4O1QD

Crystal structure of the q103n-maug/pre-methylamine dehydrogenase complex
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Methylamine utilization protein MauG
publication title Site-directed mutagenesis of Gln103 reveals the influence of this residue on the redox properties and stability of MauG.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 85
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2013-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4o1qD00
3N0DA 2YNPA 4A08B 5HYNB 2H14A 4JSPC 4G56B 1JOFA 4X61B 4YVDA 4E5ZB 4OWRA 3C9CA 5EM2A 4H5IA 4A11A 4TZ4A 1K32A 4J79A 1QNIA 5HE1B 4CY5A 4ERZA 1R5MA 1U2VC 5CXCA 5IJ8E 4J87A 3SWSD 2H9NA 3EMHA 4J86A 5GMKn 4JT6C 1TYQC 2Z2OA 2UZYB 3OKYB 3EI2A 1RI6A 2H9LA 2AGZA 4IA9A 3EG6A 3RFHA 1GG2B 2J56H 2H3XA 3AFCA 3JRPA 4FWWA 2AGXA 4HDJA 4X60B 2IUPA 1B9YA 4Y5RD 5I5MA 3B7FA 5I5JA 5TEFA 3OTTA 4GQ1A 3RN1D 4J81A 3V7DB 5AJAA 2XL3A 3OL2A 5TEEA 2CN2A 4QL1A 3EI1A 4ES0A 2H47A 2HKRA 3L4MD 4LGNA 1S4UX 3V5WB 4JT5C 2BCJB 2GC4A 5GSAA 5HE0B 1N6DA 3JZGA 3L4OD 4K3ID 2YBAA 2H6NA 5H1MA 4O45A 3ZWLB 3I7NA 1SHYB 3NVQA 1OLZA 2P9KC 4AOWA 4NSXA 1JJUB 4J84A 4PBZA 3UVLA 3C75H 2YB8B 3MMYA 4A11B 5EM2B 3RFGA 4FA9D 3OW8A 5H17A 1K8KC 3PXTD 3ULEC 2Z2NA 5CXBA 4A0BB 5CYKB 1JMZB 4CY3A 3IIYA 3OKWA 2QXVA 1U4CA 2HYEA 2P9SC 4FA5D 5FXYA 2H6QA 2XU7A 4ERYA 4A09A 5HQGA 2Q7QA 5FQDA 4L3HD 3P4FA 1GP2B 1JMXB 3JROA 3JB9L 4BL0A 2TRCB 4GGDA 4JD2C 4IMMA 3NVNA 2QC5A 4AEZA 5HE2B 3UVOA 4J0XA 2G9AA 4UI9R 1MG3A 3F3PA 3OL2B 3EI1B 2XYIA 2OVQB 1ERJA 3FRXA 3UVMA 5K1CC 2I0SA 2I0TA 2PM6B 4FAND 1VYHC 5C9ZB 4CZVA 4BH6A 3JZHA 4O3UB 3DSMA 3K27A 2PM9B 4J78A 2OK4A 5C2WB 3JPXA 3DXKC 1Q47A 4GM9A 4GGCA 4GM8A 4XYHA 4ZOVA 2OK6A 1NR0A 4ZOZA 3AL8A 5K19A 3C99A 2HJ4A 4PC0A 2YMUA 3KRWB 2IWFA 2XL2A 3UKRC 2PM7B 3FGBA 4Y7RA 3CIKB 2CN3A 5FKTA 3IIWA 3SBPA 1A0RB 4O9DA 1N6EA 2IWKA 4CI3A 2AQ5A 2P9LC 3AH8B 4ZN4A 2CO0C 1NEXB 3J80g 4Z8LA 3SXTD 3UVKA 2OVRB 3EI3A 3RRMC 1PEVA 5GXHA 3OKTA 4D0KA 3DXMC 3C5MA 1GXRA 4J73A 3EU7A 2AGLA 3UKUC 3I2NA 4J8BA 5IC7A 4E54B 5TDHB 4A2LA 2H6KA 5THAA 4QRJA 4LG9A 4J8GA 2HJBA 4XEIC 2J55H 4GZ8A 3IJ0A 3KRXB 3GFCA 3U4YA 3AL9A 4XYIA 3K26A 2Z2PA 4MK0B 2P9NC 3IKOA 5SXMA 3VH0A 5IGQA 3HFQA 4CI2A 1B9XA 3I7HA 5CXCB 4L3GD 4E5ZA 1SQJA 3I89A 2P9PC 2AGYA 4ZOXA 3EI2B 3F3FA 1L0QA 4CZXA 3NVXA 2I3TA 4ZOYA 4GQBB 3JZNA 4H5JA 1FWXA 3I8EA 5FLXg 4O3TB 1XIPA 3SBRA 3I7PA 5IJ7E 2GC7A 4FA4D 3OKYA 3PXWD 3V9FA 4LG8A 4A7JA 4KFMB 5FA5B 2H68A 4CC9A 3RLMD 4J77A 4JXMA 2CNXA 3EI4A 2B5MA 4PNKB 5HE3B 4JSVC 3J81g 4L9OA 4U7AA 3MKQA 3I7OA 5B4WA 2AH0A 1MG2A 5IGOA 3SVWD 3PE7A 4QT8A 4A2MA 4I79A 3SHFA 3MKSB 3MZLA 4N14A 4CI8A 4QQEA 4GQ2P 3N0EA 2B5LA 4CZYA 2IURA 1PBYB 3SJLD 2G99A 2AGWA 2OVPB 4R7AB 2B5NA 2IUVA 3PSLA 5AMSA 4L1QD 3IJ1A 3RMZD 3DWLC 4FAVD 2CE8A 5FKRA 1GOTB 5CXBB 5EALA 4X3EA 4CY1A 2H13A 2I3SA 1P22A 4JSNC 3ODTA 5EARA 4CY2A 4PSXB 3CFVA 5C2VB 3SFZA 2P9UC 4A09B 3VGZA 4A0BA 5CYKA 4K3JB 3FM0A 4BUJC 4OZUA 4PXWA 2HESX 4A0AA 3CFSB 4J0WA 3PVUB 1PI6A 3F3GA 5FKQA 3EI4B 5IT9g 1N6FA 1OMWB 2MTAH 5EMMB 2B4EA 3UR4A 4ERQA 3SLED 3GREA 2YNOA 4ESGA 3VA6A 4GGAA 4J82A 3SMRA 3MXXA 4JSXC 2OJYA 4D6VA 5KDOB 3ORVD 4GMBA 2I0RA 3BG0A 4PBYA 1XHMA 3I7LA 4A08A 2YNNA 5EAPA 4FA1D 3EWEA 3AL8B 5I5IA 4PSWB 4X63B 5AFU3 2PM9A 3RN0D 5FKSA 2CE9A 1YFQA 2CO0A 3PVWB 2HKMA 3I8CA 3E0CA 2H9PA 2J57G 5EMLB 3I7KA 2PBIB 3SN6B 2EBSA 2H9MA 4CI1A 2IAAA 1TBGA 3SCYA 1SQ9A 5JWZA 2GNQA 5GXIA 5EMJB 5TF2A 3BWSA 5EAMA 3SBQA 1XKSA 3EI3B 3RSEC 4GM3A 1MDAH 3MZKA 2BBKH 2OIZA 3A0FA 4A0AB 5A2Qg 3UVNA 3PSCB 2P9IC 3BG1A 2IUQA 4EWRA 2HXCA 3IJCA 3W15A 2W18A 3JAMg 3DM0A 4U1EI 2AH1A 4FB1D 4O1QD 2O9KA 2UZXB 5H14A 5EMKB 3PXSD 4E54A 4FHLA 1PGUA
