AGW A;  2B5N A;  1GOH A;  2CN3 A;  4A09 B;  1T2X A;  2VDM A;  4R7A B;  4CZY A;  4CI2 A;  3J80 g;  3BG1 A;  3JB9 L;  4NC4 A;  3W15 A;  1N6F A;  4LG8 A;  2VC2 A;  4NBM A;  5I5I A;  1OLZ A;  4JD2 C;  4U7A A;  1C9L A;  2EID A;  4QQE A;  4PBY A;  2OK6 A;  4AMY A;  3I7H A;  2VDO A;  3KRX B;  2I3S A;  5FA5 B;  3PE7 A;  4HDJ A;  4BCC A;  4AX4 A;  2Z2P A;  2CO0 C;  3EI1 A;  3EI4 B;  2XU7 A;  3FCU A;  5IJ7 E;  4CZV A;  5H1M A;  4WK4 A;  3I7L A;  5EAM A;  3C9C A;  2HKM A;  5AFU 3;  3I89 A;  3PXW D;  4D0K A;  3EI1 B;  4DNV A;  5KDO B;  3I2N A;  3ZE1 A;  2CO0 A;  4O3T B;  5CYK B;  3PXT D;  2EIE A;  2EBS A;  2VDN A;  4WK2 A;  3OF7 A;  4EWR A;  4G55 A;  4CI8 A;  2VZ3 A;  3AFC A;  4G1E A;  4K3J B;  3O4G A;  5H14 A;  2QR5 A;  5EM2 A;  3V9F A;  4ZN4 A;  2GNQ A;  4QRJ A;  4ZOX A;  2W18 A;  3P4F A;  4J73 A;  4J84 A;  4CY2 A;  1U4C A;  4L1M A;  5EML B;  4FAN D;  3O4J A;  3DSM A;  4ESG A;  3ZDX A;  4BL0 A;  5EM2 B;  3EI2 A;  2G99 A;  4JSV C;  4TZ4 A;  4JHP C;  2IUP A;  3IVM A;  4A2L A;  2AGZ A;  5TEF A;  5EAL A;  2MTA H;  2QZP A;  1H2X A;  3NID A;  5SXM A;  3CFS B;  3UR4 A;  2HJB A;  1B9X A;  1N6E A;  2PBI B;  5AJA A;  2B4E A;  2AH0 A;  2YNP A;  5HE0 B;  4BCD A;  4A7J A;  1QFS A;  3ORV D;  4PNK B;  3L4M D;  3GFC A;  5C86 A;  5TDH B;  3PVW B;  4IRZ A;  4GGC A;  2G9A A;  4BP9 A;  4O3U B;  4UM8 A;  1VZ3 A;  5M5S A;  2BKL A;  2OK4 A;  3DDU A;  4N14 A;  2HKR A;  3SLE D;  2YBA A;  3CFV A;  3MZK A;  3V4P A;  1A12 A;  4GQ1 A;  2H6N A;  4PSX B;  2XZG A;  3SBP A;  3I7K A;  2XE4 A;  5IGO A;  3MVD K;  3U4Y A;  3ZWL B;  4E5Z B;  3O4H A;  1M1X A;  2H14 A;  3T3M A;  4DNU A;  2B5L A;  2WQ8 A;  3ZE2 A;  4A2M A;  4ERY A;  2PM6 B;  2H9N A;  3ZE0 A;  5AMS A;  1U2V C; 
#chains in the Genus database with same CATH homology
 3BG0 A;  2P9I C;  2BCJ B;  3RN1 D;  4FB1 D;  3UVK A;  2PM9 A;  2H13 A;  4XYI A;  1L0Q A;  4A08 A;  2IWK A;  4AEZ A;  4J8B A;  5CXC A;  1R5M A;  1XHM A;  3HFQ A;  3JZN A;  4KFM B;  4GGA A;  2PM9 B;  3EI3 B;  4L3G D;  3MXX A;  1MG2 A;  3JPX A;  5CXC B;  4J78 A;  4PSW B;  5FXY A;  3F3F A;  3DM0 A;  4GM9 A;  4X61 B;  1XKS A;  3I7N A;  3OTT A;  4FA4 D;  4L9O A;  4O45 A;  2OVP B;  3NVX