4J86A

Crystal structure of beta'-cop/ywbp1 complex
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
301
structure length
301
Chain Sequence
MKLDIKKTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVEIWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Coatomer subunit beta'
publication title Rules for the recognition of dilysine retrieval motifs by coatomer.
pubmed doi rcsb
total genus 88
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4j86A01
2I0SA 5K1CC 5KDOB 5IJ8E 3UVLA 4LG9A 2J55H 3RN1D 3JAMg 4JSPC 3UVMA 2CN2A 1PBYB 3V5WB 1TBGA 2CO0C 2PM9B 4ZOZA 1QNIA 3CIKB 5HQGA 4UI9R 1GXRA 2Z2NA 4GQBB 3FGBA 2HYEA 3SCYA 3NVNA 4CI8A 5TDHB 3L4MD 4J79A 3SWSD 3MZKA 3DSMA 2B5LA 4J0XA 2BCJB 2XU7A 4U1EI 3E0CA 4X61B 2J57G 3OW8A 2H6NA 5C2VB 3AL9A 1U4CA 4O45A 3JPXA 4CZYA 3EI1A 5AJAA 1OMWB 2I3SA 2PM6B 2G99A 4TZ4A 4A7JA 4O1QD 3JB9L 2UZXB 3SBQA 2GNQA 5CXBA 5I5JA 4R7AB 4L3HD 3PE7A 3W15A 4AOWA 5H17A 3B7FA 3OTTA 4FAVD 4QRJA 3RN0D 3SHFA 2H9MA 4ERYA 3I7PA 2AGLA 4IMMA 3KRWB 5FKQA 3I7NA 3SJLD 3SVWD 2YNOA 3RMZD 2H47A 4A2LA 4CY2A 4FA9D 4A0AA 1XIPA 3EU7A 3ODTA 5I5MA 5SXMA 2YNPA 4E54B 4A09B 2O9KA 3K27A 4G56B 5EAPA 3V7DB 3SXTD 5GXHA 2J56H 4GQ1A 3C9CA 3AH8B 5FQDA 3MMYA 2OK4A 5K19A 3OL2A 2XYIA 5IGOA 1Q47A 4CY3A 2I3TA 4XEIC 2GC4A 4Y7RA 5FKRA 3UKRC 1P22A 3PXWD 2H13A 3SN6B 5GXIA 1R5MA 3EG6A 3OKTA 1SHYB 4J87A 2H6QA 5TEFA 3ULEC 4JSVC 2IAAA 4O3TB 4L1QD 4O9DA 5IJ7E 3OKWA 2B4EA 4I79A 3I8EA 2AH1A 2QXVA 4GM3A 4CI1A 1GG2B 5TEEA 4JSNC 4ERQA 4N14A 1MG2A 4PNKB 2OVQB 1JJUB 3EI2B 3JZHA 2GC7A 2AGXA 2AGWA 2HKRA 3C75H 4JT5C 4FHLA 4H5IA 3IIYA 3OKYA 3PXTD 3JRPA 3MZLA 2IUPA 3DM0A 5IGQA 3F3GA 2G9AA 4FA5D 5EALA 4X63B 2OIZA 2PM9A 3AFCA 3EWEA 4J0WA 3DXMC 5FKSA 5HE1B 2UZYB 4CY1A 3I8CA 4J84A 3ZWLB 1NEXB 5EARA 4LGNA 2TRCB 4GQ2P 4K3JB 3GREA 4FWWA 3DWLC 1N6EA 5CXCB 4YVDA 4J77A 2P9NC 5CYKB 4PSXB 1OLZA 4HDJA 3PVWB 5I5IA 2HESX 4QT8A 4D6VA 4A11B 5C2WB 2H14A 3PXSD 5B4WA 1N6DA 3SBPA 4JXMA 4A0BB 4A08B 3IJ1A 3L4OD 3MXXA 2OK6A 5H1MA 3IKOA 1S4UX 3FM0A 3V9FA 1MDAH 4ES0A 3EI4B 2MTAH 3CFVA 3ORVD 3BWSA 2P9SC 3JROA 1K32A 3F3FA 4A2MA 3AL8B 4L9OA 3MKQA 4A08A 5FXYA 4U7AA 4J78A 3P4FA 3N0DA 4XYHA 4GM9A 1K8KC 2XL3A 2IUQA 3EI4A 2PM7B 3I7HA 1FWXA 2B5MA 1JOFA 2EBSA 5EAMA 2P9PC 3GFCA 4X3EA 3PVUB 1JMXB 5EMJB 3RLMD 3BG0A 3EI3B 2HXCA 1GOTB 2H9PA 3IJ0A 3UVOA 3U4YA 3RRMC 4BH6A 4ZOVA 4E54A 1MG3A 4A09A 1B9XA 2HJ4A 3RFGA 3I89A 1ERJA 1YFQA 2YB8B 3PSLA 4L3GD 3UVNA 4ZN4A 1PI6A 4PBYA 1NR0A 5EM2B 4J82A 2P9LC 4J73A 2Q7QA 5A2Qg 3BG1A 3I7OA 2H3XA 5HYNB 3HFQA 4FAND 4J8GA 5HE3B 3SFZA 4CC9A 5EM2A 1L0QA 4QQEA 4ERZA 1SQ9A 4ZOYA 4CZXA 4MK0B 4J81A 4FA4D 5C9ZB 1VYHC 5THAA 2CO0A 5AFU3 2P9IC 4O3UB 5H14A 3EI2A 2P9UC 5TF2A 2HJBA 3VH0A 4XYIA 2CN3A 3MKSB 2QC5A 4GZ8A 2IWKA 4PSWB 2IURA 4X60B 1XKSA 2CE8A 2PBIB 5FKTA 4IA9A 4H5JA 4BUJC 2IUVA 3J80g 3SMRA 2OVPB 2BBKH 4AEZA 4EWRA 3EI1B 3JZGA 3I2NA 2YBAA 2AQ5A 4GMBA 2OVRB 2AH0A 3I7KA 1GP2B 4JSXC 5HE2B 3FRXA 2AGZA 2B5NA 1JMZB 4PBZA 5CXBB 4GGAA 2P9KC 4NSXA 2YMUA 3C99A 5IT9g 5CXCA 5EMKB 3IJCA 5CYKA 4GGDA 3DXKC 3RFHA 4QL1A 3C5MA 3N0EA 4J8BA 3EMHA 1N6FA 4A11A 3J81g 4BL0A 1SQJA 2IWFA 2I0RA 4J86A 3UKUC 4A0BA 4A0AB 1U2VC 4Z8LA 5FLXg 4JD2C 4GGCA 4CY5A 4OWRA 4GM8A 4CI3A 3NVXA 5EMMB 3IIWA 4FB1D 4FA1D 3NVQA 2CNXA 2AGYA 3AL8A 5JWZA 3OL2B 1TYQC 4E5ZB 3K26A 2I0TA 4PC0A 1XHMA 4K3ID 5IC7A 2OJYA 2H9LA 3VA6A 2HKMA 4Y5RD 2H68A 3SLED 4ZOXA 1PGUA 1B9YA 3EI3A 3SBRA 2YNNA 3KRXB 5AMSA 4E5ZA 2Z2PA 3A0FA 2H9NA 3F3PA 3JZNA 4PXWA 3RSEC 2H6KA 4ESGA 5GSAA 5FA5B 3PSCB 2XL2A 3I7LA 4KFMB 1RI6A 4JT6C 4LG8A 2W18A 5EMLB 1PEVA 3UVKA 2CE9A 3VGZA 5HE0B 4CI2A 4CZVA 3UR4A 5GMKn 4D0KA 2Z2OA 1A0RB 4OZUA 3CFSB 3OKYB
