4J86A

Crystal structure of beta'-cop/ywbp1 complex
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
301
structure length
301
Chain Sequence
MKLDIKKTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVEIWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coatomer subunit beta'
publication title Rules for the recognition of dilysine retrieval motifs by coatomer.
pubmed doi rcsb
molecule tags Protein transport
total genus 88
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4j86A01
4Y7RA 3SN6B 2AGWA 3MMYA 2H13A 4A11B 3NVXA 2YBAA 5EM2A 2P9PC 5K1CC 3UVKA 5FA5B 3EI3B 2TRCB 4GGAA 2B4EA 2P9LC 3AFCA 4GM3A 4GM9A 2HYEA 4IMMA 2I0SA 3RRMC 4JSXC 5FQDA 4PXWA 2B5LA 4PNKB 2PM7B 3DWLC 4I79A 3SBQA 4GQ1A 4CY3A 3JB9L 3B7FA 3DSMA 5FKQA 2PM9B 1OLZA 3PSCB 5CXBB 5FKRA 2OIZA 5EARA 4XEIC 3I8CA 4U1EI 1XKSA 2I3TA 3IIYA 1U2VC 4JSPC 2H68A 2IUPA 3JPXA 3ZWLB 3CIKB 4CY5A 5JWZA 4FA4D 4PBZA 4ES0A 1N6EA 3IIWA 4LG8A 1NEXB 3L4MD 4A0AA 3CFVA 2OVQB 1JMXB 4X3EA 4QL1A 3EG6A 1SQ9A 4FA5D 4O45A 2QC5A 4JSVC 2P9UC 3L4OD 2AGZA 3UVMA 3SLED 4A0BA 4TZ4A 3MXXA 5H1MA 4CY1A 2HJ4A 3UR4A 3W15A 4OZUA 4AOWA 4ESGA 4FHLA 2G99A 4J8GA 3SWSD 5FKTA 4JSNC 4BUJC 4JT6C 3SVWD 2OK4A 3UVNA 1JOFA 3PE7A 4J73A 2J55H 5SXMA 4LG9A 4J84A 2XL2A 3UVLA 5FXYA 5CYKB 4D6VA 2EBSA 4GQ2P 4X60B 1GXRA 2Z2PA 5GXIA 3RFGA 1RI6A 2CO0C 3PSLA 2H3XA 3JZNA 4EWRA 2CE9A 4UI9R 2G9AA 4GGDA 3NVQA 4J87A 2IWKA 4NSXA 3OL2B 3OTTA 2XU7A 4IA9A 4KFMB 2HKRA 2IURA 5GSAA 3MKQA 4E54B 2H6NA 3I2NA 1Q47A 3EWEA 5H14A 5HYNB 2Z2NA 4MK0B 3EI1A 4GMBA 2YNPA 2YB8B 3RN1D 2AGXA 1NR0A 5EMMB 3SCYA 3E0CA 3AL8B 3PXTD 4XYHA 4CY2A 2H9NA 4CZYA 5HQGA 3P4FA 4LGNA 2OK6A 4BL0A 1A0RB 5IJ7E 3RN0D 2QXVA 4L1QD 4XYIA 2J56H 3GREA 1PBYB 5CXCB 3RSEC 4GM8A 2OVRB 3N0DA 4GZ8A 1MDAH 2AGLA 3RLMD 3JAMg 4ERYA 2P9NC 4H5JA 4J81A 4FA1D 3IKOA 3J81g 5AJAA 4A09B 2H14A 3KRXB 3UKRC 4K3ID 5IGQA 4A08A 1PGUA 2I0TA 3SJLD 5I5MA 3EI2B 2XYIA 1MG2A 4J79A 5C2VB 2XL3A 1TYQC 2YMUA 5H17A 4FWWA 2I0RA 3OKYB 2Z2OA 1JJUB 3FM0A 1XHMA 3EI4B 1JMZB 4E54A 4QT8A 3JRPA 3V5WB 4A11A 1GG2B 4D0KA 2H6QA 4PSWB 4FAVD 4X61B 5IC7A 3V7DB 1GP2B 4CC9A 4R7AB 5IT9g 4J0WA 4J86A 4O3TB 1QNIA 4Y5RD 2HJBA 3EI3A 3FRXA 2I3SA 4O9DA 1ERJA 4J0XA 4ERQA 5TEFA 4ZN4A 3JZHA 4AEZA 3OW8A 3BG1A 3JROA 5EAMA 3MZLA 2GC4A 2PM9A 5CXBA 3SBPA 3OKWA 5HE2B 4E5ZB 3C5MA 3DXMC 3F3GA 2H6KA 3FGBA 4J78A 4J77A 1PI6A 3RFHA 3EMHA 3I7NA 3I7OA 4N14A 3IJ0A 3SHFA 4K3JB 3UKUC 5AFU3 4A09A 4FA9D 1U4CA 1N6DA 2P9KC 4L3HD 3V9FA 2H9MA 4CZVA 3I7LA 2W18A 5B4WA 2CN2A 3F3FA 5TF2A 4PC0A 3OKYA 5C2WB 5IJ8E 4O1QD 2AGYA 1B9YA 3U4YA 3PVUB 3N0EA 2HKMA 1OMWB 4J82A 4O3UB 4J8BA 1B9XA 4U7AA 3PVWB 2O9KA 4A2MA 3A0FA 4A0AB 3MKSB 4G56B 3BWSA 4PSXB 4CI1A 1XIPA 3SFZA 1K8KC 3ORVD 1YFQA 3UVOA 3ULEC 4A0BB 2YNNA 3AH8B 4QRJA 5EMKB 1K32A 2H9LA 2B5MA 3K27A 2CO0A 4E5ZA 3PXSD 5CYKA 5GXHA 1R5MA 5IGOA 5FLXg 2AH0A 5A2Qg 3C99A 4A7JA 5GMKn 5C9ZB 4GGCA 2H47A 3J80g 4A2LA 4QQEA 3F3PA 1MG3A 4JT5C 4CI8A 2PM6B 4ZOZA 4ERZA 1PEVA 4FB1D 3OL2A 2IUQA 2OVPB 2UZXB 4CI3A 5HE1B 3I7HA 4GQBB 4OWRA 3KRWB 2AH1A 2HESX 1FWXA 5I5IA 3I7PA 2P9IC 3SBRA 5TDHB 2H9PA 2AQ5A 3BG0A 4BH6A 2IUVA 2BCJB 3VGZA 3IJCA 4JD2C 3DM0A 3AL8A 5EAPA 4YVDA 5K19A 5EMJB 1SQJA 5HE0B 3MZKA 3NVNA 3OKTA 2B5NA 3EI1B 2MTAH 5EM2B 3PXWD 4CI2A 1N6FA 1L0QA 3DXKC 2IAAA 2IWFA 5AMSA 3C75H 3SXTD 5CXCA 4X63B 2YNOA 2UZYB 2OJYA 4ZOXA 1VYHC 5FKSA 4FAND 2PBIB 3AL9A 1S4UX 4L9OA 4L3GD 1TBGA 2CNXA 2BBKH 5KDOB 3GFCA 3EU7A 4HDJA 2HXCA 3SMRA 2Q7QA 3CFSB 1SHYB 3I7KA 3JZGA 4PBYA 5THAA 4H5IA 1P22A 4CZXA 2GNQA 3K26A 4JXMA 3VA6A 3EI2A 5TEEA 4Z8LA 3VH0A 2CE8A 5EALA 3I8EA 2J57G 4ZOVA 2P9SC 3HFQA 3EI4A 5EMLB 5HE3B 3ODTA 3RMZD 4A08B 2CN3A 4ZOYA 2GC7A 3IJ1A 1GOTB 3C9CA 5I5JA 3I89A