chains in the Genus database with same CATH superfamily
3N0DA 2YNPA 4A08B 1GOHA 2EIEA 5HYNB 3O4HA 1M1XA 1H2ZA 2H14A 4JSPC 1H2WA 4G56B 1JOFA 4WK0A 4X61B 5HDBA 4NAAA 4YVDA 5M5TA 4E5ZB 4OWRA 3C9CA 5EM2A 4H5IA 4A11A 4TZ4A 1K32A 4J79A 1QNIA 5HE1B 4CY5A 4ERZA 1R5MA 1U2VC 5CXCA 3KCIA 5IJ8E 4J87A 3SWSD 2H9NA 3QI0A 3EMHA 4J86A 5GMKn 4JT6C 1TYQC 2Z2OA 2UZYB 3OKYB 4O02A 3EI2A 3MUNA 1RI6A 2H9LA 2AGZA 4IA9A 3EG6A 3RFHA 1GG2B 2J56H 3T3PA 2H3XA 3AFCA 4BCCA 1C9IA 3JRPA 4FWWA 2AGXA 3O4IA 4HDJA 2VDKA 4BCBA 4X60B 2IUPA 1O6GA 5FFOA 4MMYA 1B9YA 4Y5RD 5I5MA 3B7FA 5I5JA 5TEFA 3VI3A 3OTTA 4GQ1A 3RN1D 4J81A 3V7DB 5AJAA 2XL3A 3OL2A 5TEEA 3NIGA 2CN2A 4QL1A 3EI1A 2VDLA 2XE4A 4ES0A 2H47A 2HKRA 3L4MD 4LGNA 1S4UX 3V5WB 4JT5C 2VC2A 2BCJB 2GC4A 1VZ2A 5GSAA 5HE0B 1N6DA 3JZGA 3L4OD 4MMZA 4K3ID 2YBAA 2H6NA 5H1MA 4O45A 5M5RA 1VE6A 4IRZA 3ZWLB 3I7NA 5M5SA 1SHYB 3T3MA 3NVQA 1OLZA 2P9KC 4AOWA 4NSXA 1JJUB 4J84A 4PBZA 3UVLA 3C75H 2YB8B 3MMYA 4A11B 5EM2B 2JKXA 3RFGA 4FA9D 2WQ8A 1UOPA 4Z7OA 3OW8A 5H17A 1K8KC 3PXTD 3ULEC 2Z2NA 2QR5A 5CXBA 5CYKB 4A0BB 2HU7A 1JMZB 4CY3A 3IIYA 3OKWA 2QXVA 4RE5A 1U4CA 2HYEA 2P9SC 4FA5D 5FXYA 2H6QA 2XU7A 4Z7QA 4ERYA 4A09A 5HQGA 2VDPA 2Q7QA 5FQDA 4L3HD 3P4FA 1GP2B 1JMXB 3JROA 3K6SA 4AN1A 3JB9L 4BL0A 2TRCB 4GGDA 4JD2C 4IMMA 3GD1I 3NVNA 2QC5A 4AEZA 5HE2B 3UVOA 4J0XA 4AMZA 4BP8A 2G9AA 4UI9R 5FFGA 1MG3A 3F3PA 3NIDA 3OL2B 2VZ3A 3EI1B 4DNWA 2XYIA 2OVQB 1ERJA 2HU5A 3FRXA 1YR2A 3UVMA 4BP9A 4NBMA 5K1CC 2I0SA 2I0TA 2PM6B 4FAND 1VYHC 3EQ8A 5C9ZB 4CZVA 4BH6A 3JZHA 4O3UB 3DSMA 3K27A 2PM9B 4NC4A 4J78A 2OK4A 5C2WB 3JPXA 3DXKC 1Q47A 4GM9A 2VDNA 4GGCA 4GM8A 4XYHA 4ZOVA 2OK6A 5M5VA 1NR0A 4ZOZA 3IVMA 3V4PA 3AL8A 4JHNA 5K19A 3C99A 2HJ4A 4PC0A 2YMUA 3KRWB 2IWFA 2XL2A 3UKRC 2PM7B 3FGBA 4Y7RA 3CIKB 2CN3A 5FKTA 3IIWA 3SBPA 1A0RB 4O9DA 3V4VA 3MVDK 3K71A 1N6EA 3GC3B 3IUQA 2IWKA 4NENA 4CI3A 2AQ5A 2P9LC 4WJKA 3AH8B 1H2XA 4ZN4A 2CO0C 1NEXB 4DNVA 3J80g 4Z8LA 3SXTD 3UVKA 2OVRB 3EI3A 1UOOA 3RRMC 1VE7A 1PEVA 5GXHA 3OKTA 4D0KA 3DXMC 3C5MA 3IUMA 1GXRA 4J73A 3EU7A 2AGLA 4L1MA 3UKUC 3I2NA 4J8BA 5IC7A 5E6RA 5M5UA 1QFMA 1H2YA 1C9LA 4E54B 5TDHB 4A2LA 4G55A 2EIBA 2H6KA 5THAA 1GOFA 4QRJA 4LG9A 4J8GA 3ZE1A 5C92A 2HJBA 3EQ9A 2J55H 4GZ8A 4XEIC 3IJ0A 3KRXB 3GFCA 3OF7A 3U4YA 3AL9A 4XYIA 2VDRA 3K26A 2Z2PA 4G1MA 4MK0B 2P9NC 1E8MA 3IKOA 1A12A 5SXMA 3VH0A 5IGQA 3HFQA 4CI2A 1B9XA 3I7HA 5CXCB 3ZE0A 2XZGA 4L3GD 4E5ZA 1SQJA 3I89A 2P9PC 2AGYA 4ZOXA 3EI2B 3F3FA 1L0QA 4CZXA 1T2XA 2I3TA 3NVXA 4ZOYA 4GQBB 3JZNA 4H5JA 1FWXA 3I8EA 5FLXg 4O3TB 1XIPA 2EIDA 3SBRA 3I7PA 5IJ7E 2GC7A 3ZE2A 4FA4D 4QAMA 3OKYA 3FCSA 3PXWD 3V9FA 4LG8A 4A7JA 4KFMB 5FA5B 2H68A 4CC9A 3RLMD 4J77A 4JXMA 3IJEA 2CNXA 3EI4A 2B5MA 4PNKB 5HE3B 3QHYB 4JSVC 3J81g 4L9OA 1VZ3A 3IUJA 3MKQA 3I7OA 4U7AA 5B4WA 2AH0A 1MG2A 5IGOA 3SVWD 3PE7A 4WK2A 4QT8A 4A2MA 1UTCA 4I79A 3SHFA 3MKSB 3MZLA 4N14A 5C86A 5M61A 4CI8A 1E8NA 4QQEA 4GQ2P 3N0EA 2B5LA 4CZYA 3FCUA 5E6SA 4AX4A 2IURA 1PBYB 3SJLD 4AMYA 2G99A 2AGWA 1JTDB 2OVPB 3IULA 4R7AB 3K72A 2B5NA 2IUVA 3PSLA 5AMSA 4L1QD 4O2WA 3IJ1A 3RMZD 3DWLC 3VI4A 4FAVD 1BPOA 2CE8A 5FKRA 4JHPC 1GOTB 5CXBB 