chains in the Genus database with same CATH superfamily
2I0SA 5K1CC 5KDOB 5IJ8E 3UVLA 4LG9A 2J55H 3RN1D 3JAMg 4JSPC 3UVMA 2CN2A 1PBYB 3V5WB 1TBGA 2CO0C 2PM9B 4ZOZA 1QNIA 3CIKB 5HQGA 4UI9R 4BCDA 1GXRA 4L1MA 2Z2NA 4GQBB 3FGBA 2HYEA 3SCYA 3EQ8A 3NVNA 4CI8A 3FCUA 5TDHB 3L4MD 4J79A 3SWSD 3MZKA 3DSMA 2B5LA 4J0XA 2BCJB 2XU7A 4JHNA 4U1EI 4MMYA 3E0CA 4X61B 3IUQA 2J57G 3OW8A 2H6NA 4WK0A 5C2VB 1GOHA 3AL9A 1U4CA 4O45A 3JPXA 4CZYA 3EI1A 2JKXA 3GD1I 5AJAA 1OMWB 2I3SA 5M5TA 4MMXA 2QR5A 2PM6B 3V4PA 3ZE2A 2G99A 4TZ4A 4A7JA 4O1QD 3JB9L 2UZXB 3SBQA 2GNQA 5CXBA 4AMZA 5I5JA 4R7AB 4L3HD 3PE7A 3W15A 4AOWA 5H17A 3B7FA 3OTTA 4FAVD 3DDUA 4O2WA 4QRJA 2EIBA 3RN0D 4NBMA 2H9MA 3SHFA 3I7PA 4ERYA 3ZDYA 4NC4A 3OF7A 2AGLA 4IMMA 3KRWB 5FKQA 3I7NA 3SJLD 3SVWD 2YNOA 4DNVA 3RMZD 2H47A 4A2LA 4CY2A 4FA9D 4A0AA 1XIPA 3EU7A 3ODTA 5I5MA 5SXMA 3EQ7A 2YNPA 4E54B 4A09B 2O9KA 3K27A 4G56B 5EAPA 3V7DB 5HDBA 3SXTD 2EICA 1JTDB 2J56H 4D9SA 4GQ1A 4Z7NA 5GXHA 3C9CA 3AH8B 5FQDA 3MMYA 2OK4A 5K19A 3OL2A 2XYIA 5IGOA 1Q47A 4CY3A 2VDLA 2I3TA 4XEIC 2GC4A 1U8CA 4Y7RA 5FKRA 3UKRC 1P22A 3PXWD 2H13A 3SN6B 5GXIA 4G1MA 3IVMA 1R5MA 3EG6A 3OKTA 1SHYB 4J87A 3ZE0A 1UOQA 2H6QA 5TEFA 3ULEC 4JSVC 2IAAA 4O3TB 4L1QD 4O9DA 4RE6A 5IJ7E 3FCSA 3OKWA 2B4EA 4I79A 3I8EA 2AH1A 2QXVA 5M5VA 4GM3A 1K3IA 4CI1A 1GG2B 2VDMA 2VDNA 5TEEA 3VI4A 3T3MA 4WK4A 4JSNC 4ERQA 4N14A 1MG2A 4PNKB 2OVQB 1JJUB 3EI2B 3JZHA 2GC7A 2AGXA 2BKLA 2AGWA 1JV2A 2HKRA 3C75H 4JT5C 4AX4A 4FHLA 4H5IA 3IIYA 3OKYA 2VDOA 3PXTD 3JRPA 3MZLA 2IUPA 1YR2A 3QHYB 3MUNA 3DM0A 2EIDA 5IGQA 3F3GA 2G9AA 4FA5D 3O4JA 1TYEA 5EALA 4X63B 2OIZA 2PM9A 3AFCA 3EWEA 1GOGA 4AN1A 4J0WA 5E6SA 3DXMC 5FKSA 5HE1B 2UZYB 4CY1A 3EQ9A 3I8CA 4J84A 3ZWLB 1NEXB 5EARA 4LGNA 2VZ3A 2TRCB 3O4GA 4GQ2P 1GOFA 4K3JB 4DNUA 3MUOA 3GREA 4FWWA 3DWLC 1N6EA 5CXCB 4YVDA 4J77A 2P9NC 5CYKB 4PSXB 1OLZA 4HDJA 3PVWB 5I5IA 3NIDA 2XZGA 2HESX 4QT8A 3K6SA 4D6VA 4A11B 5C2WB 1E5TA 2H14A 3PXSD 5B4WA 1N6DA 3SBPA 4JXMA 4A0BB 4A08B 3IJ1A 1QFMA 3L4OD 3MXXA 1H2ZA 2OK6A 4UM8A 3IKOA 5H1MA 1H2XA 1S4UX 3FM0A 3V9FA 1MDAH 4ES0A 3EI4B 2MTAH 3CFVA 3ORVD 2VDQA 3BWSA 3IJEA 2P9SC 1BPOA 3JROA 1K32A 3F3FA 4A2MA 3AL8B 4L9OA 2XDWA 3MKQA 4A08A 5FXYA 4BP8A 4AN0A 4U7AA 4J78A 3P4FA 3N0DA 4XYHA 4GM9A 1K8KC 2XL3A 2IUQA 3EI4A 5FFOA 2PM7B 3I7HA 1FWXA 2B5MA 3NIGA 1JOFA 2EBSA 5EAMA 3K72A 2P9PC 3GFCA 4X3EA 3PVUB 1JMXB 5EMJB 3RLMD 3BG0A 3EI3B 2HXCA 1GOTB 2H9PA 3IJ0A 3UVOA 1O6FA 3U4YA 3VI3A 3RRMC 4BH6A 2HU8A 4ZOVA 4G1EA 1MG3A 4E54A 4A09A 1B9XA 2HJ4A 3RFGA 3I89A 1ERJA 1YFQA 2YB8B 3PSLA 4L3GD 3IUNA 4BCBA 2HU5A 4IRZA 3UVNA 4ZN4A 1PI6A 4PBYA 4NENA 5C92A 1NR0A 5EM2B 4J82A 2P9LC 4J73A 2Q7QA 5A2Qg 1VE7A 3K71A 3BG1A 3I7OA 3O4HA 2H3XA 3T3PA 5HYNB 3HFQA 1VZ2A 2XE4A 5E6RA 2HU7A 4FAND 4J8GA 5HE3B 1M1XA 3SFZA 4CC9A 1C9LA 4O02A 5EM2A 1L0QA 5FFGA 4QQEA 4WK2A 4ERZA 1SQ9A 4ZOYA 1QFSA 4CZXA 4MK0B 4J81A 4FA4D 4NAAA 5C9ZB 1VYHC 5THAA 3ZE1A 1UTCA 1UOPA 3KCIA 1VZ3A 2VDRA 2CO0A 5AFU3 2P9IC 4O3UB 5H14A 3EI2A 2P9UC 3GC3B 5M5SA 5TF2A 2HJBA 4Z7OA 3VH0A 4XYIA 2CN3A 3MKSB 2QC5A 4GZ8A 2IWKA 4PSWB 1T2XA 4MMZA 1A12A 2IURA 4X60B 1XKSA 2CE8A 2PBIB 5C86A 5FKTA 4IA9A 