4J86A

Crystal structure of beta'-cop/ywbp1 complex
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
301
structure length
301
Chain Sequence
MKLDIKKTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVEIWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rules for the recognition of dilysine retrieval motifs by coatomer.
pubmed doi rcsb
molecule tags Protein transport
molecule keywords Coatomer subunit beta'
total genus 88
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4j86A01
2AGWA 3PVUB 5C2WB 3RSEC 4BUJC 3EI4A 3IJCA 5CXBA 2P9NC 3EG6A 2HKMA 3V7DB 1OLZA 4L9OA 4PSXB 5EMMB 5H1MA 3W15A 5FKRA 5C2VB 3UKRC 2UZYB 4AEZA 3VA6A 2J55H 3OKYA 5I5JA 3I7LA 2G99A 3MZKA 4JXMA 1K8KC 4O45A 2IUQA 2O9KA 5C9ZB 3NVQA 1TYQC 1MG2A 2OIZA 2P9IC 3L4OD 3MMYA 2I3TA 2PBIB 3IJ1A 2AGXA 3RN1D 4D6VA 3EI4B 3ORVD 3PXTD 3GREA 1S4UX 4A09A 3DSMA 4FAND 2XYIA 4CI2A 3SFZA 3J81g 4FWWA 2I0TA 2YB8B 3KRXB 4LG9A 4G56B 3N0EA 4J84A 2HYEA 5K1CC 3EI2A 5EARA 3DM0A 4A11B 5K19A 5HYNB 1JMZB 5CXBB 4J77A 5EM2B 4J82A 1RI6A 2OVQB 3F3PA 3RRMC 3UKUC 4ZOXA 4BH6A 2GNQA 2XL3A 3NVXA 2Q7QA 3OL2A 2G9AA 1MG3A 2CO0C 4H5IA 3C75H 2H9NA 2AGZA 3CFVA 3I7NA 4X60B 4J73A 4A0BA 2OK4A 3I8CA 2XU7A 3P4FA 3SBQA 3KRWB 2TRCB 2YNOA 3CIKB 4ZN4A 3V5WB 2J56H 3UVLA 2XL2A 1FWXA 5EAPA 3RLMD 4CI1A 4CZXA 2HKRA 3RN0D 2H47A 4PXWA 2P9LC 5I5MA 4J87A 4IMMA 4HDJA 2HESX 3ULEC 3EI3A 3SVWD 3FM0A 3JB9L 4AOWA 4YVDA 3U4YA 2IUVA 4A11A 5AMSA 5JWZA 1YFQA 3JROA 5FLXg 4PBZA 2CN3A 2AH0A 4XYHA 5GMKn 3HFQA 4GM3A 2Z2NA 3SWSD 3F3GA 3MKQA 4A09B 3OW8A 5HE3B 3AL8A 4JT5C 2PM6B 2B5LA 3DXKC 2I3SA 3BG1A 3AH8B 2B4EA 3JPXA 4J0XA 4K3JB 5TEEA 3AL8B 5TEFA 2CN2A 2B5MA 3PVWB 5HE0B 1QNIA 5SXMA 5KDOB 3B7FA 4GZ8A 4NSXA 5B4WA 4E54A 4FA1D 3I7HA 5GXHA 3CFSB 4J8BA 2PM7B 4GQ2P 4FA4D 3PXSD 3PSCB 4FA9D 5IC7A 2OK6A 3AL9A 4CY5A 4QL1A 3K27A 5FA5B 3FRXA 3UVOA 4X63B 3SLED 1N6DA 2IUPA 3IJ0A 4Y7RA 4L3GD 4A08A 4GMBA 1SHYB 5GSAA 3EMHA 5IJ8E 5HQGA 4QRJA 4TZ4A 4XEIC 2OVPB 4X3EA 2QXVA 3I7KA 3EI2B 3ODTA 2P9KC 4EWRA 2H9MA 4U1EI 1B9YA 4O3UB 5CYKB 4E5ZA 1XIPA 3MKSB 4X61B 5IGOA 4O9DA 5AFU3 3UVNA 4A0AB 2CE9A 2BCJB 4CZYA 3E0CA 4ZOYA 3I89A 2H6NA 4J86A 1U2VC 3I8EA 1XHMA 3EI1B 1XKSA 5FKSA 3PSLA 5EALA 1NR0A 3EI3B 4D0KA 1VYHC 5EAMA 5CXCA 5I5IA 2AGYA 4O3TB 2PM9B 1NEXB 1B9XA 3BWSA 2UZXB 5CXCB 2W18A 4J0WA 3VH0A 3UR4A 4JSNC 2Z2PA 4BL0A 4ESGA 3C99A 3SN6B 4CI3A 3EI1A 2IAAA 5IT9g 4JT6C 5TDHB 2H9LA 2HXCA 5H14A 4O1QD 3NVNA 3SBRA 3PXWD 4ERZA 4LGNA 4E54B 3DXMC 3BG0A 4CC9A 4CZVA 5IGQA 3AFCA 3DWLC 4PBYA 1SQ9A 4FAVD 5CYKA 4GGDA 4PNKB 5A2Qg 2H6KA 1PBYB 2EBSA 5EM2A 3OKWA 1U4CA 4J78A 2MTAH 3UVMA 2YMUA 2B5NA 3RMZD 2GC7A 1PI6A 2OJYA 5FKTA 4ES0A 5H17A 2CO0A 3SCYA 1L0QA 4PC0A 3JZHA 2IWFA 3MXXA 4JSXC 4KFMB 3GFCA 3FGBA 3UVKA 3JRPA 3I2NA 2AGLA 4JSPC 4GQ1A 4A08B 4GGAA 2YNPA 2CE8A 5EMLB 2AQ5A 4J8GA 5FKQA 3JAMg 1GG2B 4FA5D 3SXTD 4FB1D 1K32A 5FQDA 3JZGA 4ERYA 2H9PA 3IIWA 4LG8A 3OL2B 3J80g 2Z2OA 2H13A 4GM9A 3C5MA 4UI9R 2IURA 4A7JA 4A0BB 2OVRB 3PE7A 3RFHA 1N6EA 4CY3A 2HJBA 4Z8LA 5TF2A 1ERJA 4CY2A 4ERQA 3N0DA 2QC5A 3K26A 2P9UC 3OTTA 2H6QA 4K3ID 4H5JA 1GP2B 1GOTB 4JSVC 4E5ZB 4CY1A 4PSWB 3C9CA 3SMRA 4FHLA 3IKOA 3EWEA 4U7AA 5EMKB 3I7PA 2CNXA 4GM8A 4A0AA 2P9SC 2HJ4A 1JJUB 5IJ7E 1TBGA 3SJLD 1P22A 1N6FA 5THAA 5AJAA 5HE1B 4ZOVA 3VGZA 4OZUA 1R5MA 2BBKH 4N14A 3L4MD 4MK0B 4XYIA 4L1QD 4ZOZA 1OMWB 3SBPA 1PGUA 4GQBB 4OWRA 1MDAH 2IWKA 5GXIA 3V9FA 4I79A 1A0RB 3ZWLB 4J81A 4L3HD 5HE2B 2I0RA 2J57G 5FXYA 4IA9A 3JZNA 4J79A 1JOFA 4A2LA 3SHFA 2P9PC 3A0FA 4A2MA 5EMJB 4CI8A 2AH1A 3RFGA 1SQJA 3EU7A 4R7AB 4QT8A 1JMXB 2H14A 4Y5RD 2H68A 3OKYB 3OKTA 1GXRA 2GC4A 2H3XA 1Q47A 3F3FA 1PEVA 2PM9A 3MZLA 3IIYA 4JD2C 2YNNA 3I7OA 2I0SA 4QQEA 2YBAA 4GGCA
