4O1QD

Crystal structure of the q103n-maug/pre-methylamine dehydrogenase complex
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
376
structure length
376
Chain Sequence
b'QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Site-directed mutagenesis of Gln103 reveals the influence of this residue on the redox properties and stability of MauG.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase
total genus 85
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2013-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4o1qD00
3C99A 2OK6A 2TRCB 3IIWA 1K8KC 3CFSB 4J82A 2H6KA 3ZWLB 4D0KA 2W18A 1PEVA 3MKSB 2PM9A 5CXCA 5IJ8E 3EI2B 2GC4A 5GXHA 2HXCA 3RSEC 3SLED 3SBPA 2PM7B 4NSXA 5FXYA 5FQDA 2AQ5A 5EALA 3JPXA 1NR0A 5I5IA 3SMRA 2OIZA 3J81g 4Z8LA 3RMZD 1JJUB 4XEIC 4CZXA 3JZGA 4PBZA 3EMHA 4Y7RA 2AH1A 4L3GD 2BBKH 3EI4B 1GOTB 2I3TA 1TBGA 1XIPA 4H5JA 2P9IC 3JZNA 4CZYA 3PSLA 5H1MA 4AEZA 1N6EA 1VYHC 3PSCB 5CYKB 2OJYA 3B7FA 1MDAH 5IJ7E 5C2WB 4FAVD 5IC7A 4K3ID 4JSNC 4L9OA 5CXBA 3N0DA 4ZOYA 4CI2A 3MZKA 3PXWD 2GNQA 3UKRC 4J0XA 4N14A 1OLZA 5H17A 2XL3A 3L4OD 3VGZA 2CN3A 5HE0B 1XHMA 3KRWB 4BH6A 3PXSD 5HYNB 2O9KA 4GGDA 3SXTD 4X3EA 5K1CC 2MTAH 3OKTA 1R5MA 4CI1A 2P9NC 2G9AA 1GP2B 3I8EA 3UVOA 3JROA 4O3UB 5EMLB 3RFGA 2XYIA 4FHLA 3SN6B 4X61B 2P9KC 4A0AB 4HDJA 5HE2B 4J87A 2H3XA 5AJAA 5CXCB 2CE8A 5EMKB 4CZVA 4A2MA 3AL9A 4L3HD 3L4MD 2UZYB 4UI9R 4U7AA 4XYHA 3RFHA 4O3TB 4BUJC 1B9YA 2YNNA 4A2LA 4AOWA 1K32A 3MXXA 2IUQA 4ZOVA 1RI6A 3ULEC 3C9CA 4GQBB 4CI8A 4BL0A 4FAND 4JD2C 3AH8B 2BCJB 5TDHB 1QNIA 3N0EA 4J8GA 3IJCA 2H9LA 4A0AA 2AH0A 4Y5RD 2AGWA 3EI3A 5GSAA 2Q7QA 3I8CA 1TYQC 2G99A 2H47A 3F3GA 2HJ4A 2XL2A 4LG8A 2EBSA 3ORVD 5C9ZB 2H9MA 1SHYB 3VA6A 4A08A 4GZ8A 3BWSA 2CO0C 4GMBA 1P22A 3CIKB 4MK0B 4JSXC 1SQJA 2I3SA 3SBQA 4A09A 4J77A 3AFCA 3ODTA 2IAAA 5CXBB 4I79A 4QRJA 3UR4A 2CO0A 4QQEA 4J8BA 1OMWB 4PBYA 3V7DB 1JMZB 4JT5C 4PC0A 3OL2B 4O1QD 3E0CA 3OTTA 3UVKA 2Z2OA 3V9FA 3BG1A 3OKWA 4PSWB 3FM0A 3PE7A 5FLXg 3U4YA 3SCYA 5I5JA 5C2VB 3I7HA 3I7PA 3PVWB 3OKYB 4D6VA 2IWKA 4OWRA 3DXKC 4JXMA 1A0RB 1Q47A 2HKMA 4CY1A 1PGUA 3BG0A 2IUVA 3OL2A 5HE3B 3V5WB 4ERYA 4A11A 4LG9A 3UVMA 5EAMA 3JAMg 3K27A 2CN2A 3I7LA 3NVNA 4J0WA 5FKRA 2OVQB 4FA5D 3IJ1A 2AGZA 4J84A 3J80g 2OVRB 4GGCA 2CE9A 3MKQA 4FWWA 5I5MA 5FA5B 4CY3A 5AFU3 4FA4D 2QC5A 5IT9g 4FA1D 2P9UC 4QL1A 3OKYA 2AGXA 2H9NA 4GGAA 3EI3B 3VH0A 3PXTD 1PI6A 2I0RA 4ZOZA 3I2NA 4GM3A 1MG3A 3DXMC 2H14A 5KDOB 3NVQA 2YMUA 2Z2NA 4A08B 4J79A 3AL8B 3MZLA 2HKRA 4KFMB 1JOFA 4O45A 3RN0D 5IGOA 4A09B 2YB8B 2B5NA 2IURA 5IGQA 3JRPA 4R7AB 2GC7A 3DM0A 5EARA 2H6NA 5K19A 3FRXA 2YNPA 1ERJA 1YFQA 4CC9A 3W15A 3RN1D 3HFQA 4X60B 1N6DA 1U2VC 2J55H 3SFZA 3EU7A 2P9PC 3C75H 3F3FA 1PBYB 3PVUB 2J57G 3EI1A 3IKOA 1GXRA 4JSPC 4L1QD 5TEFA 5HQGA 2H13A 2QXVA 3AL8A 4E54B 1NEXB 4OZUA 4CY2A 4U1EI 3UVLA 5EAPA 4ERQA 5H14A 3GREA 5HE1B 3RRMC 2B5MA 1JMXB 3F3PA 4A11B 3JB9L 4JSVC 3UVNA 4PSXB 4FB1D 2P9SC 4J81A 2AGYA 4FA9D 5GMKn 4PNKB 3OW8A 3NVXA 3SJLD 1XKSA 4E54A 3RLMD 3SVWD 3MMYA 5FKSA 2IUPA 3UKUC 3KRXB 3EG6A 5AMSA 2YBAA 5FKTA 5A2Qg 2HYEA 3C5MA 3EI2A 1S4UX 2P9LC 2YNOA 4A7JA 4CY5A 3FGBA 4ZOXA 4IA9A 4PXWA 1B9XA 4G56B 5EM2B 4EWRA 2XU7A 3P4FA 4GM8A 2I0TA 2PM6B 4GQ1A 1U4CA 4TZ4A 