3O4GA 4X3EA 5EALA 1TYEA 4CY1A 3NIFA 2H13A 2I3SA 2VDOA 1P22A 4JSNC 3ODTA 5EARA 4CY2A 4PSXB 3CFVA 5C2VB 3SFZA 2P9UC 4A09B 3VGZA 4A0BA 3IURA 5CYKA 4G1EA 4K3JB 3FM0A 4BUJC 4OZUA 4PXWA 2HESX 4UM8A 4A0AA 3O4JA 3CFSB 4J0WA 3PVUB 1PI6A 1QFSA 3F3GA 4WK4A 5FKQA 3EI4B 5IT9g 1N6FA 1OMWB 2MTAH 5EMMB 2B4EA 3UR4A 4ERQA 3SLED 3GREA 2BKLA 2YNOA 2VDQA 3EQ7A 4ESGA 3VA6A 4GGAA 4J82A 3SMRA 3MXXA 4JSXC 2OJYA 4D6VA 5KDOB 3ORVD 2VDMA 4GMBA 1JV2A 3ZDYA 2I0RA 3BG0A 1K3IA 4PBYA 1XHMA 3I7LA 4Z7NA 4A08A 1I2MB 2YNNA 5EAPA 3MUOA 4FA1D 3EWEA 3AL8B 5I5IA 4PSWB 4X63B 5AFU3 2PM9A 3RN0D 1E5TA 5FKSA 3DDUA 2CE9A 1YFQA 2CO0A 3PVWB 2HKMA 3I8CA 3E0CA 2H9PA 2J57G 5EMLB 3I7KA 2PBIB 3SN6B 2EBSA 2H9MA 4CI1A 2IAAA 1TBGA 3SCYA 1SQ9A 5JWZA 2GNQA 5GXIA 5EMJB 5TF2A 3BWSA 1U8CA 5EAMA 2QZPA 3SBQA 1XKSA 3EI3B 4D9SA 3ZDZA 3RSEC 4GM3A 1MDAH 4DNUA 1GOGA 3MZKA 2BBKH 5E6UA 3ZDXA 2OIZA 3A0FA 4A0AB 5A2Qg 3UVNA 3PSCB 2P9IC 3BG1A 4RE6A 2IUQA 3IUNA 4EWRA 2VZ1A 1UOQA 2HXCA 3IJCA 1O6FA 3W15A 1L5GA 2W18A 4MMXA 3JAMg 3DM0A 4U1EI 4AN0A 2AH1A 2XDWA 4UM9A 4FB1D 4BCDA 4O1QD 2HU8A 2O9KA 2UZXB 5H14A 5EMKB 3PXSD 2EICA 4E54A 4FHLA 1PGUA
chains in the Genus database with same CATH topology
3N0DA 2YNPA 4A08B 5HYNB 2H14A 4JSPC 4G56B 1JOFA 4X61B 4YVDA 4E5ZB 4OWRA 3C9CA 5EM2A 4H5IA 4A11A 4TZ4A 1K32A 4J79A 1QNIA 5HE1B 4CY5A 4ERZA 1R5MA 1U2VC 5CXCA 5IJ8E 4J87A 3SWSD 2H9NA 3EMHA 4J86A 5GMKn 4JT6C 1TYQC 2Z2OA 2UZYB 3OKYB 3EI2A 1RI6A 2H9LA 2AGZA 4IA9A 3EG6A 3RFHA 1GG2B 2J56H 2H3XA 3AFCA 3JRPA 4FWWA 2AGXA 4HDJA 4X60B 2IUPA 1B9YA 4Y5RD 5I5MA 3B7FA 5I5JA 5TEFA 3OTTA 4GQ1A 3RN1D 4J81A 3V7DB 5AJAA 2XL3A 3OL2A 5TEEA 2CN2A 4QL1A 3EI1A 4ES0A 2H47A 2HKRA 3L4MD 4LGNA 1S4UX 3V5WB 4JT5C 2BCJB 2GC4A 5GSAA 5HE0B 1N6DA 3JZGA 3L4OD 4K3ID 2YBAA 2H6NA 5H1MA 4O45A 3ZWLB 3I7NA 1SHYB 3NVQA 1OLZA 2P9KC 4AOWA 4NSXA 1JJUB 4J84A 4PBZA 3UVLA 3C75H 2YB8B 3MMYA 4A11B 5EM2B 3RFGA 4FA9D 3OW8A 5H17A 1K8KC 3PXTD 3ULEC 2Z2NA 5CXBA 4A0BB 5CYKB 1JMZB 4CY3A 3IIYA 3OKWA 2QXVA 1U4CA 2HYEA 2P9SC 4FA5D 5FXYA 2H6QA 2XU7A 4ERYA 4A09A 5HQGA 2Q7QA 5FQDA 4L3HD 3P4FA 1GP2B 1JMXB 3JROA 3JB9L 4BL0A 2TRCB 4GGDA 4JD2C 4IMMA 3NVNA 2QC5A 4AEZA 5HE2B 3UVOA 4J0XA 2G9AA 4UI9R 1MG3A 3F3PA 3OL2B 3EI1B 2XYIA 2OVQB 1ERJA 3FRXA 3UVMA 5K1CC 2I0SA 2I0TA 2PM6B 4FAND 1VYHC 5C9ZB 4CZVA 4BH6A 3JZHA 4O3UB 3DSMA 3K27A 2PM9B 4J78A 2OK4A 5C2WB 3JPXA 3DXKC 1Q47A 4GM9A 4GGCA 4GM8A 4XYHA 4ZOVA 2OK6A 1NR0A 4ZOZA 3AL8A 5K19A 3C99A 2HJ4A 4PC0A 2YMUA 3KRWB 2IWFA 2XL2A 3UKRC 2PM7B 3FGBA 4Y7RA 3CIKB 2CN3A 5FKTA 3IIWA 3SBPA 1A0RB 4O9DA 1N6EA 2IWKA 4CI3A 2AQ5A 2P9LC 3AH8B 4ZN4A 2CO0C 1NEXB 3J80g 4Z8LA 3SXTD 3UVKA 2OVRB 3EI3A 3RRMC 1PEVA 5GXHA 3OKTA 4D0KA 3DXMC 3C5MA 1GXRA 4J73A 3EU7A 2AGLA 3UKUC 3I2NA 4J8BA 5IC7A 4E54B 5TDHB 4A2LA 2H6KA 5THAA 4QRJA 4LG9A 4J8GA 2HJBA 4XEIC 2J55H 4GZ8A 3IJ0A 3KRXB 3GFCA 3U4YA 3AL9A 4XYIA 3K26A 2Z2PA 4MK0B 2P9NC 3IKOA 5SXMA 3VH0A 5IGQA 3HFQA 4CI2A 1B9XA 3I7HA 5CXCB 4L3GD 4E5ZA 1SQJA 3I89A 2P9PC 2AGYA 4ZOXA 3EI2B 3F3FA 1L0QA 4CZXA 3NVXA 2I3TA 4ZOYA 4GQBB 3JZNA 4H5JA 1FWXA 3I8EA 5FLXg 4O3TB 1XIPA 3SBRA 3I7PA 5IJ7E 2GC7A 4FA4D 3OKYA 3PXWD 3V9FA 4LG8A 4A7JA 4KFMB 5FA5B 2H68A 4CC9A 3RLMD 4J77A 4JXMA 2CNXA 3EI4A 2B5MA 4PNKB 5HE3B 4JSVC 3J81g 4L9OA 4U7AA 3MKQA 3I7OA 5B4WA 2AH0A 1MG2A 5IGOA 3SVWD 3PE7A 4QT8A 4A2MA 4I79A 3SHFA 3MKSB 3MZLA 4N14A 4CI8A 4QQEA 4GQ2P 3N0EA 2B5LA 4CZYA 2IURA 1PBYB 3SJLD 2G99A 