chains in the Genus database with same CATH superfamily
1H2ZA 3FCSA 5M61A 2AGWA 3PVUB 5C2WB 3RSEC 4BUJC 3EI4A 3IJCA 5CXBA 2P9NC 3EG6A 2HKMA 3V7DB 1OLZA 4L9OA 4PSXB 5E6RA 5H1MA 5EMMB 3W15A 5FKRA 5C2VB 3UKRC 2UZYB 4AEZA 3VA6A 2J55H 3OKYA 5I5JA 3IURA 5M5TA 3I7LA 2G99A 3MZKA 4JXMA 1K8KC 4O45A 5HDBA 4AMYA 5M5UA 1GOHA 4RE5A 2IUQA 2O9KA 5C9ZB 3NVQA 1TYQC 4MMZA 4WK0A 1MG2A 2OIZA 2P9IC 3L4OD 3MMYA 2I3TA 2PBIB 3IJ1A 2AGXA 3RN1D 4DNUA 4D6VA 3EQ8A 3EI4B 3ORVD 1QFSA 3PXTD 3GREA 1S4UX 3MUOA 4A09A 3DSMA 4FAND 2XYIA 4CI2A 5C92A 1C9IA 3SFZA 3J81g 4FWWA 1UOQA 2I0TA 2YB8B 2VZ3A 3KRXB 3O4HA 4LG9A 4G56B 3N0EA 4J84A 2HYEA 5K1CC 3EI2A 5EARA 2XDWA 3DM0A 4A11B 5E6UA 5K19A 1QFMA 5HYNB 1JMZB 5CXBB 3QHYB 1H2XA 1O6GA 4UM9A 4J77A 5EM2B 4J82A 5FFGA 1O6FA 1RI6A 3O4IA 2OVQB 3F3PA 3RRMC 3UKUC 4Z7OA 4ZOXA 4BH6A 2GNQA 2XL3A 3NVXA 4MMXA 2Q7QA 3OL2A 2G9AA 1MG3A 2CO0C 4H5IA 3C75H 3K6SA 2H9NA 2AGZA 1C9LA 3CFVA 5FFOA 3I7NA 4X60B 1H2YA 4J73A 4A0BA 2OK4A 3OF7A 3I8CA 2XU7A 3P4FA 3SBQA 2VDRA 4AX4A 3KRWB 2TRCB 2YNOA 3CIKB 3V4PA 4ZN4A 3V5WB 1H2WA 2J56H 3UVLA 1U8CA 2HU8A 2XL2A 3IUNA 1FWXA 5EAPA 3RLMD 4CI1A 4CZXA 2HKRA 3RN0D 2H47A 4PXWA 2P9LC 5I5MA 4J87A 4BCDA 4IMMA 4HDJA 2HESX 3ULEC 3EI3A 1YR2A 2XE4A 4NAAA 3SVWD 3FM0A 3JB9L 4AOWA 4YVDA 3U4YA 3K72A 2IUVA 4A11A 3ZE1A 5AMSA 5JWZA 1YFQA 1BPOA 3JROA 5FLXg 4PBZA 2CN3A 2QZPA 1I2MB 2AH0A 4XYHA 5GMKn 3HFQA 4GM3A 4O02A 2Z2NA 3SWSD 4JHNA 3F3GA 3MKQA 4QAMA 4A09B 3OW8A 5HE3B 3AL8A 4JT5C 2PM6B 2B5LA 3DXKC 2I3SA 3BG1A 3AH8B 2B4EA 3JPXA 4J0XA 4K3JB 5M5VA 5TEEA 3AL8B 5TEFA 2CN2A 2B5MA 4Z7QA 3PVWB 5HE0B 1QNIA 5SXMA 5KDOB 3B7FA 4GZ8A 4D9SA 4NSXA 5B4WA 2EIEA 2EICA 4E54A 1UTCA 4FA1D 3GC3B 3I7HA 1E8NA 5GXHA 3CFSB 4J8BA 4NBMA 2PM7B 4GQ2P 4FA4D 1L5GA 1JV2A 3PXSD 3PSCB 2HU7A 4FA9D 5IC7A 2OK6A 3AL9A 4CY5A 3O4JA 3T3PA 4QL1A 3K27A 5FA5B 3FRXA 3UVOA 4X63B 3SLED 1N6DA 2IUPA 3IJ0A 2QR5A 4Y7RA 4L3GD 4A08A 4GMBA 1SHYB 5GSAA 3EMHA 2JKXA 5IJ8E 5HQGA 2VDMA 4QRJA 4TZ4A 2OVPB 4XEIC 3ZDXA 4X3EA 2QXVA 3I7KA 3EI2B 3ODTA 2P9KC 4EWRA 2H9MA 4U1EI 1B9YA 4O3UB 5CYKB 4AMZA 4E5ZA 3DDUA 1UOPA 2VDQA 1XIPA 3MKSB 4X61B 5IGOA 1VE6A 4G1EA 4O9DA 5AFU3 3UVNA 4JHPC 4A0AB 2CE9A 2BCJB 4WK4A 4CZYA 3IUQA 3E0CA 4ZOYA 3I89A 3IJEA 2H6NA 4J86A 1U2VC 3I8EA 1XHMA 1VE7A 3EI1B 1XKSA 3IULA 3NIDA 5FKSA 3PSLA 5EALA 1NR0A 3EI3B 4D0KA 3V4VA 1VYHC 5EAMA 5CXCA 5I5IA 2AGYA 4O3TB 2PM9B 1NEXB 1B9XA 3BWSA 2UZXB 5CXCB 2W18A 5C86A 4J0WA 3VH0A 3UR4A 4JSNC 2Z2PA 4BL0A 4NC4A 4ESGA 3C99A 3SN6B 4CI3A 3K71A 4WK2A 3EI1A 3ZDYA 2IAAA 5IT9g 3FCUA 4JT6C 5TDHB 2XZGA 2H9LA 2HXCA 5H14A 4O1QD 4RE6A 3NVNA 3SBRA 4DNWA 3PXWD 4ERZA 4LGNA 4E54B 3DXMC 3KCIA 3BG0A 4CC9A 4CZVA 4Z7NA 3AFCA 4AN1A 5IGQA 3DWLC 4PBYA 1SQ9A 4FAVD 5CYKA 4GGDA 4PNKB 4AN0A 2H6KA 5A2Qg 1PBYB 2EBSA 5EM2A 3OKWA 3IVMA 1U4CA 4J78A 2MTAH 3UVMA 2YMUA 2B5NA 3RMZD 2GC7A 1PI6A 4BCCA 2OJYA 5FKTA 4ES0A 5H17A 3IUMA 2VDPA 2CO0A 3SCYA 1L0QA 4PC0A 3JZHA 2IWFA 3MXXA 4JSXC 1GOFA 4KFMB 3GFCA 3T3MA 3FGBA 3UVKA 4BCBA 3JRPA 3I2NA 2AGLA 4JSPC 4GQ1A 4A08B 4GGAA 2YNPA 2CE8A 5EMLB 2AQ5A 4J8GA 5FKQA 3JAMg 1GG2B 4FA5D 3SXTD 4FB1D 5M5RA 1K32A 5FQDA 