2AGZA

Crystal structure of the carbinolamine intermediate in the reductive half-reaction of aromatic amine dehydrogenase (aadh) with tryptamine. f222 form
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
361
structure length
361
Chain Sequence
REVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aromatic amine dehydrogenase
publication title Atomic description of an enzyme reaction dominated by proton tunneling
pubmed doi rcsb
total genus 101
structure length 361
sequence length 361
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2agzA01
2J57G 2AH1A 2HESX 1RI6A 4A09A 4FA5D 4E5ZB 3K27A 5H1MA 4PSWB 4A11A 2OVPB 3SBQA 5C2WB 5TDHB 5C2VB 2XYIA 5CYKB 3DXMC 4D6VA 2IURA 4PBYA 3AL8A 4I79A 4A0AA 1L0QA 3IKOA 4E54A 1JJUB 3CFVA 2PM9A 3RN0D 4IA9A 4CY5A 5IJ8E 2YNOA 4L1QD 5FKTA 3OKWA 5FKSA 4JSNC 4J0XA 5CXCB 4ZOVA 2YNNA 5IJ7E 3N0DA 4LG9A 1GG2B 5TF2A 2Q7QA 3MKSB 2H6NA 3P4FA 3AFCA 4J87A 1N6EA 2OIZA 5GMKn 5FKQA 2OVQB 3IIWA 5CXBA 3RFHA 4J8BA 3EI4B 4K3ID 5K19A 3JZNA 1PGUA 3V9FA 4FA9D 3IJ0A 4GGDA 5CYKA 3OL2B 5HE1B 4O9DA 4CZYA 3EI1A 2P9LC 2I3SA 4OZUA 2CO0A 5FKRA 4LGNA 2XL3A 5H14A 3F3PA 4J0WA 3GREA 3EG6A 3JB9L 5A2Qg 3PXTD 4X61B 5EMMB 1JOFA 1FWXA 3OKYA 4QRJA 4PC0A 3EI3B 2P9SC 3SCYA 3RMZD 5B4WA 3SWSD 3JAMg 1SQ9A 4D0KA 3UVMA 4U1EI 5THAA 2CO0C 4GGAA 2OK6A 4O45A 2P9IC 4ZOZA 1B9YA 2UZXB 5HQGA 5EALA 2GC7A 3FRXA 4GQBB 2GC4A 1SQJA 3EMHA 1MG3A 3F3FA 4J78A 4A2LA 4ERZA 4AOWA 3JZGA 4O3UB 4FA4D 1U2VC 2W18A 3UR4A 1VYHC 4QL1A 5FXYA 2HYEA 5EMJB 2H9MA 3OKTA 4JT5C 4A08A 1N6FA 1TYQC 3JRPA 2IWKA 4GZ8A 5HE0B 3L4OD 4G56B 3DSMA 4X60B 4FA1D 3PXSD 3SHFA 3IIYA 4YVDA 1Q47A 2BBKH 3A0FA 3SBRA 4FWWA 2OVRB 2H6KA 2IUVA 2J56H 3MZLA 4J84A 4MK0B 3UVNA 4J8GA 4ERYA 4JD2C 3AH8B 1JMXB 4X63B 4PSXB 4CI8A 3C99A 2I0TA 2XU7A 5K1CC 3V7DB 4O3TB 3L4MD 4FB1D 2H47A 2IUQA 4CI3A 4H5IA 3NVXA 4QQEA 5EMKB 3BWSA 2HKMA 2IUPA 2CE9A 4J86A 4L9OA 2P9NC 3EI2B 1B9XA 3ZWLB 2IWFA 3J80g 3VGZA 4CI1A 2OK4A 4E5ZA 2AGXA 5H17A 2H9LA 1YFQA 4A2MA 1N6DA 3SMRA 5TEEA 4LG8A 3MZKA 4A0BB 3B7FA 3RFGA 5GXIA 3UVKA 4L3HD 4CZVA 5AMSA 4J77A 4ZN4A 2EBSA 1OMWB 2HKRA 4QT8A 1U4CA 4GQ2P 5CXCA 4ZOXA 3OW8A 3FGBA 3RN1D 3SXTD 3UVOA 3DXKC 5HE2B 2I3TA 3JZHA 3SVWD 3EI2A 2AGYA 3ULEC 1MG2A 4R7AB 5IT9g 1OLZA 5EM2B 1TBGA 4L3GD 3DM0A 3DWLC 4H5JA 2OJYA 1PBYB 2BCJB 2QC5A 3KRWB 4CY2A 3SN6B 4O1QD 3EI4A 1JMZB 1GOTB 2AGLA 2H3XA 3PE7A 2AGWA 4FHLA 3I2NA 2HXCA 1R5MA 3HFQA 3OL2A 4U7AA 5EAPA 4FAND 3I7PA 3NVNA 5EMLB 3SBPA 3U4YA 4BUJC 4CC9A 5IGQA 3AL9A 1MDAH 3RLMD 3C9CA 5IC7A 4XYHA 3PXWD 4A11B 1SHYB 3ORVD 4X3EA 4GGCA 2PBIB 4GM3A 3KRXB 5KDOB 2G9AA 4J81A 1XKSA 4JXMA 4OWRA 5I5MA 3EI3A 3PSLA 1GP2B 4PBZA 3I8CA 4JSPC 1A0RB 3AL8B 2P9KC 4A0AB 2YNPA 4GM9A 3CFSB 3I7LA 2PM9B 2CN2A 3C5MA 4A7JA 4ERQA 1PI6A 2CN3A 5TEFA 2IAAA 3V5WB 1NEXB 2G99A 3NVQA 4BH6A 3MKQA 4BL0A 4CY3A 3I89A 2H6QA 5AJAA 4PNKB 2PM7B 4XEIC 5FA5B 2CE8A 3W15A 2TRCB 3RRMC 3E0CA 5IGOA 4CZXA 5CXBB 5GSAA 3BG0A 4TZ4A 2AH0A 2PM6B 4ESGA 1S4UX 4EWRA 3IJ1A 3I8EA 2O9KA 4GMBA 4ES0A 3C75H 3EI1B 3MMYA 2HJBA 4AEZA 4J79A 4NSXA 2B5LA 5JWZA 2GNQA 2CNXA 4Z8LA 4XYIA 4Y5RD 1K8KC 1NR0A 3K26A 5I5IA 2H13A 2H9NA 1XIPA 3OKYB 3UKRC 2QXVA 4N14A 3IJCA 3CIKB 2H14A 2AGZA 3F3GA 5HYNB 3J81g 3N0EA 3VH0A 4CI2A 5C9ZB 2Z2NA 3SFZA 3I7NA 3VA6A 3MXXA 1QNIA 2P9UC 1XHMA 2I0SA 3UVLA 3EWEA 3JROA 4K3JB 4J73A 3GFCA 3I7OA 2YMUA 4IMMA 2UZYB 5AFU3 2H68A 3BG1A 4PXWA 1ERJA 5EAMA 2AQ5A 3I7KA 4J82A 1PEVA 3PVUB 5EARA 4A0BA 4A08B 5I5JA 2XL2A 4JT6C 4KFMB 4A09B 2HJ4A 2H9PA 3FM0A 2J55H 2B5MA 1K32A 2P9PC 4HDJA 3SJLD 4GM8A 5SXMA 5FQDA 4ZOYA 3PSCB 5GXHA 2B4EA 2MTAH 2Z2PA 3EU7A 4Y7RA 4CY1A 1P22A 5HE3B 4E54B 5EM2A 4JSVC 2B5NA 2YBAA 3ODTA 3JPXA 2I0RA 3UKUC 3PVWB 2Z2OA 3I7HA 4JSXC 5FLXg 1GXRA 2YB8B 3OTTA 3RSEC 4GQ1A 3SLED 4FAVD 4UI9R