2AGWA 2OVPB 4R7AB 2B5NA 2IUVA 3PSLA 5AMSA 4L1QD 3IJ1A 3RMZD 3DWLC 4FAVD 2CE8A 5FKRA 1GOTB 5CXBB 5EALA 4X3EA 4CY1A 2H13A 2I3SA 1P22A 4JSNC 3ODTA 5EARA 4CY2A 4PSXB 3CFVA 5C2VB 3SFZA 2P9UC 4A09B 3VGZA 4A0BA 5CYKA 4K3JB 3FM0A 4BUJC 4OZUA 4PXWA 2HESX 4A0AA 3CFSB 4J0WA 3PVUB 1PI6A 3F3GA 5FKQA 3EI4B 5IT9g 1N6FA 1OMWB 2MTAH 5EMMB 2B4EA 3UR4A 4ERQA 3SLED 3GREA 2YNOA 4ESGA 3VA6A 4GGAA 4J82A 3SMRA 3MXXA 4JSXC 2OJYA 4D6VA 5KDOB 3ORVD 4GMBA 2I0RA 3BG0A 4PBYA 1XHMA 3I7LA 4A08A 2YNNA 5EAPA 4FA1D 3EWEA 3AL8B 5I5IA 4PSWB 4X63B 5AFU3 2PM9A 3RN0D 5FKSA 2CE9A 1YFQA 2CO0A 3PVWB 2HKMA 3I8CA 3E0CA 2H9PA 2J57G 5EMLB 3I7KA 2PBIB 3SN6B 2EBSA 2H9MA 4CI1A 2IAAA 1TBGA 3SCYA 1SQ9A 5JWZA 2GNQA 5GXIA 5EMJB 5TF2A 3BWSA 5EAMA 3SBQA 1XKSA 3EI3B 3RSEC 4GM3A 1MDAH 3MZKA 2BBKH 2OIZA 3A0FA 4A0AB 5A2Qg 3UVNA 3PSCB 2P9IC 3BG1A 2IUQA 4EWRA 2HXCA 3IJCA 3W15A 2W18A 3JAMg 3DM0A 4U1EI 2AH1A 4FB1D 4O1QD 2O9KA 2UZXB 5H14A 5EMKB 3PXSD 4E54A 4FHLA 1PGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N0D A;  2YNP A;  4A08 B;  5HYN B;  2H14 A;  4JSP C;  4G56 B;  1JOF A;  4X61 B;  4YVD A;  4E5Z B;  4OWR A;  3C9C A;  5EM2 A;  4H5I A;  4A11 A;  4TZ4 A;  1K32 A;  4J79 A;  1QNI A;  5HE1 B;  4CY5 A;  4ERZ A;  1R5M A;  1U2V C;  5CXC A;  5IJ8 E;  4J87 A;  3SWS D;  2H9N A;  3EMH A;  4J86 A;  5GMK n;  4JT6 C;  1TYQ C;  2Z2O A;  2UZY B;  3OKY B;  3EI2 A;  1RI6 A;  2H9L A;  2AGZ A;  4IA9 A;  3EG6 A;  3RFH A;  1GG2 B;  2J56 H;  2H3X A;  3AFC A;  3JRP A;  4FWW A;  2AGX A;  4HDJ A;  4X60 B;  2IUP A;  1B9Y A;  4Y5R D;  5I5M A;  3B7F A;  5I5J A;  5TEF A;  3OTT A;  4GQ1 A;  3RN1 D;  4J81 A;  3V7D B;  5AJA A;  2XL3 A;  3OL2 A;  5TEE A;  2CN2 A;  4QL1 A;  3EI1 A;  4ES0 A;  2H47 A;  2HKR A;  3L4M D;  4LGN A;  1S4U X;  3V5W B;  4JT5 C;  2BCJ B;  2GC4 A;  5GSA A;  5HE0 B;  1N6D A;  3JZG A;  3L4O D;  4K3I D;  2YBA A;  2H6N A;  5H1M A;  4O45 A;  3ZWL B;  3I7N A;  1SHY B;  3NVQ A;  1OLZ A;  2P9K C;  4AOW A;  4NSX A;  1JJU B;  4J84 A;  4PBZ A;  3UVL A;  3C75 H;  2YB8 B;  3MMY A;  4A11 B;  5EM2 B;  3RFG A;  4FA9 D;  3OW8 A;  5H17 A;  1K8K C;  3PXT D;  3ULE C;  2Z2N A;  5CXB A;  4A0B B;  5CYK B;  1JMZ B;  4CY3 A;  3IIY A;  3OKW A;  2QXV A;  1U4C A;  2HYE A;  2P9S C;  4FA5 D;  5FXY A;  2H6Q A;  2XU7 A;  4ERY A;  4A09 A;  5HQG A;  2Q7Q A;  5FQD A;  4L3H D;  3P4F A;  1GP2 B;  1JMX B;  3JRO A;  3JB9 L;  4BL0 A;  2TRC B;  4GGD A;  4JD2 C;  4IMM A;  3NVN A;  2QC5 A;  4AEZ A;  5HE2 B;  3UVO A;  4J0X A;  2G9A A;  4UI9 R;  1MG3 A;  3F3P A;  3OL2 B;  3EI1 B;  2XYI A;  2OVQ B;  1ERJ A;  3FRX A;  3UVM A;  5K1C C;  2I0S A;  2I0T A;  2PM6 B;  4FAN D;  1VYH C;  5C9Z B;  4CZV A;  4BH6 A;  3JZH A;  4O3U B;  3DSM A;  3K27 A;  2PM9 B;  4J78 A;  2OK4 A;  5C2W B;  3JPX A;  3DXK C;  1Q47 A;  4GM9 A;  4GGC A;  4GM8 A;  4XYH A;  4ZOV A;  2OK6 A;  1NR0 A;  4ZOZ A;  3AL8 A;  5K19 A;  3C99 A;  2HJ4 A;  4PC0 A;  2YMU A;  3KRW B;  2IWF A;  2XL2 A;  3UKR C;  2PM7 B;  3FGB A;  4Y7R A;  3CIK B;  2CN3 A;  5FKT A;  3IIW A;  3SBP A;  1A0R B;  4O9D A;  1N6E A;  2IWK A;  4CI3 A;  2AQ5 A;  2P9L C;  3AH8 B;  4ZN4 A;  2CO0 C;  1NEX B;  3J80 g;  4Z8L A;  3SXT D;  3UVK A;  2OVR B;  3EI3 A;  3RRM C;  1PEV A;  5GXH A;  3OKT A;  4D0K A;  3DXM C;  3C5M A;  1GXR A;  4J73 A;  3EU7 A;  2AGL A;  3UKU C;  3I2N A;  4J8B A;  5IC7 A;  4E54 B;  5TDH B;  4A2L A;  2H6K A;  5THA A;  4QRJ A;  4LG9 A;  