3JZGA 4ERYA 2H9PA 3IIWA 4LG8A 2VDLA 3OL2B 3J80g 2Z2OA 2H13A 4G55A 4GM9A 3C5MA 4UI9R 2WQ8A 2IURA 4L1MA 4A7JA 1JTDB 4A0BB 2VZ1A 2OVRB 3PE7A 3RFHA 1N6EA 4CY3A 2HJBA 1VZ3A 4Z8LA 5TF2A 1ERJA 3MVDK 3NIGA 2HU5A 4CY2A 4ERQA 3N0DA 2QC5A 3K26A 2P9UC 3ZDZA 3O4GA 3OTTA 3QI0A 2H6QA 4K3ID 4H5JA 1GP2B 1GOTB 3EQ7A 4JSVC 4WJKA 3MUNA 4E5ZB 4CY1A 4O2WA 4PSWB 1K3IA 4BP8A 3C9CA 3SMRA 4FHLA 3IKOA 3EWEA 4U7AA 5EMKB 3I7PA 3IUJA 4DNVA 2CNXA 4GM8A 4A0AA 2P9SC 2HJ4A 1JJUB 2VDOA 5IJ7E 4UM8A 1TBGA 3SJLD 1P22A 4BP9A 3EQ9A 2EIDA 3VI3A 1N6FA 5THAA 3VI4A 5AJAA 5HE1B 4ZOVA 3VGZA 4OZUA 1R5MA 1TYEA 2BBKH 4N14A 3L4MD 4MK0B 4XYIA 4L1QD 4ZOZA 2VDNA 4IRZA 3ZE0A 1OMWB 3SBPA 1PGUA 1T2XA 1E5TA 2VDKA 4GQBB 4OWRA 2EIBA 1MDAH 5M5SA 2IWKA 5GXIA 3V9FA 4I79A 1A0RB 3ZWLB 4J81A 4L3HD 5HE2B 2I0RA 2J57G 5FXYA 2BKLA 4IA9A 3JZNA 5E6SA 4MMYA 4J79A 1JOFA 4A2LA 3SHFA 2P9PC 3A0FA 4A2MA 5EMJB 4CI8A 3NIFA 2AH1A 3RFGA 1SQJA 3EU7A 4R7AB 1E8MA 4QT8A 1JMXB 2H14A 1GOGA 4Y5RD 2VC2A 3ZE2A 4G1MA 2H68A 4NENA 1M1XA 3OKYB 3OKTA 1GXRA 2GC4A 2H3XA 1Q47A 3F3FA 1PEVA 3MZLA 2PM9A 1VZ2A 3GD1I 1A12A 3IIYA 4JD2C 2YNNA 3I7OA 2I0SA 1UOOA 4QQEA 2YBAA 4GGCA
chains in the Genus database with same CATH topology
2AGWA 3PVUB 5C2WB 3RSEC 4BUJC 3EI4A 3IJCA 5CXBA 2P9NC 3EG6A 2HKMA 3V7DB 1OLZA 4L9OA 4PSXB 5EMMB 5H1MA 3W15A 5FKRA 5C2VB 3UKRC 2UZYB 4AEZA 3VA6A 2J55H 3OKYA 5I5JA 3I7LA 2G99A 3MZKA 4JXMA 1K8KC 4O45A 2IUQA 2O9KA 5C9ZB 3NVQA 1TYQC 1MG2A 2OIZA 2P9IC 3L4OD 3MMYA 2I3TA 2PBIB 3IJ1A 2AGXA 3RN1D 4D6VA 3EI4B 3ORVD 3PXTD 3GREA 1S4UX 4A09A 3DSMA 4FAND 2XYIA 4CI2A 3SFZA 3J81g 4FWWA 2I0TA 2YB8B 3KRXB 4LG9A 4G56B 3N0EA 4J84A 2HYEA 5K1CC 3EI2A 5EARA 3DM0A 4A11B 5K19A 5HYNB 1JMZB 5CXBB 4J77A 5EM2B 4J82A 1RI6A 2OVQB 3F3PA 3RRMC 3UKUC 4ZOXA 4BH6A 2GNQA 2XL3A 3NVXA 2Q7QA 3OL2A 2G9AA 1MG3A 2CO0C 4H5IA 3C75H 2H9NA 2AGZA 3CFVA 3I7NA 4X60B 4J73A 4A0BA 2OK4A 3I8CA 2XU7A 3P4FA 3SBQA 3KRWB 2TRCB 2YNOA 3CIKB 4ZN4A 3V5WB 2J56H 3UVLA 2XL2A 1FWXA 5EAPA 3RLMD 4CI1A 4CZXA 2HKRA 3RN0D 2H47A 4PXWA 2P9LC 5I5MA 4J87A 4IMMA 4HDJA 2HESX 3ULEC 3EI3A 3SVWD 3FM0A 3JB9L 4AOWA 4YVDA 3U4YA 2IUVA 4A11A 5AMSA 5JWZA 1YFQA 3JROA 5FLXg 4PBZA 2CN3A 2AH0A 4XYHA 5GMKn 3HFQA 4GM3A 2Z2NA 3SWSD 3F3GA 3MKQA 4A09B 3OW8A 5HE3B 3AL8A 4JT5C 2PM6B 2B5LA 3DXKC 2I3SA 3BG1A 3AH8B 2B4EA 3JPXA 4J0XA 4K3JB 5TEEA 3AL8B 5TEFA 2CN2A 2B5MA 3PVWB 5HE0B 1QNIA 5SXMA 5KDOB 3B7FA 4GZ8A 4NSXA 5B4WA 4E54A 4FA1D 3I7HA 5GXHA 3CFSB 4J8BA 2PM7B 4GQ2P 4FA4D 3PXSD 3PSCB 4FA9D 5IC7A 2OK6A 3AL9A 4CY5A 4QL1A 3K27A 5FA5B 3FRXA 3UVOA 4X63B 3SLED 1N6DA 2IUPA 3IJ0A 4Y7RA 4L3GD 4A08A 4GMBA 1SHYB 5GSAA 3EMHA 5IJ8E 5HQGA 4QRJA 4TZ4A 4XEIC 2OVPB 4X3EA 2QXVA 3I7KA 3EI2B 3ODTA 2P9KC 4EWRA 2H9MA 4U1EI 1B9YA 4O3UB 5CYKB 4E5ZA 1XIPA 3MKSB 4X61B 5IGOA 4O9DA 5AFU3 3UVNA 4A0AB 2CE9A 2BCJB 4CZYA 3E0CA 4ZOYA 3I89A 2H6NA 4J86A 1U2VC 3I8EA 1XHMA 3EI1B 1XKSA 5FKSA 3PSLA 5EALA 1NR0A 3EI3B 4D0KA 1VYHC 5EAMA 5CXCA 5I5IA 2AGYA 4O3TB 2PM9B 1NEXB 1B9XA 3BWSA 2UZXB 5CXCB 2W18A 4J0WA 3VH0A 3UR4A 4JSNC 2Z2PA 4BL0A 4ESGA 3C99A 3SN6B 4CI3A 3EI1A 2IAAA 5IT9g 4JT6C 5TDHB 2H9LA 2HXCA 5H14A 4O1QD 3NVNA 3SBRA 3PXWD 4ERZA 4LGNA 4E54B 3DXMC 3BG0A 4CC9A 4CZVA 5IGQA 3AFCA 3DWLC 4PBYA 1SQ9A 4FAVD 5CYKA 4GGDA 4PNKB 5A2Qg 2H6KA 1PBYB 2EBSA 5EM2A 3OKWA 1U4CA 4J78A 2MTAH 3UVMA 2YMUA 2B5NA 3RMZD 2GC7A 1PI6A 2OJYA 5FKTA 4ES0A 5H17A 2CO0A 3SCYA 1L0QA 4PC0A 3JZHA 2IWFA 3MXXA 4JSXC 