2AGZA

Crystal structure of the carbinolamine intermediate in the reductive half-reaction of aromatic amine dehydrogenase (aadh) with tryptamine. f222 form
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
361
structure length
361
Chain Sequence
b'REVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGGT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase
molecule tags Oxidoreductase
publication title Atomic description of an enzyme reaction dominated by proton tunneling
pubmed doi rcsb
total genus 101
structure length 361
sequence length 361
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2agzA01
5FA5B 3F3GA 3JZNA 4J0WA 3NVQA 4GQBB 3RFHA 4A0AB 2P9NC 2TRCB 4J84A 4NSXA 3AL8A 2OK4A 5CXBB 3OL2A 4JT6C 4IMMA 2B4EA 4J86A 5THAA 3JPXA 2XYIA 4ERQA 4QT8A 3ULEC 2P9IC 3BG0A 2CE8A 3GREA 4LGNA 4YVDA 4GZ8A 3PXTD 4H5JA 4CZVA 3W15A 4CY3A 5IGQA 4JSPC 2Q7QA 5TDHB 3JB9L 3MZLA 5EAPA 5HE1B 2OK6A 4A08B 4J73A 1P22A 3C5MA 2GC7A 3SLED 3RRMC 2I0RA 4D6VA 3MMYA 2HKMA 4O9DA 2HYEA 5FKSA 4A2MA 2BBKH 2HESX 4A7JA 2YMUA 4K3JB 5EAMA 4JXMA 5I5IA 3EI1A 4ZN4A 3C75H 4QQEA 4ESGA 5I5JA 4BUJC 4L3HD 3P4FA 4HDJA 3UVOA 2IAAA 2AQ5A 3SCYA 4G56B 5H14A 3UVMA 3KRWB 3FRXA 4FA9D 5IT9g 3IJCA 4ZOYA 5FXYA 4GGCA 5FKQA 2P9UC 1QNIA 3MKQA 4JSXC 4AEZA 3EI3B 4CY5A 2EBSA 1XKSA 3A0FA 2QC5A 3AL9A 3N0DA 3F3FA 1SQJA 2H3XA 3K27A 2H68A 1ERJA 2IWFA 3EU7A 3JRPA 3SMRA 4E5ZB 5EM2B 4LG9A 3V5WB 1U4CA 3BG1A 4OZUA 4FAND 4A09A 3KRXB 3V9FA 4L3GD 3DXKC 4PNKB 5AFU3 3JZGA 3CFSB 4PSWB 2BCJB 5FQDA 3I8EA 1MG2A 2MTAH 4A11B 3BWSA 3I7OA 3EMHA 2H6KA 2B5LA 2GNQA 3NVXA 4CZYA 5AMSA 3E0CA 1N6FA 2IUVA 4J79A 2IURA 4GGDA 5FLXg 4J8BA 2H13A 3UKRC 1XIPA 4PC0A 2G9AA 4K3ID 4PSXB 2I3TA 4N14A 3V7DB 4E54A 2IUPA 2HJ4A 3OKWA 2CE9A 3DSMA 4H5IA 4D0KA 5IGOA 4CC9A 4FAVD 3J80g 5GMKn 2H9MA 5HYNB 2I3SA 4FA1D 3DM0A 3EI4A 3UR4A 4BL0A 3RLMD 4GQ2P 3L4MD 3OL2B 4JD2C 3OKYB 3RN0D 1R5MA 2CO0A 3OKYA 2CNXA 3JZHA 3SHFA 1MG3A 2OJYA 4MK0B 3C9CA 3EI2A 2H6QA 5CYKB 4GM3A 4ZOXA 4J0XA 1A0RB 4CI1A 3I7LA 5CXCA 1MDAH 4J82A 3SBRA 3IIWA 3IJ1A 3IKOA 5TF2A 2XL2A 4O1QD 3UVLA 3EWEA 4A11A 5HQGA 3UKUC 1PBYB 4J77A 2AH0A 1U2VC 4J8GA 3JAMg 1GXRA 3DWLC 4A2LA 1B9XA 5EM2A 1PGUA 3AL8B 3I8CA 2H47A 4JT5C 3SN6B 3VH0A 4CY2A 5EMLB 4QL1A 3PVUB 4XYHA 4ERYA 4A0AA 4TZ4A 3PSLA 5HE2B 3SBQA 2P9PC 3SXTD 4L9OA 2I0SA 4ES0A 3OKTA 3EI4B 1K8KC 3AFCA 3I7NA 4QRJA 3GFCA 5CXCB 4J87A 4A09B 3SBPA 2IWKA 4Y5RD 5FKTA 1L0QA 3SVWD 2AGYA 3EI2B 5IC7A 3RN1D 2YNPA 4E5ZA 2HKRA 1RI6A 3EI3A 1TYQC 4A0BA 5EALA 2OVRB 3IIYA 3IJ0A 3K26A 3I7HA 3FGBA 3C99A 4L1QD 2AGXA 4FA4D 3B7FA 3SJLD 1GG2B 4PBZA 2CN2A 5I5MA 2J56H 3N0EA 3DXMC 1OLZA 4Z8LA 5IJ7E 2OVPB 4O3TB 4BH6A 5K19A 1GOTB 4FB1D 4FA5D 2OVQB 3PXWD 1N6EA 4E54B 5H17A 5GXHA 2O9KA 4J81A 5C9ZB 4PBYA 1TBGA 3I7KA 2HXCA 3NVNA 5HE0B 2YBAA 2J55H 4CY1A 5H1MA 1S4UX 5TEEA 3UVKA 2I0TA 3I2NA 3F3PA 4GGAA 2Z2NA 1PI6A 2IUQA 4GM8A 4A0BB 4JSNC 4Y7RA 3JROA 4GQ1A 4U7AA 3U4YA 1SHYB 4X63B 3CFVA 2H9PA 2H9LA 2Z2PA 3UVNA 3MKSB 3HFQA 4J78A 1N6DA 1NR0A 1NEXB 3MZKA 3ZWLB 1B9YA 4ZOZA 4ZOVA 2H6NA 2HJBA 4X60B 2AGWA 2P9SC 5TEFA 1FWXA 5SXMA 4UI9R 4EWRA 3J81g 1K32A 4A08A 5A2Qg 4XEIC 3RFGA 1GP2B 3PXSD 1JJUB 5K1CC 5IJ8E 1OMWB 3PSCB 2YB8B 3I7PA 5GXIA 3FM0A 2G99A 3VA6A 3PE7A 4AOWA 3SFZA 1Q47A 3MXXA 4I79A 2Z2OA 4GMBA 2P9LC 4FHLA 4R7AB 2YNOA 2CO0C 2XU7A 2GC4A 3AH8B 3EI1B 5HE3B 2PM6B 4CZXA 4LG8A 3SWSD 2B5MA 2PM7B 4XYIA 5KDOB 3VGZA 1SQ9A 2B5NA 4GM9A 5EMJB 2YNNA 1JMZB 2AGLA 1PEVA 4JSVC 3PVWB 2QXVA 4FWWA 5EMKB 4O3UB 4X61B 5C2VB 2XL3A 5CYKA 3RSEC 3RMZD 5C2WB 1VYHC 2UZYB 2PBIB 5EMMB 2P9KC 2W18A 2CN3A 1XHMA 4X3EA 2PM9B 3ODTA 4ERZA 3CIKB 4O45A 2UZXB 4CI8A 1YFQA 5B4WA 5GSAA 1JMXB 2J57G 4U1EI 2OIZA 4KFMB 5EARA 3ORVD 5FKRA 2AH1A 4CI3A 5AJAA 3EG6A 4OWRA 3I89A 2H14A 5JWZA 5CXBA 3OTTA 4PXWA 3L4OD 2PM9A 2H9NA 4IA9A 3OW8A 2AGZA 1JOFA 4CI2A