chains in the Genus database with same CATH superfamily
4Y7RA 3SN6B 4AN1A 2AGWA 5M5UA 3MMYA 5M5SA 2H13A 1JTDB 3NVXA 4A11B 2YBAA 4G1EA 5EM2A 4AX4A 3VI3A 2P9PC 5K1CC 3QI0A 3UVKA 5FA5B 3EI3B 1H2YA 2TRCB 4GGAA 2B4EA 2P9LC 3AFCA 4GM3A 4GM9A 2HYEA 4IMMA 2I0SA 3RRMC 4JSXC 5FQDA 4PXWA 2B5LA 4PNKB 4MMXA 2PM7B 3DWLC 2HU7A 4I79A 1O6GA 3SBQA 4GQ1A 4CY3A 3JB9L 3B7FA 5E6UA 3DSMA 5FKQA 2PM9B 1OLZA 3PSCB 5CXBB 5FKRA 3MUOA 2OIZA 2VZ3A 4BP8A 5EARA 4XEIC 2JKXA 4AN0A 5FFOA 3I8CA 4U1EI 1XKSA 3VI4A 2I3TA 3IIYA 4DNWA 1U2VC 4JSPC 2H68A 2IUPA 3JPXA 3T3PA 3ZWLB 3CIKB 4CY5A 3KCIA 5JWZA 3IVMA 4FA4D 4PBZA 5M5TA 5E6RA 4AMZA 4ES0A 1N6EA 3IIWA 1NEXB 4LG8A 3L4MD 4A0AA 3CFVA 2OVQB 1JMXB 4X3EA 2VC2A 3QHYB 4QL1A 3K72A 2EICA 3EG6A 4O02A 1SQ9A 4FA5D 4O45A 2QC5A 4JSVC 2P9UC 3L4OD 2QZPA 2AGZA 3UVMA 3SLED 4A0BA 4TZ4A 3MXXA 5H1MA 4CY1A 2HJ4A 3UR4A 3W15A 4OZUA 3DDUA 4AOWA 4ESGA 4FHLA 2G99A 4J8GA 3ZE0A 3SWSD 4AMYA 5FKTA 4JSNC 4BUJC 1H2XA 4JT6C 3SVWD 4BCBA 2OK4A 3UVNA 3FCSA 3IUNA 1JOFA 3MUNA 3PE7A 4J73A 3ZE2A 2J55H 5SXMA 4LG9A 4J84A 3IUMA 4L1MA 2XL2A 3UVLA 5FXYA 5CYKB 4D6VA 2WQ8A 2EBSA 3V4VA 4GQ2P 4X60B 2VDRA 1GXRA 2Z2PA 5GXIA 3RFGA 3O4JA 1RI6A 2CO0C 3ZDYA 3PSLA 2H3XA 3JZNA 4EWRA 2CE9A 4UI9R 2G9AA 4GGDA 3NVQA 4J87A 2IWKA 4NSXA 3OL2B 3OTTA 2XU7A 4IA9A 4KFMB 2HKRA 2IURA 5GSAA 3MKQA 3O4IA 3OF7A 5C86A 4E54B 2H6NA 3I2NA 1Q47A 3EWEA 4NENA 3O4HA 5H14A 5HYNB 2Z2NA 1T2XA 4MK0B 3EI1A 4GMBA 1QFMA 2YNPA 2YB8B 3RN1D 2AGXA 1NR0A 2EIDA 5EMMB 1L5GA 3SCYA 1GOHA 3E0CA 3AL8B 3PXTD 3V4PA 4XYHA 4CY2A 2H9NA 4CZYA 3NIDA 5HQGA 3P4FA 5M5VA 4NAAA 4LGNA 2VDMA 2OK6A 4BL0A 1A0RB 5IJ7E 3RN0D 2QXVA 4L1QD 4XYIA 2J56H 3GREA 1VE7A 1PBYB 5CXCB 3RSEC 4GM8A 2OVRB 3N0DA 4GZ8A 1MDAH 2AGLA 3IUQA 4G1MA 4JHNA 3RLMD 3JAMg 4ERYA 2EIEA 2P9NC 4H5JA 4J81A 4MMZA 4FA1D 3IKOA 1UTCA 4BP9A 3J81g 5AJAA 4A09B 2H14A 3GC3B 3KRXB 3UKRC 4O2WA 4K3ID 5IGQA 4DNVA 4A08A 1PGUA 2I0TA 3SJLD 5I5MA 3EI2B 2XYIA 1MG2A 4J79A 5C2VB 2XL3A 1I2MB 1TYQC 1A12A 1GOGA 2YMUA 4FWWA 2I0RA 3OKYB 4QAMA 5H17A 5M61A 2Z2OA 1JJUB 3FM0A 1XHMA 3EI4B 1JMZB 4E54A 4QT8A 4WK2A 4IRZA 3JRPA 3V5WB 4RE5A 4A11A 1GG2B 4D0KA 2H6QA 4PSWB 4FAVD 3IUJA 4X61B 5IC7A 3V7DB 1GP2B 4CC9A 4R7AB 5IT9g 4J0WA 4J86A 4O3TB 4G55A 1QNIA 4Y5RD 2VDOA 2HJBA 3EI3A 3EQ7A 3FRXA 1UOQA 2I3SA 4O9DA 1ERJA 4J0XA 4ERQA 2VDLA 1VZ2A 5TEFA 3FCUA 4ZN4A 3JZHA 4AEZA 3OW8A 3BG1A 3JROA 5EAMA 3MZLA 2GC4A 2PM9A 1C9LA 2VZ1A 5CXBA 3SBPA 3OKWA 5HE2B 4E5ZB 3C5MA 3DXMC 2HU8A 2H6KA 3F3GA 3FGBA 4JHPC 4J78A 3K6SA 4J77A 1PI6A 3RFHA 3EMHA 3I7NA 3I7OA 4N14A 3IJ0A 3SHFA 1UOPA 4K3JB 3UKUC 1M1XA 3IULA 5AFU3 4WK4A 4A09A 2VDPA 4FA9D 1U4CA 1N6DA 2P9KC 4L3HD 3V9FA 2H9MA 4CZVA 4BCCA 3I7LA 2QR5A 2W18A 5B4WA 2CN2A 3F3FA 5TF2A 4PC0A 3OKYA 5C2WB 5IJ8E 4O1QD 2AGYA 1B9YA 3U4YA 1K3IA 3PVUB 3O4GA 3N0EA 2HKMA 3EQ8A 1OMWB 1GOFA 4J82A 4Z7NA 4O3UB 4J8BA 1B9XA 4BCDA 4U7AA 1H2WA 1BPOA 3PVWB 2O9KA 4A2MA 3A0FA 4A0AB 3MKSB 1H2ZA 4G56B 3BWSA 4PSXB 4CI1A 1XIPA 3SFZA 1K8KC 3ORVD 1YFQA 3UVOA 3ULEC 4A0BB 2YNNA 3AH8B 4Z7QA 4QRJA 5EMKB 1K32A 3NIFA 2H9LA 2B5MA 3K27A 5FFGA 2CO0A 2XDWA 3ZDXA 4UM9A 4E5ZA 3PXSD 4UM8A 5CYKA 