4YVDA 3EWEA 5GXIA 2H68A 3SHFA 1N6FA 4E5ZB 3IIYA 3DWLC 4O9DA 1FWXA 2CNXA 4QT8A 4JT6C 3I89A 4GM9A 4X63B 2I0SA 3EI4A 2OK4A 4H5IA 3K26A 3SWSD 4GQ2P 4A0BB 3GFCA 3JZHA 3EI1B 2Z2PA 3I7OA 3I7NA 5EM2A 3DSMA 5FKQA 5CYKA 3A0FA 2PBIB 4J78A 4LGNA 2B4EA 4CI3A 5TEEA 2AGLA 4ZN4A 2UZXB 1SQ9A 2PM9B 2B5LA 5EMJB 4ERZA 5THAA 3CFVA 4IMMA 1MG2A 4ES0A 2H6QA 2OVPB 4J73A 5JWZA 4E5ZA 5B4WA 2HJBA 4ESGA 1GG2B 5SXMA 4XYIA 5TF2A 1L0QA 3IJ0A 4K3JB 2J56H 4J86A 5EMMB 3SBRA 4A0BA 2HESX 2H9PA 2IWFA 3I7KA
chains in the Genus database with same CATH superfamily
1O6FA 3C99A 4WJKA 2OK6A 2TRCB 4Z7QA 3IIWA 1K8KC 3CFSB 4J82A 2H6KA 3ZWLB 4D0KA 1H2YA 2W18A 1PEVA 3MKSB 2PM9A 3QHYB 5CXCA 5IJ8E 3EI2B 1UTCA 2VDRA 2GC4A 1C9LA 5GXHA 1QFMA 2HXCA 3RSEC 2HU5A 3SLED 3SBPA 2PM7B 4JHNA 4NSXA 5FXYA 3IUQA 2AQ5A 5FQDA 5EALA 3JPXA 1NR0A 1VE6A 2VDKA 4AMZA 5I5IA 3SMRA 4Z7NA 2OIZA 3J81g 4Z8LA 3RMZD 1JJUB 4XEIC 4CZXA 3JZGA 3IVMA 3GC3B 4PBZA 3EMHA 4AN1A 4Y7RA 2AH1A 4IRZA 4L3GD 2BBKH 3EI4B 3OF7A 3EQ8A 1GOTB 1C9IA 1VZ3A 2I3TA 1TBGA 1XIPA 4H5JA 2VDOA 2P9IC 3EQ9A 3JZNA 4CZYA 1K3IA 3PSLA 5H1MA 2XDWA 4AEZA 1N6EA 1VYHC 3PSCB 5CYKB 2OJYA 3B7FA 1MDAH 5IJ7E 5C2WB 4FAVD 3IULA 4NBMA 5IC7A 4K3ID 4JSNC 3ZE1A 4L9OA 3K71A 5CXBA 3N0DA 4ZOYA 4CI2A 3MZKA 3PXWD 2GNQA 3UKRC 3ZDZA 4J0XA 4N14A 1OLZA 4JHPC 5H17A 2XL3A 3L4OD 3VGZA 5M5SA 2CN3A 2EICA 4G55A 5HE0B 1XHMA 3KRWB 4BH6A 3PXSD 2VDNA 3QI0A 2O9KA 4GGDA 5HYNB 3SXTD 4MMYA 4X3EA 5K1CC 2MTAH 3OKTA 1R5MA 4CI1A 2P9NC 2G9AA 1GP2B 3I8EA 2XZGA 3UVOA 3JROA 4O3UB 5EMLB 3RFGA 2XYIA 4FHLA 3SN6B 4X61B 2P9KC 4A0AB 4HDJA 5HE2B 4J87A 2H3XA 5AJAA 1VZ2A 5CXCB 2CE8A 5EMKB 4CZVA 5M5UA 4RE5A 4A2MA 3AL9A 4L3HD 3L4MD 5E6UA 2UZYB 3IUNA 4UI9R 4U7AA 4XYHA 4DNVA 3RFHA 1A12A 4O3TB 4BUJC 1B9YA 5E6SA 2YNNA 4A2LA 4AOWA 4MMZA 3O4GA 1K32A 2EIBA 3MXXA 2IUQA 4WK4A 4ZOVA 1RI6A 4WK2A 3ULEC 3C9CA 4GQBB 4CI8A 4BL0A 4FAND 1H2XA 4JD2C 1UOQA 3AH8B 2BCJB 5TDHB 1QNIA 3N0EA 4J8GA 5C86A 3IJCA 2H9LA 4A0AA 1E5TA 5FFOA 2AH0A 4Y5RD 2AGWA 3EI3A 5GSAA 2Q7QA 3I8CA 1TYQC 2G99A 4MMXA 2H47A 3F3GA 2HJ4A 2XL2A 1E8NA 4LG8A 4O02A 2EBSA 3ORVD 1E8MA 3O4HA 5C9ZB 1TYEA 2H9MA 3ZE0A 1SHYB 3VA6A 4A08A 4GZ8A 3BWSA 4Z7OA 4L1MA 3GD1I 2CO0C 4GMBA 1P22A 3CIKB 4MK0B 4JSXC 1SQJA 2I3SA 3SBQA 4A09A 4J77A 3AFCA 3ODTA 2IAAA 5CXBB 4I79A 4QRJA 3UR4A 2CO0A 4QQEA 4J8BA 1OMWB 1T2XA 4PBYA 3V7DB 1JMZB 4JT5C 4PC0A 3OL2B 4O1QD 5FFGA 3ZE2A 3E0CA 3OTTA 3UVKA 2Z2OA 3V9FA 3BG1A 4NAAA 3OKWA 4PSWB 3K72A 3FM0A 3PE7A 1H2ZA 5FLXg 3U4YA 3SCYA 5I5JA 1M1XA 5C2VB 3I7HA 3I7PA 3PVWB 4BP9A 3O4JA 3OKYB 4AMYA 4D6VA 4UM9A 2IWKA 4OWRA 3DXKC 4JXMA 1A0RB 1Q47A 2HKMA 4CY1A 1PGUA 3BG0A 4NC4A 2XE4A 2IUVA 3DDUA 3OL2A 5HE3B 3V5WB 4NENA 4A11A 4ERYA 4LG9A 3UVMA 5EAMA 3JAMg 3K27A 2CN2A 3I7LA 3MUNA 3NVNA 4J0WA 5FKRA 2OVQB 1UOOA 5E6RA 4FA5D 3IJ1A 2AGZA 4J84A 3J80g 2OVRB 4GGCA 2CE9A 3MKQA 4FWWA 5I5MA 5FA5B 4CY3A 5AFU3 3MVDK 4FA4D 2QC5A 3O4IA 5IT9g 4FA1D 2P9UC 4QL1A 3OKYA 1VE7A 2AGXA 2H9NA 4GGAA 4O2WA 3EI3B 2EIDA 3VH0A 3PXTD 1PI6A 2I0RA 1U8CA 4ZOZA 3I2NA 4GM3A 1MG3A 3DXMC 2H14A 5KDOB 3NVQA 2YMUA 2Z2NA 4A08B 4DNUA 3NIGA 4J79A 3AL8B 3MZLA 2HKRA 4KFMB 1BPOA 1JOFA 2VDQA 2VZ3A 4O45A 3ZDXA 3RN0D 3IUMA 5IGOA 4A09B 2YB8B 2BKLA 2B5NA 2IURA 3T3PA 5IGQA 3JRPA 4R7AB 2GC7A 3DM0A 5EARA 