4J8G A;  2HJB A;  4XEI C;  2J55 H;  4GZ8 A;  3IJ0 A;  3KRX B;  3GFC A;  3U4Y A;  3AL9 A;  4XYI A;  3K26 A;  2Z2P A;  4MK0 B;  2P9N C;  3IKO A;  5SXM A;  3VH0 A;  5IGQ A;  3HFQ A;  4CI2 A;  1B9X A;  3I7H A;  5CXC B;  4L3G D;  4E5Z A;  1SQJ A;  3I89 A;  2P9P C;  2AGY A;  4ZOX A;  3EI2 B;  3F3F A;  1L0Q A;  4CZX A;  3NVX A;  2I3T A;  4ZOY A;  4GQB B;  3JZN A;  4H5J A;  1FWX A;  3I8E A;  5FLX g;  4O3T B;  1XIP A;  3SBR A;  3I7P A;  5IJ7 E;  2GC7 A;  4FA4 D;  3OKY A;  3PXW D;  3V9F A;  4LG8 A;  4A7J A;  4KFM B;  5FA5 B;  2H68 A;  4CC9 A;  3RLM D;  4J77 A;  4JXM A;  2CNX A;  3EI4 A;  2B5M A;  4PNK B;  5HE3 B;  4JSV C;  3J81 g;  4L9O A;  4U7A A;  3MKQ A;  3I7O A;  5B4W A;  2AH0 A;  1MG2 A;  5IGO A;  3SVW D;  3PE7 A;  4QT8 A;  4A2M A;  4I79 A;  3SHF A;  3MKS B;  3MZL A;  4N14 A;  4CI8 A;  4QQE A;  4GQ2 P;  3N0E A;  2B5L A;  4CZY A;  2IUR A;  1PBY B;  3SJL D;  2G99 A;  2AGW A;  2OVP B;  4R7A B;  2B5N A;  2IUV A;  3PSL A;  5AMS A;  4L1Q D;  3IJ1 A;  3RMZ D;  3DWL C;  4FAV D;  2CE8 A;  5FKR A;  1GOT B;  5CXB B;  5EAL A;  4X3E A;  4CY1 A;  2H13 A;  2I3S A;  1P22 A;  4JSN C;  3ODT A;  5EAR A;  4CY2 A;  4PSX B;  3CFV A;  5C2V B;  3SFZ A;  2P9U C;  4A09 B;  3VGZ A;  4A0B A;  5CYK A;  4K3J B;  3FM0 A;  4BUJ C;  4OZU A;  4PXW A;  2HES X;  4A0A A;  3CFS B;  4J0W A;  3PVU B;  1PI6 A;  3F3G A;  5FKQ A;  3EI4 B;  5IT9 g;  1N6F A;  1OMW B;  2MTA H;  5EMM B;  2B4E A;  3UR4 A;  4ERQ A;  3SLE D;  3GRE A;  2YNO A;  4ESG A;  3VA6 A;  4GGA A;  4J82 A;  3SMR A;  3MXX A;  4JSX C;  2OJY A;  4D6V A;  5KDO B;  3ORV D;  4GMB A;  2I0R A;  3BG0 A;  4PBY A;  1XHM A;  3I7L A;  4A08 A;  2YNN A;  5EAP A;  4FA1 D;  3EWE A;  3AL8 B;  5I5I A;  4PSW B;  4X63 B;  5AFU 3;  2PM9 A;  3RN0 D;  5FKS A;  2CE9 A;  1YFQ A;  2CO0 A;  3PVW B;  2HKM A;  3I8C A;  3E0C A;  2H9P A;  2J57 G;  5EML B;  3I7K A;  2PBI B;  3SN6 B;  2EBS A;  2H9M A;  4CI1 A;  2IAA A;  1TBG A;  3SCY A;  1SQ9 A;  5JWZ A;  2GNQ A;  5GXI A;  5EMJ B;  5TF2 A;  3BWS A;  5EAM A;  3SBQ A;  1XKS A;  3EI3 B;  3RSE C;  4GM3 A;  1MDA H;  3MZK A;  2BBK H;  2OIZ A;  3A0F A;  4A0A B;  5A2Q g;  3UVN A;  3PSC B;  2P9I C;  3BG1 A;  2IUQ A;  4EWR A;  2HXC A;  3IJC A;  3W15 A;  2W18 A;  3JAM g;  3DM0 A;  4U1E I;  2AH1 A;  4FB1 D;  4O1Q D;  2O9K A;  2UZX B;  5H14 A;  5EMK B;  3PXS D;  4E54 A;  4FHL A;  1PGU A; 
#chains in the Genus database with same CATH topology
 3N0D A;  2YNP A;  4A08 B;  1GOH A;  2EIE A;  5HYN B;  3O4H A;  1M1X A;  1H2Z A;  2H14 A;  4JSP C;  1H2W A;  4G56 B;  1JOF A;  4WK0 A;  4X61 B;  5HDB A;  4NAA A;  4YVD A;  5M5T A;  4E5Z B;  4OWR A;  3C9C A;  5EM2 A;  4H5I A;  4A11 A;  4TZ4 A;  1K32 A;  4J79 A;  1QNI A;  5HE1 B;  4CY5 A;  4ERZ A;  1R5M A;  1U2V C;  5CXC A;  3KCI A;  5IJ8 E;  4J87 A;  3SWS D;  2H9N A;  3QI0 A;  3EMH A;  4J86 A;  5GMK n;  4JT6 C;  1TYQ C;  2Z2O A;  2UZY B;  3OKY B;  4O02 A;  3EI2 A;  3MUN A;  1RI6 A;  2H9L A;  2AGZ A;  4IA9 A;  3EG6 A;  3RFH A;  1GG2 B;  2J56 H;  3T3P A;  2H3X A;  3AFC A;  4BCC A;  1C9I A;  3JRP A;  4FWW A;  2AGX A;  3O4I A;  4HDJ A;  2VDK A;  4BCB A;  4X60 B;  2IUP A;  1O6G A;  5FFO A;  4MMY A;  1B9Y A;  4Y5R D;  5I5M A;  3B7F A;  5I5J A;  5TEF A;  3VI3 A;  3OTT A;  4GQ1 A;  3RN1 D;  4J81 A;  3V7D B;  5AJA A;  2XL3 A;  3OL2 A;  5TEE A;  3NIG A;  2CN2 A;  4QL1 A;  3EI1 A;  2VDL A;  2XE4 A;  4ES0 A;  2H47 A;  