A;  4X3E A;  4NSX A;  3EG6 A;  1PEV A;  1Q47 A;  4IA9 A;  4GQB B;  4ZOZ A;  2BBK H;  4J81 A;  3AH8 B;  1RI6 A;  5CXB A;  3UVN A;  4FA5 D;  4JXM A;  1TBG A;  1SQ9 A;  2OIZ A;  3MKS B;  1TYQ C;  3PSC B;  5THA A;  2J57 G;  3GRE A;  4CY5 A;  1JMZ B;  3SBQ A;  2AGX A;  5CXB B;  1XIP A;  2J55 H;  1PGU A;  3OW8 A;  4JSX C;  3V5W B;  2Z2O A;  2CN2 A;  3K26 A;  4XEI C;  5EAR A;  4J77 A;  4GM8 A;  4J0W A;  1A0R B;  1N6D A;  3SJL D;  1MDA H;  4X63 B;  4Y5R D;  3SBR A;  3ODT A;  4CZX A;  2UZY B;  5EMJ B;  1NEX B;  3I8E A;  3EI2 B;  4ZOV A;  5FKT A;  3FGB A;  3DWL C;  5GXH A;  3SFZ A;  4ZOY A;  2Q7Q A;  4FA9 D;  1QNI A;  5HQG A;  2YB8 B;  3OKY A;  1PBY B;  3OKW A;  5EMM B;  3J81 g;  1SHY B;  4PC0 A;  3JRO A;  3N0E A;  4GZ8 A;  5HE2 B;  3CIK B;  5TF2 A;  3I7P A;  3OKY B;  2TRC B;  4JT5 C;  5EAP A;  3DXM C;  4IMM A;  5IJ8 E;  1JOF A;  3NVQ A;  2IAA A;  2H6K A;  2I3T A;  2YNO A;  4CY3 A;  4PBZ A;  3SN6 B;  5GSA A;  3AL8 A;  3RSE C;  3JZH A;  3SMR A;  5FLX g;  4A11 A;  2AGL A;  3RN0 D;  4O1Q D;  3MZL A;  3L4O D;  3NVN A;  3RLM D;  3UVL A;  2HJ4 A;  4A11 B;  3AL9 A;  1YFQ A;  2OVR B;  2OVQ B;  2CNX A;  4A0A A;  1K32 A;  2P9N C;  1JJU B;  2IUR A;  2CE9 A;  2I0S A;  4A08 B;  4GGD A;  4L3H D;  5HE3 B;  4A0A B;  5C2V B;  3SXT D;  5FKS A;  4J86 A;  4BUJ C;  4D6V A;  2I0R A;  3OL2 A;  4QT8 A;  2P9P C;  4J79 A;  5HE1 B;  4O9D A;  3EU7 A;  1MG3 A;  2PM7 B;  3SHF A;  3SCY A;  3UVO A;  5JWZ A;  5TEE A;  2XL3 A;  4CI3 A;  4ES0 A;  1GP2 B;  5C9Z B;  3F3G A;  4E54 A;  2P9S C;  3IJ0 A;  1S4U X;  2HXC A;  3B7F A;  3SWS D;  4GQ2 P;  5FQD A;  3JAM g;  2H3X A;  3IKO A;  1NR0 A;  3C75 H;  3V7D B;  3SVW D;  4E54 B;  3EI4 A;  2P9L C;  4OZU A;  4Y7R A;  3VA6 A;  1VYH C;  4ERZ A;  2O9K A;  3FM0 A;  2B5M A;  2I0T A;  3RRM C;  4OWR A;  4FAV D;  4FWW A;  5K19 A;  2XYI A;  1JMX B;  4X60 B;  2H6Q A;  3IIW A;  5K1C C;  3PXS D;  2GC7 A;  2HES X;  4BH6 A;  2AQ5 A;  4YVD A;  5CYK A;  3KRW B;  4AOW A;  3RFH A;  4Z8L A;  3OKT A;  5FKQ A;  2XL2 A;  2P9U C;  4GM3 A;  4U1E I;  2AH1 A;  3UKU C;  3F3P A;  4A0B A;  4UI9 R;  4QL1 A;  5I5M A;  3FRX A;  1GOT B;  3EMH A;  2QXV A;  2IUQ A;  4K3I D;  1FWX A;  2H9M