4H5JA 5M5RA 4BUJC 2IUVA 3ZDZA 3SMRA 3J80g 5E6UA 1C9IA 2OVPB 2BBKH 4DNWA 4AEZA 4EWRA 3EI1B 3JZGA 3I2NA 2YBAA 2AQ5A 4BP9A 4GMBA 1L5GA 2OVRB 2AH0A 4AMYA 4WJKA 3I7KA 4UM9A 1GP2B 4JSXC 5HE2B 3FRXA 2AGZA 2B5NA 2VZ1A 1JMZB 3QI0A 4PBZA 5CXBB 4GGAA 4G55A 2P9KC 4NSXA 2YMUA 3IULA 5M5UA 3ZDXA 3C99A 4JHPC 5IT9g 5CXCA 5EMKB 3NIFA 3IJCA 5CYKA 4GGDA 3DXKC 3RFHA 5M61A 4QL1A 3C5MA 1H2WA 3N0EA 4J8BA 3EMHA 1N6FA 4A11A 3J81g 4BL0A 1SQJA 2WQ8A 2IWFA 2I0RA 4J86A 1E8NA 3UKUC 4A0BA 2EIEA 4A0AB 1U2VC 4Z8LA 4BCCA 5FLXg 4JD2C 4GGCA 4CY5A 4OWRA 4GM8A 4CI3A 3IURA 1UOOA 3NVXA 4QAMA 5EMMB 3IIWA 1O6GA 4FA1D 4FB1D 3NVQA 3O4IA 2AGYA 2CNXA 3AL8A 2QZPA 3MVDK 5JWZA 1I2MB 3OL2B 2VC2A 1TYQC 4E5ZB 3K26A 2I0TA 4PC0A 1XHMA 4K3ID 5IC7A 2OJYA 2H9LA 3VA6A 2HKMA 4RE5A 4Y5RD 2H68A 3SLED 4ZOXA 1PGUA 1B9YA 3EI3A 2VDPA 3IUJA 3SBRA 2YNNA 1VE6A 3KRXB 5AMSA 4E5ZA 2Z2PA 3V4VA 3A0FA 2H9NA 3F3PA 3JZNA 4PXWA 3RSEC 1E8MA 2H6KA 4ESGA 5GSAA 5FA5B 3PSCB 2XL2A 3I7LA 4KFMB 1RI6A 4JT6C 4LG8A 2W18A 5EMLB 1PEVA 3UVKA 2CE9A 3VGZA 5HE0B 4CI2A 4CZVA 3UR4A 5GMKn 4D0KA 4Z7QA 1H2YA 2Z2OA 1A0RB 2VDKA 4OZUA 3IUMA 3CFSB 3OKYB
chains in the Genus database with same CATH topology
2I0SA 5K1CC 5KDOB 5IJ8E 3UVLA 4LG9A 2J55H 3RN1D 3JAMg 4JSPC 3UVMA 2CN2A 1PBYB 3V5WB 1TBGA 2CO0C 2PM9B 4ZOZA 1QNIA 3CIKB 5HQGA 4UI9R 1GXRA 2Z2NA 4GQBB 3FGBA 2HYEA 3SCYA 3NVNA 4CI8A 5TDHB 3L4MD 4J79A 3SWSD 3MZKA 3DSMA 2B5LA 4J0XA 2BCJB 2XU7A 4U1EI 3E0CA 4X61B 2J57G 3OW8A 2H6NA 5C2VB 3AL9A 1U4CA 4O45A 3JPXA 4CZYA 3EI1A 5AJAA 1OMWB 2I3SA 2PM6B 2G99A 4TZ4A 4A7JA 4O1QD 3JB9L 2UZXB 3SBQA 2GNQA 5CXBA 5I5JA 4R7AB 4L3HD 3PE7A 3W15A 4AOWA 5H17A 3B7FA 3OTTA 4FAVD 4QRJA 3RN0D 3SHFA 2H9MA 4ERYA 3I7PA 2AGLA 4IMMA 3KRWB 5FKQA 3I7NA 3SJLD 3SVWD 2YNOA 3RMZD 2H47A 4A2LA 4CY2A 4FA9D 4A0AA 1XIPA 3EU7A 3ODTA 5I5MA 5SXMA 2YNPA 4E54B 4A09B 2O9KA 3K27A 4G56B 5EAPA 3V7DB 3SXTD 5GXHA 2J56H 4GQ1A 3C9CA 3AH8B 5FQDA 3MMYA 2OK4A 5K19A 3OL2A 2XYIA 5IGOA 1Q47A 4CY3A 2I3TA 4XEIC 2GC4A 4Y7RA 5FKRA 3UKRC 1P22A 3PXWD 2H13A 3SN6B 5GXIA 1R5MA 3EG6A 3OKTA 1SHYB 4J87A 2H6QA 5TEFA 3ULEC 4JSVC 2IAAA 4O3TB 4L1QD 4O9DA 5IJ7E 3OKWA 2B4EA 4I79A 3I8EA 2AH1A 2QXVA 4GM3A 4CI1A 1GG2B 5TEEA 4JSNC 4ERQA 4N14A 1MG2A 4PNKB 2OVQB 1JJUB 3EI2B 3JZHA 2GC7A 2AGXA 2AGWA 2HKRA 3C75H 4JT5C 4FHLA 4H5IA 3IIYA 3OKYA 3PXTD 3JRPA 3MZLA 2IUPA 3DM0A 5IGQA 3F3GA 2G9AA 4FA5D 5EALA 4X63B 2OIZA 2PM9A 3AFCA 3EWEA 4J0WA 3DXMC 5FKSA 5HE1B 2UZYB 4CY1A 3I8CA 4J84A 3ZWLB 1NEXB 5EARA 4LGNA 2TRCB 4GQ2P 4K3JB 3GREA 4FWWA 3DWLC 1N6EA 5CXCB 4YVDA 4J77A 2P9NC 5CYKB 4PSXB 1OLZA 4HDJA 3PVWB 5I5IA 2HESX 4QT8A 4D6VA 4A11B 5C2WB 2H14A 3PXSD 5B4WA 1N6DA 3SBPA 4JXMA 4A0BB 4A08B 3IJ1A 3L4OD 3MXXA 2OK6A 5H1MA 3IKOA 1S4UX 3FM0A 3V9FA 1MDAH 4ES0A 3EI4B 2MTAH 3CFVA 3ORVD 3BWSA 2P9SC 3JROA 1K32A 3F3FA 4A2MA 3AL8B 4L9OA 3MKQA 4A08A 5FXYA 4U7AA 4J78A 3P4FA 3N0DA 4XYHA 4GM9A 1K8KC 2XL3A 2IUQA 3EI4A 2PM7B 3I7HA 1FWXA 2B5MA 1JOFA 2EBSA 5EAMA 2P9PC 3GFCA 4X3EA 3PVUB 1JMXB 5EMJB 3RLMD 3BG0A 3EI3B 2HXCA 1GOTB 2H9PA 3IJ0A 3UVOA 3U4YA 3RRMC 4BH6A 4ZOVA 4E54A 1MG3A 4A09A 1B9XA 2HJ4A 3RFGA 3I89A 1ERJA 1YFQA 2YB8B 3PSLA 4L3GD 3UVNA 4ZN4A 1PI6A 4PBYA 1NR0A 5EM2B 4J82A 2P9LC 4J73A 2Q7QA 5A2Qg 3BG1A 3I7OA 2H3XA 5HYNB 3HFQA 4FAND 4J8GA 5HE3B 3SFZA 4CC9A 5EM2A 1L0QA 4QQEA 4ERZA 1SQ9A 4ZOYA 4CZXA 4MK0B 4J81A 4FA4D 5C9ZB 1VYHC 5THAA 2CO0A 5AFU3 2P9IC 4O3UB 5H14A 3EI2A 2P9UC 5TF2A 