chains in the Genus database with same CATH superfamily
2J57G 3ZE1A 4Z7NA 2AH1A 2HESX 1RI6A 3T3PA 4A09A 4FA5D 4E5ZB 3K27A 5H1MA 4MMXA 4PSWB 4A11A 2OVPB 3IJEA 4UM8A 3SBQA 3ZDYA 5C2WB 5TDHB 4NC4A 5C2VB 2XYIA 3ZDXA 5C86A 5CYKB 3DXMC 4D6VA 2IURA 4PBYA 3AL8A 4I79A 5M5TA 4A0AA 1L0QA 3IKOA 4E54A 1JJUB 1VE6A 2XZGA 3VI4A 2EIDA 2EIEA 3CFVA 3ZE0A 4BCBA 2PM9A 1U8CA 4IA9A 3RN0D 4CY5A 5IJ8E 2YNOA 4L1QD 2QZPA 3FCSA 5FKTA 3OKWA 5FKSA 4JSNC 4J0XA 5CXCB 4ZOVA 4BP8A 3K72A 2YNNA 5IJ7E 3N0DA 4LG9A 1GG2B 5TF2A 2Q7QA 3MKSB 1O6FA 4AN1A 2H6NA 3P4FA 5E6SA 3AFCA 4J87A 4G55A 1N6EA 2OIZA 4NBMA 3VI3A 4DNWA 5GMKn 5FKQA 2OVQB 3O4GA 3IIWA 4DNVA 5CXBA 3RFHA 4J8BA 3EI4B 4K3ID 5K19A 3JZNA 1PGUA 3V9FA 4FA9D 3IJ0A 4GGDA 5CYKA 3OL2B 5HE1B 4O9DA 4CZYA 3EI1A 2P9LC 1M1XA 1H2ZA 3V4VA 2I3SA 4OZUA 2CO0A 5FKRA 4LGNA 2XL3A 5H14A 3F3PA 3GD1I 4J0WA 3GREA 3EG6A 3JB9L 5A2Qg 3IUJA 3PXTD 4X61B 1TYEA 5EMMB 1JOFA 1FWXA 3OKYA 4QRJA 4PC0A 2VDPA 3EI3B 2P9SC 3SCYA 3RMZD 5B4WA 3SWSD 3JAMg 1SQ9A 4D0KA 3UVMA 4U1EI 5THAA 2CO0C 4GGAA 2OK6A 4Z7OA 4O45A 2P9IC 3EQ8A 4ZOZA 1B9YA 2UZXB 5HQGA 5EALA 2GC7A 3FRXA 4GQBB 2GC4A 1SQJA 3EMHA 2EICA 1MG3A 3F3FA 4J78A 4A2LA 4ERZA 5M5UA 4AOWA 3JZGA 4O3UB 4FA4D 4AMZA 1U2VC 2W18A 3UR4A 1VYHC 3NIDA 4QL1A 5E6UA 3DDUA 5FXYA 2HYEA 5EMJB 2H9MA 2VDQA 1GOHA 3OKTA 4JT5C 4A08A 1N6FA 4L1MA 1A12A 1TYQC 3JRPA 3MUOA 2IWKA 3EQ9A 4GZ8A 4G1EA 5HE0B 3L4OD 4G56B 3DSMA 4X60B 4AMYA 4FA1D 3PXSD 2VDOA 3SHFA 3IIYA 4YVDA 1H2XA 1Q47A 5FFGA 3IVMA 2BBKH 3A0FA 3SBRA 1VZ2A 4FWWA 2OVRB 5HDBA 2H6KA 2IUVA 2J56H 3MZLA 4J84A 4MK0B 3UVNA 4J8GA 4ERYA 4JD2C 3AH8B 1JMXB 4X63B 4PSXB 4CI8A 1UTCA 2I0TA 2XU7A 3C99A 5K1CC 1O6GA 4JHNA 4O3TB 3V7DB 1QFSA 3L4MD 5M61A 2HU7A 3O4JA 2H47A 2IUQA 4FB1D 4CI3A 4H5IA 3NVXA 4QQEA 5EMKB 3BWSA 2HKMA 5M5VA 5E6RA 2IUPA 2CE9A 4J86A 4L9OA 2P9NC 3EI2B 1B9XA 4MMYA 2IWFA 1QFMA 3VGZA 3ZWLB 3J80g 4UM9A 4CI1A 2OK4A 3MVDK 4E5ZA 3GC3B 2AGXA 5H17A 2H9LA 2BKLA 1YFQA 4A2MA 1N6DA 3SMRA 5TEEA 5M5SA 3IUMA 4LG8A 4MMZA 3MZKA 1H2YA 4A0BB 3B7FA 3RFGA 5GXIA 3UVKA 4L3HD 4CZVA 5AMSA 4J77A 4QAMA 4ZN4A 2EBSA 1OMWB 4G1MA 2HKRA 4QT8A 1UOPA 1U4CA 4GQ2P 3MUNA 5CXCA 4ZOXA 3OW8A 4BP9A 3FGBA 3RN1D 3SXTD 1GOFA 3UVOA 3DXKC 5HE2B 3K71A 2I3TA 3JZHA 4BCCA 3SVWD 3EI2A 2AGYA 3O4HA 3ULEC 1MG2A 4R7AB 5IT9g 1OLZA 5EM2B 3IURA 1TBGA 4L3GD 4WK2A 3DM0A 3DWLC 4H5JA 2OJYA 1PBYB 2BCJB 2QC5A 1UOOA 3KRWB 4CY2A 3SN6B 4O1QD 3EI4A 1JMZB 1GOTB 2AGLA 2H3XA 3PE7A 1UOQA 2AGWA 4FHLA 1E8MA 1T2XA 3I2NA 2HXCA 1K3IA 1R5MA 3HFQA 3OL2A 4U7AA 5EAPA 4FAND 4Z7QA 3K6SA 3I7PA 3NVNA 5EMLB 3SBPA 3U4YA 4BUJC 4CC9A 5IGQA 3AL9A 1MDAH 3RLMD 3C9CA 5IC7A 4XYHA 3PXWD 4A11B 1SHYB 3ORVD 4X3EA 2VDNA 2QR5A 4GGCA 2PBIB 3ZDZA 4GM3A 3QHYB 3KRXB 5KDOB 2G9AA 4J81A 1C9IA 1XKSA 4JXMA 4OWRA 5I5MA 3EI3A 3PSLA 1GP2B 4PBZA 2VZ3A 3I8CA 4JSPC 3FCUA 1A0RB 1JV2A 2VZ1A 3AL8B 2P9KC 1E5TA 4A0AB 1JTDB 2YNPA 4GM9A 3CFSB 1VZ3A 3I7LA 2PM9B 4IRZA 4JHPC 4AN0A 2CN2A 3C5MA 4A7JA 4ERQA 1PI6A 2CN3A 3KCIA 2XDWA 5TEFA 2IAAA 3V5WB 5C92A 1NEXB 2G99A 3NVQA 4BH6A 3MKQA 4BL0A 4CY3A 3I89A 2H6QA 5AJAA 4D9SA 4PNKB 