chains in the Genus database with same CATH superfamily
5FA5B 3F3GA 3JZNA 4J0WA 1JV2A 3NVQA 4GQBB 3RFHA 4A0AB 2P9NC 3OF7A 2TRCB 4J84A 2JKXA 3T3MA 4NSXA 4L1MA 3AL8A 2OK4A 5CXBB 3OL2A 4JT6C 4IMMA 2HU5A 2B4EA 4J86A 4MMYA 2VDQA 5THAA 3JPXA 2XYIA 4ERQA 3V4PA 3K6SA 2VZ1A 4QT8A 3ULEC 2P9IC 3BG0A 2CE8A 3GREA 4LGNA 4YVDA 4GZ8A 3PXTD 4H5JA 4CZVA 3W15A 4CY3A 5IGQA 4JSPC 2Q7QA 2EIBA 5TDHB 3JB9L 3MZLA 1H2YA 5EAPA 5HE1B 2OK6A 1C9LA 2VDNA 4J73A 4DNVA 4A08B 1P22A 3C5MA 2GC7A 4WK4A 3SLED 3RRMC 2I0RA 4D6VA 2QR5A 3MMYA 1GOGA 3O4IA 2HKMA 4O9DA 2HYEA 5FKSA 4A2MA 2BBKH 2HESX 4A7JA 2YMUA 4K3JB 5EAMA 4JXMA 4AMZA 5I5IA 3EI1A 4ZN4A 3C75H 3IUNA 4QQEA 4ESGA 5I5JA 1I2MB 4BUJC 4L3HD 3GC3B 3VI3A 3P4FA 4HDJA 3UVOA 2IAAA 2AQ5A 1U8CA 4DNWA 3SCYA 4G56B 5H14A 1VZ3A 3UVMA 3KRWB 3FRXA 2VDKA 4FA9D 5IT9g 3IJCA 3FCUA 4ZOYA 5FXYA 3IJEA 4GGCA 5FKQA 2P9UC 1QNIA 3MKQA 3QHYB 4JSXC 4AEZA 3EI3B 4CY5A 2EBSA 1XKSA 4DNUA 3IULA 1VZ2A 3A0FA 3AL9A 2QC5A 3N0DA 5E6UA 1L5GA 3F3FA 1SQJA 2H3XA 3K27A 2H68A 1ERJA 2IWFA 3EU7A 3JRPA 3SMRA 4E5ZB 5EM2B 4LG9A 3V5WB 1U4CA 3BG1A 3MUNA 4OZUA 4FAND 5FFGA 4A09A 1H2WA 3KRXB 3V9FA 4L3GD 3MUOA 3DXKC 4PNKB 1E5TA 3JZGA 5AFU3 3CFSB 4PSWB 2QZPA 2BCJB 5FQDA 3I8EA 1MG2A 3O4JA 2MTAH 1VE7A 1O6GA 4A11B 3BWSA 3I7OA 3EMHA 2H6KA 2B5LA 2GNQA 3NVXA 4CZYA 4JHNA 2VZ3A 5AMSA 3E0CA 1N6FA 2IUVA 4J79A 2IURA 3ZE1A 4GGDA 4BCBA 5FLXg 4J8BA 2H13A 3UKRC 1XIPA 4PC0A 2G9AA 4K3ID 4PSXB 2I3TA 1UTCA 4N14A 3V7DB 4E54A 2IUPA 2HJ4A 3OKWA 1M1XA 2CE9A 3DSMA 4H5IA 4D0KA 1BPOA 5IGOA 4RE6A 3DDUA 3ZDZA 4CC9A 4FAVD 3J80g 5GMKn 1K3IA 2H9MA 5HYNB 2I3SA 4FA1D 3DM0A 2HU8A 3EI4A 3UR4A 4BL0A 4Z7QA 2VDMA 3K71A 3RLMD 4GQ2P 5M61A 3L4MD 3OL2B 1E8NA 4JD2C 3OKYB 3RN0D 1R5MA 2CO0A 1GOFA 3OKYA 4WJKA 2CNXA 3JZHA 3SHFA 1MG3A 5HDBA 2OJYA 3ZE0A 4MK0B 4AN0A 2XE4A 3C9CA 3EI2A 2H6QA 5CYKB 4GM3A 4RE5A 4ZOXA 4J0XA 1A0RB 4CI1A 3I7LA 5CXCA 1MDAH 4Z7NA 4J82A 3SBRA 3O4GA 3IIWA 3IJ1A 4BP8A 3IKOA 4QAMA 5TF2A 2XL2A 4IRZA 4O1QD 3UVLA 1VE6A 3EWEA 4A11A 5HQGA 3UKUC 3ZE2A 3T3PA 1PBYB 4J77A 2AH0A 1U2VC 4J8GA 3JAMg 1GXRA 5M5SA 3DWLC 5M5UA 4A2LA 1B9XA 5EM2A 1PGUA 3IUJA 3AL8B 3I8CA 2H47A 4JT5C 3SN6B 4AN1A 3VH0A 3IUMA 1A12A 5EMLB 3NIGA 2VC2A 4CY2A 3EQ7A 4QL1A 1QFMA 1C9IA 3PVUB 4XYHA 4ERYA 4A0AA 3IVMA 4TZ4A 3PSLA 5HE2B 5E6RA 3SBQA 2P9PC 3EQ8A 3SXTD 4L9OA 2I0SA 4ES0A 3OKTA 4D9SA 5C86A 3EI4B 1K8KC 2EICA 3NIFA 3AFCA 3I7NA 4QRJA 3GFCA 5CXCB 4J87A 4UM9A 4A09B 3SBPA 2IWKA 2XZGA 4Y5RD 5FKTA 1L0QA 3SVWD 2AGYA 1TYEA 5IC7A 3RN1D 3EI2B 2YNPA 4NENA 4E5ZA 2HKRA 5M5TA 1RI6A 4O2WA 3EI3A 1TYQC 4A0BA 3IUQA 5EALA 2WQ8A 2OVRB 3IIYA 3IJ0A 3K26A 3I7HA 3FGBA 3C99A 4L1QD 4WK0A 1T2XA 2AGXA 3V4VA 4FA4D 3B7FA 3SJLD 2EIDA 3IURA 1GG2B 4PBZA 1GOHA 2CN2A 5I5MA 2J56H 3N0EA 3DXMC 1OLZA 4Z8LA 1H2XA 4AX4A 5IJ7E 1E8MA 2OVPB 4O3TB 4BH6A 5K19A 1GOTB 4FB1D 4FA5D 4O02A 4MMXA 2OVQB 3PXWD 1N6EA 4E54B 5H17A 5GXHA 2O9KA 4J81A 5C9ZB 4PBYA 1TBGA 3I7KA 2HXCA 3NVNA 5HE0B 2YBAA 2J55H 4CY1A 1O6FA 5H1MA 1S4UX 5TEEA 2BKLA 3UVKA 2I0TA 3I2NA 3F3PA 4GGAA 2Z2NA 