2H6NA 3EQ7A 5K19A 3FRXA 2YNPA 1ERJA 1YFQA 4CC9A 3W15A 1GOHA 3RN1D 2EIEA 3HFQA 4X60B 1N6DA 3V4PA 1U2VC 2J55H 4BCDA 3SFZA 2QR5A 5M5VA 3EU7A 2P9PC 2HU7A 1QFSA 3C75H 3F3FA 1PBYB 3KCIA 3PVUB 5M61A 2J57G 3EI1A 3IKOA 1UOPA 2QZPA 4G1EA 1GXRA 4JSPC 4L1QD 5TEFA 5HQGA 2H13A 3FCSA 2QXVA 3AL8A 3K6SA 1NEXB 4E54B 4OZUA 4CY2A 4U1EI 3UVLA 5EAPA 4ERQA 5H14A 5HDBA 3GREA 4BP8A 1O6GA 5HE1B 3RRMC 2B5MA 1JMXB 3F3PA 3IURA 4A11B 3JB9L 4JSVC 3UVNA 4PSXB 4FB1D 2P9SC 4J81A 2AGYA 4FA9D 5GMKn 4PNKB 3OW8A 3MUOA 3NVXA 4BCBA 3NIDA 3T3MA 3SJLD 1XKSA 3ZDYA 4E54A 3RLMD 3SVWD 3MMYA 5FKSA 2IUPA 2VC2A 3UKUC 3KRXB 1JTDB 3EG6A 5AMSA 2YBAA 2VDMA 5FKTA 5A2Qg 2HYEA 3C5MA 3EI2A 1S4UX 4D9SA 2P9LC 2YNOA 1I2MB 1JV2A 4A7JA 5M5RA 4CY5A 4AN0A 3FGBA 4ZOXA 4IA9A 4PXWA 3IUJA 1B9XA 4G56B 5EM2B 4EWRA 2VDPA 2XU7A 5M5TA 3P4FA 4GM8A 2I0TA 2PM6B 4GQ1A 1U4CA 4TZ4A 2VDLA 4YVDA 3VI4A 3EWEA 4G1MA 5GXIA 2H68A 1L5GA 3SHFA 3V4VA 1N6FA 4E5ZB 3IIYA 3DWLC 4O9DA 1FWXA 2CNXA 4QT8A 3IJEA 4JT6C 3I89A 3VI3A 4GM9A 4X63B 2I0SA 3EI4A 2OK4A 4H5IA 3K26A 3SWSD 4WK0A 2JKXA 4GQ2P 4A0BB 4RE6A 5C92A 3GFCA 3JZHA 3EI1B 2Z2PA 3I7OA 3I7NA 3FCUA 5EM2A 3DSMA 5FKQA 5CYKA 3A0FA 2PBIB 4J78A 4LGNA 2B4EA 4CI3A 5TEEA 2AGLA 4ZN4A 2UZXB 1SQ9A 1GOFA 2PM9B 4UM8A 2B5LA 5EMJB 4ERZA 5THAA 3CFVA 4IMMA 1MG2A 4ES0A 2H6QA 2OVPB 1YR2A 4J73A 5JWZA 4E5ZA 5B4WA 2HJBA 4ESGA 4DNWA 2WQ8A 1GG2B 4AX4A 5SXMA 4XYIA 1GOGA 3NIFA 4QAMA 5TF2A 1L0QA 3IJ0A 4K3JB 2J56H 4BCCA 4J86A 2VZ1A 3SBRA 5EMMB 4A0BA 2HESX 2H9PA 1H2WA 2HU8A 2IWFA 3I7KA
chains in the Genus database with same CATH topology
3C99A 2OK6A 2TRCB 3IIWA 1K8KC 3CFSB 4J82A 2H6KA 3ZWLB 4D0KA 2W18A 1PEVA 3MKSB 2PM9A 5CXCA 5IJ8E 3EI2B 2GC4A 5GXHA 2HXCA 3RSEC 3SLED 3SBPA 2PM7B 4NSXA 5FXYA 5FQDA 2AQ5A 5EALA 3JPXA 1NR0A 5I5IA 3SMRA 2OIZA 3J81g 4Z8LA 3RMZD 1JJUB 4XEIC 4CZXA 3JZGA 4PBZA 3EMHA 4Y7RA 2AH1A 4L3GD 2BBKH 3EI4B 1GOTB 2I3TA 1TBGA 1XIPA 4H5JA 2P9IC 3JZNA 4CZYA 3PSLA 5H1MA 4AEZA 1N6EA 1VYHC 3PSCB 5CYKB 2OJYA 3B7FA 1MDAH 5IJ7E 5C2WB 4FAVD 5IC7A 4K3ID 4JSNC 4L9OA 5CXBA 3N0DA 4ZOYA 4CI2A 3MZKA 3PXWD 2GNQA 3UKRC 4J0XA 4N14A 1OLZA 5H17A 2XL3A 3L4OD 3VGZA 2CN3A 5HE0B 1XHMA 3KRWB 4BH6A 3PXSD 5HYNB 2O9KA 4GGDA 3SXTD 4X3EA 5K1CC 2MTAH 3OKTA 1R5MA 4CI1A 2P9NC 2G9AA 1GP2B 3I8EA 3UVOA 3JROA 4O3UB 5EMLB 3RFGA 2XYIA 4FHLA 3SN6B 4X61B 2P9KC 4A0AB 4HDJA 5HE2B 4J87A 2H3XA 5AJAA 5CXCB 2CE8A 5EMKB 4CZVA 4A2MA 3AL9A 4L3HD 3L4MD 2UZYB 4UI9R 4U7AA 4XYHA 3RFHA 4O3TB 4BUJC 1B9YA 2YNNA 4A2LA 4AOWA 1K32A 3MXXA 2IUQA 4ZOVA 1RI6A 3ULEC 3C9CA 4GQBB 4CI8A 4BL0A 4FAND 4JD2C 3AH8B 2BCJB 5TDHB 1QNIA 3N0EA 4J8GA 3IJCA 2H9LA 4A0AA 2AH0A 4Y5RD 2AGWA 3EI3A 5GSAA 2Q7QA 3I8CA 1TYQC 2G99A 2H47A 3F3GA 2HJ4A 2XL2A 4LG8A 2EBSA 3ORVD 5C9ZB 2H9MA 1SHYB 3VA6A 4A08A 4GZ8A 3BWSA 2CO0C 4GMBA 1P22A 3CIKB 4MK0B 4JSXC 1SQJA 2I3SA 3SBQA 4A09A 4J77A 3AFCA 3ODTA 2IAAA 5CXBB 4I79A 4QRJA 3UR4A 2CO0A 4QQEA 4J8BA 1OMWB 4PBYA 3V7DB 1JMZB 4JT5C 4PC0A 3OL2B 4O1QD 3E0CA 3OTTA 3UVKA 2Z2OA 3V9FA 3BG1A 3OKWA 4PSWB 3FM0A 3PE7A 5FLXg 3U4YA 3SCYA 5I5JA 5C2VB 3I7HA 3I7PA 3PVWB 3OKYB 4D6VA 2IWKA 4OWRA 3DXKC 4JXMA 1A0RB 1Q47A 2HKMA 4CY1A 1PGUA 3BG0A 2IUVA 3OL2A 5HE3B 3V5WB 4ERYA 4A11A 4LG9A 3UVMA 5EAMA 3JAMg 3K27A 2CN2A 3I7LA 3NVNA 4J0WA 5FKRA 2OVQB 