2PM7B 4XEIC 5FA5B 2CE8A 3NIFA 3W15A 2TRCB 3RRMC 1E8NA 2XE4A 3E0CA 5IGOA 2VC2A 4CZXA 5CXBB 5GSAA 3BG0A 3IUQA 1YR2A 4TZ4A 2AH0A 2PM6B 4ESGA 1S4UX 4EWRA 3IUNA 3IJ1A 3I8EA 2O9KA 4GMBA 2VDRA 4ES0A 1BPOA 1GOGA 4NENA 3C75H 3O4IA 3EI1B 3MMYA 2HJBA 4WK4A 4AEZA 4J79A 4RE6A 4NSXA 2B5LA 5JWZA 2GNQA 4NAAA 1C9LA 2CNXA 4Z8LA 4XYIA 4Y5RD 1K8KC 1NR0A 3V4PA 3K26A 5I5IA 2H13A 2H9NA 1XIPA 2EIBA 1H2WA 3OKYB 3UKRC 2QXVA 4N14A 3IJCA 4O02A 5FFOA 3QI0A 3CIKB 2H14A 2AGZA 3F3GA 2JKXA 5HYNB 3J81g 3N0EA 3VH0A 4CI2A 5C9ZB 2Z2NA 3SFZA 2HU8A 4AX4A 4WJKA 3I7NA 3VA6A 3MXXA 1QNIA 2P9UC 1XHMA 2VDMA 2I0SA 3UVLA 2HU5A 3EWEA 3JROA 4K3JB 4J73A 3GFCA 3I7OA 1L5GA 2YMUA 4IMMA 2UZYB 1I2MB 5AFU3 2H68A 3BG1A 4PXWA 2VDKA 1ERJA 5EAMA 2AQ5A 3I7KA 4J82A 1PEVA 3PVUB 5EARA 4A0BA 3OF7A 4A08B 5I5JA 2XL2A 3ZE2A 4JT6C 4KFMB 4A09B 4BCDA 2HJ4A 2H9PA 3FM0A 4RE5A 2J55H 2B5MA 1K32A 2P9PC 4HDJA 2VDLA 3SJLD 4GM8A 5SXMA 5FQDA 4ZOYA 3PSCB 5GXHA 2B4EA 1VE7A 2MTAH 2Z2PA 3EU7A 4Y7RA 4DNUA 4CY1A 1P22A 5HE3B 3T3MA 4E54B 5EM2A 4JSVC 3IULA 2B5NA 2YBAA 4O2WA 3ODTA 3JPXA 2I0RA 3UKUC 3PVWB 2WQ8A 2Z2OA 3I7HA 4JSXC 5FLXg 3NIGA 1GXRA 4WK0A 2YB8B 3OTTA 3RSEC 4GQ1A 3SLED 4FAVD 4UI9R 3EQ7A 5M5RA
chains in the Genus database with same CATH topology
2J57G 2AH1A 2HESX 1RI6A 4A09A 4FA5D 4E5ZB 3K27A 5H1MA 4PSWB 4A11A 2OVPB 3SBQA 5C2WB 5TDHB 5C2VB 2XYIA 5CYKB 3DXMC 4D6VA 2IURA 4PBYA 3AL8A 4I79A 4A0AA 1L0QA 3IKOA 4E54A 1JJUB 3CFVA 2PM9A 3RN0D 4IA9A 4CY5A 5IJ8E 2YNOA 4L1QD 5FKTA 3OKWA 5FKSA 4JSNC 4J0XA 5CXCB 4ZOVA 2YNNA 5IJ7E 3N0DA 4LG9A 1GG2B 5TF2A 2Q7QA 3MKSB 2H6NA 3P4FA 3AFCA 4J87A 1N6EA 2OIZA 5GMKn 5FKQA 2OVQB 3IIWA 5CXBA 3RFHA 4J8BA 3EI4B 4K3ID 5K19A 3JZNA 1PGUA 3V9FA 4FA9D 3IJ0A 4GGDA 5CYKA 3OL2B 5HE1B 4O9DA 4CZYA 3EI1A 2P9LC 2I3SA 4OZUA 2CO0A 5FKRA 4LGNA 2XL3A 5H14A 3F3PA 4J0WA 3GREA 3EG6A 3JB9L 5A2Qg 3PXTD 4X61B 5EMMB 1JOFA 1FWXA 3OKYA 4QRJA 4PC0A 3EI3B 2P9SC 3SCYA 3RMZD 5B4WA 3SWSD 3JAMg 1SQ9A 4D0KA 3UVMA 4U1EI 5THAA 2CO0C 4GGAA 2OK6A 4O45A 2P9IC 4ZOZA 1B9YA 2UZXB 5HQGA 5EALA 2GC7A 3FRXA 4GQBB 2GC4A 1SQJA 3EMHA 1MG3A 3F3FA 4J78A 4A2LA 4ERZA 4AOWA 3JZGA 4O3UB 4FA4D 1U2VC 2W18A 3UR4A 1VYHC 4QL1A 5FXYA 2HYEA 5EMJB 2H9MA 3OKTA 4JT5C 4A08A 1N6FA 1TYQC 3JRPA 2IWKA 4GZ8A 5HE0B 3L4OD 4G56B 3DSMA 4X60B 4FA1D 3PXSD 3SHFA 3IIYA 4YVDA 1Q47A 2BBKH 3A0FA 3SBRA 4FWWA 2OVRB 2H6KA 2IUVA 2J56H 3MZLA 4J84A 4MK0B 3UVNA 4J8GA 4ERYA 4JD2C 3AH8B 1JMXB 4X63B 4PSXB 4CI8A 3C99A 2I0TA 2XU7A 5K1CC 3V7DB 4O3TB 3L4MD 4FB1D 2H47A 2IUQA 4CI3A 4H5IA 3NVXA 4QQEA 5EMKB 3BWSA 2HKMA 2IUPA 2CE9A 4J86A 4L9OA 2P9NC 3EI2B 1B9XA 3ZWLB 2IWFA 3J80g 3VGZA 4CI1A 2OK4A 4E5ZA 2AGXA 5H17A 2H9LA 1YFQA 4A2MA 1N6DA 3SMRA 5TEEA 4LG8A 3MZKA 4A0BB 3B7FA 3RFGA 5GXIA 3UVKA 4L3HD 4CZVA 5AMSA 4J77A 4ZN4A 2EBSA 1OMWB 2HKRA 4QT8A 1U4CA 4GQ2P 5CXCA 4ZOXA 3OW8A 3FGBA 3RN1D 3SXTD 3UVOA 3DXKC 5HE2B 2I3TA 3JZHA 3SVWD 3EI2A 2AGYA 3ULEC 1MG2A 4R7AB 5IT9g 1OLZA 5EM2B 1TBGA 4L3GD 3DM0A 3DWLC 4H5JA 2OJYA 1PBYB 2BCJB 2QC5A 3KRWB 4CY2A 3SN6B 4O1QD 3EI4A 1JMZB 1GOTB 2AGLA 2H3XA 3PE7A 2AGWA 4FHLA 3I2NA 2HXCA 1R5MA 3HFQA 3OL2A 4U7AA 5EAPA 4FAND 3I7PA 3NVNA 5EMLB 3SBPA 3U4YA 4BUJC 4CC9A 5IGQA 3AL9A 1MDAH 3RLMD 3C9CA 5IC7A 4XYHA 3PXWD 4A11B 1SHYB 3ORVD 4X3EA 4GGCA 2PBIB 4GM3A 3KRXB 5KDOB 2G9AA 4J81A 1XKSA 4JXMA 4OWRA 5I5MA 3EI3A 3PSLA 1GP2B 4PBZA 3I8CA 4JSPC 1A0RB 3AL8B 2P9KC 4A0AB 2YNPA 4GM9A 3CFSB 3I7LA 2PM9B 2CN2A 3C5MA 4A7JA 