4BCDA 1PI6A 2IUQA 4MMZA 4GM8A 4A0BB 4JSNC 4Y7RA 3JROA 4GQ1A 4U7AA 1QFSA 3U4YA 1SHYB 2HU7A 3CFVA 4X63B 2H9PA 2H9LA 2Z2PA 3UVNA 3MKSB 3HFQA 4J78A 1N6DA 1NR0A 1NEXB 3MZKA 1UOQA 3ZWLB 1B9YA 4ZOZA 4Z7OA 4ZOVA 2H6NA 2HJBA 4X60B 2AGWA 3FCSA 2P9SC 5TEFA 1FWXA 5SXMA 4UI9R 4EWRA 3J81g 1K32A 4A08A 5A2Qg 4XEIC 3RFGA 5C92A 1GP2B 3PXSD 1JJUB 1YR2A 5K1CC 1OMWB 3ZDYA 5IJ8E 4AMYA 3PSCB 2YB8B 3MVDK 3QI0A 3I7PA 5GXIA 3FM0A 2G99A 3VA6A 3PE7A 5FFOA 4AOWA 3SFZA 1Q47A 3MXXA 4G1MA 4I79A 5M5RA 2Z2OA 4GMBA 2P9LC 3K72A 4FHLA 4R7AB 4UM8A 2YNOA 2CO0C 2XU7A 3GD1I 2GC4A 3AH8B 2VDOA 3EI1B 5HE3B 2PM6B 4CZXA 4LG8A 3NIDA 3SWSD 2B5MA 2PM7B 4XYIA 5KDOB 4JHPC 2XDWA 3VGZA 1SQ9A 2B5NA 3O4HA 4GM9A 4BCCA 4NAAA 5EMJB 4G55A 2YNNA 1JMZB 2AGLA 1PEVA 4JSVC 3PVWB 2QXVA 4FWWA 2EIEA 5EMKB 4O3UB 4X61B 5C2VB 2XL3A 5CYKA 1JTDB 3RSEC 3RMZD 5E6SA 5C2WB 1VYHC 2UZYB 2PBIB 3KCIA 5EMMB 2P9KC 2W18A 1UOPA 3EQ9A 2CN3A 1XHMA 3VI4A 2VDPA 4WK2A 4X3EA 4G1EA 2PM9B 3ODTA 5M5VA 4ERZA 3CIKB 4O45A 2UZXB 4CI8A 1YFQA 5B4WA 5GSAA 1JMXB 2J57G 2OIZA 4U1EI 4KFMB 5EARA 3ORVD 5FKRA 2AH1A 4CI3A 5AJAA 1H2ZA 4BP9A 3EG6A 4OWRA 3I89A 2H14A 4NC4A 5JWZA 5CXBA 3OTTA 4PXWA 2VDLA 3L4OD 3ZDXA 2PM9A 2H9NA 4IA9A 1UOOA 4NBMA 3OW8A 2AGZA 2VDRA 1JOFA 4CI2A
chains in the Genus database with same CATH topology
5FA5B 3F3GA 3JZNA 4J0WA 3NVQA 4GQBB 3RFHA 4A0AB 2P9NC 2TRCB 4J84A 4NSXA 3AL8A 2OK4A 5CXBB 3OL2A 4JT6C 4IMMA 2B4EA 4J86A 5THAA 3JPXA 2XYIA 4ERQA 4QT8A 3ULEC 2P9IC 3BG0A 2CE8A 3GREA 4LGNA 4YVDA 4GZ8A 3PXTD 4H5JA 4CZVA 3W15A 4CY3A 5IGQA 4JSPC 2Q7QA 5TDHB 3JB9L 3MZLA 5EAPA 5HE1B 2OK6A 4A08B 4J73A 1P22A 3C5MA 2GC7A 3SLED 3RRMC 2I0RA 4D6VA 3MMYA 2HKMA 4O9DA 2HYEA 5FKSA 4A2MA 2BBKH 2HESX 4A7JA 2YMUA 4K3JB 5EAMA 4JXMA 5I5IA 3EI1A 4ZN4A 3C75H 4QQEA 4ESGA 5I5JA 4BUJC 4L3HD 3P4FA 4HDJA 3UVOA 2IAAA 2AQ5A 3SCYA 4G56B 5H14A 3UVMA 3KRWB 3FRXA 4FA9D 5IT9g 3IJCA 4ZOYA 5FXYA 4GGCA 5FKQA 2P9UC 1QNIA 3MKQA 4JSXC 4AEZA 3EI3B 4CY5A 2EBSA 1XKSA 3A0FA 2QC5A 3AL9A 3N0DA 3F3FA 1SQJA 2H3XA 3K27A 2H68A 1ERJA 2IWFA 3EU7A 3JRPA 3SMRA 4E5ZB 5EM2B 4LG9A 3V5WB 1U4CA 3BG1A 4OZUA 4FAND 4A09A 3KRXB 3V9FA 4L3GD 3DXKC 4PNKB 5AFU3 3JZGA 3CFSB 4PSWB 2BCJB 5FQDA 3I8EA 1MG2A 2MTAH 4A11B 3BWSA 3I7OA 3EMHA 2H6KA 2B5LA 2GNQA 3NVXA 4CZYA 5AMSA 3E0CA 1N6FA 2IUVA 4J79A 2IURA 4GGDA 5FLXg 4J8BA 2H13A 3UKRC 1XIPA 4PC0A 2G9AA 4K3ID 4PSXB 2I3TA 4N14A 3V7DB 4E54A 2IUPA 2HJ4A 3OKWA 2CE9A 3DSMA 4H5IA 4D0KA 5IGOA 4CC9A 4FAVD 3J80g 5GMKn 2H9MA 5HYNB 2I3SA 4FA1D 3DM0A 3EI4A 3UR4A 4BL0A 3RLMD 4GQ2P 3L4MD 3OL2B 4JD2C 3OKYB 3RN0D 1R5MA 2CO0A 3OKYA 2CNXA 3JZHA 3SHFA 1MG3A 2OJYA 4MK0B 3C9CA 3EI2A 2H6QA 5CYKB 4GM3A 4ZOXA 4J0XA 1A0RB 4CI1A 3I7LA 5CXCA 1MDAH 4J82A 3SBRA 3IIWA 3IJ1A 3IKOA 5TF2A 2XL2A 4O1QD 3UVLA 3EWEA 4A11A 5HQGA 3UKUC 1PBYB 4J77A 2AH0A 1U2VC 4J8GA 3JAMg 1GXRA 3DWLC 4A2LA 1B9XA 5EM2A 1PGUA 3AL8B 3I8CA 2H47A 4JT5C 3SN6B 3VH0A 4CY2A 5EMLB 4QL1A 3PVUB 4XYHA 4ERYA 4A0AA 4TZ4A 3PSLA 5HE2B 3SBQA 2P9PC 3SXTD 4L9OA 2I0SA 4ES0A 3OKTA 3EI4B 1K8KC 3AFCA 3I7NA 4QRJA 3GFCA 5CXCB 4J87A 4A09B 3SBPA 2IWKA 4Y5RD 5FKTA 1L0QA 3SVWD 2AGYA 3EI2B 5IC7A 3RN1D 2YNPA 4E5ZA 2HKRA 1RI6A 3EI3A 1TYQC 4A0BA 5EALA 2OVRB 3IIYA 3IJ0A 3K26A 3I7HA 3FGBA 3C99A 4L1QD 2AGXA 4FA4D 3B7FA 3SJLD 1GG2B 4PBZA 2CN2A 5I5MA 2J56H 3N0EA 3DXMC 1OLZA 4Z8LA 5IJ7E 2OVPB 4O3TB 4BH6A 5K19A 1GOTB 4FB1D 4FA5D 2OVQB 3PXWD 1N6EA 4E54B 5H17A 5GXHA 2O9KA 4J81A 5C9ZB 4PBYA 1TBGA 