2HJBA 3VH0A 4XYIA 2CN3A 3MKSB 2QC5A 4GZ8A 2IWKA 4PSWB 2IURA 4X60B 1XKSA 2CE8A 2PBIB 5FKTA 4IA9A 4H5JA 4BUJC 2IUVA 3J80g 3SMRA 2OVPB 2BBKH 4AEZA 4EWRA 3EI1B 3JZGA 3I2NA 2YBAA 2AQ5A 4GMBA 2OVRB 2AH0A 3I7KA 1GP2B 4JSXC 5HE2B 3FRXA 2AGZA 2B5NA 1JMZB 4PBZA 5CXBB 4GGAA 2P9KC 4NSXA 2YMUA 3C99A 5IT9g 5CXCA 5EMKB 3IJCA 5CYKA 4GGDA 3DXKC 3RFHA 4QL1A 3C5MA 3N0EA 4J8BA 3EMHA 1N6FA 4A11A 3J81g 4BL0A 1SQJA 2IWFA 2I0RA 4J86A 3UKUC 4A0BA 4A0AB 1U2VC 4Z8LA 5FLXg 4JD2C 4GGCA 4CY5A 4OWRA 4GM8A 4CI3A 3NVXA 5EMMB 3IIWA 4FB1D 4FA1D 3NVQA 2CNXA 2AGYA 3AL8A 5JWZA 3OL2B 1TYQC 4E5ZB 3K26A 2I0TA 4PC0A 1XHMA 4K3ID 5IC7A 2OJYA 2H9LA 3VA6A 2HKMA 4Y5RD 2H68A 3SLED 4ZOXA 1PGUA 1B9YA 3EI3A 3SBRA 2YNNA 3KRXB 5AMSA 4E5ZA 2Z2PA 3A0FA 2H9NA 3F3PA 3JZNA 4PXWA 3RSEC 2H6KA 4ESGA 5GSAA 5FA5B 3PSCB 2XL2A 3I7LA 4KFMB 1RI6A 4JT6C 4LG8A 2W18A 5EMLB 1PEVA 3UVKA 2CE9A 3VGZA 5HE0B 4CI2A 4CZVA 3UR4A 5GMKn 4D0KA 2Z2OA 1A0RB 4OZUA 3CFSB 3OKYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I0S A;  5K1C C;  5KDO B;  5IJ8 E;  3UVL A;  4LG9 A;  2J55 H;  3RN1 D;  3JAM g;  4JSP C;  3UVM A;  2CN2 A;  1PBY B;  3V5W B;  1TBG A;  2CO0 C;  2PM9 B;  4ZOZ A;  1QNI A;  3CIK B;  5HQG A;  4UI9 R;  1GXR A;  2Z2N A;  4GQB B;  3FGB A;  2HYE A;  3SCY A;  3NVN A;  4CI8 A;  5TDH B;  3L4M D;  4J79 A;  3SWS D;  3MZK A;  3DSM A;  2B5L A;  4J0X A;  2BCJ B;  2XU7 A;  4U1E I;  3E0C A;  4X61 B;  2J57 G;  3OW8 A;  2H6N A;  5C2V B;  3AL9 A;  1U4C A;  4O45 A;  3JPX A;  4CZY A;  3EI1 A;  5AJA A;  1OMW B;  2I3S A;  2PM6 B;  2G99 A;  4TZ4 A;  4A7J A;  4O1Q D;  3JB9 L;  2UZX B;  3SBQ A;  2GNQ A;  5CXB A;  5I5J A;  4R7A B;  4L3H D;  3PE7 A;  3W15 A;  4AOW A;  5H17 A;  3B7F A;  3OTT A;  4FAV D;  4QRJ A;  3RN0 D;  3SHF A;  2H9M A;  4ERY A;  3I7P A;  2AGL A;  4IMM A;  3KRW B;  5FKQ A;  3I7N A;  3SJL D;  3SVW D;  2YNO A;  3RMZ D;  2H47 A;  4A2L A;  4CY2 A;  4FA9 D;  4A0A A;  1XIP A;  3EU7 A;  3ODT A;  5I5M A;  5SXM A;  2YNP A;  4E54 B;  4A09 B;  2O9K A;  3K27 A;  4G56 B;  5EAP A;  3V7D B;  3SXT D;  5GXH A;  2J56 H;  4GQ1 A;  3C9C A;  3AH8 B;  5FQD A;  3MMY A;  2OK4 A;  5K19 A;  3OL2 A;  2XYI A;  5IGO A;  1Q47 A;  4CY3 A;  2I3T A;  4XEI C;  2GC4 A;  4Y7R A;  5FKR A;  3UKR C;  1P22 A;  3PXW D;  2H13 A;  3SN6 B;  5GXI A;  1R5M A;  3EG6 A;  3OKT A;  1SHY B;  4J87 A;  2H6Q A;  5TEF A;  3ULE C;  4JSV C;  2IAA A;  4O3T B;  4L1Q D;  4O9D A;  5IJ7 E;  3OKW A;  2B4E A;  4I79 A;  3I8E A;  2AH1 A;  2QXV A;  4GM3 A;  4CI1 A;  1GG2 B;  5TEE A;  4JSN C;  4ERQ A;  4N14 A;  1MG2 A;  4PNK B;  2OVQ B;  1JJU B;  3EI2 B;  3JZH A;  2GC7 A;  2AGX A;  2AGW A;  2HKR A;  3C75 H;  4JT5 C;  4FHL A;  4H5I A;  3IIY A;  3OKY A;  3PXT D;  3JRP A;  3MZL A;  2IUP A;  3DM0 A;  5IGQ A;  3F3G A;  2G9A A;  4FA5 D;  5EAL A;  4X63 B;  2OIZ A;  2PM9 A;  3AFC A;  3EWE A;  4J0W A;  3DXM C;  5FKS A;  5HE1 B;  2UZY B;  4CY1 A;  3I8C A;  4J84 A;  3ZWL B;  1NEX B;  5EAR A;  4LGN A;  2TRC B;  4GQ2 P;  4K3J B;  3GRE A;  4FWW A;  3DWL C;  1N6E A;  5CXC B;  4YVD A;  4J77 A;  2P9N C;  5CYK B;  4PSX B;  1OLZ A;  4HDJ A;  3PVW B;  5I5I A;  2HES X;  4QT8 A;  4D6V A;  4A11 B;  5C2W B;  2H14 A;  3PXS D;  5B4W A;  1N6D A;  3SBP A;  4JXM A;  4A0B B;  4A08 B;  3IJ1 A;  3L4O D;  3MXX A;  2OK6 A;  5H1M A;  3IKO A;  1S4U X;  3FM0 A;  3V9F A;  1MDA H;  4ES0 A;  3EI4 B;  2MTA H;  3CFV A;  3ORV D;  3BWS A;  2P9S C;  