4FA5D 3IJ1A 2AGZA 4J84A 3J80g 2OVRB 4GGCA 2CE9A 3MKQA 4FWWA 5I5MA 5FA5B 4CY3A 5AFU3 4FA4D 2QC5A 5IT9g 4FA1D 2P9UC 4QL1A 3OKYA 2AGXA 2H9NA 4GGAA 3EI3B 3VH0A 3PXTD 1PI6A 2I0RA 4ZOZA 3I2NA 4GM3A 1MG3A 3DXMC 2H14A 5KDOB 3NVQA 2YMUA 2Z2NA 4A08B 4J79A 3AL8B 3MZLA 2HKRA 4KFMB 1JOFA 4O45A 3RN0D 5IGOA 4A09B 2YB8B 2B5NA 2IURA 5IGQA 3JRPA 4R7AB 2GC7A 3DM0A 5EARA 2H6NA 5K19A 3FRXA 2YNPA 1ERJA 1YFQA 4CC9A 3W15A 3RN1D 3HFQA 4X60B 1N6DA 1U2VC 2J55H 3SFZA 3EU7A 2P9PC 3C75H 3F3FA 1PBYB 3PVUB 2J57G 3EI1A 3IKOA 1GXRA 4JSPC 4L1QD 5TEFA 5HQGA 2H13A 2QXVA 3AL8A 4E54B 1NEXB 4OZUA 4CY2A 4U1EI 3UVLA 5EAPA 4ERQA 5H14A 3GREA 5HE1B 3RRMC 2B5MA 1JMXB 3F3PA 4A11B 3JB9L 4JSVC 3UVNA 4PSXB 4FB1D 2P9SC 4J81A 2AGYA 4FA9D 5GMKn 4PNKB 3OW8A 3NVXA 3SJLD 1XKSA 4E54A 3RLMD 3SVWD 3MMYA 5FKSA 2IUPA 3UKUC 3KRXB 3EG6A 5AMSA 2YBAA 5FKTA 5A2Qg 2HYEA 3C5MA 3EI2A 1S4UX 2P9LC 2YNOA 4A7JA 4CY5A 3FGBA 4ZOXA 4IA9A 4PXWA 1B9XA 4G56B 5EM2B 4EWRA 2XU7A 3P4FA 4GM8A 2I0TA 2PM6B 4GQ1A 1U4CA 4TZ4A 4YVDA 3EWEA 5GXIA 2H68A 3SHFA 1N6FA 4E5ZB 3IIYA 3DWLC 4O9DA 1FWXA 2CNXA 4QT8A 4JT6C 3I89A 4GM9A 4X63B 2I0SA 3EI4A 2OK4A 4H5IA 3K26A 3SWSD 4GQ2P 4A0BB 3GFCA 3JZHA 3EI1B 2Z2PA 3I7OA 3I7NA 5EM2A 3DSMA 5FKQA 5CYKA 3A0FA 2PBIB 4J78A 4LGNA 2B4EA 4CI3A 5TEEA 2AGLA 4ZN4A 2UZXB 1SQ9A 2PM9B 2B5LA 5EMJB 4ERZA 5THAA 3CFVA 4IMMA 1MG2A 4ES0A 2H6QA 2OVPB 4J73A 5JWZA 4E5ZA 5B4WA 2HJBA 4ESGA 1GG2B 5SXMA 4XYIA 5TF2A 1L0QA 3IJ0A 4K3JB 2J56H 4J86A 5EMMB 3SBRA 4A0BA 2HESX 2H9PA 2IWFA 3I7KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C99 A;  2OK6 A;  2TRC B;  3IIW A;  1K8K C;  3CFS B;  4J82 A;  2H6K A;  3ZWL B;  4D0K A;  2W18 A;  1PEV A;  3MKS B;  2PM9 A;  5CXC A;  5IJ8 E;  3EI2 B;  2GC4 A;  5GXH A;  2HXC A;  3RSE C;  3SLE D;  3SBP A;  2PM7 B;  4NSX A;  5FXY A;  5FQD A;  2AQ5 A;  5EAL A;  3JPX A;  1NR0 A;  5I5I A;  3SMR A;  2OIZ A;  3J81 g;  4Z8L A;  3RMZ D;  1JJU B;  4XEI C;  4CZX A;  3JZG A;  4PBZ A;  3EMH A;  4Y7R A;  2AH1 A;  4L3G D;  2BBK H;  3EI4 B;  1GOT B;  2I3T A;  1TBG A;  1XIP A;  4H5J A;  2P9I C;  3JZN A;  4CZY A;  3PSL A;  5H1M A;  4AEZ A;  1N6E A;  1VYH C;  3PSC B;  5CYK B;  2OJY A;  3B7F A;  1MDA H;  5IJ7 E;  5C2W B;  4FAV D;  5IC7 A;  4K3I D;  4JSN C;  4L9O A;  5CXB A;  3N0D A;  4ZOY A;  4CI2 A;  3MZK A;  3PXW D;  2GNQ A;  3UKR C;  4J0X A;  4N14 A;  1OLZ A;  5H17 A;  2XL3 A;  3L4O D;  3VGZ A;  2CN3 A;  5HE0 B;  1XHM A;  3KRW B;  4BH6 A;  3PXS D;  5HYN B;  2O9K A;  4GGD A;  3SXT D;  4X3E A;  5K1C C;  2MTA H;  3OKT A;  1R5M A;  4CI1 A;  2P9N C;  2G9A A;  1GP2 B;  3I8E A;  3UVO A;  3JRO A;  4O3U B;  5EML B;  3RFG A;  2XYI A;  4FHL A;  3SN6 B;  4X61 B;  2P9K C;  4A0A B;  4HDJ A;  5HE2 B;  4J87 A;  2H3X A;  5AJA A;  5CXC B;  2CE8 A;  5EMK B;  4CZV A;  4A2M A;  3AL9 A;  4L3H D;  3L4M D;  2UZY B;  4UI9 R;  4U7A A;  4XYH A;  3RFH A;  4O3T B;  4BUJ C;  1B9Y A;  2YNN A;  4A2L A;  4AOW A;  1K32 A;  3MXX A;  2IUQ A;  4ZOV A;  1RI6 A;  3ULE C;  3C9C A;  4GQB B;  4CI8 A;  4BL0 A;  4FAN D;  4JD2 C;  3AH8 B;  2BCJ B;  5TDH B;  1QNI A;  3N0E A;  4J8G A;  3IJC A;  2H9L A;  4A0A A;  2AH0 A;  4Y5R D;  2AGW A;  3EI3 A;  5GSA A;  2Q7Q A;  3I8C A;  1TYQ C;  2G99 A;  2H47 A;  3F3G A;  2HJ4 A;  2XL2 A;  4LG8 