3I7KA 2HXCA 3NVNA 5HE0B 2YBAA 2J55H 4CY1A 5H1MA 1S4UX 5TEEA 3UVKA 2I0TA 3I2NA 3F3PA 4GGAA 2Z2NA 1PI6A 2IUQA 4GM8A 4A0BB 4JSNC 4Y7RA 3JROA 4GQ1A 4U7AA 3U4YA 1SHYB 4X63B 3CFVA 2H9PA 2H9LA 2Z2PA 3UVNA 3MKSB 3HFQA 4J78A 1N6DA 1NR0A 1NEXB 3MZKA 3ZWLB 1B9YA 4ZOZA 4ZOVA 2H6NA 2HJBA 4X60B 2AGWA 2P9SC 5TEFA 1FWXA 5SXMA 4UI9R 4EWRA 3J81g 1K32A 4A08A 5A2Qg 4XEIC 3RFGA 1GP2B 3PXSD 1JJUB 5K1CC 5IJ8E 1OMWB 3PSCB 2YB8B 3I7PA 5GXIA 3FM0A 2G99A 3VA6A 3PE7A 4AOWA 3SFZA 1Q47A 3MXXA 4I79A 2Z2OA 4GMBA 2P9LC 4FHLA 4R7AB 2YNOA 2CO0C 2XU7A 2GC4A 3AH8B 3EI1B 5HE3B 2PM6B 4CZXA 4LG8A 3SWSD 2B5MA 2PM7B 4XYIA 5KDOB 3VGZA 1SQ9A 2B5NA 4GM9A 5EMJB 2YNNA 1JMZB 2AGLA 1PEVA 4JSVC 3PVWB 2QXVA 4FWWA 5EMKB 4O3UB 4X61B 5C2VB 2XL3A 5CYKA 3RSEC 3RMZD 5C2WB 1VYHC 2UZYB 2PBIB 5EMMB 2P9KC 2W18A 2CN3A 1XHMA 4X3EA 2PM9B 3ODTA 4ERZA 3CIKB 4O45A 2UZXB 4CI8A 1YFQA 5B4WA 5GSAA 1JMXB 2J57G 4U1EI 2OIZA 4KFMB 5EARA 3ORVD 5FKRA 2AH1A 4CI3A 5AJAA 3EG6A 4OWRA 3I89A 2H14A 5JWZA 5CXBA 3OTTA 4PXWA 3L4OD 2PM9A 2H9NA 4IA9A 3OW8A 2AGZA 1JOFA 4CI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FA5 B;  3F3G A;  3JZN A;  4J0W A;  3NVQ A;  4GQB B;  3RFH A;  4A0A B;  2P9N C;  2TRC B;  4J84 A;  4NSX A;  3AL8 A;  2OK4 A;  5CXB B;  3OL2 A;  4JT6 C;  4IMM A;  2B4E A;  4J86 A;  5THA A;  3JPX A;  2XYI A;  4ERQ A;  4QT8 A;  3ULE C;  2P9I C;  3BG0 A;  2CE8 A;  3GRE A;  4LGN A;  4YVD A;  4GZ8 A;  3PXT D;  4H5J A;  4CZV A;  3W15 A;  4CY3 A;  5IGQ A;  4JSP C;  2Q7Q A;  5TDH B;  3JB9 L;  3MZL A;  5EAP A;  5HE1 B;  2OK6 A;  4A08 B;  4J73 A;  1P22 A;  3C5M A;  2GC7 A;  3SLE D;  3RRM C;  2I0R A;  4D6V A;  3MMY A;  2HKM A;  4O9D A;  2HYE A;  5FKS A;  4A2M A;  2BBK H;  2HES X;  4A7J A;  2YMU A;  4K3J B;  5EAM A;  4JXM A;  5I5I A;  3EI1 A;  4ZN4 A;  3C75 H;  4QQE A;  4ESG A;  5I5J A;  4BUJ C;  4L3H D;  3P4F A;  4HDJ A;  3UVO A;  2IAA A;  2AQ5 A;  3SCY A;  4G56 B;  5H14 A;  3UVM A;  3KRW B;  3FRX A;  4FA9 D;  5IT9 g;  3IJC A;  4ZOY A;  5FXY A;  4GGC A;  5FKQ A;  2P9U C;  1QNI A;  3MKQ A;  4JSX C;  4AEZ A;  3EI3 B;  4CY5 A;  2EBS A;  1XKS A;  3A0F A;  2QC5 A;  3AL9 A;  3N0D A;  3F3F A;  1SQJ A;  2H3X A;  3K27 A;  2H68 A;  1ERJ A;  2IWF A;  3EU7 A;  3JRP A;  3SMR A;  4E5Z B;  5EM2 B;  4LG9 A;  3V5W B;  1U4C A;  3BG1 A;  4OZU A;  4FAN D;  4A09 A;  3KRX B;  3V9F A;  4L3G D;  3DXK C;  4PNK B;  5AFU 3;  3JZG A;  3CFS B;  4PSW B;  2BCJ B;  5FQD A;  3I8E A;  1MG2 A;  2MTA H;  4A11 B;  3BWS A;  3I7O A;  3EMH A;  2H6K A;  2B5L A;  2GNQ A;  3NVX A;  4CZY A;  5AMS A;  3E0C A;  1N6F A;  2IUV A;  4J79 A;  2IUR A;  4GGD A;  5FLX g;  4J8B A;  2H13 A;  3UKR C;  1XIP A;  4PC0 A;  2G9A A;  4K3I D;  4PSX B;  2I3T A;  4N14 A;  3V7D B;  4E54 A;  2IUP A;  2HJ4 A;  3OKW A;  2CE9 A;  3DSM A;  4H5I A;  4D0K A;  5IGO A;  4CC9 A;  4FAV D;  3J80 g;  5GMK n;  2H9M A;  5HYN B;  2I3S A;  4FA1 D;  3DM0 A;  3EI4 A;  3UR4 A;  4BL0 A;  3RLM D;  4GQ2 P;  3L4M D;  3OL2 B;  4JD2 C;  3OKY B;  3RN0 D;  1R5M A;  2CO0 A;  3OKY A;  2CNX A;  3JZH A;  3SHF A;  1MG3 A;  2OJY A;  4MK0 B;  3C9C A;  3EI2 A;  2H6Q A;  5CYK B;  4GM3 A;  4ZOX A;  4J0X A;  1A0R B;  4CI1 A;  3I7L A;  5CXC A;  1MDA H;  4J82 A;  3SBR A;  3IIW A;  3IJ1 A;  3IKO A;  5TF2 A;  2XL2 A;  4O1Q D;  3UVL A;  3EWE A;  4A11 A;  5HQG A;  3UKU C;  1PBY B;  4J77 A;  2AH0 A;  1U2V C;  4J8G A;  3JAM g;  1GXR A;  3DWL C;  4A2L A;  1B9X A;  5EM2 A;  1PGU