5GXHA 1R5MA 5HDBA 5IGOA 4Z7OA 5FLXg 4WJKA 2AH0A 5A2Qg 3C99A 4A7JA 3MVDK 5GMKn 5C9ZB 4GGCA 3NIGA 2H47A 3EQ9A 2EIBA 3J80g 4A2LA 4QQEA 3F3PA 1MG3A 4JT5C 4CI8A 2PM6B 4ZOZA 4ERZA 1PEVA 2BKLA 4FB1D 3OL2A 2XE4A 2IUQA 2OVPB 2UZXB 4CI3A 5HE1B 3I7HA 4GQBB 4OWRA 3KRWB 1E8NA 2AH1A 2HESX 1FWXA 5I5IA 1C9IA 3T3MA 3I7PA 2P9IC 3SBRA 5TDHB 2H9PA 1UOOA 2AQ5A 3BG0A 4MMYA 4BH6A 4D9SA 2IUVA 2BCJB 3ZDZA 3VGZA 3IJCA 4JD2C 1E5TA 3AL8A 3DM0A 5EAPA 4YVDA 4NC4A 5K19A 5EMJB 1SQJA 5HE0B 2VDNA 3MZKA 3NVNA 3OKTA 4RE6A 2B5NA 3EI1B 2MTAH 5EM2B 3ZE1A 4NBMA 3IJEA 3PXWD 4CI2A 1N6FA 1L0QA 3DXKC 2IAAA 2IWFA 2XZGA 5AMSA 3C75H 3SXTD 3IURA 5CXCA 4X63B 2YNOA 2UZYB 2OJYA 4ZOXA 1VYHC 5FKSA 4FAND 2PBIB 1VZ3A 3AL9A 3K71A 1S4UX 4L9OA 4L3GD 1O6FA 1TBGA 3GD1I 2CNXA 2BBKH 5KDOB 1YR2A 3GFCA 3EU7A 4HDJA 2HXCA 3SMRA 2Q7QA 3CFSB 1JV2A 1SHYB 5E6SA 3I7KA 3JZGA 4PBYA 5THAA 4H5IA 1P22A 4CZXA 2GNQA 3K26A 4JXMA 1E8MA 3VA6A 3EI2A 1U8CA 2VDKA 5TEEA 4Z8LA 2HU5A 5C92A 3VH0A 2CE8A 5EALA 3I8EA 2J57G 4ZOVA 1TYEA 2P9SC 3HFQA 4WK0A 3EI4A 5EMLB 5HE3B 4DNUA 2VDQA 3ODTA 3RMZD 4A08B 2CN3A 4ZOYA 2GC7A 3IJ1A 1GOTB 1VE6A 5M5RA 3C9CA 1QFSA 5I5JA 3I89A
chains in the Genus database with same CATH topology
4Y7RA 3SN6B 2AGWA 3MMYA 2H13A 4A11B 3NVXA 2YBAA 5EM2A 2P9PC 5K1CC 3UVKA 5FA5B 3EI3B 2TRCB 4GGAA 2B4EA 2P9LC 3AFCA 4GM3A 4GM9A 2HYEA 4IMMA 2I0SA 3RRMC 4JSXC 5FQDA 4PXWA 2B5LA 4PNKB 2PM7B 3DWLC 4I79A 3SBQA 4GQ1A 4CY3A 3JB9L 3B7FA 3DSMA 5FKQA 2PM9B 1OLZA 3PSCB 5CXBB 5FKRA 2OIZA 5EARA 4XEIC 3I8CA 4U1EI 1XKSA 2I3TA 3IIYA 1U2VC 4JSPC 2H68A 2IUPA 3JPXA 3ZWLB 3CIKB 4CY5A 5JWZA 4FA4D 4PBZA 4ES0A 1N6EA 3IIWA 4LG8A 1NEXB 3L4MD 4A0AA 3CFVA 2OVQB 1JMXB 4X3EA 4QL1A 3EG6A 1SQ9A 4FA5D 4O45A 2QC5A 4JSVC 2P9UC 3L4OD 2AGZA 3UVMA 3SLED 4A0BA 4TZ4A 3MXXA 5H1MA 4CY1A 2HJ4A 3UR4A 3W15A 4OZUA 4AOWA 4ESGA 4FHLA 2G99A 4J8GA 3SWSD 5FKTA 4JSNC 4BUJC 4JT6C 3SVWD 2OK4A 3UVNA 1JOFA 3PE7A 4J73A 2J55H 5SXMA 4LG9A 4J84A 2XL2A 3UVLA 5FXYA 5CYKB 4D6VA 2EBSA 4GQ2P 4X60B 1GXRA 2Z2PA 5GXIA 3RFGA 1RI6A 2CO0C 3PSLA 2H3XA 3JZNA 4EWRA 2CE9A 4UI9R 2G9AA 4GGDA 3NVQA 4J87A 2IWKA 4NSXA 3OL2B 3OTTA 2XU7A 4IA9A 4KFMB 2HKRA 2IURA 5GSAA 3MKQA 4E54B 2H6NA 3I2NA 1Q47A 3EWEA 5H14A 5HYNB 2Z2NA 4MK0B 3EI1A 4GMBA 2YNPA 2YB8B 3RN1D 2AGXA 1NR0A 5EMMB 3SCYA 3E0CA 3AL8B 3PXTD 4XYHA 4CY2A 2H9NA 4CZYA 5HQGA 3P4FA 4LGNA 2OK6A 4BL0A 1A0RB 5IJ7E 3RN0D 2QXVA 4L1QD 4XYIA 2J56H 3GREA 1PBYB 5CXCB 3RSEC 4GM8A 2OVRB 3N0DA 4GZ8A 1MDAH 2AGLA 3RLMD 3JAMg 4ERYA 2P9NC 4H5JA 4J81A 4FA1D 3IKOA 3J81g 5AJAA 4A09B 2H14A 3KRXB 3UKRC 4K3ID 5IGQA 4A08A 1PGUA 2I0TA 3SJLD 5I5MA 3EI2B 2XYIA 1MG2A 4J79A 5C2VB 2XL3A 1TYQC 2YMUA 5H17A 4FWWA 2I0RA 3OKYB 2Z2OA 1JJUB 3FM0A 1XHMA 3EI4B 1JMZB 4E54A 4QT8A 3JRPA 3V5WB 4A11A 1GG2B 4D0KA 2H6QA 4PSWB 4FAVD 4X61B 5IC7A 3V7DB 1GP2B 4CC9A 4R7AB 5IT9g 4J0WA 4J86A 4O3TB 1QNIA 4Y5RD 2HJBA 3EI3A 3FRXA 2I3SA 4O9DA 1ERJA 4J0XA 4ERQA 5TEFA 4ZN4A 3JZHA 4AEZA 3OW8A 3BG1A 3JROA 5EAMA 3MZLA 2GC4A 2PM9A 5CXBA 3SBPA 3OKWA 5HE2B 4E5ZB 3C5MA 3DXMC 3F3GA 2H6KA 3FGBA 4J78A 4J77A 1PI6A 3RFHA 3EMHA 3I7NA 3I7OA 4N14A 3IJ0A 3SHFA 4K3JB 3UKUC 5AFU3 4A09A 4FA9D 1U4CA 1N6DA 2P9KC 4L3HD 3V9FA 2H9MA 4CZVA 3I7LA 2W18A 5B4WA 2CN2A 3F3FA 5TF2A 4PC0A 3OKYA 5C2WB 5IJ8E 4O1QD 2AGYA 1B9YA 3U4YA 3PVUB 3N0EA 2HKMA 1OMWB 4J82A 4O3UB 4J8BA 1B9XA 4U7AA 3PVWB 2O9KA 4A2MA 3A0FA 4A0AB 3MKSB 4G56B 3BWSA 4PSXB 4CI1A 1XIPA 3SFZA 1K8KC 3ORVD 