4ERQA 1PI6A 2CN3A 5TEFA 2IAAA 3V5WB 1NEXB 2G99A 3NVQA 4BH6A 3MKQA 4BL0A 4CY3A 3I89A 2H6QA 5AJAA 4PNKB 2PM7B 4XEIC 5FA5B 2CE8A 3W15A 2TRCB 3RRMC 3E0CA 5IGOA 4CZXA 5CXBB 5GSAA 3BG0A 4TZ4A 2AH0A 2PM6B 4ESGA 1S4UX 4EWRA 3IJ1A 3I8EA 2O9KA 4GMBA 4ES0A 3C75H 3EI1B 3MMYA 2HJBA 4AEZA 4J79A 4NSXA 2B5LA 5JWZA 2GNQA 2CNXA 4Z8LA 4XYIA 4Y5RD 1K8KC 1NR0A 3K26A 5I5IA 2H13A 2H9NA 1XIPA 3OKYB 3UKRC 2QXVA 4N14A 3IJCA 3CIKB 2H14A 2AGZA 3F3GA 5HYNB 3J81g 3N0EA 3VH0A 4CI2A 5C9ZB 2Z2NA 3SFZA 3I7NA 3VA6A 3MXXA 1QNIA 2P9UC 1XHMA 2I0SA 3UVLA 3EWEA 3JROA 4K3JB 4J73A 3GFCA 3I7OA 2YMUA 4IMMA 2UZYB 5AFU3 2H68A 3BG1A 4PXWA 1ERJA 5EAMA 2AQ5A 3I7KA 4J82A 1PEVA 3PVUB 5EARA 4A0BA 4A08B 5I5JA 2XL2A 4JT6C 4KFMB 4A09B 2HJ4A 2H9PA 3FM0A 2J55H 2B5MA 1K32A 2P9PC 4HDJA 3SJLD 4GM8A 5SXMA 5FQDA 4ZOYA 3PSCB 5GXHA 2B4EA 2MTAH 2Z2PA 3EU7A 4Y7RA 4CY1A 1P22A 5HE3B 4E54B 5EM2A 4JSVC 2B5NA 2YBAA 3ODTA 3JPXA 2I0RA 3UKUC 3PVWB 2Z2OA 3I7HA 4JSXC 5FLXg 1GXRA 2YB8B 3OTTA 3RSEC 4GQ1A 3SLED 4FAVD 4UI9R
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J57 G;  2AH1 A;  2HES X;  1RI6 A;  4A09 A;  4FA5 D;  4E5Z B;  3K27 A;  5H1M A;  4PSW B;  4A11 A;  2OVP B;  3SBQ A;  5C2W B;  5TDH B;  5C2V B;  2XYI A;  5CYK B;  3DXM C;  4D6V A;  2IUR A;  4PBY A;  3AL8 A;  4I79 A;  4A0A A;  1L0Q A;  3IKO A;  4E54 A;  1JJU B;  3CFV A;  2PM9 A;  3RN0 D;  4IA9 A;  4CY5 A;  5IJ8 E;  2YNO A;  4L1Q D;  5FKT A;  3OKW A;  5FKS A;  4JSN C;  4J0X A;  5CXC B;  4ZOV A;  2YNN A;  5IJ7 E;  3N0D A;  4LG9 A;  1GG2 B;  5TF2 A;  2Q7Q A;  3MKS B;  2H6N A;  3P4F A;  3AFC A;  4J87 A;  1N6E A;  2OIZ A;  5GMK n;  5FKQ A;  2OVQ B;  3IIW A;  5CXB A;  3RFH A;  4J8B A;  3EI4 B;  4K3I D;  5K19 A;  3JZN A;  1PGU A;  3V9F A;  4FA9 D;  3IJ0 A;  4GGD A;  5CYK A;  3OL2 B;  5HE1 B;  4O9D A;  4CZY A;  3EI1 A;  2P9L C;  2I3S A;  4OZU A;  2CO0 A;  5FKR A;  4LGN A;  2XL3 A;  5H14 A;  3F3P A;  4J0W A;  3GRE A;  3EG6 A;  3JB9 L;  5A2Q g;  3PXT D;  4X61 B;  5EMM B;  1JOF A;  1FWX A;  3OKY A;  4QRJ A;  4PC0 A;  3EI3 B;  2P9S C;  3SCY A;  3RMZ D;  5B4W A;  3SWS D;  3JAM g;  1SQ9 A;  4D0K A;  3UVM A;  4U1E I;  5THA A;  2CO0 C;  4GGA A;  2OK6 A;  4O45 A;  2P9I C;  4ZOZ A;  1B9Y A;  2UZX B;  5HQG A;  5EAL A;  2GC7 A;  3FRX A;  4GQB B;  2GC4 A;  1SQJ A;  3EMH A;  1MG3 A;  3F3F A;  4J78 A;  4A2L A;  4ERZ A;  4AOW A;  3JZG A;  4O3U B;  4FA4 D;  1U2V C;  2W18 A;  3UR4 A;  1VYH C;  4QL1 A;  5FXY A;  2HYE A;  5EMJ B;  2H9M A;  3OKT A;  4JT5 C;  4A08 A;  1N6F A;  1TYQ C;  3JRP A;  2IWK A;  4GZ8 A;  5HE0 B;  3L4O D;  4G56 B;  3DSM A;  4X60 B;  4FA1 D;  3PXS D;  3SHF A;  3IIY A;  4YVD A;  1Q47 A;  2BBK H;  3A0F A;  3SBR A;  4FWW A;  2OVR B;  2H6K A;  2IUV A;  2J56 H;  3MZL A;  4J84 A;  4MK0 B;  3UVN A;  4J8G A;  4ERY A;  4JD2 C;  3AH8 B;  1JMX B;  4X63 B;  4PSX B;  4CI8 A;  3C99 A;  2I0T A;  2XU7 A;  5K1C C;  3V7D B;  4O3T B;  3L4M D;  4FB1 D;  2H47 A;  2IUQ A;  4CI3 A;  4H5I A;  3NVX A;  4QQE A;  5EMK B;  3BWS A;  2HKM A;  2IUP A;  2CE9 A;  4J86 A;  4L9O A;  2P9N C;  3EI2 B;  1B9X A;  3ZWL B;  2IWF A;  3J80 g;  3VGZ A;  4CI1 A;  2OK4 A;  4E5Z A;  2AGX A;  5H17 A;  2H9L A;  1YFQ A;  4A2M A;  1N6D A;  3SMR A;  5TEE A;  4LG8 A;  3MZK A;  4A0B B;  3B7F A;  3RFG A;  5GXI A;  3UVK A;  4L3H D;  4CZV A;  5AMS A;  4J77 A;  4ZN4 A;  2EBS A;  1OMW B;  2HKR A;  4QT8 A;  1U4C A;  4GQ2 P;  5CXC A;  4ZOX A;  3OW8 