4KFMB 3GFCA 3FGBA 3UVKA 3JRPA 3I2NA 2AGLA 4JSPC 4GQ1A 4A08B 4GGAA 2YNPA 2CE8A 5EMLB 2AQ5A 4J8GA 5FKQA 3JAMg 1GG2B 4FA5D 3SXTD 4FB1D 1K32A 5FQDA 3JZGA 4ERYA 2H9PA 3IIWA 4LG8A 3OL2B 3J80g 2Z2OA 2H13A 4GM9A 3C5MA 4UI9R 2IURA 4A7JA 4A0BB 2OVRB 3PE7A 3RFHA 1N6EA 4CY3A 2HJBA 4Z8LA 5TF2A 1ERJA 4CY2A 4ERQA 3N0DA 2QC5A 3K26A 2P9UC 3OTTA 2H6QA 4K3ID 4H5JA 1GP2B 1GOTB 4JSVC 4E5ZB 4CY1A 4PSWB 3C9CA 3SMRA 4FHLA 3IKOA 3EWEA 4U7AA 5EMKB 3I7PA 2CNXA 4GM8A 4A0AA 2P9SC 2HJ4A 1JJUB 5IJ7E 1TBGA 3SJLD 1P22A 1N6FA 5THAA 5AJAA 5HE1B 4ZOVA 3VGZA 4OZUA 1R5MA 2BBKH 4N14A 3L4MD 4MK0B 4XYIA 4L1QD 4ZOZA 1OMWB 3SBPA 1PGUA 4GQBB 4OWRA 1MDAH 2IWKA 5GXIA 3V9FA 4I79A 1A0RB 3ZWLB 4J81A 4L3HD 5HE2B 2I0RA 2J57G 5FXYA 4IA9A 3JZNA 4J79A 1JOFA 4A2LA 3SHFA 2P9PC 3A0FA 4A2MA 5EMJB 4CI8A 2AH1A 3RFGA 1SQJA 3EU7A 4R7AB 4QT8A 1JMXB 2H14A 4Y5RD 2H68A 3OKYB 3OKTA 1GXRA 2GC4A 2H3XA 1Q47A 3F3FA 1PEVA 2PM9A 3MZLA 3IIYA 4JD2C 2YNNA 3I7OA 2I0SA 4QQEA 2YBAA 4GGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AGW A;  3PVU B;  5C2W B;  3RSE C;  4BUJ C;  3EI4 A;  3IJC A;  5CXB A;  2P9N C;  3EG6 A;  2HKM A;  3V7D B;  1OLZ A;  4L9O A;  4PSX B;  5EMM B;  5H1M A;  3W15 A;  5FKR A;  5C2V B;  3UKR C;  2UZY B;  4AEZ A;  3VA6 A;  2J55 H;  3OKY A;  5I5J A;  3I7L A;  2G99 A;  3MZK A;  4JXM A;  1K8K C;  4O45 A;  2IUQ A;  2O9K A;  5C9Z B;  3NVQ A;  1TYQ C;  1MG2 A;  2OIZ A;  2P9I C;  3L4O D;  3MMY A;  2I3T A;  2PBI B;  3IJ1 A;  2AGX A;  3RN1 D;  4D6V A;  3EI4 B;  3ORV D;  3PXT D;  3GRE A;  1S4U X;  4A09 A;  3DSM A;  4FAN D;  2XYI A;  4CI2 A;  3SFZ A;  3J81 g;  4FWW A;  2I0T A;  2YB8 B;  3KRX B;  4LG9 A;  4G56 B;  3N0E A;  4J84 A;  2HYE A;  5K1C C;  3EI2 A;  5EAR A;  3DM0 A;  4A11 B;  5K19 A;  5HYN B;  1JMZ B;  5CXB B;  4J77 A;  5EM2 B;  4J82 A;  1RI6 A;  2OVQ B;  3F3P A;  3RRM C;  3UKU C;  4ZOX A;  4BH6 A;  2GNQ A;  2XL3 A;  3NVX A;  2Q7Q A;  3OL2 A;  2G9A A;  1MG3 A;  2CO0 C;  4H5I A;  3C75 H;  2H9N A;  2AGZ A;  3CFV A;  3I7N A;  4X60 B;  4J73 A;  4A0B A;  2OK4 A;  3I8C A;  2XU7 A;  3P4F A;  3SBQ A;  3KRW B;  2TRC B;  2YNO A;  3CIK B;  4ZN4 A;  3V5W B;  2J56 H;  3UVL A;  2XL2 A;  1FWX A;  5EAP A;  3RLM D;  4CI1 A;  4CZX A;  2HKR A;  3RN0 D;  2H47 A;  4PXW A;  2P9L C;  5I5M A;  4J87 A;  4IMM A;  4HDJ A;  2HES X;  3ULE C;  3EI3 A;  3SVW D;  3FM0 A;  3JB9 L;  4AOW A;  4YVD A;  3U4Y A;  2IUV A;  4A11 A;  5AMS A;  5JWZ A;  1YFQ A;  3JRO A;  5FLX g;  4PBZ A;  2CN3 A;  2AH0 A;  4XYH A;  5GMK n;  3HFQ A;  4GM3 A;  2Z2N A;  3SWS D;  3F3G A;  3MKQ A;  4A09 B;  3OW8 A;  5HE3 B;  3AL8 A;  4JT5 C;  2PM6 B;  2B5L A;  3DXK C;  2I3S A;  3BG1 A;  3AH8 B;  2B4E A;  3JPX A;  4J0X A;  4K3J B;  5TEE A;  3AL8 B;  5TEF A;  2CN2 A;  2B5M A;  3PVW B;  5HE0 B;  1QNI A;  5SXM A;  5KDO B;  3B7F A;  4GZ8 A;  4NSX A;  5B4W A;  4E54 A;  4FA1 D;  3I7H A;  5GXH A;  3CFS B;  4J8B A;  2PM7 B;  4GQ2 P;  4FA4 D;  3PXS D;  3PSC B;  4FA9 D;  5IC7 A;  2OK6 A;  3AL9 A;  4CY5 A;  4QL1 A;  3K27 A;  5FA5 B;  3FRX A;  3UVO A;  4X63 B;  3SLE D;  1N6D A;  2IUP A;  3IJ0 A;  4Y7R A;  4L3G D;  4A08 A;  4GMB A;  1SHY B;  5GSA A;  3EMH A;  5IJ8 E;  5HQG A;  4QRJ A;  4TZ4 A;  4XEI C;  2OVP B;  4X3E A;  2QXV A;  3I7K A;  3EI2 B;  3ODT A;  2P9K C;  4EWR A;  2H9M A;  4U1E I;  1B9Y A;  4O3U B;  5CYK B;  4E5Z A;  1XIP A;  3MKS B;  4X61 B;  5IGO A;  4O9D A;  5AFU 3;  3UVN A;  4A0A B;  