1YFQA 3UVOA 3ULEC 4A0BB 2YNNA 3AH8B 4QRJA 5EMKB 1K32A 2H9LA 2B5MA 3K27A 2CO0A 4E5ZA 3PXSD 5CYKA 5GXHA 1R5MA 5IGOA 5FLXg 2AH0A 5A2Qg 3C99A 4A7JA 5GMKn 5C9ZB 4GGCA 2H47A 3J80g 4A2LA 4QQEA 3F3PA 1MG3A 4JT5C 4CI8A 2PM6B 4ZOZA 4ERZA 1PEVA 4FB1D 3OL2A 2IUQA 2OVPB 2UZXB 4CI3A 5HE1B 3I7HA 4GQBB 4OWRA 3KRWB 2AH1A 2HESX 1FWXA 5I5IA 3I7PA 2P9IC 3SBRA 5TDHB 2H9PA 2AQ5A 3BG0A 4BH6A 2IUVA 2BCJB 3VGZA 3IJCA 4JD2C 3DM0A 3AL8A 5EAPA 4YVDA 5K19A 5EMJB 1SQJA 5HE0B 3MZKA 3NVNA 3OKTA 2B5NA 3EI1B 2MTAH 5EM2B 3PXWD 4CI2A 1N6FA 1L0QA 3DXKC 2IAAA 2IWFA 5AMSA 3C75H 3SXTD 5CXCA 4X63B 2YNOA 2UZYB 2OJYA 4ZOXA 1VYHC 5FKSA 4FAND 2PBIB 3AL9A 1S4UX 4L9OA 4L3GD 1TBGA 2CNXA 2BBKH 5KDOB 3GFCA 3EU7A 4HDJA 2HXCA 3SMRA 2Q7QA 3CFSB 1SHYB 3I7KA 3JZGA 4PBYA 5THAA 4H5IA 1P22A 4CZXA 2GNQA 3K26A 4JXMA 3VA6A 3EI2A 5TEEA 4Z8LA 3VH0A 2CE8A 5EALA 3I8EA 2J57G 4ZOVA 2P9SC 3HFQA 3EI4A 5EMLB 5HE3B 3ODTA 3RMZD 4A08B 2CN3A 4ZOYA 2GC7A 3IJ1A 1GOTB 3C9CA 5I5JA 3I89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y7R A;  3SN6 B;  2AGW A;  3MMY A;  2H13 A;  4A11 B;  3NVX A;  2YBA A;  5EM2 A;  2P9P C;  5K1C C;  3UVK A;  5FA5 B;  3EI3 B;  2TRC B;  4GGA A;  2B4E A;  2P9L C;  3AFC A;  4GM3 A;  4GM9 A;  2HYE A;  4IMM A;  2I0S A;  3RRM C;  4JSX C;  5FQD A;  4PXW A;  2B5L A;  4PNK B;  2PM7 B;  3DWL C;  4I79 A;  3SBQ A;  4GQ1 A;  4CY3 A;  3JB9 L;  3B7F A;  3DSM A;  5FKQ A;  2PM9 B;  1OLZ A;  3PSC B;  5CXB B;  5FKR A;  2OIZ A;  5EAR A;  4XEI C;  3I8C A;  4U1E I;  1XKS A;  2I3T A;  3IIY A;  1U2V C;  4JSP C;  2H68 A;  2IUP A;  3JPX A;  3ZWL B;  3CIK B;  4CY5 A;  5JWZ A;  4FA4 D;  4PBZ A;  4ES0 A;  1N6E A;  3IIW A;  4LG8 A;  1NEX B;  3L4M D;  4A0A A;  3CFV A;  2OVQ B;  1JMX B;  4X3E A;  4QL1 A;  3EG6 A;  1SQ9 A;  4FA5 D;  4O45 A;  2QC5 A;  4JSV C;  2P9U C;  3L4O D;  2AGZ A;  3UVM A;  3SLE D;  4A0B A;  4TZ4 A;  3MXX A;  5H1M A;  4CY1 A;  2HJ4 A;  3UR4 A;  3W15 A;  4OZU A;  4AOW A;  4ESG A;  4FHL A;  2G99 A;  4J8G A;  3SWS D;  5FKT A;  4JSN C;  4BUJ C;  4JT6 C;  3SVW D;  2OK4 A;  3UVN A;  1JOF A;  3PE7 A;  4J73 A;  2J55 H;  5SXM A;  4LG9 A;  4J84 A;  2XL2 A;  3UVL A;  5FXY A;  5CYK B;  4D6V A;  2EBS A;  4GQ2 P;  4X60 B;  1GXR A;  2Z2P A;  5GXI A;  3RFG A;  1RI6 A;  2CO0 C;  3PSL A;  2H3X A;  3JZN A;  4EWR A;  2CE9 A;  4UI9 R;  2G9A A;  4GGD A;  3NVQ A;  4J87 A;  2IWK A;  4NSX A;  3OL2 B;  3OTT A;  2XU7 A;  4IA9 A;  4KFM B;  2HKR A;  2IUR A;  5GSA A;  3MKQ A;  4E54 B;  2H6N A;  3I2N A;  1Q47 A;  3EWE A;  5H14 A;  5HYN B;  2Z2N A;  4MK0 B;  3EI1 A;  4GMB A;  2YNP A;  2YB8 B;  3RN1 D;  2AGX A;  1NR0 A;  5EMM B;  3SCY A;  3E0C A;  3AL8 B;  3PXT D;  4XYH A;  4CY2 A;  2H9N A;  4CZY A;  5HQG A;  3P4F A;  4LGN A;  2OK6 A;  4BL0 A;  1A0R B;  5IJ7 E;  3RN0 D;  2QXV A;  4L1Q D;  4XYI A;  2J56 H;  3GRE A;  1PBY B;  5CXC B;  3RSE C;  4GM8 A;  2OVR B;  3N0D A;  4GZ8 A;  1MDA H;  2AGL A;  3RLM D;  3JAM g;  4ERY A;  2P9N C;  4H5J A;  4J81 A;  4FA1 D;  3IKO A;  3J81 g;  5AJA A;  4A09 B;  2H14 A;  3KRX B;  3UKR C;  4K3I D;  5IGQ A;  4A08 A;  1PGU A;  2I0T A;  3SJL D;  5I5M A;  3EI2 B;  2XYI A;  1MG2 A;  4J79 A;  5C2V B;  2XL3 A;  1TYQ C;  2YMU A;  5H17 A;  4FWW A;  2I0R A;  3OKY B;  2Z2O A;  1JJU B;  3FM0 A;  1XHM A;  3EI4 B;  1JMZ B;  4E54 A;  4QT8 A;  3JRP A;  3V5W B;  4A11 A;  1GG2 B;  4D0K A;  2H6Q A;  4PSW B;  4FAV D;  4X61 B;  5IC7 A;  3V7D B;  