A;  3AL8 B;  3I8C A;  2H47 A;  4JT5 C;  3SN6 B;  3VH0 A;  4CY2 A;  5EML B;  4QL1 A;  3PVU B;  4XYH A;  4ERY A;  4A0A A;  4TZ4 A;  3PSL A;  5HE2 B;  3SBQ A;  2P9P C;  3SXT D;  4L9O A;  2I0S A;  4ES0 A;  3OKT A;  3EI4 B;  1K8K C;  3AFC A;  3I7N A;  4QRJ A;  3GFC A;  5CXC B;  4J87 A;  4A09 B;  3SBP A;  2IWK A;  4Y5R D;  5FKT A;  1L0Q A;  3SVW D;  2AGY A;  3EI2 B;  5IC7 A;  3RN1 D;  2YNP A;  4E5Z A;  2HKR A;  1RI6 A;  3EI3 A;  1TYQ C;  4A0B A;  5EAL A;  2OVR B;  3IIY A;  3IJ0 A;  3K26 A;  3I7H A;  3FGB A;  3C99 A;  4L1Q D;  2AGX A;  4FA4 D;  3B7F A;  3SJL D;  1GG2 B;  4PBZ A;  2CN2 A;  5I5M A;  2J56 H;  3N0E A;  3DXM C;  1OLZ A;  4Z8L A;  5IJ7 E;  2OVP B;  4O3T B;  4BH6 A;  5K19 A;  1GOT B;  4FB1 D;  4FA5 D;  2OVQ B;  3PXW D;  1N6E A;  4E54 B;  5H17 A;  5GXH A;  2O9K A;  4J81 A;  5C9Z B;  4PBY A;  1TBG A;  3I7K A;  2HXC A;  3NVN A;  5HE0 B;  2YBA A;  2J55 H;  4CY1 A;  5H1M A;  1S4U X;  5TEE A;  3UVK A;  2I0T A;  3I2N A;  3F3P A;  4GGA A;  2Z2N A;  1PI6 A;  2IUQ A;  4GM8 A;  4A0B B;  4JSN C;  4Y7R A;  3JRO A;  4GQ1 A;  4U7A A;  3U4Y A;  1SHY B;  4X63 B;  3CFV A;  2H9P A;  2H9L A;  2Z2P A;  3UVN A;  3MKS B;  3HFQ A;  4J78 A;  1N6D A;  1NR0 A;  1NEX B;  3MZK A;  3ZWL B;  1B9Y A;  4ZOZ A;  4ZOV A;  2H6N A;  2HJB A;  4X60 B;  2AGW A;  2P9S C;  5TEF A;  1FWX A;  5SXM A;  4UI9 R;  4EWR A;  3J81 g;  1K32 A;  4A08 A;  5A2Q g;  4XEI C;  3RFG A;  1GP2 B;  3PXS D;  1JJU B;  5K1C C;  5IJ8 E;  1OMW B;  3PSC B;  2YB8 B;  3I7P A;  5GXI A;  3FM0 A;  2G99 A;  3VA6 A;  3PE7 A;  4AOW A;  3SFZ A;  1Q47 A;  3MXX A;  4I79 A;  2Z2O A;  4GMB A;  2P9L C;  4FHL A;  4R7A B;  2YNO A;  2CO0 C;  2XU7 A;  2GC4 A;  3AH8 B;  3EI1 B;  5HE3 B;  2PM6 B;  4CZX A;  4LG8 A;  3SWS D;  2B5M A;  2PM7 B;  4XYI A;  5KDO B;  3VGZ A;  1SQ9 A;  2B5N A;  4GM9 A;  5EMJ B;  2YNN A;  1JMZ B;  2AGL A;  1PEV A;  4JSV C;  3PVW B;  2QXV A;  4FWW A;  5EMK B;  4O3U B;  4X61 B;  5C2V B;  2XL3 A;  5CYK A;  3RSE C;  3RMZ D;  5C2W B;  1VYH C;  2UZY B;  2PBI B;  5EMM B;  2P9K C;  2W18 A;  2CN3 A;  1XHM A;  4X3E A;  2PM9 B;  3ODT A;  4ERZ A;  3CIK B;  4O45 A;  2UZX B;  4CI8 A;  1YFQ A;  5B4W A;  5GSA A;  1JMX B;  2J57 G;  4U1E I;  2OIZ A;  4KFM B;  5EAR A;  3ORV D;  5FKR A;  2AH1 A;  4CI3 A;  5AJA A;  3EG6 A;  4OWR A;  3I89 A;  2H14 A;  5JWZ A;  5CXB A;  3OTT A;  4PXW A;  3L4O D;  2PM9 A;  2H9N A;  4IA9 A;  3OW8 A;  2AGZ A;  1JOF A;  4CI2 A; 
#chains in the Genus database with same CATH topology
 5FA5 B;  3F3G A;  3JZN A;  4J0W A;  1JV2 A;  3NVQ A;  4GQB B;  3RFH A;  4A0A B;  2P9N C;  3OF7 A;  2TRC B;  4J84 A;  2JKX A;  3T3M A;  4NSX A;  4L1M A;  3AL8 A;  2OK4 A;  5CXB B;  3OL2 A;  4JT6 C;  4IMM A;  2HU5 A;  2B4E A;  4J86 A;  4MMY A;  2VDQ A;  5THA A;  3JPX A;  2XYI A;  4ERQ A;  3V4P A;  3K6S A;  2VZ1 A;  4QT8 A;  3ULE C;  2P9I C;  3BG0 A;  2CE8 A;  3GRE A;  4LGN A;  4YVD A;  4GZ8 A;  3PXT D;  4H5J A;  4CZV A;  3W15 A;  4CY3 A;  5IGQ A;  4JSP C;  2Q7Q A;  2EIB A;  5TDH B;  3JB9 L;  3MZL A;  1H2Y A;  5EAP A;  5HE1 B;  2OK6 A;  1C9L A;  2VDN A;  4J73 A;  4DNV A;  4A08 B;  1P22 A;  3C5M A;  2GC7 A;  4WK4 A;  3SLE D;  3RRM C;  2I0R A;  4D6V A;  2QR5 A;  3MMY A;  1GOG A;  3O4I A;  2HKM A;  4O9D A;  2HYE A;  5FKS A;  4A2M A;  2BBK H;  2HES X;  4A7J A;  2YMU A;  4K3J B;  5EAM A;  4JXM A;  4AMZ A;  5I5I A;  3EI1 A;  4ZN4 A;  3C75 H;  3IUN A;  4QQE A;  4ESG