2CE9 A;  2BCJ B;  4CZY A;  3E0C A;  4ZOY A;  3I89 A;  2H6N A;  4J86 A;  1U2V C;  3I8E A;  1XHM A;  3EI1 B;  1XKS A;  5FKS A;  3PSL A;  5EAL A;  1NR0 A;  3EI3 B;  4D0K A;  1VYH C;  5EAM A;  5CXC A;  5I5I A;  2AGY A;  4O3T B;  2PM9 B;  1NEX B;  1B9X A;  3BWS A;  2UZX B;  5CXC B;  2W18 A;  4J0W A;  3VH0 A;  3UR4 A;  4JSN C;  2Z2P A;  4BL0 A;  4ESG A;  3C99 A;  3SN6 B;  4CI3 A;  3EI1 A;  2IAA A;  5IT9 g;  4JT6 C;  5TDH B;  2H9L A;  2HXC A;  5H14 A;  4O1Q D;  3NVN A;  3SBR A;  3PXW D;  4ERZ A;  4LGN A;  4E54 B;  3DXM C;  3BG0 A;  4CC9 A;  4CZV A;  5IGQ A;  3AFC A;  3DWL C;  4PBY A;  1SQ9 A;  4FAV D;  5CYK A;  4GGD A;  4PNK B;  5A2Q g;  2H6K A;  1PBY B;  2EBS A;  5EM2 A;  3OKW A;  1U4C A;  4J78 A;  2MTA H;  3UVM A;  2YMU A;  2B5N A;  3RMZ D;  2GC7 A;  1PI6 A;  2OJY A;  5FKT A;  4ES0 A;  5H17 A;  2CO0 A;  3SCY A;  1L0Q A;  4PC0 A;  3JZH A;  2IWF A;  3MXX A;  4JSX C;  4KFM B;  3GFC A;  3FGB A;  3UVK A;  3JRP A;  3I2N A;  2AGL A;  4JSP C;  4GQ1 A;  4A08 B;  4GGA A;  2YNP A;  2CE8 A;  5EML B;  2AQ5 A;  4J8G A;  5FKQ A;  3JAM g;  1GG2 B;  4FA5 D;  3SXT D;  4FB1 D;  1K32 A;  5FQD A;  3JZG A;  4ERY A;  2H9P A;  3IIW A;  4LG8 A;  3OL2 B;  3J80 g;  2Z2O A;  2H13 A;  4GM9 A;  3C5M A;  4UI9 R;  2IUR A;  4A7J A;  4A0B B;  2OVR B;  3PE7 A;  3RFH A;  1N6E A;  4CY3 A;  2HJB A;  4Z8L A;  5TF2 A;  1ERJ A;  4CY2 A;  4ERQ A;  3N0D A;  2QC5 A;  3K26 A;  2P9U C;  3OTT A;  2H6Q A;  4K3I D;  4H5J A;  1GP2 B;  1GOT B;  4JSV C;  4E5Z B;  4CY1 A;  4PSW B;  3C9C A;  3SMR A;  4FHL A;  3IKO A;  3EWE A;  4U7A A;  5EMK B;  3I7P A;  2CNX A;  4GM8 A;  4A0A A;  2P9S C;  2HJ4 A;  1JJU B;  5IJ7 E;  1TBG A;  3SJL D;  1P22 A;  1N6F A;  5THA A;  5AJA A;  5HE1 B;  4ZOV A;  3VGZ A;  4OZU A;  1R5M A;  2BBK H;  4N14 A;  3L4M D;  4MK0 B;  4XYI A;  4L1Q D;  4ZOZ A;  1OMW B;  3SBP A;  1PGU A;  4GQB B;  4OWR A;  1MDA H;  2IWK A;  5GXI A;  3V9F A;  4I79 A;  1A0R B;  3ZWL B;  4J81 A;  4L3H D;  5HE2 B;  2I0R A;  2J57 G;  5FXY A;  4IA9 A;  3JZN A;  4J79 A;  1JOF A;  4A2L A;  3SHF A;  2P9P C;  3A0F A;  4A2M A;  5EMJ B;  4CI8 A;  2AH1 A;  3RFG A;  1SQJ A;  3EU7 A;  4R7A B;  4QT8 A;  1JMX B;  2H14 A;  4Y5R D;  2H68 A;  3OKY B;  3OKT A;  1GXR A;  2GC4 A;  2H3X A;  1Q47 A;  3F3F A;  1PEV A;  2PM9 A;  3MZL A;  3IIY A;  4JD2 C;  2YNN A;  3I7O A;  2I0S A;  4QQE A;  2YBA A;  4GGC A; 
#chains in the Genus database with same CATH topology
 1H2Z A;  3FCS A;  5M61 A;  2AGW A;  3PVU B;  5C2W B;  3RSE C;  4BUJ C;  3EI4 A;  3IJC A;  5CXB A;  2P9N C;  3EG6 A;  2HKM A;  3V7D B;  1OLZ A;  4L9O A;  4PSX B;  5E6R A;  5H1M A;  5EMM B;  3W15 A;  5FKR A;  5C2V B;  3UKR C;  2UZY B;  4AEZ A;  3VA6 A;  2J55 H;  3OKY A;  5I5J A;  3IUR A;  5M5T A;  3I7L A;  2G99 A;  3MZK A;  4JXM A;  1K8K C;  4O45 A;  5HDB A;  4AMY A;  5M5U A;  1GOH A;  4RE5 A;  2IUQ A;  2O9K A;  5C9Z B;  3NVQ A;  1TYQ C;  4MMZ A;  4WK0 A;  1MG2 A;  2OIZ A;  2P9I C;  3L4O D;  3MMY A;  2I3T A;  2PBI B;  3IJ1 A;  2AGX A;  3RN1 D;  4DNU A;  4D6V A;  3EQ8 A;  3EI4 B;  3ORV D;  1QFS A;  3PXT D;  3GRE A;  1S4U X;  3MUO A;  4A09 A;  3DSM A;  4FAN D;  2XYI A;  4CI2 A;  5C92 A;  1C9I A;  3SFZ A;  3J81 g;  4FWW A;  1UOQ A;  2I0T A;  2YB8 B;  2VZ3 A;  3KRX B;  3O4H A;  4LG9 A;  4G56 B;  3N0E A;  4J84 A;  2HYE A;  5K1C C;  3EI2 A;  5EAR A;  2XDW A;  3DM0 A;  4A11 B;  5E6U A;  5K19 A;  1QFM A;  5HYN