1GP2 B;  4CC9 A;  4R7A B;  5IT9 g;  4J0W A;  4J86 A;  4O3T B;  1QNI A;  4Y5R D;  2HJB A;  3EI3 A;  3FRX A;  2I3S A;  4O9D A;  1ERJ A;  4J0X A;  4ERQ A;  5TEF A;  4ZN4 A;  3JZH A;  4AEZ A;  3OW8 A;  3BG1 A;  3JRO A;  5EAM A;  3MZL A;  2GC4 A;  2PM9 A;  5CXB A;  3SBP A;  3OKW A;  5HE2 B;  4E5Z B;  3C5M A;  3DXM C;  3F3G A;  2H6K A;  3FGB A;  4J78 A;  4J77 A;  1PI6 A;  3RFH A;  3EMH A;  3I7N A;  3I7O A;  4N14 A;  3IJ0 A;  3SHF A;  4K3J B;  3UKU C;  5AFU 3;  4A09 A;  4FA9 D;  1U4C A;  1N6D A;  2P9K C;  4L3H D;  3V9F A;  2H9M A;  4CZV A;  3I7L A;  2W18 A;  5B4W A;  2CN2 A;  3F3F A;  5TF2 A;  4PC0 A;  3OKY A;  5C2W B;  5IJ8 E;  4O1Q D;  2AGY A;  1B9Y A;  3U4Y A;  3PVU B;  3N0E A;  2HKM A;  1OMW B;  4J82 A;  4O3U B;  4J8B A;  1B9X A;  4U7A A;  3PVW B;  2O9K A;  4A2M A;  3A0F A;  4A0A B;  3MKS B;  4G56 B;  3BWS A;  4PSX B;  4CI1 A;  1XIP A;  3SFZ A;  1K8K C;  3ORV D;  1YFQ A;  3UVO A;  3ULE C;  4A0B B;  2YNN A;  3AH8 B;  4QRJ A;  5EMK B;  1K32 A;  2H9L A;  2B5M A;  3K27 A;  2CO0 A;  4E5Z A;  3PXS D;  5CYK A;  5GXH A;  1R5M A;  5IGO A;  5FLX g;  2AH0 A;  5A2Q g;  3C99 A;  4A7J A;  5GMK n;  5C9Z B;  4GGC A;  2H47 A;  3J80 g;  4A2L A;  4QQE A;  3F3P A;  1MG3 A;  4JT5 C;  4CI8 A;  2PM6 B;  4ZOZ A;  4ERZ A;  1PEV A;  4FB1 D;  3OL2 A;  2IUQ A;  2OVP B;  2UZX B;  4CI3 A;  5HE1 B;  3I7H A;  4GQB B;  4OWR A;  3KRW B;  2AH1 A;  2HES X;  1FWX A;  5I5I A;  3I7P A;  2P9I C;  3SBR A;  5TDH B;  2H9P A;  2AQ5 A;  3BG0 A;  4BH6 A;  2IUV A;  2BCJ B;  3VGZ A;  3IJC A;  4JD2 C;  3DM0 A;  3AL8 A;  5EAP A;  4YVD A;  5K19 A;  5EMJ B;  1SQJ A;  5HE0 B;  3MZK A;  3NVN A;  3OKT A;  2B5N A;  3EI1 B;  2MTA H;  5EM2 B;  3PXW D;  4CI2 A;  1N6F A;  1L0Q A;  3DXK C;  2IAA A;  2IWF A;  5AMS A;  3C75 H;  3SXT D;  5CXC A;  4X63 B;  2YNO A;  2UZY B;  2OJY A;  4ZOX A;  1VYH C;  5FKS A;  4FAN D;  2PBI B;  3AL9 A;  1S4U X;  4L9O A;  4L3G D;  1TBG A;  2CNX A;  2BBK H;  5KDO B;  3GFC A;  3EU7 A;  4HDJ A;  2HXC A;  3SMR A;  2Q7Q A;  3CFS B;  1SHY B;  3I7K A;  3JZG A;  4PBY A;  5THA A;  4H5I A;  1P22 A;  4CZX A;  2GNQ A;  3K26 A;  4JXM A;  3VA6 A;  3EI2 A;  5TEE A;  4Z8L A;  3VH0 A;  2CE8 A;  5EAL A;  3I8E A;  2J57 G;  4ZOV A;  2P9S C;  3HFQ A;  3EI4 A;  5EML B;  5HE3 B;  3ODT A;  3RMZ D;  4A08 B;  2CN3 A;  4ZOY A;  2GC7 A;  3IJ1 A;  1GOT B;  3C9C A;  5I5J A;  3I89 A; 
#chains in the Genus database with same CATH topology
 4Y7R A;  3SN6 B;  4AN1 A;  2AGW A;  5M5U A;  3MMY A;  5M5S A;  2H13 A;  1JTD B;  3NVX A;  4A11 B;  2YBA A;  4G1E A;  5EM2 A;  4AX4 A;  3VI3 A;  2P9P C;  5K1C C;  3QI0 A;  3UVK A;  5FA5 B;  3EI3 B;  1H2Y A;  2TRC B;  4GGA A;  2B4E A;  2P9L C;  3AFC A;  4GM3 A;  4GM9 A;  2HYE A;  4IMM A;  2I0S A;  3RRM C;  4JSX C;  5FQD A;  4PXW A;  2B5L A;  4PNK B;  4MMX A;  2PM7 B;  3DWL C;  2HU7 A;  4I79 A;  1O6G A;  3SBQ A;  4GQ1 A;  4CY3 A;  3JB9 L;  3B7F A;  5E6U A;  3DSM A;  5FKQ A;  2PM9 B;  1OLZ A;  3PSC B;  5CXB B;  5FKR A;  3MUO A;  2OIZ A;  2VZ3 A;  4BP8 A;  5EAR A;  4XEI C;  2JKX A;  4AN0 A;  5FFO A;  3I8C A;  4U1E I;  1XKS A;  3VI4 A;  2I3T A;  3IIY A;  4DNW A;  1U2V C;  4JSP C;  2H68 A;  2IUP A;  3JPX A;  3T3P A;  3ZWL B;  3CIK B;  4CY5 A;  3KCI A;  5JWZ A;  3IVM A;  4FA4 D;  4PBZ A;  5M5T A;  5E6R A;  4AMZ A;  4ES0 A;  1N6E A;  3IIW A;  1NEX B;  4LG8 A;  3L4M D;  4A0A A;  3CFV A;  2OVQ B;  1JMX B;  4X3E