A;  3FGB A;  3RN1 D;  3SXT D;  3UVO A;  3DXK C;  5HE2 B;  2I3T A;  3JZH A;  3SVW D;  3EI2 A;  2AGY A;  3ULE C;  1MG2 A;  4R7A B;  5IT9 g;  1OLZ A;  5EM2 B;  1TBG A;  4L3G D;  3DM0 A;  3DWL C;  4H5J A;  2OJY A;  1PBY B;  2BCJ B;  2QC5 A;  3KRW B;  4CY2 A;  3SN6 B;  4O1Q D;  3EI4 A;  1JMZ B;  1GOT B;  2AGL A;  2H3X A;  3PE7 A;  2AGW A;  4FHL A;  3I2N A;  2HXC A;  1R5M A;  3HFQ A;  3OL2 A;  4U7A A;  5EAP A;  4FAN D;  3I7P A;  3NVN A;  5EML B;  3SBP A;  3U4Y A;  4BUJ C;  4CC9 A;  5IGQ A;  3AL9 A;  1MDA H;  3RLM D;  3C9C A;  5IC7 A;  4XYH A;  3PXW D;  4A11 B;  1SHY B;  3ORV D;  4X3E A;  4GGC A;  2PBI B;  4GM3 A;  3KRX B;  5KDO B;  2G9A A;  4J81 A;  1XKS A;  4JXM A;  4OWR A;  5I5M A;  3EI3 A;  3PSL A;  1GP2 B;  4PBZ A;  3I8C A;  4JSP C;  1A0R B;  3AL8 B;  2P9K C;  4A0A B;  2YNP A;  4GM9 A;  3CFS B;  3I7L A;  2PM9 B;  2CN2 A;  3C5M A;  4A7J A;  4ERQ A;  1PI6 A;  2CN3 A;  5TEF A;  2IAA A;  3V5W B;  1NEX B;  2G99 A;  3NVQ A;  4BH6 A;  3MKQ A;  4BL0 A;  4CY3 A;  3I89 A;  2H6Q A;  5AJA A;  4PNK B;  2PM7 B;  4XEI C;  5FA5 B;  2CE8 A;  3W15 A;  2TRC B;  3RRM C;  3E0C A;  5IGO A;  4CZX A;  5CXB B;  5GSA A;  3BG0 A;  4TZ4 A;  2AH0 A;  2PM6 B;  4ESG A;  1S4U X;  4EWR A;  3IJ1 A;  3I8E A;  2O9K A;  4GMB A;  4ES0 A;  3C75 H;  3EI1 B;  3MMY A;  2HJB A;  4AEZ A;  4J79 A;  4NSX A;  2B5L A;  5JWZ A;  2GNQ A;  2CNX A;  4Z8L A;  4XYI A;  4Y5R D;  1K8K C;  1NR0 A;  3K26 A;  5I5I A;  2H13 A;  2H9N A;  1XIP A;  3OKY B;  3UKR C;  2QXV A;  4N14 A;  3IJC A;  3CIK B;  2H14 A;  2AGZ A;  3F3G A;  5HYN B;  3J81 g;  3N0E A;  3VH0 A;  4CI2 A;  5C9Z B;  2Z2N A;  3SFZ A;  3I7N A;  3VA6 A;  3MXX A;  1QNI A;  2P9U C;  1XHM A;  2I0S A;  3UVL A;  3EWE A;  3JRO A;  4K3J B;  4J73 A;  3GFC A;  3I7O A;  2YMU A;  4IMM A;  2UZY B;  5AFU 3;  2H68 A;  3BG1 A;  4PXW A;  1ERJ A;  5EAM A;  2AQ5 A;  3I7K A;  4J82 A;  1PEV A;  3PVU B;  5EAR A;  4A0B A;  4A08 B;  5I5J A;  2XL2 A;  4JT6 C;  4KFM B;  4A09 B;  2HJ4 A;  2H9P A;  3FM0 A;  2J55 H;  2B5M A;  1K32 A;  2P9P C;  4HDJ A;  3SJL D;  4GM8 A;  5SXM A;  5FQD A;  4ZOY A;  3PSC B;  5GXH A;  2B4E A;  2MTA H;  2Z2P A;  3EU7 A;  4Y7R A;  4CY1 A;  1P22 A;  5HE3 B;  4E54 B;  5EM2 A;  4JSV C;  2B5N A;  2YBA A;  3ODT A;  3JPX A;  2I0R A;  3UKU C;  3PVW B;  2Z2O A;  3I7H A;  4JSX C;  5FLX g;  1GXR A;  2YB8 B;  3OTT A;  3RSE C;  4GQ1 A;  3SLE D;  4FAV D;  4UI9 R; 
#chains in the Genus database with same CATH topology
 2J57 G;  3ZE1 A;  4Z7N A;  2AH1 A;  2HES X;  1RI6 A;  3T3P A;  4A09 A;  4FA5 D;  4E5Z B;  3K27 A;  5H1M A;  4MMX A;  4PSW B;  4A11 A;  2OVP B;  3IJE A;  4UM8 A;  3SBQ A;  3ZDY A;  5C2W B;  5TDH B;  4NC4 A;  5C2V B;  2XYI A;  3ZDX A;  5C86 A;  5CYK B;  3DXM C;  4D6V A;  2IUR A;  4PBY A;  3AL8 A;  4I79 A;  5M5T A;  4A0A A;  1L0Q A;  3IKO A;  4E54 A;  1JJU B;  1VE6 A;  2XZG A;  3VI4 A;  2EID A;  2EIE A;  3CFV A;  3ZE0 A;  4BCB A;  2PM9 A;  1U8C A;  4IA9 A;  3RN0 D;  4CY5 A;  5IJ8 E;  2YNO A;  4L1Q D;  2QZP A;  3FCS A;  5FKT A;  3OKW A;  5FKS A;  4JSN C;  4J0X A;  5CXC B;  4ZOV A;  4BP8 A;  3K72 A;  2YNN A;  5IJ7 E;  3N0D A;  4LG9 A;  1GG2 B;  5TF2 A;  2Q7Q A;  3MKS B;  1O6F A;  4AN1 A;  2H6N A;  3P4F A;  5E6S A;  3AFC A;  4J87 A;  4G55 A;  1N6E A;  2OIZ A;  4NBM A;  3VI3 A;  4DNW A;  5GMK n;  5FKQ A;  2OVQ B;  3O4G A;  3IIW A;  4DNV A;  5CXB A;  3RFH A;  4J8B A;  3EI4 B;  4K3I D;  