A;  5I5J A;  1I2M B;  4BUJ C;  4L3H D;  3GC3 B;  3VI3 A;  3P4F A;  4HDJ A;  3UVO A;  2IAA A;  2AQ5 A;  1U8C A;  4DNW A;  3SCY A;  4G56 B;  5H14 A;  1VZ3 A;  3UVM A;  3KRW B;  3FRX A;  2VDK A;  4FA9 D;  5IT9 g;  3IJC A;  3FCU A;  4ZOY A;  5FXY A;  3IJE A;  4GGC A;  5FKQ A;  2P9U C;  1QNI A;  3MKQ A;  3QHY B;  4JSX C;  4AEZ A;  3EI3 B;  4CY5 A;  2EBS A;  1XKS A;  4DNU A;  3IUL A;  1VZ2 A;  3A0F A;  3AL9 A;  2QC5 A;  3N0D A;  5E6U A;  1L5G A;  3F3F A;  1SQJ A;  2H3X A;  3K27 A;  2H68 A;  1ERJ A;  2IWF A;  3EU7 A;  3JRP A;  3SMR A;  4E5Z B;  5EM2 B;  4LG9 A;  3V5W B;  1U4C A;  3BG1 A;  3MUN A;  4OZU A;  4FAN D;  5FFG A;  4A09 A;  1H2W A;  3KRX B;  3V9F A;  4L3G D;  3MUO A;  3DXK C;  4PNK B;  1E5T A;  3JZG A;  5AFU 3;  3CFS B;  4PSW B;  2QZP A;  2BCJ B;  5FQD A;  3I8E A;  1MG2 A;  3O4J A;  2MTA H;  1VE7 A;  1O6G A;  4A11 B;  3BWS A;  3I7O A;  3EMH A;  2H6K A;  2B5L A;  2GNQ A;  3NVX A;  4CZY A;  4JHN A;  2VZ3 A;  5AMS A;  3E0C A;  1N6F A;  2IUV A;  4J79 A;  2IUR A;  3ZE1 A;  4GGD A;  4BCB A;  5FLX g;  4J8B A;  2H13 A;  3UKR C;  1XIP A;  4PC0 A;  2G9A A;  4K3I D;  4PSX B;  2I3T A;  1UTC A;  4N14 A;  3V7D B;  4E54 A;  2IUP A;  2HJ4 A;  3OKW A;  1M1X A;  2CE9 A;  3DSM A;  4H5I A;  4D0K A;  1BPO A;  5IGO A;  4RE6 A;  3DDU A;  3ZDZ A;  4CC9 A;  4FAV D;  3J80 g;  5GMK n;  1K3I A;  2H9M A;  5HYN B;  2I3S A;  4FA1 D;  3DM0 A;  2HU8 A;  3EI4 A;  3UR4 A;  4BL0 A;  4Z7Q A;  2VDM A;  3K71 A;  3RLM D;  4GQ2 P;  5M61 A;  3L4M D;  3OL2 B;  1E8N A;  4JD2 C;  3OKY B;  3RN0 D;  1R5M A;  2CO0 A;  1GOF A;  3OKY A;  4WJK A;  2CNX A;  3JZH A;  3SHF A;  1MG3 A;  5HDB A;  2OJY A;  3ZE0 A;  4MK0 B;  4AN0 A;  2XE4 A;  3C9C A;  3EI2 A;  2H6Q A;  5CYK B;  4GM3 A;  4RE5 A;  4ZOX A;  4J0X A;  1A0R B;  4CI1 A;  3I7L A;  5CXC A;  1MDA H;  4Z7N A;  4J82 A;  3SBR A;  3O4G A;  3IIW A;  3IJ1 A;  4BP8 A;  3IKO A;  4QAM A;  5TF2 A;  2XL2 A;  4IRZ A;  4O1Q D;  3UVL A;  1VE6 A;  3EWE A;  4A11 A;  5HQG A;  3UKU C;  3ZE2 A;  3T3P A;  1PBY B;  4J77 A;  2AH0 A;  1U2V C;  4J8G A;  3JAM g;  1GXR A;  5M5S A;  3DWL C;  5M5U A;  4A2L A;  1B9X A;  5EM2 A;  1PGU A;  3IUJ A;  3AL8 B;  3I8C A;  2H47 A;  4JT5 C;  3SN6 B;  4AN1 A;  3VH0 A;  3IUM A;  1A12 A;  5EML B;  3NIG A;  2VC2 A;  4CY2 A;  3EQ7 A;  4QL1 A;  1QFM A;  1C9I A;  3PVU B;  4XYH A;  4ERY A;  4A0A A;  3IVM A;  4TZ4 A;  3PSL A;  5HE2 B;  5E6R A;  3SBQ A;  2P9P C;  3EQ8 A;  3SXT D;  4L9O A;  2I0S A;  4ES0 A;  3OKT A;  4D9S A;  5C86 A;  3EI4 B;  1K8K C;  2EIC A;  3NIF A;  3AFC A;  3I7N A;  4QRJ A;  3GFC A;  5CXC B;  4J87 A;  4UM9 A;  4A09 B;  3SBP A;  2IWK A;  2XZG A;  4Y5R D;  5FKT A;  1L0Q A;  3SVW D;  2AGY A;  1TYE A;  5IC7 A;  3RN1 D;  3EI2 B;  2YNP A;  4NEN A;  4E5Z A;  2HKR A;  5M5T A;  1RI6 A;  4O2W A;  3EI3 A;  1TYQ C;  4A0B A;  3IUQ A;  5EAL A;  2WQ8 A;  2OVR B;  3IIY A;  3IJ0 A;  3K26 A;  3I7H A;  3FGB A;  3C99 A;  4L1Q D;  4WK0 A;  1T2X A;  2AGX A;  3V4V A;  4FA4 D;  3B7F A;  3SJL D;  2EID A;  3IUR A;  1GG2 B;  4PBZ A;  1GOH A;  2CN2 A;  5I5M A;  2J56 H;  3N0E A;  3DXM C;  1OLZ A;  4Z8L A;  1H2X A;  4AX4 A;  5IJ7 E;  1E8M A;  2OVP B;  4O3T B;  4BH6 A;  5K19 A;  1GOT B;  4FB1 D;  4FA5 D;  4O02 A;  4MMX A;  2OVQ B;  3PXW D;  1N6E A;  4E54 B;  5H17 A;  5GXH A;  2O9K A;  4J81 A;  5C9Z B;  4PBY A;  1TBG A;  3I7K A;  2HXC A;  3NVN A;  5HE0 B;  2YBA A;  2J55 H;  4CY1 A;  1O6F