3JRO A;  1K32 A;  3F3F A;  4A2M A;  3AL8 B;  4L9O A;  3MKQ A;  4A08 A;  5FXY A;  4U7A A;  4J78 A;  3P4F A;  3N0D A;  4XYH A;  4GM9 A;  1K8K C;  2XL3 A;  2IUQ A;  3EI4 A;  2PM7 B;  3I7H A;  1FWX A;  2B5M A;  1JOF A;  2EBS A;  5EAM A;  2P9P C;  3GFC A;  4X3E A;  3PVU B;  1JMX B;  5EMJ B;  3RLM D;  3BG0 A;  3EI3 B;  2HXC A;  1GOT B;  2H9P A;  3IJ0 A;  3UVO A;  3U4Y A;  3RRM C;  4BH6 A;  4ZOV A;  4E54 A;  1MG3 A;  4A09 A;  1B9X A;  2HJ4 A;  3RFG A;  3I89 A;  1ERJ A;  1YFQ A;  2YB8 B;  3PSL A;  4L3G D;  3UVN A;  4ZN4 A;  1PI6 A;  4PBY A;  1NR0 A;  5EM2 B;  4J82 A;  2P9L C;  4J73 A;  2Q7Q A;  5A2Q g;  3BG1 A;  3I7O A;  2H3X A;  5HYN B;  3HFQ A;  4FAN D;  4J8G A;  5HE3 B;  3SFZ A;  4CC9 A;  5EM2 A;  1L0Q A;  4QQE A;  4ERZ A;  1SQ9 A;  4ZOY A;  4CZX A;  4MK0 B;  4J81 A;  4FA4 D;  5C9Z B;  1VYH C;  5THA A;  2CO0 A;  5AFU 3;  2P9I C;  4O3U B;  5H14 A;  3EI2 A;  2P9U C;  5TF2 A;  2HJB A;  3VH0 A;  4XYI A;  2CN3 A;  3MKS B;  2QC5 A;  4GZ8 A;  2IWK A;  4PSW B;  2IUR A;  4X60 B;  1XKS A;  2CE8 A;  2PBI B;  5FKT A;  4IA9 A;  4H5J A;  4BUJ C;  2IUV A;  3J80 g;  3SMR A;  2OVP B;  2BBK H;  4AEZ A;  4EWR A;  3EI1 B;  3JZG A;  3I2N A;  2YBA A;  2AQ5 A;  4GMB A;  2OVR B;  2AH0 A;  3I7K A;  1GP2 B;  4JSX C;  5HE2 B;  3FRX A;  2AGZ A;  2B5N A;  1JMZ B;  4PBZ A;  5CXB B;  4GGA A;  2P9K C;  4NSX A;  2YMU A;  3C99 A;  5IT9 g;  5CXC A;  5EMK B;  3IJC A;  5CYK A;  4GGD A;  3DXK C;  3RFH A;  4QL1 A;  3C5M A;  3N0E A;  4J8B A;  3EMH A;  1N6F A;  4A11 A;  3J81 g;  4BL0 A;  1SQJ A;  2IWF A;  2I0R A;  4J86 A;  3UKU C;  4A0B A;  4A0A B;  1U2V C;  4Z8L A;  5FLX g;  4JD2 C;  4GGC A;  4CY5 A;  4OWR A;  4GM8 A;  4CI3 A;  3NVX A;  5EMM B;  3IIW A;  4FB1 D;  4FA1 D;  3NVQ A;  2CNX A;  2AGY A;  3AL8 A;  5JWZ A;  3OL2 B;  1TYQ C;  4E5Z B;  3K26 A;  2I0T A;  4PC0 A;  1XHM A;  4K3I D;  5IC7 A;  2OJY A;  2H9L A;  3VA6 A;  2HKM A;  4Y5R D;  2H68 A;  3SLE D;  4ZOX A;  1PGU A;  1B9Y A;  3EI3 A;  3SBR A;  2YNN A;  3KRX B;  5AMS A;  4E5Z A;  2Z2P A;  3A0F A;  2H9N A;  3F3P A;  3JZN A;  4PXW A;  3RSE C;  2H6K A;  4ESG A;  5GSA A;  5FA5 B;  3PSC B;  2XL2 A;  3I7L A;  4KFM B;  1RI6 A;  4JT6 C;  4LG8 A;  2W18 A;  5EML B;  1PEV A;  3UVK A;  2CE9 A;  3VGZ A;  5HE0 B;  4CI2 A;  4CZV A;  3UR4 A;  5GMK n;  4D0K A;  2Z2O A;  1A0R B;  4OZU A;  3CFS B;  3OKY B; 
#chains in the Genus database with same CATH topology
 2I0S A;  5K1C C;  5KDO B;  5IJ8 E;  3UVL A;  4LG9 A;  2J55 H;  3RN1 D;  3JAM g;  4JSP C;  3UVM A;  2CN2 A;  1PBY B;  3V5W B;  1TBG A;  2CO0 C;  2PM9 B;  4ZOZ A;  1QNI A;  3CIK B;  5HQG A;  4UI9 R;  4BCD A;  1GXR A;  4L1M A;  2Z2N A;  4GQB B;  3FGB A;  2HYE A;  3SCY A;  3EQ8 A;  3NVN A;  4CI8 A;  3FCU A;  5TDH B;  3L4M D;  4J79 A;  3SWS D;  3MZK A;  3DSM A;  2B5L A;  4J0X A;  2BCJ B;  2XU7 A;  4JHN A;  4U1E I;  4MMY A;  3E0C A;  4X61 B;  3IUQ A;  2J57 G;  3OW8 A;  2H6N A;  4WK0 A;  5C2V B;  1GOH A;  3AL9 A;  1U4C A;  4O45 A;  3JPX A;  4CZY A;  3EI1 A;  2JKX A;  3GD1 I;  5AJA A;  1OMW B;  2I3S A;  5M5T A;  4MMX A;  2QR5 A;  2PM6 B;  3V4P A;  3ZE2 A;  2G99 A;  4TZ4 A;  4A7J A;  4O1Q D;  3JB9 L;  2UZX B;  3SBQ A;  2GNQ A;  5CXB A;  4AMZ A;  5I5J A;  4R7A B;  4L3H D;  3PE7 A;  3W15 A;  4AOW A;  5H17 A;  3B7F A;  3OTT A;  4FAV D;  3DDU A;  4O2W A;  4QRJ A;  2EIB A;  3RN0 D;  4NBM A;  2H9M A;  3SHF A;  3I7P A;  4ERY A;  