A;  4MK0 B;  4PXW A;  3UVM A;  3I7O A;  4A0B B;  2H9P A;  4G56 B;  3RMZ D;  4XYH A;  5B4W A;  3IJ1 A;  2IWF A;  3VH0 A;  1K8K C;  2HYE A;  4J87 A;  4H5I A;  3EWE A;  1P22 A;  4CY1 A;  1ERJ A;  2H47 A;  3PSL A;  4JSN C;  3IJC A;  3JRP A;  4LG9 A;  5GMK n;  3JZG A;  5EMK B;  1GXR A;  1SQJ A;  2YMU A;  3VGZ A;  5C2W B;  1GG2 B;  5IT9 g;  3N0D A;  2H9L A;  3DXK C;  3ULE C;  1B9Y A;  4ERQ A;  5I5J A;  4GMB A;  5GXI A;  2QC5 A;  5A2Q g;  2YNN A;  3E0C A;  3IIY A;  2H68 A;  3A0F A;  2CE8 A;  3C99 A;  3MMY A;  3MKQ A;  5HYN B;  4J8G A;  4FA1 D;  3AL8 B;  3K27 A;  4LGN A;  2AGY A;  4E5Z A;  1PI6 A;  2OJY A;  2GC4 A;  2J56 H;  5H17 A;  5FKR A;  5IGQ A;  3BWS A;  2Z2N A;  3I8C A;  4L1Q D;  3C5M A;  2UZX B;  1OMW B;  3PVU B;  2IUV A;  4J82 A;  5IC7 A;  3EI3 A;  4H5J A;  2P9K C;  3UKR C;  4CI1 A;  4J0X A;  3RFG A;  4I79 A;  4JT6 C;  4A09 A;  4CC9 A;  3OL2 B;  4FHL A;  4JSP C;  2AGW A;  2B5N A;  2CN3 A;  4A09 B;  4R7A B;  4CZY A;  4CI2 A;  3J80 g;  3BG1 A;  3JB9 L;  3W15 A;  1N6F A;  4LG8 A;  5I5I A;  1OLZ A;  4JD2 C;  4U7A A;  4QQE A;  4PBY A;  2OK6 A;  3I7H A;  3KRX B;  2I3S A;  5FA5 B;  3PE7 A;  4HDJ A;  2Z2P A;  2CO0 C;  3EI1 A;  3EI4 B;  2XU7 A;  5IJ7 E;  4CZV A;  5H1M A;  3I7L A;  5EAM A;  3C9C A;  2HKM A;  5AFU 3;  3I89 A;  3PXW D;  4D0K A;  3EI1 B;  5KDO B;  3I2N A;  2CO0 A;  4O3T B;  5CYK B;  3PXT D;  2EBS A;  4EWR A;  4CI8 A;  4K3J B;  3AFC A;  5H14 A;  5EM2 A;  3V9F A;  4ZN4 A;  2GNQ A;  4QRJ A;  4ZOX A;  2W18 A;  3P4F A;  4J73 A;  4J84 A;  4CY2 A;  1U4C A;  5EML B;  4FAN D;  4ESG A;  3DSM A;  4BL0 A;  5EM2 B;  3EI2 A;  2G99 A;  4JSV C;  4TZ4 A;  2IUP A;  4A2L A;  2AGZ A;  5TEF A;  5EAL A;  2MTA H;  5SXM A;  3CFS B;  3UR4 A;  2HJB A;  1B9X A;  1N6E A;  2PBI B;  5AJA A;  2B4E A;  2AH0 A;  2YNP A;  5HE0 B;  4A7J A;  3ORV D;  4PNK B;  3L4M D;  3GFC A;  5TDH B;  3PVW B;  4GGC A;  2G9A A;  4O3U B;  2OK4 A;  4N14 A;  2HKR A;  3SLE D;  2YBA A;  3CFV A;  3MZK A;  4GQ1 A;  2H6N A;  4PSX B;  3SBP A;  3I7K A;  5IGO A;  3U4Y A;  3ZWL B;  4E5Z B;  2H14 A;  2B5L A;  4A2M A;  4ERY A;  2PM6 B;  2H9N A;  5AMS A;  1U2V C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...