A;  2VC2 A;  3QHY B;  4QL1 A;  3K72 A;  2EIC A;  3EG6 A;  4O02 A;  1SQ9 A;  4FA5 D;  4O45 A;  2QC5 A;  4JSV C;  2P9U C;  3L4O D;  2QZP A;  2AGZ A;  3UVM A;  3SLE D;  4A0B A;  4TZ4 A;  3MXX A;  5H1M A;  4CY1 A;  2HJ4 A;  3UR4 A;  3W15 A;  4OZU A;  3DDU A;  4AOW A;  4ESG A;  4FHL A;  2G99 A;  4J8G A;  3ZE0 A;  3SWS D;  4AMY A;  5FKT A;  4JSN C;  4BUJ C;  1H2X A;  4JT6 C;  3SVW D;  4BCB A;  2OK4 A;  3UVN A;  3FCS A;  3IUN A;  1JOF A;  3MUN A;  3PE7 A;  4J73 A;  3ZE2 A;  2J55 H;  5SXM A;  4LG9 A;  4J84 A;  3IUM A;  4L1M A;  2XL2 A;  3UVL A;  5FXY A;  5CYK B;  4D6V A;  2WQ8 A;  2EBS A;  3V4V A;  4GQ2 P;  4X60 B;  2VDR A;  1GXR A;  2Z2P A;  5GXI A;  3RFG A;  3O4J A;  1RI6 A;  2CO0 C;  3ZDY A;  3PSL A;  2H3X A;  3JZN A;  4EWR A;  2CE9 A;  4UI9 R;  2G9A A;  4GGD A;  3NVQ A;  4J87 A;  2IWK A;  4NSX A;  3OL2 B;  3OTT A;  2XU7 A;  4IA9 A;  4KFM B;  2HKR A;  2IUR A;  5GSA A;  3MKQ A;  3O4I A;  3OF7 A;  5C86 A;  4E54 B;  2H6N A;  3I2N A;  1Q47 A;  3EWE A;  4NEN A;  3O4H A;  5H14 A;  5HYN B;  2Z2N A;  1T2X A;  4MK0 B;  3EI1 A;  4GMB A;  1QFM A;  2YNP A;  2YB8 B;  3RN1 D;  2AGX A;  1NR0 A;  2EID A;  5EMM B;  1L5G A;  3SCY A;  1GOH A;  3E0C A;  3AL8 B;  3PXT D;  3V4P A;  4XYH A;  4CY2 A;  2H9N A;  4CZY A;  3NID A;  5HQG A;  3P4F A;  5M5V A;  4NAA A;  4LGN A;  2VDM A;  2OK6 A;  4BL0 A;  1A0R B;  5IJ7 E;  3RN0 D;  2QXV A;  4L1Q D;  4XYI A;  2J56 H;  3GRE A;  1VE7 A;  1PBY B;  5CXC B;  3RSE C;  4GM8 A;  2OVR B;  3N0D A;  4GZ8 A;  1MDA H;  2AGL A;  3IUQ A;  4G1M A;  4JHN A;  3RLM D;  3JAM g;  4ERY A;  2EIE A;  2P9N C;  4H5J A;  4J81 A;  4MMZ A;  4FA1 D;  3IKO A;  1UTC A;  4BP9 A;  3J81 g;  5AJA A;  4A09 B;  2H14 A;  3GC3 B;  3KRX B;  3UKR C;  4O2W A;  4K3I D;  5IGQ A;  4DNV A;  4A08 A;  1PGU A;  2I0T A;  3SJL D;  5I5M A;  3EI2 B;  2XYI A;  1MG2 A;  4J79 A;  5C2V B;  2XL3 A;  1I2M B;  1TYQ C;  1A12 A;  1GOG A;  2YMU A;  4FWW A;  2I0R A;  3OKY B;  4QAM A;  5H17 A;  5M61 A;  2Z2O A;  1JJU B;  3FM0 A;  1XHM A;  3EI4 B;  1JMZ B;  4E54 A;  4QT8 A;  4WK2 A;  4IRZ A;  3JRP A;  3V5W B;  4RE5 A;  4A11 A;  1GG2 B;  4D0K A;  2H6Q A;  4PSW B;  4FAV D;  3IUJ A;  4X61 B;  5IC7 A;  3V7D B;  1GP2 B;  4CC9 A;  4R7A B;  5IT9 g;  4J0W A;  4J86 A;  4O3T B;  4G55 A;  1QNI A;  4Y5R D;  2VDO A;  2HJB A;  3EI3 A;  3EQ7 A;  3FRX A;  1UOQ A;  2I3S A;  4O9D A;  1ERJ A;  4J0X A;  4ERQ A;  2VDL A;  1VZ2 A;  5TEF A;  3FCU A;  4ZN4 A;  3JZH A;  4AEZ A;  3OW8 A;  3BG1 A;  3JRO A;  5EAM A;  3MZL A;  2GC4 A;  2PM9 A;  1C9L A;  2VZ1 A;  5CXB A;  3SBP A;  3OKW A;  5HE2 B;  4E5Z B;  3C5M A;  3DXM C;  2HU8 A;  2H6K A;  3F3G A;  3FGB A;  4JHP C;  4J78 A;  3K6S A;  4J77 A;  1PI6 A;  3RFH A;  3EMH A;  3I7N A;  3I7O A;  4N14 A;  3IJ0 A;  3SHF A;  1UOP A;  4K3J B;  3UKU C;  1M1X A;  3IUL A;  5AFU 3;  4WK4 A;  4A09 A;  2VDP A;  4FA9 D;  1U4C A;  1N6D A;  2P9K C;  4L3H D;  3V9F A;  2H9M A;  4CZV A;  4BCC A;  3I7L A;  2QR5 A;  2W18 A;  5B4W A;  2CN2 A;  3F3F A;  5TF2 A;  4PC0 A;  3OKY A;  5C2W B;  5IJ8 E;  4O1Q D;  2AGY A;  1B9Y A;  3U4Y A;  1K3I A;  3PVU B;  3O4G A;  3N0E A;  2HKM A;  3EQ8 A;  1OMW B;  1GOF A;  4J82 A;  4Z7N A;  4O3U B;  4J8B A;  1B9X A;  4BCD A;  4U7A A;  1H2W A;  1BPO A;  3PVW B;  2O9K A;  4A2M A;  3A0F A;  4A0A B;  3MKS B;  1H2Z A;  4G56 B;  3BWS A;  4PSX B;  4CI1 A;  1XIP A;  3SFZ A;  1K8K C;  3ORV D;  1YFQ A;  