3ZDY A;  4NC4 A;  3OF7 A;  2AGL A;  4IMM A;  3KRW B;  5FKQ A;  3I7N A;  3SJL D;  3SVW D;  2YNO A;  4DNV A;  3RMZ D;  2H47 A;  4A2L A;  4CY2 A;  4FA9 D;  4A0A A;  1XIP A;  3EU7 A;  3ODT A;  5I5M A;  5SXM A;  3EQ7 A;  2YNP A;  4E54 B;  4A09 B;  2O9K A;  3K27 A;  4G56 B;  5EAP A;  3V7D B;  5HDB A;  3SXT D;  2EIC A;  1JTD B;  2J56 H;  4D9S A;  4GQ1 A;  4Z7N A;  5GXH A;  3C9C A;  3AH8 B;  5FQD A;  3MMY A;  2OK4 A;  5K19 A;  3OL2 A;  2XYI A;  5IGO A;  1Q47 A;  4CY3 A;  2VDL A;  2I3T A;  4XEI C;  2GC4 A;  1U8C A;  4Y7R A;  5FKR A;  3UKR C;  1P22 A;  3PXW D;  2H13 A;  3SN6 B;  5GXI A;  4G1M A;  3IVM A;  1R5M A;  3EG6 A;  3OKT A;  1SHY B;  4J87 A;  3ZE0 A;  1UOQ A;  2H6Q A;  5TEF A;  3ULE C;  4JSV C;  2IAA A;  4O3T B;  4L1Q D;  4O9D A;  4RE6 A;  5IJ7 E;  3FCS A;  3OKW A;  2B4E A;  4I79 A;  3I8E A;  2AH1 A;  2QXV A;  5M5V A;  4GM3 A;  1K3I A;  4CI1 A;  1GG2 B;  2VDM A;  2VDN A;  5TEE A;  3VI4 A;  3T3M A;  4WK4 A;  4JSN C;  4ERQ A;  4N14 A;  1MG2 A;  4PNK B;  2OVQ B;  1JJU B;  3EI2 B;  3JZH A;  2GC7 A;  2AGX A;  2BKL A;  2AGW A;  1JV2 A;  2HKR A;  3C75 H;  4JT5 C;  4AX4 A;  4FHL A;  4H5I A;  3IIY A;  3OKY A;  2VDO A;  3PXT D;  3JRP A;  3MZL A;  2IUP A;  1YR2 A;  3QHY B;  3MUN A;  3DM0 A;  2EID A;  5IGQ A;  3F3G A;  2G9A A;  4FA5 D;  3O4J A;  1TYE A;  5EAL A;  4X63 B;  2OIZ A;  2PM9 A;  3AFC A;  3EWE A;  1GOG A;  4AN1 A;  4J0W A;  5E6S A;  3DXM C;  5FKS A;  5HE1 B;  2UZY B;  4CY1 A;  3EQ9 A;  3I8C A;  4J84 A;  3ZWL B;  1NEX B;  5EAR A;  4LGN A;  2VZ3 A;  2TRC B;  3O4G A;  4GQ2 P;  1GOF A;  4K3J B;  4DNU A;  3MUO A;  3GRE A;  4FWW A;  3DWL C;  1N6E A;  5CXC B;  4YVD A;  4J77 A;  2P9N C;  5CYK B;  4PSX B;  1OLZ A;  4HDJ A;  3PVW B;  5I5I A;  3NID A;  2XZG A;  2HES X;  4QT8 A;  3K6S A;  4D6V A;  4A11 B;  5C2W B;  1E5T A;  2H14 A;  3PXS D;  5B4W A;  1N6D A;  3SBP A;  4JXM A;  4A0B B;  4A08 B;  3IJ1 A;  1QFM A;  3L4O D;  3MXX A;  1H2Z A;  2OK6 A;  4UM8 A;  3IKO A;  5H1M A;  1H2X A;  1S4U X;  3FM0 A;  3V9F A;  1MDA H;  4ES0 A;  3EI4 B;  2MTA H;  3CFV A;  3ORV D;  2VDQ A;  3BWS A;  3IJE A;  2P9S C;  1BPO A;  3JRO A;  1K32 A;  3F3F A;  4A2M A;  3AL8 B;  4L9O A;  2XDW A;  3MKQ A;  4A08 A;  5FXY A;  4BP8 A;  4AN0 A;  4U7A A;  4J78 A;  3P4F A;  3N0D A;  4XYH A;  4GM9 A;  1K8K C;  2XL3 A;  2IUQ A;  3EI4 A;  5FFO A;  2PM7 B;  3I7H A;  1FWX A;  2B5M A;  3NIG A;  1JOF A;  2EBS A;  5EAM A;  3K72 A;  2P9P C;  3GFC A;  4X3E A;  3PVU B;  1JMX B;  5EMJ B;  3RLM D;  3BG0 A;  3EI3 B;  2HXC A;  1GOT B;  2H9P A;  3IJ0 A;  3UVO A;  1O6F A;  3U4Y A;  3VI3 A;  3RRM C;  4BH6 A;  2HU8 A;  4ZOV A;  4G1E A;  1MG3 A;  4E54 A;  4A09 A;  1B9X A;  2HJ4 A;  3RFG A;  3I89 A;  1ERJ A;  1YFQ A;  2YB8 B;  3PSL A;  4L3G D;  3IUN A;  4BCB A;  2HU5 A;  4IRZ A;  3UVN A;  4ZN4 A;  1PI6 A;  4PBY A;  4NEN A;  5C92 A;  1NR0 A;  5EM2 B;  4J82 A;  2P9L C;  4J73 A;  2Q7Q A;  5A2Q g;  1VE7 A;  3K71 A;  3BG1 A;  3I7O A;  3O4H A;  2H3X A;  3T3P A;  5HYN B;  3HFQ A;  1VZ2 A;  2XE4 A;  5E6R A;  2HU7 A;  4FAN D;  4J8G A;  5HE3 B;  1M1X A;  3SFZ A;  4CC9 A;  1C9L A;  4O02 A;  5EM2 A;  1L0Q A;  5FFG A;  4QQE A;  4WK2 A;  4ERZ A;  1SQ9 A;  4ZOY A;  1QFS A;  4CZX A;  4MK0 B;  4J81 A;  4FA4 D;  4NAA A;  5C9Z B;  1VYH C;  5THA A;  3ZE1 A;  1UTC A;  1UOP A;  3KCI A;  1VZ3 A;  2VDR A;  2CO0 A;  5AFU 3;  2P9I C;  4O3U B;  5H14 A;  3EI2 A;  