A;  5H1M A;  1S4U X;  5TEE A;  2BKL A;  3UVK A;  2I0T A;  3I2N A;  3F3P A;  4GGA A;  2Z2N A;  4BCD A;  1PI6 A;  2IUQ A;  4MMZ A;  4GM8 A;  4A0B B;  4JSN C;  4Y7R A;  3JRO A;  4GQ1 A;  4U7A A;  1QFS A;  3U4Y A;  1SHY B;  2HU7 A;  3CFV A;  4X63 B;  2H9P A;  2H9L A;  2Z2P A;  3UVN A;  3MKS B;  3HFQ A;  4J78 A;  1N6D A;  1NR0 A;  1NEX B;  3MZK A;  1UOQ A;  3ZWL B;  1B9Y A;  4ZOZ A;  4Z7O A;  4ZOV A;  2H6N A;  2HJB A;  4X60 B;  2AGW A;  3FCS A;  2P9S C;  5TEF A;  1FWX A;  5SXM A;  4UI9 R;  4EWR A;  3J81 g;  1K32 A;  4A08 A;  5A2Q g;  4XEI C;  3RFG A;  5C92 A;  1GP2 B;  3PXS D;  1JJU B;  1YR2 A;  5K1C C;  1OMW B;  3ZDY A;  5IJ8 E;  4AMY A;  3PSC B;  2YB8 B;  3MVD K;  3QI0 A;  3I7P A;  5GXI A;  3FM0 A;  2G99 A;  3VA6 A;  3PE7 A;  5FFO A;  4AOW A;  3SFZ A;  1Q47 A;  3MXX A;  4G1M A;  4I79 A;  5M5R A;  2Z2O A;  4GMB A;  2P9L C;  3K72 A;  4FHL A;  4R7A B;  4UM8 A;  2YNO A;  2CO0 C;  2XU7 A;  3GD1 I;  2GC4 A;  3AH8 B;  2VDO A;  3EI1 B;  5HE3 B;  2PM6 B;  4CZX A;  4LG8 A;  3NID A;  3SWS D;  2B5M A;  2PM7 B;  4XYI A;  5KDO B;  4JHP C;  2XDW A;  3VGZ A;  1SQ9 A;  2B5N A;  3O4H A;  4GM9 A;  4BCC A;  4NAA A;  5EMJ B;  4G55 A;  2YNN A;  1JMZ B;  2AGL A;  1PEV A;  4JSV C;  3PVW B;  2QXV A;  4FWW A;  2EIE A;  5EMK B;  4O3U B;  4X61 B;  5C2V B;  2XL3 A;  5CYK A;  1JTD B;  3RSE C;  3RMZ D;  5E6S A;  5C2W B;  1VYH C;  2UZY B;  2PBI B;  3KCI A;  5EMM B;  2P9K C;  2W18 A;  1UOP A;  3EQ9 A;  2CN3 A;  1XHM A;  3VI4 A;  2VDP A;  4WK2 A;  4X3E A;  4G1E A;  2PM9 B;  3ODT A;  5M5V A;  4ERZ A;  3CIK B;  4O45 A;  2UZX B;  4CI8 A;  1YFQ A;  5B4W A;  5GSA A;  1JMX B;  2J57 G;  2OIZ A;  4U1E I;  4KFM B;  5EAR A;  3ORV D;  5FKR A;  2AH1 A;  4CI3 A;  5AJA A;  1H2Z A;  4BP9 A;  3EG6 A;  4OWR A;  3I89 A;  2H14 A;  4NC4 A;  5JWZ A;  5CXB A;  3OTT A;  4PXW A;  2VDL A;  3L4O D;  3ZDX A;  2PM9 A;  2H9N A;  4IA9 A;  1UOO A;  4NBM A;  3OW8 A;  2AGZ A;  2VDR A;  1JOF A;  4CI2 A; 
#chains in the Genus database with same CATH homology
 5FA5 B;  3F3G A;  3JZN A;  4J0W A;  3NVQ A;  4GQB B;  3RFH A;  4A0A B;  2P9N C;  2TRC B;  4J84 A;  4NSX A;  3AL8 A;  2OK4 A;  5CXB B;  3OL2 A;  4JT6 C;  4IMM A;  2B4E A;  4J86 A;  5THA A;  3JPX A;  2XYI A;  4ERQ A;  4QT8 A;  3ULE C;  2P9I C;  3BG0 A;  2CE8 A;  3GRE A;  4LGN A;  4YVD A;  4GZ8 A;  3PXT D;  4H5J A;  4CZV A;  3W15 A;  4CY3 A;  5IGQ A;  4JSP C;  2Q7Q A;  5TDH B;  3JB9 L;  3MZL A;  5EAP A;  5HE1 B;  2OK6 A;  4A08 B;  4J73 A;  1P22 A;  3C5M A;  2GC7 A;  3SLE D;  3RRM C;  2I0R A;  4D6V A;  3MMY A;  2HKM A;  4O9D A;  2HYE A;  5FKS A;  4A2M A;  2BBK H;  2HES X;  4A7J A;  2YMU A;  4K3J B;  5EAM A;  4JXM A;  5I5I A;  3EI1 A;  4ZN4 A;  3C75 H;  4QQE A;  4ESG A;  5I5J A;  4BUJ C;  4L3H D;  3P4F A;  4HDJ A;  3UVO A;  2IAA A;  2AQ5 A;  3SCY A;  4G56 B;  5H14 A;  3UVM A;  3KRW B;  3FRX A;  4FA9 D;  5IT9 g;  3IJC A;  4ZOY A;  5FXY A;  4GGC A;  5FKQ A;  2P9U C;  1QNI A;  3MKQ A;  4JSX C;  4AEZ A;  3EI3 B;  4CY5 A;  2EBS A;  1XKS A;  3A0F A;  2QC5 A;  3AL9 A;  3N0D A;  3F3F A;  1SQJ A;  2H3X A;  3K27 A;  2H68 A;  1ERJ A;  2IWF A;  3EU7 A;  3JRP A;  3SMR A;  4E5Z B;  5EM2 B;  4LG9 A;  3V5W B;  1U4C A;  3BG1 A;  4OZU A;  4FAN D;  4A09 A;  3KRX B;  3V9F A;  4L3G D;  3DXK C;  4PNK B;  5AFU 3;  3JZG A;  3CFS B;  4PSW B;  2BCJ B;  5FQD A;  3I8E A;  1MG2 A;  2MTA H;  4A11 B;  3BWS A;  3I7O A;  3EMH A;  2H6K