5K19 A;  3JZN A;  1PGU A;  3V9F A;  4FA9 D;  3IJ0 A;  4GGD A;  5CYK A;  3OL2 B;  5HE1 B;  4O9D A;  4CZY A;  3EI1 A;  2P9L C;  1M1X A;  1H2Z A;  3V4V A;  2I3S A;  4OZU A;  2CO0 A;  5FKR A;  4LGN A;  2XL3 A;  5H14 A;  3F3P A;  3GD1 I;  4J0W A;  3GRE A;  3EG6 A;  3JB9 L;  5A2Q g;  3IUJ A;  3PXT D;  4X61 B;  1TYE A;  5EMM B;  1JOF A;  1FWX A;  3OKY A;  4QRJ A;  4PC0 A;  2VDP A;  3EI3 B;  2P9S C;  3SCY A;  3RMZ D;  5B4W A;  3SWS D;  3JAM g;  1SQ9 A;  4D0K A;  3UVM A;  4U1E I;  5THA A;  2CO0 C;  4GGA A;  2OK6 A;  4Z7O A;  4O45 A;  2P9I C;  3EQ8 A;  4ZOZ A;  1B9Y A;  2UZX B;  5HQG A;  5EAL A;  2GC7 A;  3FRX A;  4GQB B;  2GC4 A;  1SQJ A;  3EMH A;  2EIC A;  1MG3 A;  3F3F A;  4J78 A;  4A2L A;  4ERZ A;  5M5U A;  4AOW A;  3JZG A;  4O3U B;  4FA4 D;  4AMZ A;  1U2V C;  2W18 A;  3UR4 A;  1VYH C;  3NID A;  4QL1 A;  5E6U A;  3DDU A;  5FXY A;  2HYE A;  5EMJ B;  2H9M A;  2VDQ A;  1GOH A;  3OKT A;  4JT5 C;  4A08 A;  1N6F A;  4L1M A;  1A12 A;  1TYQ C;  3JRP A;  3MUO A;  2IWK A;  3EQ9 A;  4GZ8 A;  4G1E A;  5HE0 B;  3L4O D;  4G56 B;  3DSM A;  4X60 B;  4AMY A;  4FA1 D;  3PXS D;  2VDO A;  3SHF A;  3IIY A;  4YVD A;  1H2X A;  1Q47 A;  5FFG A;  3IVM A;  2BBK H;  3A0F A;  3SBR A;  1VZ2 A;  4FWW A;  2OVR B;  5HDB A;  2H6K A;  2IUV A;  2J56 H;  3MZL A;  4J84 A;  4MK0 B;  3UVN A;  4J8G A;  4ERY A;  4JD2 C;  3AH8 B;  1JMX B;  4X63 B;  4PSX B;  4CI8 A;  1UTC A;  2I0T A;  2XU7 A;  3C99 A;  5K1C C;  1O6G A;  4JHN A;  4O3T B;  3V7D B;  1QFS A;  3L4M D;  5M61 A;  2HU7 A;  3O4J A;  2H47 A;  2IUQ A;  4FB1 D;  4CI3 A;  4H5I A;  3NVX A;  4QQE A;  5EMK B;  3BWS A;  2HKM A;  5M5V A;  5E6R A;  2IUP A;  2CE9 A;  4J86 A;  4L9O A;  2P9N C;  3EI2 B;  1B9X A;  4MMY A;  2IWF A;  1QFM A;  3VGZ A;  3ZWL B;  3J80 g;  4UM9 A;  4CI1 A;  2OK4 A;  3MVD K;  4E5Z A;  3GC3 B;  2AGX A;  5H17 A;  2H9L A;  2BKL A;  1YFQ A;  4A2M A;  1N6D A;  3SMR A;  5TEE A;  5M5S A;  3IUM A;  4LG8 A;  4MMZ A;  3MZK A;  1H2Y A;  4A0B B;  3B7F A;  3RFG A;  5GXI A;  3UVK A;  4L3H D;  4CZV A;  5AMS A;  4J77 A;  4QAM A;  4ZN4 A;  2EBS A;  1OMW B;  4G1M A;  2HKR A;  4QT8 A;  1UOP A;  1U4C A;  4GQ2 P;  3MUN A;  5CXC A;  4ZOX A;  3OW8 A;  4BP9 A;  3FGB A;  3RN1 D;  3SXT D;  1GOF A;  3UVO A;  3DXK C;  5HE2 B;  3K71 A;  2I3T A;  3JZH A;  4BCC A;  3SVW D;  3EI2 A;  2AGY A;  3O4H A;  3ULE C;  1MG2 A;  4R7A B;  5IT9 g;  1OLZ A;  5EM2 B;  3IUR A;  1TBG A;  4L3G D;  4WK2 A;  3DM0 A;  3DWL C;  4H5J A;  2OJY A;  1PBY B;  2BCJ B;  2QC5 A;  1UOO A;  3KRW B;  4CY2 A;  3SN6 B;  4O1Q D;  3EI4 A;  1JMZ B;  1GOT B;  2AGL A;  2H3X A;  3PE7 A;  1UOQ A;  2AGW A;  4FHL A;  1E8M A;  1T2X A;  3I2N A;  2HXC A;  1K3I A;  1R5M A;  3HFQ A;  3OL2 A;  4U7A A;  5EAP A;  4FAN D;  4Z7Q A;  3K6S A;  3I7P A;  3NVN A;  5EML B;  3SBP A;  3U4Y A;  4BUJ C;  4CC9 A;  5IGQ A;  3AL9 A;  1MDA H;  3RLM D;  3C9C A;  5IC7 A;  4XYH A;  3PXW D;  4A11 B;  1SHY B;  3ORV D;  4X3E A;  2VDN A;  2QR5 A;  4GGC A;  2PBI B;  3ZDZ A;  4GM3 A;  3QHY B;  3KRX B;  5KDO B;  2G9A A;  4J81 A;  1C9I A;  1XKS A;  4JXM A;  4OWR A;  5I5M A;  3EI3 A;  3PSL A;  1GP2 B;  4PBZ A;  2VZ3 A;  3I8C A;  4JSP C;  3FCU A;  1A0R B;  1JV2 A;  2VZ1 A;  3AL8 B;  2P9K C;  1E5T A;  4A0A B;  1JTD B;  2YNP A;  4GM9 A;  3CFS B;  1VZ3 A;  3I7L A;  2PM9 B;  4IRZ A;  4JHP C;  4AN0 A;  2CN2 A;  3C5M A;  4A7J A;  4ERQ A;  1PI6 A;  2CN3 A;  3KCI A;  2XDW