3UVO A;  3ULE C;  4A0B B;  2YNN A;  3AH8 B;  4Z7Q A;  4QRJ A;  5EMK B;  1K32 A;  3NIF A;  2H9L A;  2B5M A;  3K27 A;  5FFG A;  2CO0 A;  2XDW A;  3ZDX A;  4UM9 A;  4E5Z A;  3PXS D;  4UM8 A;  5CYK A;  5GXH A;  1R5M A;  5HDB A;  5IGO A;  4Z7O A;  5FLX g;  4WJK A;  2AH0 A;  5A2Q g;  3C99 A;  4A7J A;  3MVD K;  5GMK n;  5C9Z B;  4GGC A;  3NIG A;  2H47 A;  3EQ9 A;  2EIB A;  3J80 g;  4A2L A;  4QQE A;  3F3P A;  1MG3 A;  4JT5 C;  4CI8 A;  2PM6 B;  4ZOZ A;  4ERZ A;  1PEV A;  2BKL A;  4FB1 D;  3OL2 A;  2XE4 A;  2IUQ A;  2OVP B;  2UZX B;  4CI3 A;  5HE1 B;  3I7H A;  4GQB B;  4OWR A;  3KRW B;  1E8N A;  2AH1 A;  2HES X;  1FWX A;  5I5I A;  1C9I A;  3T3M A;  3I7P A;  2P9I C;  3SBR A;  5TDH B;  2H9P A;  1UOO A;  2AQ5 A;  3BG0 A;  4MMY A;  4BH6 A;  4D9S A;  2IUV A;  2BCJ B;  3ZDZ A;  3VGZ A;  3IJC A;  4JD2 C;  1E5T A;  3AL8 A;  3DM0 A;  5EAP A;  4YVD A;  4NC4 A;  5K19 A;  5EMJ B;  1SQJ A;  5HE0 B;  2VDN A;  3MZK A;  3NVN A;  3OKT A;  4RE6 A;  2B5N A;  3EI1 B;  2MTA H;  5EM2 B;  3ZE1 A;  4NBM A;  3IJE A;  3PXW D;  4CI2 A;  1N6F A;  1L0Q A;  3DXK C;  2IAA A;  2IWF A;  2XZG A;  5AMS A;  3C75 H;  3SXT D;  3IUR A;  5CXC A;  4X63 B;  2YNO A;  2UZY B;  2OJY A;  4ZOX A;  1VYH C;  5FKS A;  4FAN D;  2PBI B;  1VZ3 A;  3AL9 A;  3K71 A;  1S4U X;  4L9O A;  4L3G D;  1O6F A;  1TBG A;  3GD1 I;  2CNX A;  2BBK H;  5KDO B;  1YR2 A;  3GFC A;  3EU7 A;  4HDJ A;  2HXC A;  3SMR A;  2Q7Q A;  3CFS B;  1JV2 A;  1SHY B;  5E6S A;  3I7K A;  3JZG A;  4PBY A;  5THA A;  4H5I A;  1P22 A;  4CZX A;  2GNQ A;  3K26 A;  4JXM A;  1E8M A;  3VA6 A;  3EI2 A;  1U8C A;  2VDK A;  5TEE A;  4Z8L A;  2HU5 A;  5C92 A;  3VH0 A;  2CE8 A;  5EAL A;  3I8E A;  2J57 G;  4ZOV A;  1TYE A;  2P9S C;  3HFQ A;  4WK0 A;  3EI4 A;  5EML B;  5HE3 B;  4DNU A;  2VDQ A;  3ODT A;  3RMZ D;  4A08 B;  2CN3 A;  4ZOY A;  2GC7 A;  3IJ1 A;  1GOT B;  1VE6 A;  5M5R A;  3C9C A;  1QFS A;  5I5J A;  3I89 A; 
#chains in the Genus database with same CATH homology
 4Y7R A;  3SN6 B;  2AGW A;  3MMY A;  2H13 A;  4A11 B;  3NVX A;  2YBA A;  5EM2 A;  2P9P C;  5K1C C;  3UVK A;  5FA5 B;  3EI3 B;  2TRC B;  4GGA A;  2B4E A;  2P9L C;  3AFC A;  4GM3 A;  4GM9 A;  2HYE A;  4IMM A;  2I0S A;  3RRM C;  4JSX C;  5FQD A;  4PXW A;  2B5L A;  4PNK B;  2PM7 B;  3DWL C;  4I79 A;  3SBQ A;  4GQ1 A;  4CY3 A;  3JB9 L;  3B7F A;  3DSM A;  5FKQ A;  2PM9 B;  1OLZ A;  3PSC B;  5CXB B;  5FKR A;  2OIZ A;  5EAR A;  4XEI C;  3I8C A;  4U1E I;  1XKS A;  2I3T A;  3IIY A;  1U2V C;  4JSP C;  2H68 A;  2IUP A;  3JPX A;  3ZWL B;  3CIK B;  4CY5 A;  5JWZ A;  4FA4 D;  4PBZ A;  4ES0 A;  1N6E A;  3IIW A;  4LG8 A;  1NEX B;  3L4M D;  4A0A A;  3CFV A;  2OVQ B;  1JMX B;  4X3E A;  4QL1 A;  3EG6 A;  1SQ9 A;  4FA5 D;  4O45 A;  2QC5 A;  4JSV C;  2P9U C;  3L4O D;  2AGZ A;  3UVM A;  3SLE D;  4A0B A;  4TZ4 A;  3MXX A;  5H1M A;  4CY1 A;  2HJ4 A;  3UR4 A;  3W15 A;  4OZU A;  4AOW A;  4ESG A;  4FHL A;  2G99 A;  4J8G A;  3SWS D;  5FKT A;  4JSN C;  4BUJ C;  4JT6 C;  3SVW D;  2OK4 A;  3UVN A;  1JOF A;  3PE7 A;  4J73 A;  2J55 H;  5SXM A;  4LG9 A;  4J84 A;  2XL2 A;  3UVL A;  5FXY A;  5CYK B;  4D6V A;  2EBS A;  4GQ2 P;  4X60 B;  1GXR A;  2Z2P A;  5GXI A;  3RFG A;  1RI6 A;  2CO0 C;  3PSL A;  2H3X A;  3JZN A;  4EWR A;  2CE9 A;  4UI9 R;  2G9A A;  4GGD A;  3NVQ A;  4J87 A;  2IWK A;  4NSX A;  3OL2 B;  3OTT A;  2XU7 A;  4IA9 A;  4KFM B;  2HKR A;  