A;  2EBS A;  3ORV D;  5C9Z B;  2H9M A;  1SHY B;  3VA6 A;  4A08 A;  4GZ8 A;  3BWS A;  2CO0 C;  4GMB A;  1P22 A;  3CIK B;  4MK0 B;  4JSX C;  1SQJ A;  2I3S A;  3SBQ A;  4A09 A;  4J77 A;  3AFC A;  3ODT A;  2IAA A;  5CXB B;  4I79 A;  4QRJ A;  3UR4 A;  2CO0 A;  4QQE A;  4J8B A;  1OMW B;  4PBY A;  3V7D B;  1JMZ B;  4JT5 C;  4PC0 A;  3OL2 B;  4O1Q D;  3E0C A;  3OTT A;  3UVK A;  2Z2O A;  3V9F A;  3BG1 A;  3OKW A;  4PSW B;  3FM0 A;  3PE7 A;  5FLX g;  3U4Y A;  3SCY A;  5I5J A;  5C2V B;  3I7H A;  3I7P A;  3PVW B;  3OKY B;  4D6V A;  2IWK A;  4OWR A;  3DXK C;  4JXM A;  1A0R B;  1Q47 A;  2HKM A;  4CY1 A;  1PGU A;  3BG0 A;  2IUV A;  3OL2 A;  5HE3 B;  3V5W B;  4ERY A;  4A11 A;  4LG9 A;  3UVM A;  5EAM A;  3JAM g;  3K27 A;  2CN2 A;  3I7L A;  3NVN A;  4J0W A;  5FKR A;  2OVQ B;  4FA5 D;  3IJ1 A;  2AGZ A;  4J84 A;  3J80 g;  2OVR B;  4GGC A;  2CE9 A;  3MKQ A;  4FWW A;  5I5M A;  5FA5 B;  4CY3 A;  5AFU 3;  4FA4 D;  2QC5 A;  5IT9 g;  4FA1 D;  2P9U C;  4QL1 A;  3OKY A;  2AGX A;  2H9N A;  4GGA A;  3EI3 B;  3VH0 A;  3PXT D;  1PI6 A;  2I0R A;  4ZOZ A;  3I2N A;  4GM3 A;  1MG3 A;  3DXM C;  2H14 A;  5KDO B;  3NVQ A;  2YMU A;  2Z2N A;  4A08 B;  4J79 A;  3AL8 B;  3MZL A;  2HKR A;  4KFM B;  1JOF A;  4O45 A;  3RN0 D;  5IGO A;  4A09 B;  2YB8 B;  2B5N A;  2IUR A;  5IGQ A;  3JRP A;  4R7A B;  2GC7 A;  3DM0 A;  5EAR A;  2H6N A;  5K19 A;  3FRX A;  2YNP A;  1ERJ A;  1YFQ A;  4CC9 A;  3W15 A;  3RN1 D;  3HFQ A;  4X60 B;  1N6D A;  1U2V C;  2J55 H;  3SFZ A;  3EU7 A;  2P9P C;  3C75 H;  3F3F A;  1PBY B;  3PVU B;  2J57 G;  3EI1 A;  3IKO A;  1GXR A;  4JSP C;  4L1Q D;  5TEF A;  5HQG A;  2H13 A;  2QXV A;  3AL8 A;  4E54 B;  1NEX B;  4OZU A;  4CY2 A;  4U1E I;  3UVL A;  5EAP A;  4ERQ A;  5H14 A;  3GRE A;  5HE1 B;  3RRM C;  2B5M A;  1JMX B;  3F3P A;  4A11 B;  3JB9 L;  4JSV C;  3UVN A;  4PSX B;  4FB1 D;  2P9S C;  4J81 A;  2AGY A;  4FA9 D;  5GMK n;  4PNK B;  3OW8 A;  3NVX A;  3SJL D;  1XKS A;  4E54 A;  3RLM D;  3SVW D;  3MMY A;  5FKS A;  2IUP A;  3UKU C;  3KRX B;  3EG6 A;  5AMS A;  2YBA A;  5FKT A;  5A2Q g;  2HYE A;  3C5M A;  3EI2 A;  1S4U X;  2P9L C;  2YNO A;  4A7J A;  4CY5 A;  3FGB A;  4ZOX A;  4IA9 A;  4PXW A;  1B9X A;  4G56 B;  5EM2 B;  4EWR A;  2XU7 A;  3P4F A;  4GM8 A;  2I0T A;  2PM6 B;  4GQ1 A;  1U4C A;  4TZ4 A;  4YVD A;  3EWE A;  5GXI A;  2H68 A;  3SHF A;  1N6F A;  4E5Z B;  3IIY A;  3DWL C;  4O9D A;  1FWX A;  2CNX A;  4QT8 A;  4JT6 C;  3I89 A;  4GM9 A;  4X63 B;  2I0S A;  3EI4 A;  2OK4 A;  4H5I A;  3K26 A;  3SWS D;  4GQ2 P;  4A0B B;  3GFC A;  3JZH A;  3EI1 B;  2Z2P A;  3I7O A;  3I7N A;  5EM2 A;  3DSM A;  5FKQ A;  5CYK A;  3A0F A;  2PBI B;  4J78 A;  4LGN A;  2B4E A;  4CI3 A;  5TEE A;  2AGL A;  4ZN4 A;  2UZX B;  1SQ9 A;  2PM9 B;  2B5L A;  5EMJ B;  4ERZ A;  5THA A;  3CFV A;  4IMM A;  1MG2 A;  4ES0 A;  2H6Q A;  2OVP B;  4J73 A;  5JWZ A;  4E5Z A;  5B4W A;  2HJB A;  4ESG A;  1GG2 B;  5SXM A;  4XYI A;  5TF2 A;  1L0Q A;  3IJ0 A;  4K3J B;  2J56 H;  4J86 A;  5EMM B;  3SBR A;  4A0B A;  2HES X;  2H9P A;  2IWF A;  3I7K A; 
#chains in the Genus database with same CATH topology