2P9U C;  3GC3 B;  5M5S A;  5TF2 A;  2HJB A;  4Z7O A;  3VH0 A;  4XYI A;  2CN3 A;  3MKS B;  2QC5 A;  4GZ8 A;  2IWK A;  4PSW B;  1T2X A;  4MMZ A;  1A12 A;  2IUR A;  4X60 B;  1XKS A;  2CE8 A;  2PBI B;  5C86 A;  5FKT A;  4IA9 A;  4H5J A;  5M5R A;  4BUJ C;  2IUV A;  3ZDZ A;  3SMR A;  3J80 g;  5E6U A;  1C9I A;  2OVP B;  2BBK H;  4DNW A;  4AEZ A;  4EWR A;  3EI1 B;  3JZG A;  3I2N A;  2YBA A;  2AQ5 A;  4BP9 A;  4GMB A;  1L5G A;  2OVR B;  2AH0 A;  4AMY A;  4WJK A;  3I7K A;  4UM9 A;  1GP2 B;  4JSX C;  5HE2 B;  3FRX A;  2AGZ A;  2B5N A;  2VZ1 A;  1JMZ B;  3QI0 A;  4PBZ A;  5CXB B;  4GGA A;  4G55 A;  2P9K C;  4NSX A;  2YMU A;  3IUL A;  5M5U A;  3ZDX A;  3C99 A;  4JHP C;  5IT9 g;  5CXC A;  5EMK B;  3NIF A;  3IJC A;  5CYK A;  4GGD A;  3DXK C;  3RFH A;  5M61 A;  4QL1 A;  3C5M A;  1H2W A;  3N0E A;  4J8B A;  3EMH A;  1N6F A;  4A11 A;  3J81 g;  4BL0 A;  1SQJ A;  2WQ8 A;  2IWF A;  2I0R A;  4J86 A;  1E8N A;  3UKU C;  4A0B A;  2EIE A;  4A0A B;  1U2V C;  4Z8L A;  4BCC A;  5FLX g;  4JD2 C;  4GGC A;  4CY5 A;  4OWR A;  4GM8 A;  4CI3 A;  3IUR A;  1UOO A;  3NVX A;  4QAM A;  5EMM B;  3IIW A;  1O6G A;  4FA1 D;  4FB1 D;  3NVQ A;  3O4I A;  2AGY A;  2CNX A;  3AL8 A;  2QZP A;  3MVD K;  5JWZ A;  1I2M B;  3OL2 B;  2VC2 A;  1TYQ C;  4E5Z B;  3K26 A;  2I0T A;  4PC0 A;  1XHM A;  4K3I D;  5IC7 A;  2OJY A;  2H9L A;  3VA6 A;  2HKM A;  4RE5 A;  4Y5R D;  2H68 A;  3SLE D;  4ZOX A;  1PGU A;  1B9Y A;  3EI3 A;  2VDP A;  3IUJ A;  3SBR A;  2YNN A;  1VE6 A;  3KRX B;  5AMS A;  4E5Z A;  2Z2P A;  3V4V A;  3A0F A;  2H9N A;  3F3P A;  3JZN A;  4PXW A;  3RSE C;  1E8M A;  2H6K A;  4ESG A;  5GSA A;  5FA5 B;  3PSC B;  2XL2 A;  3I7L A;  4KFM B;  1RI6 A;  4JT6 C;  4LG8 A;  2W18 A;  5EML B;  1PEV A;  3UVK A;  2CE9 A;  3VGZ A;  5HE0 B;  4CI2 A;  4CZV A;  3UR4 A;  5GMK n;  4D0K A;  4Z7Q A;  1H2Y A;  2Z2O A;  1A0R B;  2VDK A;  4OZU A;  3IUM A;  3CFS B;  3OKY B; 
#chains in the Genus database with same CATH homology
 2I0S A;  5K1C C;  5KDO B;  5IJ8 E;  3UVL A;  4LG9 A;  2J55 H;  3RN1 D;  3JAM g;  4JSP C;  3UVM A;  2CN2 A;  1PBY B;  3V5W B;  1TBG A;  2CO0 C;  2PM9 B;  4ZOZ A;  1QNI A;  3CIK B;  5HQG A;  4UI9 R;  1GXR A;  2Z2N A;  4GQB B;  3FGB A;  2HYE A;  3SCY A;  3NVN A;  4CI8 A;  5TDH B;  3L4M D;  4J79 A;  3SWS D;  3MZK A;  3DSM A;  2B5L A;  4J0X A;  2BCJ B;  2XU7 A;  4U1E I;  3E0C A;  4X61 B;  2J57 G;  3OW8 A;  2H6N A;  5C2V B;  3AL9 A;  1U4C A;  4O45 A;  3JPX A;  4CZY A;  3EI1 A;  5AJA A;  1OMW B;  2I3S A;  2PM6 B;  2G99 A;  4TZ4 A;  4A7J A;  4O1Q D;  3JB9 L;  2UZX B;  3SBQ A;  2GNQ A;  5CXB A;  5I5J A;  4R7A B;  4L3H D;  3PE7 A;  3W15 A;  4AOW A;  5H17 A;  3B7F A;  3OTT A;  4FAV D;  4QRJ A;  3RN0 D;  3SHF A;  2H9M A;  4ERY A;  3I7P A;  2AGL A;  4IMM A;  3KRW B;  5FKQ A;  3I7N A;  3SJL D;  3SVW D;  2YNO A;  3RMZ D;  2H47 A;  4A2L A;  4CY2 A;  4FA9 D;  4A0A A;  1XIP A;  3EU7 A;  3ODT A;  5I5M A;  5SXM A;  2YNP A;  4E54 B;  4A09 B;  2O9K A;  3K27 A;  4G56 B;  5EAP A;  3V7D B;  3SXT D;  5GXH A;  2J56 H;  4GQ1 A;  3C9C A;  3AH8 B;  5FQD A;  3MMY A;  2OK4 A;  5K19 A;  3OL2 A;  2XYI A;  5IGO A;  1Q47 A;  4CY3 A;  2I3T A;  4XEI C;  2GC4 A;  4Y7R A;  5FKR A;  3UKR C;  1P22 A;  3PXW D;  2H13 A;  3SN6 B;  5GXI A;  1R5M A;  3EG6 A;  3OKT A;  1SHY B;  4J87 A;  2H6Q A;  5TEF A;  3ULE C;  4JSV C;  2IAA A;  4O3T B;  4L1Q D;  4O9D A;  5IJ7 