B;  1JMZ B;  5CXB B;  3QHY B;  1H2X A;  1O6G A;  4UM9 A;  4J77 A;  5EM2 B;  4J82 A;  5FFG A;  1O6F A;  1RI6 A;  3O4I A;  2OVQ B;  3F3P A;  3RRM C;  3UKU C;  4Z7O A;  4ZOX A;  4BH6 A;  2GNQ A;  2XL3 A;  3NVX A;  4MMX A;  2Q7Q A;  3OL2 A;  2G9A A;  1MG3 A;  2CO0 C;  4H5I A;  3C75 H;  3K6S A;  2H9N A;  2AGZ A;  1C9L A;  3CFV A;  5FFO A;  3I7N A;  4X60 B;  1H2Y A;  4J73 A;  4A0B A;  2OK4 A;  3OF7 A;  3I8C A;  2XU7 A;  3P4F A;  3SBQ A;  2VDR A;  4AX4 A;  3KRW B;  2TRC B;  2YNO A;  3CIK B;  3V4P A;  4ZN4 A;  3V5W B;  1H2W A;  2J56 H;  3UVL A;  1U8C A;  2HU8 A;  2XL2 A;  3IUN A;  1FWX A;  5EAP A;  3RLM D;  4CI1 A;  4CZX A;  2HKR A;  3RN0 D;  2H47 A;  4PXW A;  2P9L C;  5I5M A;  4J87 A;  4BCD A;  4IMM A;  4HDJ A;  2HES X;  3ULE C;  3EI3 A;  1YR2 A;  2XE4 A;  4NAA A;  3SVW D;  3FM0 A;  3JB9 L;  4AOW A;  4YVD A;  3U4Y A;  3K72 A;  2IUV A;  4A11 A;  3ZE1 A;  5AMS A;  5JWZ A;  1YFQ A;  1BPO A;  3JRO A;  5FLX g;  4PBZ A;  2CN3 A;  2QZP A;  1I2M B;  2AH0 A;  4XYH A;  5GMK n;  3HFQ A;  4GM3 A;  4O02 A;  2Z2N A;  3SWS D;  4JHN A;  3F3G A;  3MKQ A;  4QAM A;  4A09 B;  3OW8 A;  5HE3 B;  3AL8 A;  4JT5 C;  2PM6 B;  2B5L A;  3DXK C;  2I3S A;  3BG1 A;  3AH8 B;  2B4E A;  3JPX A;  4J0X A;  4K3J B;  5M5V A;  5TEE A;  3AL8 B;  5TEF A;  2CN2 A;  2B5M A;  4Z7Q A;  3PVW B;  5HE0 B;  1QNI A;  5SXM A;  5KDO B;  3B7F A;  4GZ8 A;  4D9S A;  4NSX A;  5B4W A;  2EIE A;  2EIC A;  4E54 A;  1UTC A;  4FA1 D;  3GC3 B;  3I7H A;  1E8N A;  5GXH A;  3CFS B;  4J8B A;  4NBM A;  2PM7 B;  4GQ2 P;  4FA4 D;  1L5G A;  1JV2 A;  3PXS D;  3PSC B;  2HU7 A;  4FA9 D;  5IC7 A;  2OK6 A;  3AL9 A;  4CY5 A;  3O4J A;  3T3P A;  4QL1 A;  3K27 A;  5FA5 B;  3FRX A;  3UVO A;  4X63 B;  3SLE D;  1N6D A;  2IUP A;  3IJ0 A;  2QR5 A;  4Y7R A;  4L3G D;  4A08 A;  4GMB A;  1SHY B;  5GSA A;  3EMH A;  2JKX A;  5IJ8 E;  5HQG A;  2VDM A;  4QRJ A;  4TZ4 A;  2OVP B;  4XEI C;  3ZDX A;  4X3E A;  2QXV A;  3I7K A;  3EI2 B;  3ODT A;  2P9K C;  4EWR A;  2H9M A;  4U1E I;  1B9Y A;  4O3U B;  5CYK B;  4AMZ A;  4E5Z A;  3DDU A;  1UOP A;  2VDQ A;  1XIP A;  3MKS B;  4X61 B;  5IGO A;  1VE6 A;  4G1E A;  4O9D A;  5AFU 3;  3UVN A;  4JHP C;  4A0A B;  2CE9 A;  2BCJ B;  4WK4 A;  4CZY A;  3IUQ A;  3E0C A;  4ZOY A;  3I89 A;  3IJE A;  2H6N A;  4J86 A;  1U2V C;  3I8E A;  1XHM A;  1VE7 A;  3EI1 B;  1XKS A;  3IUL A;  3NID A;  5FKS A;  3PSL A;  5EAL A;  1NR0 A;  3EI3 B;  4D0K A;  3V4V A;  1VYH C;  5EAM A;  5CXC A;  5I5I A;  2AGY A;  4O3T B;  2PM9 B;  1NEX B;  1B9X A;  3BWS A;  2UZX B;  5CXC B;  2W18 A;  5C86 A;  4J0W A;  3VH0 A;  3UR4 A;  4JSN C;  2Z2P A;  4BL0 A;  4NC4 A;  4ESG A;  3C99 A;  3SN6 B;  4CI3 A;  3K71 A;  4WK2 A;  3EI1 A;  3ZDY A;  2IAA A;  5IT9 g;  3FCU A;  4JT6 C;  5TDH B;  2XZG A;  2H9L A;  2HXC A;  5H14 A;  4O1Q D;  4RE6 A;  3NVN A;  3SBR A;  4DNW A;  3PXW D;  4ERZ A;  4LGN A;  4E54 B;  3DXM C;  3KCI A;  3BG0 A;  4CC9 A;  4CZV A;  4Z7N A;  3AFC A;  4AN1 A;  5IGQ A;  3DWL C;  4PBY A;  1SQ9 A;  4FAV D;  5CYK A;  4GGD A;  4PNK B;  4AN0 A;  2H6K A;  5A2Q g;  1PBY B;  2EBS A;  5EM2 A;  3OKW A;  3IVM A;  1U4C A;  4J78 A;  2MTA H;  3UVM A;  2YMU A;  2B5N A;  3RMZ D;  2GC7 A;  1PI6 A;  4BCC A;  2OJY A;  5FKT A;  4ES0 A;  5H17 A;  3IUM A;  2VDP A;  2CO0 A;  3SCY A;  1L0Q A;  4PC0 A;  3JZH A;  2IWF A;  3MXX A;  4JSX C;  1GOF A;  4KFM B;  3GFC A;  3T3M A;  3FGB A;  3UVK A;  