 1O6F A;  3C99 A;  4WJK A;  2OK6 A;  2TRC B;  4Z7Q A;  3IIW A;  1K8K C;  3CFS B;  4J82 A;  2H6K A;  3ZWL B;  4D0K A;  1H2Y A;  2W18 A;  1PEV A;  3MKS B;  2PM9 A;  3QHY B;  5CXC A;  5IJ8 E;  3EI2 B;  1UTC A;  2VDR A;  2GC4 A;  1C9L A;  5GXH A;  1QFM A;  2HXC A;  3RSE C;  2HU5 A;  3SLE D;  3SBP A;  2PM7 B;  4JHN A;  4NSX A;  5FXY A;  3IUQ A;  2AQ5 A;  5FQD A;  5EAL A;  3JPX A;  1NR0 A;  1VE6 A;  2VDK A;  4AMZ A;  5I5I A;  3SMR A;  4Z7N A;  2OIZ A;  3J81 g;  4Z8L A;  3RMZ D;  1JJU B;  4XEI C;  4CZX A;  3JZG A;  3IVM A;  3GC3 B;  4PBZ A;  3EMH A;  4AN1 A;  4Y7R A;  2AH1 A;  4IRZ A;  4L3G D;  2BBK H;  3EI4 B;  3OF7 A;  3EQ8 A;  1GOT B;  1C9I A;  1VZ3 A;  2I3T A;  1TBG A;  1XIP A;  4H5J A;  2VDO A;  2P9I C;  3EQ9 A;  3JZN A;  4CZY A;  1K3I A;  3PSL A;  5H1M A;  2XDW A;  4AEZ A;  1N6E A;  1VYH C;  3PSC B;  5CYK B;  2OJY A;  3B7F A;  1MDA H;  5IJ7 E;  5C2W B;  4FAV D;  3IUL A;  4NBM A;  5IC7 A;  4K3I D;  4JSN C;  3ZE1 A;  4L9O A;  3K71 A;  5CXB A;  3N0D A;  4ZOY A;  4CI2 A;  3MZK A;  3PXW D;  2GNQ A;  3UKR C;  3ZDZ A;  4J0X A;  4N14 A;  1OLZ A;  4JHP C;  5H17 A;  2XL3 A;  3L4O D;  3VGZ A;  5M5S A;  2CN3 A;  2EIC A;  4G55 A;  5HE0 B;  1XHM A;  3KRW B;  4BH6 A;  3PXS D;  2VDN A;  3QI0 A;  2O9K A;  4GGD A;  5HYN B;  3SXT D;  4MMY A;  4X3E A;  5K1C C;  2MTA H;  3OKT A;  1R5M A;  4CI1 A;  2P9N C;  2G9A A;  1GP2 B;  3I8E A;  2XZG A;  3UVO A;  3JRO A;  4O3U B;  5EML B;  3RFG A;  2XYI A;  4FHL A;  3SN6 B;  4X61 B;  2P9K C;  4A0A B;  4HDJ A;  5HE2 B;  4J87 A;  2H3X A;  5AJA A;  1VZ2 A;  5CXC B;  2CE8 A;  5EMK B;  4CZV A;  5M5U A;  4RE5 A;  4A2M A;  3AL9 A;  4L3H D;  3L4M D;  5E6U A;  2UZY B;  3IUN A;  4UI9 R;  4U7A A;  4XYH A;  4DNV A;  3RFH A;  1A12 A;  4O3T B;  4BUJ C;  1B9Y A;  5E6S A;  2YNN A;  4A2L A;  4AOW A;  4MMZ A;  3O4G A;  1K32 A;  2EIB A;  3MXX A;  2IUQ A;  4WK4 A;  4ZOV A;  1RI6 A;  4WK2 A;  3ULE C;  3C9C A;  4GQB B;  4CI8 A;  4BL0 A;  4FAN D;  1H2X A;  4JD2 C;  1UOQ A;  3AH8 B;  2BCJ B;  5TDH B;  1QNI A;  3N0E A;  4J8G A;  5C86 A;  3IJC A;  2H9L A;  4A0A A;  1E5T A;  5FFO A;  2AH0 A;  4Y5R D;  2AGW A;  3EI3 A;  5GSA A;  2Q7Q A;  3I8C A;  1TYQ C;  2G99 A;  4MMX A;  2H47 A;  3F3G A;  2HJ4 A;  2XL2 A;  1E8N A;  4LG8 A;  4O02 A;  2EBS A;  3ORV D;  1E8M A;  3O4H A;  5C9Z B;  1TYE A;  2H9M A;  3ZE0 A;  1SHY B;  3VA6 A;  4A08 A;  4GZ8 A;  3BWS A;  4Z7O A;  4L1M A;  3GD1 I;  2CO0 C;  4GMB A;  1P22 A;  3CIK B;  4MK0 B;  4JSX C;  1SQJ A;  2I3S A;  3SBQ A;  4A09 A;  4J77 A;  3AFC A;  3ODT A;  2IAA A;  5CXB B;  4I79 A;  4QRJ A;  3UR4 A;  2CO0 A;  4QQE A;  4J8B A;  1OMW B;  1T2X A;  4PBY A;  3V7D B;  1JMZ B;  4JT5 C;  4PC0 A;  3OL2 B;  4O1Q D;  5FFG A;  3ZE2 A;  3E0C A;  3OTT A;  3UVK A;  2Z2O A;  3V9F A;  3BG1 A;  4NAA A;  3OKW A;  4PSW B;  3K72 A;  3FM0 A;  3PE7 A;  1H2Z A;  5FLX g;  3U4Y A;  3SCY A;  5I5J A;  1M1X A;  5C2V B;  3I7H A;  3I7P A;  3PVW B;  4BP9 A;  3O4J A;  3OKY B;  4AMY A;  4D6V A;  4UM9 A;  2IWK A;  4OWR A;  3DXK C;  4JXM A;  1A0R B;  1Q47 A;  2HKM A;  4CY1 A;  1PGU A;  3BG0 A;  4NC4 A;  2XE4 A;  2IUV A;  3DDU A;  3OL2 A;  5HE3 B;  3V5W B;  4NEN A;  4A11 A;  4ERY A;  4LG9 A;  3UVM A;  5EAM A;  3JAM g;  3K27 A;  2CN2 A;  3I7L A;  3MUN A;  3NVN A;  4J0W A;  5FKR A;  2OVQ B;  1UOO A;  5E6R A;  4FA5 D;  3IJ1 A;  2AGZ A;  4J84 