E;  3OKW A;  2B4E A;  4I79 A;  3I8E A;  2AH1 A;  2QXV A;  4GM3 A;  4CI1 A;  1GG2 B;  5TEE A;  4JSN C;  4ERQ A;  4N14 A;  1MG2 A;  4PNK B;  2OVQ B;  1JJU B;  3EI2 B;  3JZH A;  2GC7 A;  2AGX A;  2AGW A;  2HKR A;  3C75 H;  4JT5 C;  4FHL A;  4H5I A;  3IIY A;  3OKY A;  3PXT D;  3JRP A;  3MZL A;  2IUP A;  3DM0 A;  5IGQ A;  3F3G A;  2G9A A;  4FA5 D;  5EAL A;  4X63 B;  2OIZ A;  2PM9 A;  3AFC A;  3EWE A;  4J0W A;  3DXM C;  5FKS A;  5HE1 B;  2UZY B;  4CY1 A;  3I8C A;  4J84 A;  3ZWL B;  1NEX B;  5EAR A;  4LGN A;  2TRC B;  4GQ2 P;  4K3J B;  3GRE A;  4FWW A;  3DWL C;  1N6E A;  5CXC B;  4YVD A;  4J77 A;  2P9N C;  5CYK B;  4PSX B;  1OLZ A;  4HDJ A;  3PVW B;  5I5I A;  2HES X;  4QT8 A;  4D6V A;  4A11 B;  5C2W B;  2H14 A;  3PXS D;  5B4W A;  1N6D A;  3SBP A;  4JXM A;  4A0B B;  4A08 B;  3IJ1 A;  3L4O D;  3MXX A;  2OK6 A;  5H1M A;  3IKO A;  1S4U X;  3FM0 A;  3V9F A;  1MDA H;  4ES0 A;  3EI4 B;  2MTA H;  3CFV A;  3ORV D;  3BWS A;  2P9S C;  3JRO A;  1K32 A;  3F3F A;  4A2M A;  3AL8 B;  4L9O A;  3MKQ A;  4A08 A;  5FXY A;  4U7A A;  4J78 A;  3P4F A;  3N0D A;  4XYH A;  4GM9 A;  1K8K C;  2XL3 A;  2IUQ A;  3EI4 A;  2PM7 B;  3I7H A;  1FWX A;  2B5M A;  1JOF A;  2EBS A;  5EAM A;  2P9P C;  3GFC A;  4X3E A;  3PVU B;  1JMX B;  5EMJ B;  3RLM D;  3BG0 A;  3EI3 B;  2HXC A;  1GOT B;  2H9P A;  3IJ0 A;  3UVO A;  3U4Y A;  3RRM C;  4BH6 A;  4ZOV A;  4E54 A;  1MG3 A;  4A09 A;  1B9X A;  2HJ4 A;  3RFG A;  3I89 A;  1ERJ A;  1YFQ A;  2YB8 B;  3PSL A;  4L3G D;  3UVN A;  4ZN4 A;  1PI6 A;  4PBY A;  1NR0 A;  5EM2 B;  4J82 A;  2P9L C;  4J73 A;  2Q7Q A;  5A2Q g;  3BG1 A;  3I7O A;  2H3X A;  5HYN B;  3HFQ A;  4FAN D;  4J8G A;  5HE3 B;  3SFZ A;  4CC9 A;  5EM2 A;  1L0Q A;  4QQE A;  4ERZ A;  1SQ9 A;  4ZOY A;  4CZX A;  4MK0 B;  4J81 A;  4FA4 D;  5C9Z B;  1VYH C;  5THA A;  2CO0 A;  5AFU 3;  2P9I C;  4O3U B;  5H14 A;  3EI2 A;  2P9U C;  5TF2 A;  2HJB A;  3VH0 A;  4XYI A;  2CN3 A;  3MKS B;  2QC5 A;  4GZ8 A;  2IWK A;  4PSW B;  2IUR A;  4X60 B;  1XKS A;  2CE8 A;  2PBI B;  5FKT A;  4IA9 A;  4H5J A;  4BUJ C;  2IUV A;  3J80 g;  3SMR A;  2OVP B;  2BBK H;  4AEZ A;  4EWR A;  3EI1 B;  3JZG A;  3I2N A;  2YBA A;  2AQ5 A;  4GMB A;  2OVR B;  2AH0 A;  3I7K A;  1GP2 B;  4JSX C;  5HE2 B;  3FRX A;  2AGZ A;  2B5N A;  1JMZ B;  4PBZ A;  5CXB B;  4GGA A;  2P9K C;  4NSX A;  2YMU A;  3C99 A;  5IT9 g;  5CXC A;  5EMK B;  3IJC A;  5CYK A;  4GGD A;  3DXK C;  3RFH A;  4QL1 A;  3C5M A;  3N0E A;  4J8B A;  3EMH A;  1N6F A;  4A11 A;  3J81 g;  4BL0 A;  1SQJ A;  2IWF A;  2I0R A;  4J86 A;  3UKU C;  4A0B A;  4A0A B;  1U2V C;  4Z8L A;  5FLX g;  4JD2 C;  4GGC A;  4CY5 A;  4OWR A;  4GM8 A;  4CI3 A;  3NVX A;  5EMM B;  3IIW A;  4FB1 D;  4FA1 D;  3NVQ A;  2CNX A;  2AGY A;  3AL8 A;  5JWZ A;  3OL2 B;  1TYQ C;  4E5Z B;  3K26 A;  2I0T A;  4PC0 A;  1XHM A;  4K3I D;  5IC7 A;  2OJY A;  2H9L A;  3VA6 A;  2HKM A;  4Y5R D;  2H68 A;  3SLE D;  4ZOX A;  1PGU A;  1B9Y A;  3EI3 A;  3SBR A;  2YNN A;  3KRX B;  5AMS A;  4E5Z A;  2Z2P A;  3A0F A;  2H9N A;  3F3P A;  3JZN A;  4PXW A;  3RSE C;  2H6K A;  4ESG A;  5GSA A;  5FA5 B;  3PSC B;  2XL2 A;  3I7L A;  4KFM B;  1RI6 A;  4JT6 C;  4LG8 A;  2W18 A;  5EML B;  1PEV A;  3UVK A;  2CE9 A;  3VGZ A;  5HE0 B;  4CI2 A;  4CZV A;  3UR4 A;  5GMK n;  4D0K A;  2Z2O A;  1A0R B;  4OZU A;  3CFS B;  3OKY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...