4BCB A;  3JRP A;  3I2N A;  2AGL A;  4JSP C;  4GQ1 A;  4A08 B;  4GGA A;  2YNP A;  2CE8 A;  5EML B;  2AQ5 A;  4J8G A;  5FKQ A;  3JAM g;  1GG2 B;  4FA5 D;  3SXT D;  4FB1 D;  5M5R A;  1K32 A;  5FQD A;  3JZG A;  4ERY A;  2H9P A;  3IIW A;  4LG8 A;  2VDL A;  3OL2 B;  3J80 g;  2Z2O A;  2H13 A;  4G55 A;  4GM9 A;  3C5M A;  4UI9 R;  2WQ8 A;  2IUR A;  4L1M A;  4A7J A;  1JTD B;  4A0B B;  2VZ1 A;  2OVR B;  3PE7 A;  3RFH A;  1N6E A;  4CY3 A;  2HJB A;  1VZ3 A;  4Z8L A;  5TF2 A;  1ERJ A;  3MVD K;  3NIG A;  2HU5 A;  4CY2 A;  4ERQ A;  3N0D A;  2QC5 A;  3K26 A;  2P9U C;  3ZDZ A;  3O4G A;  3OTT A;  3QI0 A;  2H6Q A;  4K3I D;  4H5J A;  1GP2 B;  1GOT B;  3EQ7 A;  4JSV C;  4WJK A;  3MUN A;  4E5Z B;  4CY1 A;  4O2W A;  4PSW B;  1K3I A;  4BP8 A;  3C9C A;  3SMR A;  4FHL A;  3IKO A;  3EWE A;  4U7A A;  5EMK B;  3I7P A;  3IUJ A;  4DNV A;  2CNX A;  4GM8 A;  4A0A A;  2P9S C;  2HJ4 A;  1JJU B;  2VDO A;  5IJ7 E;  4UM8 A;  1TBG A;  3SJL D;  1P22 A;  4BP9 A;  3EQ9 A;  2EID A;  3VI3 A;  1N6F A;  5THA A;  3VI4 A;  5AJA A;  5HE1 B;  4ZOV A;  3VGZ A;  4OZU A;  1R5M A;  1TYE A;  2BBK H;  4N14 A;  3L4M D;  4MK0 B;  4XYI A;  4L1Q D;  4ZOZ A;  2VDN A;  4IRZ A;  3ZE0 A;  1OMW B;  3SBP A;  1PGU A;  1T2X A;  1E5T A;  2VDK A;  4GQB B;  4OWR A;  2EIB A;  1MDA H;  5M5S A;  2IWK A;  5GXI A;  3V9F A;  4I79 A;  1A0R B;  3ZWL B;  4J81 A;  4L3H D;  5HE2 B;  2I0R A;  2J57 G;  5FXY A;  2BKL A;  4IA9 A;  3JZN A;  5E6S A;  4MMY A;  4J79 A;  1JOF A;  4A2L A;  3SHF A;  2P9P C;  3A0F A;  4A2M A;  5EMJ B;  4CI8 A;  3NIF A;  2AH1 A;  3RFG A;  1SQJ A;  3EU7 A;  4R7A B;  1E8M A;  4QT8 A;  1JMX B;  2H14 A;  1GOG A;  4Y5R D;  2VC2 A;  3ZE2 A;  4G1M A;  2H68 A;  4NEN A;  1M1X A;  3OKY B;  3OKT A;  1GXR A;  2GC4 A;  2H3X A;  1Q47 A;  3F3F A;  1PEV A;  3MZL A;  2PM9 A;  1VZ2 A;  3GD1 I;  1A12 A;  3IIY A;  4JD2 C;  2YNN A;  3I7O A;  2I0S A;  1UOO A;  4QQE A;  2YBA A;  4GGC A; 
#chains in the Genus database with same CATH homology
 2AGW A;  3PVU B;  5C2W B;  3RSE C;  4BUJ C;  3EI4 A;  3IJC A;  5CXB A;  2P9N C;  3EG6 A;  2HKM A;  3V7D B;  1OLZ A;  4L9O A;  4PSX B;  5EMM B;  5H1M A;  3W15 A;  5FKR A;  5C2V B;  3UKR C;  2UZY B;  4AEZ A;  3VA6 A;  2J55 H;  3OKY A;  5I5J A;  3I7L A;  2G99 A;  3MZK A;  4JXM A;  1K8K C;  4O45 A;  2IUQ A;  2O9K A;  5C9Z B;  3NVQ A;  1TYQ C;  1MG2 A;  2OIZ A;  2P9I C;  3L4O D;  3MMY A;  2I3T A;  2PBI B;  3IJ1 A;  2AGX A;  3RN1 D;  4D6V A;  3EI4 B;  3ORV D;  3PXT D;  3GRE A;  1S4U X;  4A09 A;  3DSM A;  4FAN D;  2XYI A;  4CI2 A;  3SFZ A;  3J81 g;  4FWW A;  2I0T A;  2YB8 B;  3KRX B;  4LG9 A;  4G56 B;  3N0E A;  4J84 A;  2HYE A;  5K1C C;  3EI2 A;  5EAR A;  3DM0 A;  4A11 B;  5K19 A;  5HYN B;  1JMZ B;  5CXB B;  4J77 A;  5EM2 B;  4J82 A;  1RI6 A;  2OVQ B;  3F3P A;  3RRM C;  3UKU C;  4ZOX A;  4BH6 A;  2GNQ A;  2XL3 A;  3NVX A;  2Q7Q A;  3OL2 A;  2G9A A;  1MG3 A;  2CO0 C;  4H5I A;  3C75 H;  2H9N A;  2AGZ A;  3CFV A;  3I7N A;  4X60 B;  4J73 A;  4A0B A;  2OK4 A;  3I8C A;  2XU7 A;  3P4F A;  3SBQ A;  3KRW B;  2TRC B;  2YNO A;  3CIK B;  4ZN4 A;  3V5W B;  2J56 H;  3UVL A;  2XL2 A;  1FWX A;  5EAP A;  3RLM D;  4CI1 A;  4CZX A;  2HKR A;  3RN0 D;  2H47 A;  4PXW A;  2P9L C;  5I5M A;  4J87 A;  4IMM A;  4HDJ A;  2HES X;  3ULE C;  3EI3 A;  3SVW D;  3FM0 A;  3JB9 L;  4AOW A;  4YVD A;  3U4Y A;  2IUV A;  4A11 A;  5AMS A;  5JWZ A;  1YFQ A;  