A;  2B5L A;  2GNQ A;  3NVX A;  4CZY A;  5AMS A;  3E0C A;  1N6F A;  2IUV A;  4J79 A;  2IUR A;  4GGD A;  5FLX g;  4J8B A;  2H13 A;  3UKR C;  1XIP A;  4PC0 A;  2G9A A;  4K3I D;  4PSX B;  2I3T A;  4N14 A;  3V7D B;  4E54 A;  2IUP A;  2HJ4 A;  3OKW A;  2CE9 A;  3DSM A;  4H5I A;  4D0K A;  5IGO A;  4CC9 A;  4FAV D;  3J80 g;  5GMK n;  2H9M A;  5HYN B;  2I3S A;  4FA1 D;  3DM0 A;  3EI4 A;  3UR4 A;  4BL0 A;  3RLM D;  4GQ2 P;  3L4M D;  3OL2 B;  4JD2 C;  3OKY B;  3RN0 D;  1R5M A;  2CO0 A;  3OKY A;  2CNX A;  3JZH A;  3SHF A;  1MG3 A;  2OJY A;  4MK0 B;  3C9C A;  3EI2 A;  2H6Q A;  5CYK B;  4GM3 A;  4ZOX A;  4J0X A;  1A0R B;  4CI1 A;  3I7L A;  5CXC A;  1MDA H;  4J82 A;  3SBR A;  3IIW A;  3IJ1 A;  3IKO A;  5TF2 A;  2XL2 A;  4O1Q D;  3UVL A;  3EWE A;  4A11 A;  5HQG A;  3UKU C;  1PBY B;  4J77 A;  2AH0 A;  1U2V C;  4J8G A;  3JAM g;  1GXR A;  3DWL C;  4A2L A;  1B9X A;  5EM2 A;  1PGU A;  3AL8 B;  3I8C A;  2H47 A;  4JT5 C;  3SN6 B;  3VH0 A;  4CY2 A;  5EML B;  4QL1 A;  3PVU B;  4XYH A;  4ERY A;  4A0A A;  4TZ4 A;  3PSL A;  5HE2 B;  3SBQ A;  2P9P C;  3SXT D;  4L9O A;  2I0S A;  4ES0 A;  3OKT A;  3EI4 B;  1K8K C;  3AFC A;  3I7N A;  4QRJ A;  3GFC A;  5CXC B;  4J87 A;  4A09 B;  3SBP A;  2IWK A;  4Y5R D;  5FKT A;  1L0Q A;  3SVW D;  2AGY A;  3EI2 B;  5IC7 A;  3RN1 D;  2YNP A;  4E5Z A;  2HKR A;  1RI6 A;  3EI3 A;  1TYQ C;  4A0B A;  5EAL A;  2OVR B;  3IIY A;  3IJ0 A;  3K26 A;  3I7H A;  3FGB A;  3C99 A;  4L1Q D;  2AGX A;  4FA4 D;  3B7F A;  3SJL D;  1GG2 B;  4PBZ A;  2CN2 A;  5I5M A;  2J56 H;  3N0E A;  3DXM C;  1OLZ A;  4Z8L A;  5IJ7 E;  2OVP B;  4O3T B;  4BH6 A;  5K19 A;  1GOT B;  4FB1 D;  4FA5 D;  2OVQ B;  3PXW D;  1N6E A;  4E54 B;  5H17 A;  5GXH A;  2O9K A;  4J81 A;  5C9Z B;  4PBY A;  1TBG A;  3I7K A;  2HXC A;  3NVN A;  5HE0 B;  2YBA A;  2J55 H;  4CY1 A;  5H1M A;  1S4U X;  5TEE A;  3UVK A;  2I0T A;  3I2N A;  3F3P A;  4GGA A;  2Z2N A;  1PI6 A;  2IUQ A;  4GM8 A;  4A0B B;  4JSN C;  4Y7R A;  3JRO A;  4GQ1 A;  4U7A A;  3U4Y A;  1SHY B;  4X63 B;  3CFV A;  2H9P A;  2H9L A;  2Z2P A;  3UVN A;  3MKS B;  3HFQ A;  4J78 A;  1N6D A;  1NR0 A;  1NEX B;  3MZK A;  3ZWL B;  1B9Y A;  4ZOZ A;  4ZOV A;  2H6N A;  2HJB A;  4X60 B;  2AGW A;  2P9S C;  5TEF A;  1FWX A;  5SXM A;  4UI9 R;  4EWR A;  3J81 g;  1K32 A;  4A08 A;  5A2Q g;  4XEI C;  3RFG A;  1GP2 B;  3PXS D;  1JJU B;  5K1C C;  5IJ8 E;  1OMW B;  3PSC B;  2YB8 B;  3I7P A;  5GXI A;  3FM0 A;  2G99 A;  3VA6 A;  3PE7 A;  4AOW A;  3SFZ A;  1Q47 A;  3MXX A;  4I79 A;  2Z2O A;  4GMB A;  2P9L C;  4FHL A;  4R7A B;  2YNO A;  2CO0 C;  2XU7 A;  2GC4 A;  3AH8 B;  3EI1 B;  5HE3 B;  2PM6 B;  4CZX A;  4LG8 A;  3SWS D;  2B5M A;  2PM7 B;  4XYI A;  5KDO B;  3VGZ A;  1SQ9 A;  2B5N A;  4GM9 A;  5EMJ B;  2YNN A;  1JMZ B;  2AGL A;  1PEV A;  4JSV C;  3PVW B;  2QXV A;  4FWW A;  5EMK B;  4O3U B;  4X61 B;  5C2V B;  2XL3 A;  5CYK A;  3RSE C;  3RMZ D;  5C2W B;  1VYH C;  2UZY B;  2PBI B;  5EMM B;  2P9K C;  2W18 A;  2CN3 A;  1XHM A;  4X3E A;  2PM9 B;  3ODT A;  4ERZ A;  3CIK B;  4O45 A;  2UZX B;  4CI8 A;  1YFQ A;  5B4W A;  5GSA A;  1JMX B;  2J57 G;  4U1E I;  2OIZ A;  4KFM B;  5EAR A;  3ORV D;  5FKR A;  2AH1 A;  4CI3 A;  5AJA A;  3EG6 A;  4OWR A;  3I89 A;  2H14 A;  5JWZ A;  5CXB A;  3OTT A;  4PXW A;  3L4O D;  2PM9 A;  2H9N A;  4IA9 A;  3OW8 A;  2AGZ A;  1JOF A;  4CI2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...