A;  5TEF A;  2IAA A;  3V5W B;  5C92 A;  1NEX B;  2G99 A;  3NVQ A;  4BH6 A;  3MKQ A;  4BL0 A;  4CY3 A;  3I89 A;  2H6Q A;  5AJA A;  4D9S A;  4PNK B;  2PM7 B;  4XEI C;  5FA5 B;  2CE8 A;  3NIF A;  3W15 A;  2TRC B;  3RRM C;  1E8N A;  2XE4 A;  3E0C A;  5IGO A;  2VC2 A;  4CZX A;  5CXB B;  5GSA A;  3BG0 A;  3IUQ A;  1YR2 A;  4TZ4 A;  2AH0 A;  2PM6 B;  4ESG A;  1S4U X;  4EWR A;  3IUN A;  3IJ1 A;  3I8E A;  2O9K A;  4GMB A;  2VDR A;  4ES0 A;  1BPO A;  1GOG A;  4NEN A;  3C75 H;  3O4I A;  3EI1 B;  3MMY A;  2HJB A;  4WK4 A;  4AEZ A;  4J79 A;  4RE6 A;  4NSX A;  2B5L A;  5JWZ A;  2GNQ A;  4NAA A;  1C9L A;  2CNX A;  4Z8L A;  4XYI A;  4Y5R D;  1K8K C;  1NR0 A;  3V4P A;  3K26 A;  5I5I A;  2H13 A;  2H9N A;  1XIP A;  2EIB A;  1H2W A;  3OKY B;  3UKR C;  2QXV A;  4N14 A;  3IJC A;  4O02 A;  5FFO A;  3QI0 A;  3CIK B;  2H14 A;  2AGZ A;  3F3G A;  2JKX A;  5HYN B;  3J81 g;  3N0E A;  3VH0 A;  4CI2 A;  5C9Z B;  2Z2N A;  3SFZ A;  2HU8 A;  4AX4 A;  4WJK A;  3I7N A;  3VA6 A;  3MXX A;  1QNI A;  2P9U C;  1XHM A;  2VDM A;  2I0S A;  3UVL A;  2HU5 A;  3EWE A;  3JRO A;  4K3J B;  4J73 A;  3GFC A;  3I7O A;  1L5G A;  2YMU A;  4IMM A;  2UZY B;  1I2M B;  5AFU 3;  2H68 A;  3BG1 A;  4PXW A;  2VDK A;  1ERJ A;  5EAM A;  2AQ5 A;  3I7K A;  4J82 A;  1PEV A;  3PVU B;  5EAR A;  4A0B A;  3OF7 A;  4A08 B;  5I5J A;  2XL2 A;  3ZE2 A;  4JT6 C;  4KFM B;  4A09 B;  4BCD A;  2HJ4 A;  2H9P A;  3FM0 A;  4RE5 A;  2J55 H;  2B5M A;  1K32 A;  2P9P C;  4HDJ A;  2VDL A;  3SJL D;  4GM8 A;  5SXM A;  5FQD A;  4ZOY A;  3PSC B;  5GXH A;  2B4E A;  1VE7 A;  2MTA H;  2Z2P A;  3EU7 A;  4Y7R A;  4DNU A;  4CY1 A;  1P22 A;  5HE3 B;  3T3M A;  4E54 B;  5EM2 A;  4JSV C;  3IUL A;  2B5N A;  2YBA A;  4O2W A;  3ODT A;  3JPX A;  2I0R A;  3UKU C;  3PVW B;  2WQ8 A;  2Z2O A;  3I7H A;  4JSX C;  5FLX g;  3NIG A;  1GXR A;  4WK0 A;  2YB8 B;  3OTT A;  3RSE C;  4GQ1 A;  3SLE D;  4FAV D;  4UI9 R;  3EQ7 A;  5M5R A; 
#chains in the Genus database with same CATH homology
 2J57 G;  2AH1 A;  2HES X;  1RI6 A;  4A09 A;  4FA5 D;  4E5Z B;  3K27 A;  5H1M A;  4PSW B;  4A11 A;  2OVP B;  3SBQ A;  5C2W B;  5TDH B;  5C2V B;  2XYI A;  5CYK B;  3DXM C;  4D6V A;  2IUR A;  4PBY A;  3AL8 A;  4I79 A;  4A0A A;  1L0Q A;  3IKO A;  4E54 A;  1JJU B;  3CFV A;  2PM9 A;  3RN0 D;  4IA9 A;  4CY5 A;  5IJ8 E;  2YNO A;  4L1Q D;  5FKT A;  3OKW A;  5FKS A;  4JSN C;  4J0X A;  5CXC B;  4ZOV A;  2YNN A;  5IJ7 E;  3N0D A;  4LG9 A;  1GG2 B;  5TF2 A;  2Q7Q A;  3MKS B;  2H6N A;  3P4F A;  3AFC A;  4J87 A;  1N6E A;  2OIZ A;  5GMK n;  5FKQ A;  2OVQ B;  3IIW A;  5CXB A;  3RFH A;  4J8B A;  3EI4 B;  4K3I D;  5K19 A;  3JZN A;  1PGU A;  3V9F A;  4FA9 D;  3IJ0 A;  4GGD A;  5CYK A;  3OL2 B;  5HE1 B;  4O9D A;  4CZY A;  3EI1 A;  2P9L C;  2I3S A;  4OZU A;  2CO0 A;  5FKR A;  4LGN A;  2XL3 A;  5H14 A;  3F3P A;  4J0W A;  3GRE A;  3EG6 A;  3JB9 L;  5A2Q g;  3PXT D;  4X61 B;  5EMM B;  1JOF A;  1FWX A;  3OKY A;  4QRJ A;  4PC0 A;  3EI3 B;  2P9S C;  3SCY A;  3RMZ D;  5B4W A;  3SWS D;  3JAM g;  1SQ9 A;  4D0K A;  3UVM A;  4U1E I;  5THA A;  2CO0 C;  4GGA A;  2OK6 A;  4O45 A;  2P9I C;  4ZOZ A;  1B9Y A;  2UZX B;  5HQG A;  5EAL A;  2GC7 A;  3FRX A;  4GQB B;  2GC4 A;  1SQJ A;  3EMH A;  1MG3 A;  3F3F A;  4J78 A;  4A2L A;  4ERZ A;  4AOW A;  3JZG A;  4O3U B;  4FA4 D;  1U2V C;  2W18 A;  3UR4 A;  1VYH C;  4QL1 A;  5FXY A;  2HYE A;  5EMJ B;  2H9M