3JRO A;  5FLX g;  4PBZ A;  2CN3 A;  2AH0 A;  4XYH A;  5GMK n;  3HFQ A;  4GM3 A;  2Z2N A;  3SWS D;  3F3G A;  3MKQ A;  4A09 B;  3OW8 A;  5HE3 B;  3AL8 A;  4JT5 C;  2PM6 B;  2B5L A;  3DXK C;  2I3S A;  3BG1 A;  3AH8 B;  2B4E A;  3JPX A;  4J0X A;  4K3J B;  5TEE A;  3AL8 B;  5TEF A;  2CN2 A;  2B5M A;  3PVW B;  5HE0 B;  1QNI A;  5SXM A;  5KDO B;  3B7F A;  4GZ8 A;  4NSX A;  5B4W A;  4E54 A;  4FA1 D;  3I7H A;  5GXH A;  3CFS B;  4J8B A;  2PM7 B;  4GQ2 P;  4FA4 D;  3PXS D;  3PSC B;  4FA9 D;  5IC7 A;  2OK6 A;  3AL9 A;  4CY5 A;  4QL1 A;  3K27 A;  5FA5 B;  3FRX A;  3UVO A;  4X63 B;  3SLE D;  1N6D A;  2IUP A;  3IJ0 A;  4Y7R A;  4L3G D;  4A08 A;  4GMB A;  1SHY B;  5GSA A;  3EMH A;  5IJ8 E;  5HQG A;  4QRJ A;  4TZ4 A;  4XEI C;  2OVP B;  4X3E A;  2QXV A;  3I7K A;  3EI2 B;  3ODT A;  2P9K C;  4EWR A;  2H9M A;  4U1E I;  1B9Y A;  4O3U B;  5CYK B;  4E5Z A;  1XIP A;  3MKS B;  4X61 B;  5IGO A;  4O9D A;  5AFU 3;  3UVN A;  4A0A B;  2CE9 A;  2BCJ B;  4CZY A;  3E0C A;  4ZOY A;  3I89 A;  2H6N A;  4J86 A;  1U2V C;  3I8E A;  1XHM A;  3EI1 B;  1XKS A;  5FKS A;  3PSL A;  5EAL A;  1NR0 A;  3EI3 B;  4D0K A;  1VYH C;  5EAM A;  5CXC A;  5I5I A;  2AGY A;  4O3T B;  2PM9 B;  1NEX B;  1B9X A;  3BWS A;  2UZX B;  5CXC B;  2W18 A;  4J0W A;  3VH0 A;  3UR4 A;  4JSN C;  2Z2P A;  4BL0 A;  4ESG A;  3C99 A;  3SN6 B;  4CI3 A;  3EI1 A;  2IAA A;  5IT9 g;  4JT6 C;  5TDH B;  2H9L A;  2HXC A;  5H14 A;  4O1Q D;  3NVN A;  3SBR A;  3PXW D;  4ERZ A;  4LGN A;  4E54 B;  3DXM C;  3BG0 A;  4CC9 A;  4CZV A;  5IGQ A;  3AFC A;  3DWL C;  4PBY A;  1SQ9 A;  4FAV D;  5CYK A;  4GGD A;  4PNK B;  5A2Q g;  2H6K A;  1PBY B;  2EBS A;  5EM2 A;  3OKW A;  1U4C A;  4J78 A;  2MTA H;  3UVM A;  2YMU A;  2B5N A;  3RMZ D;  2GC7 A;  1PI6 A;  2OJY A;  5FKT A;  4ES0 A;  5H17 A;  2CO0 A;  3SCY A;  1L0Q A;  4PC0 A;  3JZH A;  2IWF A;  3MXX A;  4JSX C;  4KFM B;  3GFC A;  3FGB A;  3UVK A;  3JRP A;  3I2N A;  2AGL A;  4JSP C;  4GQ1 A;  4A08 B;  4GGA A;  2YNP A;  2CE8 A;  5EML B;  2AQ5 A;  4J8G A;  5FKQ A;  3JAM g;  1GG2 B;  4FA5 D;  3SXT D;  4FB1 D;  1K32 A;  5FQD A;  3JZG A;  4ERY A;  2H9P A;  3IIW A;  4LG8 A;  3OL2 B;  3J80 g;  2Z2O A;  2H13 A;  4GM9 A;  3C5M A;  4UI9 R;  2IUR A;  4A7J A;  4A0B B;  2OVR B;  3PE7 A;  3RFH A;  1N6E A;  4CY3 A;  2HJB A;  4Z8L A;  5TF2 A;  1ERJ A;  4CY2 A;  4ERQ A;  3N0D A;  2QC5 A;  3K26 A;  2P9U C;  3OTT A;  2H6Q A;  4K3I D;  4H5J A;  1GP2 B;  1GOT B;  4JSV C;  4E5Z B;  4CY1 A;  4PSW B;  3C9C A;  3SMR A;  4FHL A;  3IKO A;  3EWE A;  4U7A A;  5EMK B;  3I7P A;  2CNX A;  4GM8 A;  4A0A A;  2P9S C;  2HJ4 A;  1JJU B;  5IJ7 E;  1TBG A;  3SJL D;  1P22 A;  1N6F A;  5THA A;  5AJA A;  5HE1 B;  4ZOV A;  3VGZ A;  4OZU A;  1R5M A;  2BBK H;  4N14 A;  3L4M D;  4MK0 B;  4XYI A;  4L1Q D;  4ZOZ A;  1OMW B;  3SBP A;  1PGU A;  4GQB B;  4OWR A;  1MDA H;  2IWK A;  5GXI A;  3V9F A;  4I79 A;  1A0R B;  3ZWL B;  4J81 A;  4L3H D;  5HE2 B;  2I0R A;  2J57 G;  5FXY A;  4IA9 A;  3JZN A;  4J79 A;  1JOF A;  4A2L A;  3SHF A;  2P9P C;  3A0F A;  4A2M A;  5EMJ B;  4CI8 A;  2AH1 A;  3RFG A;  1SQJ A;  3EU7 A;  4R7A B;  4QT8 A;  1JMX B;  2H14 A;  4Y5R D;  2H68 A;  3OKY B;  3OKT A;  1GXR A;  2GC4 A;  2H3X A;  1Q47 A;  3F3F A;  1PEV A;  2PM9 A;  3MZL A;  3IIY A;  4JD2 C;  2YNN A;  3I7O A;  2I0S A;  4QQE A;  2YBA A;  4GGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...