A;  3J80 g;  2OVR B;  4GGC A;  2CE9 A;  3MKQ A;  4FWW A;  5I5M A;  5FA5 B;  4CY3 A;  5AFU 3;  3MVD K;  4FA4 D;  2QC5 A;  3O4I A;  5IT9 g;  4FA1 D;  2P9U C;  4QL1 A;  3OKY A;  1VE7 A;  2AGX A;  2H9N A;  4GGA A;  4O2W A;  3EI3 B;  2EID A;  3VH0 A;  3PXT D;  1PI6 A;  2I0R A;  1U8C A;  4ZOZ A;  3I2N A;  4GM3 A;  1MG3 A;  3DXM C;  2H14 A;  5KDO B;  3NVQ A;  2YMU A;  2Z2N A;  4A08 B;  4DNU A;  3NIG A;  4J79 A;  3AL8 B;  3MZL A;  2HKR A;  4KFM B;  1BPO A;  1JOF A;  2VDQ A;  2VZ3 A;  4O45 A;  3ZDX A;  3RN0 D;  3IUM A;  5IGO A;  4A09 B;  2YB8 B;  2BKL A;  2B5N A;  2IUR A;  3T3P A;  5IGQ A;  3JRP A;  4R7A B;  2GC7 A;  3DM0 A;  5EAR A;  2H6N A;  3EQ7 A;  5K19 A;  3FRX A;  2YNP A;  1ERJ A;  1YFQ A;  4CC9 A;  3W15 A;  1GOH A;  3RN1 D;  2EIE A;  3HFQ A;  4X60 B;  1N6D A;  3V4P A;  1U2V C;  2J55 H;  4BCD A;  3SFZ A;  2QR5 A;  5M5V A;  3EU7 A;  2P9P C;  2HU7 A;  1QFS A;  3C75 H;  3F3F A;  1PBY B;  3KCI A;  3PVU B;  5M61 A;  2J57 G;  3EI1 A;  3IKO A;  1UOP A;  2QZP A;  4G1E A;  1GXR A;  4JSP C;  4L1Q D;  5TEF A;  5HQG A;  2H13 A;  3FCS A;  2QXV A;  3AL8 A;  3K6S A;  1NEX B;  4E54 B;  4OZU A;  4CY2 A;  4U1E I;  3UVL A;  5EAP A;  4ERQ A;  5H14 A;  5HDB A;  3GRE A;  4BP8 A;  1O6G A;  5HE1 B;  3RRM C;  2B5M A;  1JMX B;  3F3P A;  3IUR A;  4A11 B;  3JB9 L;  4JSV C;  3UVN A;  4PSX B;  4FB1 D;  2P9S C;  4J81 A;  2AGY A;  4FA9 D;  5GMK n;  4PNK B;  3OW8 A;  3MUO A;  3NVX A;  4BCB A;  3NID A;  3T3M A;  3SJL D;  1XKS A;  3ZDY A;  4E54 A;  3RLM D;  3SVW D;  3MMY A;  5FKS A;  2IUP A;  2VC2 A;  3UKU C;  3KRX B;  1JTD B;  3EG6 A;  5AMS A;  2YBA A;  2VDM A;  5FKT A;  5A2Q g;  2HYE A;  3C5M A;  3EI2 A;  1S4U X;  4D9S A;  2P9L C;  2YNO A;  1I2M B;  1JV2 A;  4A7J A;  5M5R A;  4CY5 A;  4AN0 A;  3FGB A;  4ZOX A;  4IA9 A;  4PXW A;  3IUJ A;  1B9X A;  4G56 B;  5EM2 B;  4EWR A;  2VDP A;  2XU7 A;  5M5T A;  3P4F A;  4GM8 A;  2I0T A;  2PM6 B;  4GQ1 A;  1U4C A;  4TZ4 A;  2VDL A;  4YVD A;  3VI4 A;  3EWE A;  4G1M A;  5GXI A;  2H68 A;  1L5G A;  3SHF A;  3V4V A;  1N6F A;  4E5Z B;  3IIY A;  3DWL C;  4O9D A;  1FWX A;  2CNX A;  4QT8 A;  3IJE A;  4JT6 C;  3I89 A;  3VI3 A;  4GM9 A;  4X63 B;  2I0S A;  3EI4 A;  2OK4 A;  4H5I A;  3K26 A;  3SWS D;  4WK0 A;  2JKX A;  4GQ2 P;  4A0B B;  4RE6 A;  5C92 A;  3GFC A;  3JZH A;  3EI1 B;  2Z2P A;  3I7O A;  3I7N A;  3FCU A;  5EM2 A;  3DSM A;  5FKQ A;  5CYK A;  3A0F A;  2PBI B;  4J78 A;  4LGN A;  2B4E A;  4CI3 A;  5TEE A;  2AGL A;  4ZN4 A;  2UZX B;  1SQ9 A;  1GOF A;  2PM9 B;  4UM8 A;  2B5L A;  5EMJ B;  4ERZ A;  5THA A;  3CFV A;  4IMM A;  1MG2 A;  4ES0 A;  2H6Q A;  2OVP B;  1YR2 A;  4J73 A;  5JWZ A;  4E5Z A;  5B4W A;  2HJB A;  4ESG A;  4DNW A;  2WQ8 A;  1GG2 B;  4AX4 A;  5SXM A;  4XYI A;  1GOG A;  3NIF A;  4QAM A;  5TF2 A;  1L0Q A;  3IJ0 A;  4K3J B;  2J56 H;  4BCC A;  4J86 A;  2VZ1 A;  3SBR A;  5EMM B;  4A0B A;  2HES X;  2H9P A;  1H2W A;  2HU8 A;  2IWF A;  3I7K A; 
#chains in the Genus database with same CATH homology