2HKR A;  3L4M D;  4LGN A;  1S4U X;  3V5W B;  4JT5 C;  2VC2 A;  2BCJ B;  2GC4 A;  1VZ2 A;  5GSA A;  5HE0 B;  1N6D A;  3JZG A;  3L4O D;  4MMZ A;  4K3I D;  2YBA A;  2H6N A;  5H1M A;  4O45 A;  5M5R A;  1VE6 A;  4IRZ A;  3ZWL B;  3I7N A;  5M5S A;  1SHY B;  3T3M A;  3NVQ A;  1OLZ A;  2P9K C;  4AOW A;  4NSX A;  1JJU B;  4J84 A;  4PBZ A;  3UVL A;  3C75 H;  2YB8 B;  3MMY A;  4A11 B;  5EM2 B;  2JKX A;  3RFG A;  4FA9 D;  2WQ8 A;  1UOP A;  4Z7O A;  3OW8 A;  5H17 A;  1K8K C;  3PXT D;  3ULE C;  2Z2N A;  2QR5 A;  5CXB A;  5CYK B;  4A0B B;  2HU7 A;  1JMZ B;  4CY3 A;  3IIY A;  3OKW A;  2QXV A;  4RE5 A;  1U4C A;  2HYE A;  2P9S C;  4FA5 D;  5FXY A;  2H6Q A;  2XU7 A;  4Z7Q A;  4ERY A;  4A09 A;  5HQG A;  2VDP A;  2Q7Q A;  5FQD A;  4L3H D;  3P4F A;  1GP2 B;  1JMX B;  3JRO A;  3K6S A;  4AN1 A;  3JB9 L;  4BL0 A;  2TRC B;  4GGD A;  4JD2 C;  4IMM A;  3GD1 I;  3NVN A;  2QC5 A;  4AEZ A;  5HE2 B;  3UVO A;  4J0X A;  4AMZ A;  4BP8 A;  2G9A A;  4UI9 R;  5FFG A;  1MG3 A;  3F3P A;  3NID A;  3OL2 B;  2VZ3 A;  3EI1 B;  4DNW A;  2XYI A;  2OVQ B;  1ERJ A;  2HU5 A;  3FRX A;  1YR2 A;  3UVM A;  4BP9 A;  4NBM A;  5K1C C;  2I0S A;  2I0T A;  2PM6 B;  4FAN D;  1VYH C;  3EQ8 A;  5C9Z B;  4CZV A;  4BH6 A;  3JZH A;  4O3U B;  3DSM A;  3K27 A;  2PM9 B;  4NC4 A;  4J78 A;  2OK4 A;  5C2W B;  3JPX A;  3DXK C;  1Q47 A;  4GM9 A;  2VDN A;  4GGC A;  4GM8 A;  4XYH A;  4ZOV A;  2OK6 A;  5M5V A;  1NR0 A;  4ZOZ A;  3IVM A;  3V4P A;  3AL8 A;  4JHN A;  5K19 A;  3C99 A;  2HJ4 A;  4PC0 A;  2YMU A;  3KRW B;  2IWF A;  2XL2 A;  3UKR C;  2PM7 B;  3FGB A;  4Y7R A;  3CIK B;  2CN3 A;  5FKT A;  3IIW A;  3SBP A;  1A0R B;  4O9D A;  3V4V A;  3MVD K;  3K71 A;  1N6E A;  3GC3 B;  3IUQ A;  2IWK A;  4NEN A;  4CI3 A;  2AQ5 A;  2P9L C;  4WJK A;  3AH8 B;  1H2X A;  4ZN4 A;  2CO0 C;  1NEX B;  4DNV A;  3J80 g;  4Z8L A;  3SXT D;  3UVK A;  2OVR B;  3EI3 A;  1UOO A;  3RRM C;  1VE7 A;  1PEV A;  5GXH A;  3OKT A;  4D0K A;  3DXM C;  3C5M A;  3IUM A;  1GXR A;  4J73 A;  3EU7 A;  2AGL A;  4L1M A;  3UKU C;  3I2N A;  4J8B A;  5IC7 A;  5E6R A;  5M5U A;  1QFM A;  1H2Y A;  1C9L A;  4E54 B;  5TDH B;  4A2L A;  4G55 A;  2EIB A;  2H6K A;  5THA A;  1GOF A;  4QRJ A;  4LG9 A;  4J8G A;  3ZE1 A;  5C92 A;  2HJB A;  3EQ9 A;  2J55 H;  4GZ8 A;  4XEI C;  3IJ0 A;  3KRX B;  3GFC A;  3OF7 A;  3U4Y A;  3AL9 A;  4XYI A;  2VDR A;  3K26 A;  2Z2P A;  4G1M A;  4MK0 B;  2P9N C;  1E8M A;  3IKO A;  1A12 A;  5SXM A;  3VH0 A;  5IGQ A;  3HFQ A;  4CI2 A;  1B9X A;  3I7H A;  5CXC B;  3ZE0 A;  2XZG A;  4L3G D;  4E5Z A;  1SQJ A;  3I89 A;  2P9P C;  2AGY A;  4ZOX A;  3EI2 B;  3F3F A;  1L0Q A;  4CZX A;  1T2X A;  2I3T A;  3NVX A;  4ZOY A;  4GQB B;  3JZN A;  4H5J A;  1FWX A;  3I8E A;  5FLX g;  4O3T B;  1XIP A;  2EID A;  3SBR A;  3I7P A;  5IJ7 E;  2GC7 A;  3ZE2 A;  4FA4 D;  4QAM A;  3OKY A;  3FCS A;  3PXW D;  3V9F A;  4LG8 A;  4A7J A;  4KFM B;  5FA5 B;  2H68 A;  4CC9 A;  3RLM D;  4J77 A;  4JXM A;  3IJE A;  2CNX A;  3EI4 A;  2B5M A;  4PNK B;  5HE3 B;  3QHY B;  4JSV C;  3J81 g;  4L9O A;  1VZ3 A;  3IUJ A;  3MKQ A;  3I7O A;  4U7A A;  5B4W A;  2AH0 A;  1MG2 A;  5IGO A;  3SVW D;  3PE7 A;  4WK2 A;  4QT8 A;  4A2M A;  1UTC A;  4I79 A;  3SHF A;  3MKS B;  3MZL A;  4N14 A;  5C86 A;  5M61 A;  4CI8 A;  1E8N A;  4QQE A;  4GQ2 P;  3N0E A;  2B5L A;  4CZY A;  3FCU A;  5E6S A;  4AX4 A;  2IUR A;  1PBY B;  3SJL D;  4AMY A;  