2IUR A;  5GSA A;  3MKQ A;  4E54 B;  2H6N A;  3I2N A;  1Q47 A;  3EWE A;  5H14 A;  5HYN B;  2Z2N A;  4MK0 B;  3EI1 A;  4GMB A;  2YNP A;  2YB8 B;  3RN1 D;  2AGX A;  1NR0 A;  5EMM B;  3SCY A;  3E0C A;  3AL8 B;  3PXT D;  4XYH A;  4CY2 A;  2H9N A;  4CZY A;  5HQG A;  3P4F A;  4LGN A;  2OK6 A;  4BL0 A;  1A0R B;  5IJ7 E;  3RN0 D;  2QXV A;  4L1Q D;  4XYI A;  2J56 H;  3GRE A;  1PBY B;  5CXC B;  3RSE C;  4GM8 A;  2OVR B;  3N0D A;  4GZ8 A;  1MDA H;  2AGL A;  3RLM D;  3JAM g;  4ERY A;  2P9N C;  4H5J A;  4J81 A;  4FA1 D;  3IKO A;  3J81 g;  5AJA A;  4A09 B;  2H14 A;  3KRX B;  3UKR C;  4K3I D;  5IGQ A;  4A08 A;  1PGU A;  2I0T A;  3SJL D;  5I5M A;  3EI2 B;  2XYI A;  1MG2 A;  4J79 A;  5C2V B;  2XL3 A;  1TYQ C;  2YMU A;  5H17 A;  4FWW A;  2I0R A;  3OKY B;  2Z2O A;  1JJU B;  3FM0 A;  1XHM A;  3EI4 B;  1JMZ B;  4E54 A;  4QT8 A;  3JRP A;  3V5W B;  4A11 A;  1GG2 B;  4D0K A;  2H6Q A;  4PSW B;  4FAV D;  4X61 B;  5IC7 A;  3V7D B;  1GP2 B;  4CC9 A;  4R7A B;  5IT9 g;  4J0W A;  4J86 A;  4O3T B;  1QNI A;  4Y5R D;  2HJB A;  3EI3 A;  3FRX A;  2I3S A;  4O9D A;  1ERJ A;  4J0X A;  4ERQ A;  5TEF A;  4ZN4 A;  3JZH A;  4AEZ A;  3OW8 A;  3BG1 A;  3JRO A;  5EAM A;  3MZL A;  2GC4 A;  2PM9 A;  5CXB A;  3SBP A;  3OKW A;  5HE2 B;  4E5Z B;  3C5M A;  3DXM C;  3F3G A;  2H6K A;  3FGB A;  4J78 A;  4J77 A;  1PI6 A;  3RFH A;  3EMH A;  3I7N A;  3I7O A;  4N14 A;  3IJ0 A;  3SHF A;  4K3J B;  3UKU C;  5AFU 3;  4A09 A;  4FA9 D;  1U4C A;  1N6D A;  2P9K C;  4L3H D;  3V9F A;  2H9M A;  4CZV A;  3I7L A;  2W18 A;  5B4W A;  2CN2 A;  3F3F A;  5TF2 A;  4PC0 A;  3OKY A;  5C2W B;  5IJ8 E;  4O1Q D;  2AGY A;  1B9Y A;  3U4Y A;  3PVU B;  3N0E A;  2HKM A;  1OMW B;  4J82 A;  4O3U B;  4J8B A;  1B9X A;  4U7A A;  3PVW B;  2O9K A;  4A2M A;  3A0F A;  4A0A B;  3MKS B;  4G56 B;  3BWS A;  4PSX B;  4CI1 A;  1XIP A;  3SFZ A;  1K8K C;  3ORV D;  1YFQ A;  3UVO A;  3ULE C;  4A0B B;  2YNN A;  3AH8 B;  4QRJ A;  5EMK B;  1K32 A;  2H9L A;  2B5M A;  3K27 A;  2CO0 A;  4E5Z A;  3PXS D;  5CYK A;  5GXH A;  1R5M A;  5IGO A;  5FLX g;  2AH0 A;  5A2Q g;  3C99 A;  4A7J A;  5GMK n;  5C9Z B;  4GGC A;  2H47 A;  3J80 g;  4A2L A;  4QQE A;  3F3P A;  1MG3 A;  4JT5 C;  4CI8 A;  2PM6 B;  4ZOZ A;  4ERZ A;  1PEV A;  4FB1 D;  3OL2 A;  2IUQ A;  2OVP B;  2UZX B;  4CI3 A;  5HE1 B;  3I7H A;  4GQB B;  4OWR A;  3KRW B;  2AH1 A;  2HES X;  1FWX A;  5I5I A;  3I7P A;  2P9I C;  3SBR A;  5TDH B;  2H9P A;  2AQ5 A;  3BG0 A;  4BH6 A;  2IUV A;  2BCJ B;  3VGZ A;  3IJC A;  4JD2 C;  3DM0 A;  3AL8 A;  5EAP A;  4YVD A;  5K19 A;  5EMJ B;  1SQJ A;  5HE0 B;  3MZK A;  3NVN A;  3OKT A;  2B5N A;  3EI1 B;  2MTA H;  5EM2 B;  3PXW D;  4CI2 A;  1N6F A;  1L0Q A;  3DXK C;  2IAA A;  2IWF A;  5AMS A;  3C75 H;  3SXT D;  5CXC A;  4X63 B;  2YNO A;  2UZY B;  2OJY A;  4ZOX A;  1VYH C;  5FKS A;  4FAN D;  2PBI B;  3AL9 A;  1S4U X;  4L9O A;  4L3G D;  1TBG A;  2CNX A;  2BBK H;  5KDO B;  3GFC A;  3EU7 A;  4HDJ A;  2HXC A;  3SMR A;  2Q7Q A;  3CFS B;  1SHY B;  3I7K A;  3JZG A;  4PBY A;  5THA A;  4H5I A;  1P22 A;  4CZX A;  2GNQ A;  3K26 A;  4JXM A;  3VA6 A;  3EI2 A;  5TEE A;  4Z8L A;  3VH0 A;  2CE8 A;  5EAL A;  3I8E A;  2J57 G;  4ZOV A;  2P9S C;  3HFQ A;  3EI4 A;  5EML B;  5HE3 B;  3ODT A;  3RMZ D;  4A08 B;  2CN3 A;  4ZOY A;  2GC7 A;  3IJ1 A;  1GOT B;  3C9C A;  5I5J A;  3I89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...