A;  3OKT A;  4JT5 C;  4A08 A;  1N6F A;  1TYQ C;  3JRP A;  2IWK A;  4GZ8 A;  5HE0 B;  3L4O D;  4G56 B;  3DSM A;  4X60 B;  4FA1 D;  3PXS D;  3SHF A;  3IIY A;  4YVD A;  1Q47 A;  2BBK H;  3A0F A;  3SBR A;  4FWW A;  2OVR B;  2H6K A;  2IUV A;  2J56 H;  3MZL A;  4J84 A;  4MK0 B;  3UVN A;  4J8G A;  4ERY A;  4JD2 C;  3AH8 B;  1JMX B;  4X63 B;  4PSX B;  4CI8 A;  3C99 A;  2I0T A;  2XU7 A;  5K1C C;  3V7D B;  4O3T B;  3L4M D;  4FB1 D;  2H47 A;  2IUQ A;  4CI3 A;  4H5I A;  3NVX A;  4QQE A;  5EMK B;  3BWS A;  2HKM A;  2IUP A;  2CE9 A;  4J86 A;  4L9O A;  2P9N C;  3EI2 B;  1B9X A;  3ZWL B;  2IWF A;  3J80 g;  3VGZ A;  4CI1 A;  2OK4 A;  4E5Z A;  2AGX A;  5H17 A;  2H9L A;  1YFQ A;  4A2M A;  1N6D A;  3SMR A;  5TEE A;  4LG8 A;  3MZK A;  4A0B B;  3B7F A;  3RFG A;  5GXI A;  3UVK A;  4L3H D;  4CZV A;  5AMS A;  4J77 A;  4ZN4 A;  2EBS A;  1OMW B;  2HKR A;  4QT8 A;  1U4C A;  4GQ2 P;  5CXC A;  4ZOX A;  3OW8 A;  3FGB A;  3RN1 D;  3SXT D;  3UVO A;  3DXK C;  5HE2 B;  2I3T A;  3JZH A;  3SVW D;  3EI2 A;  2AGY A;  3ULE C;  1MG2 A;  4R7A B;  5IT9 g;  1OLZ A;  5EM2 B;  1TBG A;  4L3G D;  3DM0 A;  3DWL C;  4H5J A;  2OJY A;  1PBY B;  2BCJ B;  2QC5 A;  3KRW B;  4CY2 A;  3SN6 B;  4O1Q D;  3EI4 A;  1JMZ B;  1GOT B;  2AGL A;  2H3X A;  3PE7 A;  2AGW A;  4FHL A;  3I2N A;  2HXC A;  1R5M A;  3HFQ A;  3OL2 A;  4U7A A;  5EAP A;  4FAN D;  3I7P A;  3NVN A;  5EML B;  3SBP A;  3U4Y A;  4BUJ C;  4CC9 A;  5IGQ A;  3AL9 A;  1MDA H;  3RLM D;  3C9C A;  5IC7 A;  4XYH A;  3PXW D;  4A11 B;  1SHY B;  3ORV D;  4X3E A;  4GGC A;  2PBI B;  4GM3 A;  3KRX B;  5KDO B;  2G9A A;  4J81 A;  1XKS A;  4JXM A;  4OWR A;  5I5M A;  3EI3 A;  3PSL A;  1GP2 B;  4PBZ A;  3I8C A;  4JSP C;  1A0R B;  3AL8 B;  2P9K C;  4A0A B;  2YNP A;  4GM9 A;  3CFS B;  3I7L A;  2PM9 B;  2CN2 A;  3C5M A;  4A7J A;  4ERQ A;  1PI6 A;  2CN3 A;  5TEF A;  2IAA A;  3V5W B;  1NEX B;  2G99 A;  3NVQ A;  4BH6 A;  3MKQ A;  4BL0 A;  4CY3 A;  3I89 A;  2H6Q A;  5AJA A;  4PNK B;  2PM7 B;  4XEI C;  5FA5 B;  2CE8 A;  3W15 A;  2TRC B;  3RRM C;  3E0C A;  5IGO A;  4CZX A;  5CXB B;  5GSA A;  3BG0 A;  4TZ4 A;  2AH0 A;  2PM6 B;  4ESG A;  1S4U X;  4EWR A;  3IJ1 A;  3I8E A;  2O9K A;  4GMB A;  4ES0 A;  3C75 H;  3EI1 B;  3MMY A;  2HJB A;  4AEZ A;  4J79 A;  4NSX A;  2B5L A;  5JWZ A;  2GNQ A;  2CNX A;  4Z8L A;  4XYI A;  4Y5R D;  1K8K C;  1NR0 A;  3K26 A;  5I5I A;  2H13 A;  2H9N A;  1XIP A;  3OKY B;  3UKR C;  2QXV A;  4N14 A;  3IJC A;  3CIK B;  2H14 A;  2AGZ A;  3F3G A;  5HYN B;  3J81 g;  3N0E A;  3VH0 A;  4CI2 A;  5C9Z B;  2Z2N A;  3SFZ A;  3I7N A;  3VA6 A;  3MXX A;  1QNI A;  2P9U C;  1XHM A;  2I0S A;  3UVL A;  3EWE A;  3JRO A;  4K3J B;  4J73 A;  3GFC A;  3I7O A;  2YMU A;  4IMM A;  2UZY B;  5AFU 3;  2H68 A;  3BG1 A;  4PXW A;  1ERJ A;  5EAM A;  2AQ5 A;  3I7K A;  4J82 A;  1PEV A;  3PVU B;  5EAR A;  4A0B A;  4A08 B;  5I5J A;  2XL2 A;  4JT6 C;  4KFM B;  4A09 B;  2HJ4 A;  2H9P A;  3FM0 A;  2J55 H;  2B5M A;  1K32 A;  2P9P C;  4HDJ A;  3SJL D;  4GM8 A;  5SXM A;  5FQD A;  4ZOY A;  3PSC B;  5GXH A;  2B4E A;  2MTA H;  2Z2P A;  3EU7 A;  4Y7R A;  4CY1 A;  1P22 A;  5HE3 B;  4E54 B;  5EM2 A;  4JSV C;  2B5N A;  2YBA A;  3ODT A;  3JPX A;  2I0R A;  3UKU C;  3PVW B;  2Z2O A;  3I7H A;  4JSX C;  5FLX g;  1GXR A;  2YB8 B;  3OTT A;  3RSE C;  4GQ1 A;  3SLE D;  4FAV D;  4UI9 R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...