2G99 A;  2AGW A;  1JTD B;  2OVP B;  3IUL A;  4R7A B;  3K72 A;  2B5N A;  2IUV A;  3PSL A;  5AMS A;  4L1Q D;  4O2W A;  3IJ1 A;  3RMZ D;  3DWL C;  3VI4 A;  4FAV D;  1BPO A;  2CE8 A;  5FKR A;  4JHP C;  1GOT B;  5CXB B;  3O4G A;  4X3E A;  5EAL A;  1TYE A;  4CY1 A;  3NIF A;  2H13 A;  2I3S A;  2VDO A;  1P22 A;  4JSN C;  3ODT A;  5EAR A;  4CY2 A;  4PSX B;  3CFV A;  5C2V B;  3SFZ A;  2P9U C;  4A09 B;  3VGZ A;  4A0B A;  3IUR A;  5CYK A;  4G1E A;  4K3J B;  3FM0 A;  4BUJ C;  4OZU A;  4PXW A;  2HES X;  4UM8 A;  4A0A A;  3O4J A;  3CFS B;  4J0W A;  3PVU B;  1PI6 A;  1QFS A;  3F3G A;  4WK4 A;  5FKQ A;  3EI4 B;  5IT9 g;  1N6F A;  1OMW B;  2MTA H;  5EMM B;  2B4E A;  3UR4 A;  4ERQ A;  3SLE D;  3GRE A;  2BKL A;  2YNO A;  2VDQ A;  3EQ7 A;  4ESG A;  3VA6 A;  4GGA A;  4J82 A;  3SMR A;  3MXX A;  4JSX C;  2OJY A;  4D6V A;  5KDO B;  3ORV D;  2VDM A;  4GMB A;  1JV2 A;  3ZDY A;  2I0R A;  3BG0 A;  1K3I A;  4PBY A;  1XHM A;  3I7L A;  4Z7N A;  4A08 A;  1I2M B;  2YNN A;  5EAP A;  3MUO A;  4FA1 D;  3EWE A;  3AL8 B;  5I5I A;  4PSW B;  4X63 B;  5AFU 3;  2PM9 A;  3RN0 D;  1E5T A;  5FKS A;  3DDU A;  2CE9 A;  1YFQ A;  2CO0 A;  3PVW B;  2HKM A;  3I8C A;  3E0C A;  2H9P A;  2J57 G;  5EML B;  3I7K A;  2PBI B;  3SN6 B;  2EBS A;  2H9M A;  4CI1 A;  2IAA A;  1TBG A;  3SCY A;  1SQ9 A;  5JWZ A;  2GNQ A;  5GXI A;  5EMJ B;  5TF2 A;  3BWS A;  1U8C A;  5EAM A;  2QZP A;  3SBQ A;  1XKS A;  3EI3 B;  4D9S A;  3ZDZ A;  3RSE C;  4GM3 A;  1MDA H;  4DNU A;  1GOG A;  3MZK A;  2BBK H;  5E6U A;  3ZDX A;  2OIZ A;  3A0F A;  4A0A B;  5A2Q g;  3UVN A;  3PSC B;  2P9I C;  3BG1 A;  4RE6 A;  2IUQ A;  3IUN A;  4EWR A;  2VZ1 A;  1UOQ A;  2HXC A;  3IJC A;  1O6F A;  3W15 A;  1L5G A;  2W18 A;  4MMX A;  3JAM g;  3DM0 A;  4U1E I;  4AN0 A;  2AH1 A;  2XDW A;  4UM9 A;  4FB1 D;  4BCD A;  4O1Q D;  2HU8 A;  2O9K A;  2UZX B;  5H14 A;  5EMK B;  3PXS D;  2EIC A;  4E54 A;  4FHL A;  1PGU A; 
#chains in the Genus database with same CATH homology
 3N0D A;  2YNP A;  4A08 B;  5HYN B;  2H14 A;  4JSP C;  4G56 B;  1JOF A;  4X61 B;  4YVD A;  4E5Z B;  4OWR A;  3C9C A;  5EM2 A;  4H5I A;  4A11 A;  4TZ4 A;  1K32 A;  4J79 A;  1QNI A;  5HE1 B;  4CY5 A;  4ERZ A;  1R5M A;  1U2V C;  5CXC A;  5IJ8 E;  4J87 A;  3SWS D;  2H9N A;  3EMH A;  4J86 A;  5GMK n;  4JT6 C;  1TYQ C;  2Z2O A;  2UZY B;  3OKY B;  3EI2 A;  1RI6 A;  2H9L A;  2AGZ A;  4IA9 A;  3EG6 A;  3RFH A;  1GG2 B;  2J56 H;  2H3X A;  3AFC A;  3JRP A;  4FWW A;  2AGX A;  4HDJ A;  4X60 B;  2IUP A;  1B9Y A;  4Y5R D;  5I5M A;  3B7F A;  5I5J A;  5TEF A;  3OTT A;  4GQ1 A;  3RN1 D;  4J81 A;  3V7D B;  5AJA A;  2XL3 A;  3OL2 A;  5TEE A;  2CN2 A;  4QL1 A;  3EI1 A;  4ES0 A;  2H47 A;  2HKR A;  3L4M D;  4LGN A;  1S4U X;  3V5W B;  4JT5 C;  2BCJ B;  2GC4 A;  5GSA A;  5HE0 B;  1N6D A;  3JZG A;  3L4O D;  4K3I D;  2YBA A;  2H6N A;  5H1M A;  4O45 A;  3ZWL B;  3I7N A;  1SHY B;  3NVQ A;  1OLZ A;  2P9K C;  4AOW A;  4NSX A;  1JJU B;  4J84 A;  4PBZ A;  3UVL A;  3C75 H;  2YB8 B;  3MMY A;  4A11 B;  5EM2 B;  3RFG A;  4FA9 D;  3OW8 A;  5H17 A;  1K8K C;  3PXT D;  3ULE C;  2Z2N A;  5CXB A;  4A0B B;  5CYK B;  1JMZ B;  4CY3 A;  3IIY A;  3OKW A;  2QXV A;  1U4C A;  2HYE A;  2P9S C;  4FA5 D;  5FXY A;  2H6Q A;  2XU7 A;  4ERY A;  4A09 A;  5HQG A;  2Q7Q A;  5FQD A;  4L3H D;  3P4F A;  1GP2 B;  1JMX B;  3JRO A;  3JB9 L;  4BL0 A;  2TRC B;  4GGD A;  4JD2 C;  4IMM A;  3NVN A;  2QC5 A;  4AEZ A;  5HE2 B;  3UVO A;  4J0X A;  2G9A A;  4UI9 R;  1MG3 A;  3F3P A;  3OL2 B;  3EI1 B;  2XYI A;  2OVQ B;  1ERJ A;  3FRX A;  3UVM A;  5K1C C;  2I0S A;  2I0T A;  2PM6 B;  4FAN D;  1VYH C;  5C9Z B;  4CZV A;  4BH6 A;  3JZH A;  4O3U B;  3DSM A;  3K27 A;  2PM9 B;  4J78 A;  2OK4 A;  5C2W B;  3JPX A;  3DXK C;  1Q47 A;  4GM9 A;  4GGC A;  4GM8 A;  4XYH A;  4ZOV A;  2OK6 A;  1NR0 A;  4ZOZ A;  3AL8 A;  5K19 A;  3C99 A;  2HJ4 A;  4PC0 A;  2YMU A;  3KRW B;  2IWF A;  2XL2 A;  3UKR C;  2PM7 B;  3FGB A;  4Y7R A;  3CIK B;  2CN3 A;  5FKT A;  3IIW A;  3SBP A;  1A0R B;  4O9D A;  1N6E A;  2IWK A;  4CI3 A;  2AQ5 A;  2P9L C;  3AH8 B;  4ZN4 A;  2CO0 C;  1NEX B;  3J80 g;  4Z8L A;  3SXT D;  3UVK A;  2OVR B;  3EI3 A;  3RRM C;  1PEV A;  5GXH A;  3OKT A;  4D0K A;  3DXM C;  3C5M A;  1GXR A;  4J73 A;  3EU7 A;  2AGL A;  3UKU C;  3I2N A;  4J8B A;  5IC7 A;  4E54 B;  5TDH B;  4A2L A;  2H6K A;  5THA A;  4QRJ A;  4LG9 A;  4J8G A;  2HJB A;  4XEI C;  2J55 H;  4GZ8 A;  3IJ0 A;  3KRX B;  3GFC A;  3U4Y A;  3AL9 A;  4XYI A;  3K26 A;  2Z2P A;  4MK0 B;  2P9N C;  3IKO A;  5SXM A;  3VH0 A;  5IGQ A;  3HFQ A;  4CI2 A;  1B9X A;  3I7H A;  5CXC B;  4L3G D;  4E5Z A;  1SQJ A;  3I89 A;  2P9P C;  2AGY A;  4ZOX A;  3EI2 B;  3F3F A;  1L0Q A;  4CZX A;  3NVX A;  2I3T A;  4ZOY A;  4GQB B;  3JZN A;  4H5J A;  1FWX A;  3I8E A;  5FLX g;  4O3T B;  1XIP A;  3SBR A;  3I7P A;  5IJ7 E;  2GC7 A;  4FA4 D;  3OKY A;  3PXW D;  3V9F A;  4LG8 A;  4A7J A;  4KFM B;  5FA5 B;  2H68 A;  4CC9 A;  3RLM D;  4J77 A;  4JXM A;  2CNX A;  3EI4 A;  2B5M A;  4PNK B;  5HE3 B;  4JSV C;  3J81 g;  4L9O A;  4U7A A;  3MKQ A;  3I7O A;  5B4W A;  2AH0 A;  1MG2 A;  5IGO A;  3SVW D;  3PE7 A;  4QT8 A;  4A2M A;  4I79 A;  3SHF A;  3MKS B;  3MZL A;  4N14 A;  4CI8 A;  4QQE A;  4GQ2 P;  3N0E A;  2B5L A;  4CZY A;  2IUR A;  1PBY B;  3SJL D;  2G99 A;  2AGW A;  2OVP B;  4R7A B;  2B5N A;  2IUV A;  3PSL A;  5AMS A;  4L1Q D;  3IJ1 A;  3RMZ D;  3DWL C;  4FAV D;  2CE8 A;  5FKR A;  1GOT B;  5CXB B;  5EAL A;  4X3E A;  4CY1 A;  2H13 A;  2I3S A;  1P22 A;  4JSN C;  3ODT A;  5EAR A;  4CY2 A;  4PSX B;  3CFV A;  5C2V B;  3SFZ A;  2P9U C;  4A09 B;  3VGZ A;  4A0B A;  5CYK A;  4K3J B;  3FM0 A;  4BUJ C;  4OZU A;  4PXW A;  2HES X;  4A0A A;  3CFS B;  4J0W A;  3PVU B;  1PI6 A;  3F3G A;  5FKQ A;  3EI4 B;  5IT9 g;  1N6F A;  1OMW B;  2MTA H;  5EMM B;  2B4E A;  3UR4 A;  4ERQ A;  3SLE D;  3GRE A;  2YNO A;  4ESG A;  3VA6 A;  4GGA A;  4J82 A;  3SMR A;  3MXX A;  4JSX C;  2OJY A;  4D6V A;  5KDO B;  3ORV D;  4GMB A;  2I0R A;  3BG0 A;  4PBY A;  1XHM A;  3I7L A;  4A08 A;  2YNN A;  5EAP A;  4FA1 D;  3EWE A;  3AL8 B;  5I5I A;  4PSW B;  4X63 B;  5AFU 3;  2PM9 A;  3RN0 D;  5FKS A;  2CE9 A;  1YFQ A;  2CO0 A;  3PVW B;  2HKM A;  3I8C A;  3E0C A;  2H9P A;  2J57 G;  5EML B;  3I7K A;  2PBI B;  3SN6 B;  2EBS A;  2H9M A;  4CI1 A;  2IAA A;  1TBG A;  3SCY A;  1SQ9 A;  5JWZ A;  2GNQ A;  5GXI A;  5EMJ B;  5TF2 A;  3BWS A;  5EAM A;  3SBQ A;  1XKS A;  3EI3 B;  3RSE C;  4GM3 A;  1MDA H;  3MZK A;  2BBK H;  2OIZ A;  3A0F A;  4A0A B;  5A2Q g;  3UVN A;  3PSC B;  2P9I C;  3BG1 A;  2IUQ A;  4EWR A;  2HXC A;  3IJC A;  3W15 A;  2W18 A;  3JAM g;  3DM0 A;  4U1E I;  2AH1 A;  4FB1 D;  4O1Q D;  2O9K A;  2UZX B;  5H14 A;  5EMK B;  3PXS D;  4E54 A;  4FHL A;  1PGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...