 3C99 A;  2OK6 A;  2TRC B;  3IIW A;  1K8K C;  3CFS B;  4J82 A;  2H6K A;  3ZWL B;  4D0K A;  2W18 A;  1PEV A;  3MKS B;  2PM9 A;  5CXC A;  5IJ8 E;  3EI2 B;  2GC4 A;  5GXH A;  2HXC A;  3RSE C;  3SLE D;  3SBP A;  2PM7 B;  4NSX A;  5FXY A;  5FQD A;  2AQ5 A;  5EAL A;  3JPX A;  1NR0 A;  5I5I A;  3SMR A;  2OIZ A;  3J81 g;  4Z8L A;  3RMZ D;  1JJU B;  4XEI C;  4CZX A;  3JZG A;  4PBZ A;  3EMH A;  4Y7R A;  2AH1 A;  4L3G D;  2BBK H;  3EI4 B;  1GOT B;  2I3T A;  1TBG A;  1XIP A;  4H5J A;  2P9I C;  3JZN A;  4CZY A;  3PSL A;  5H1M A;  4AEZ A;  1N6E A;  1VYH C;  3PSC B;  5CYK B;  2OJY A;  3B7F A;  1MDA H;  5IJ7 E;  5C2W B;  4FAV D;  5IC7 A;  4K3I D;  4JSN C;  4L9O A;  5CXB A;  3N0D A;  4ZOY A;  4CI2 A;  3MZK A;  3PXW D;  2GNQ A;  3UKR C;  4J0X A;  4N14 A;  1OLZ A;  5H17 A;  2XL3 A;  3L4O D;  3VGZ A;  2CN3 A;  5HE0 B;  1XHM A;  3KRW B;  4BH6 A;  3PXS D;  5HYN B;  2O9K A;  4GGD A;  3SXT D;  4X3E A;  5K1C C;  2MTA H;  3OKT A;  1R5M A;  4CI1 A;  2P9N C;  2G9A A;  1GP2 B;  3I8E A;  3UVO A;  3JRO A;  4O3U B;  5EML B;  3RFG A;  2XYI A;  4FHL A;  3SN6 B;  4X61 B;  2P9K C;  4A0A B;  4HDJ A;  5HE2 B;  4J87 A;  2H3X A;  5AJA A;  5CXC B;  2CE8 A;  5EMK B;  4CZV A;  4A2M A;  3AL9 A;  4L3H D;  3L4M D;  2UZY B;  4UI9 R;  4U7A A;  4XYH A;  3RFH A;  4O3T B;  4BUJ C;  1B9Y A;  2YNN A;  4A2L A;  4AOW A;  1K32 A;  3MXX A;  2IUQ A;  4ZOV A;  1RI6 A;  3ULE C;  3C9C A;  4GQB B;  4CI8 A;  4BL0 A;  4FAN D;  4JD2 C;  3AH8 B;  2BCJ B;  5TDH B;  1QNI A;  3N0E A;  4J8G A;  3IJC A;  2H9L A;  4A0A A;  2AH0 A;  4Y5R D;  2AGW A;  3EI3 A;  5GSA A;  2Q7Q A;  3I8C A;  1TYQ C;  2G99 A;  2H47 A;  3F3G A;  2HJ4 A;  2XL2 A;  4LG8 A;  2EBS A;  3ORV D;  5C9Z B;  2H9M A;  1SHY B;  3VA6 A;  4A08 A;  4GZ8 A;  3BWS A;  2CO0 C;  4GMB A;  1P22 A;  3CIK B;  4MK0 B;  4JSX C;  1SQJ A;  2I3S A;  3SBQ A;  4A09 A;  4J77 A;  3AFC A;  3ODT A;  2IAA A;  5CXB B;  4I79 A;  4QRJ A;  3UR4 A;  2CO0 A;  4QQE A;  4J8B A;  1OMW B;  4PBY A;  3V7D B;  1JMZ B;  4JT5 C;  4PC0 A;  3OL2 B;  4O1Q D;  3E0C A;  3OTT A;  3UVK A;  2Z2O A;  3V9F A;  3BG1 A;  3OKW A;  4PSW B;  3FM0 A;  3PE7 A;  5FLX g;  3U4Y A;  3SCY A;  5I5J A;  5C2V B;  3I7H A;  3I7P A;  3PVW B;  3OKY B;  4D6V A;  2IWK A;  4OWR A;  3DXK C;  4JXM A;  1A0R B;  1Q47 A;  2HKM A;  4CY1 A;  1PGU A;  3BG0 A;  2IUV A;  3OL2 A;  5HE3 B;  3V5W B;  4ERY A;  4A11 A;  4LG9 A;  3UVM A;  5EAM A;  3JAM g;  3K27 A;  2CN2 A;  3I7L A;  3NVN A;  4J0W A;  5FKR A;  2OVQ B;  4FA5 D;  3IJ1 A;  2AGZ A;  4J84 A;  3J80 g;  2OVR B;  4GGC A;  2CE9 A;  3MKQ A;  4FWW A;  5I5M A;  5FA5 B;  4CY3 A;  5AFU 3;  4FA4 D;  2QC5 A;  5IT9 g;  4FA1 D;  2P9U C;  4QL1 A;  3OKY A;  2AGX A;  2H9N A;  4GGA A;  3EI3 B;  3VH0 A;  3PXT D;  1PI6 A;  2I0R A;  4ZOZ A;  3I2N A;  4GM3 A;  1MG3 A;  3DXM C;  2H14 A;  5KDO B;  3NVQ A;  2YMU A;  2Z2N A;  4A08 B;  4J79 A;  3AL8 B;  3MZL A;  2HKR A;  4KFM B;  1JOF A;  4O45 A;  3RN0 D;  5IGO A;  4A09 B;  2YB8 B;  2B5N A;  2IUR A;  5IGQ A;  3JRP A;  4R7A B;  2GC7 A;  3DM0 A;  5EAR A;  2H6N A;  5K19 A;  3FRX A;  2YNP A;  1ERJ A;  1YFQ A;  4CC9 A;  3W15 A;  3RN1 D;  3HFQ A;  4X60 B;  1N6D A;  1U2V C;  2J55 H;  3SFZ A;  3EU7 A;  2P9P C;  3C75 H;  3F3F A;  1PBY B;  3PVU B;  2J57 G;  3EI1 A;  3IKO A;  1GXR A;  4JSP C;  4L1Q D;  5TEF A;  5HQG A;  2H13 A;  2QXV A;  3AL8 A;  4E54 B;  1NEX B;  4OZU A;  4CY2 A;  4U1E I;  3UVL A;  5EAP A;  4ERQ A;  5H14 A;  3GRE A;  5HE1 B;  3RRM C;  2B5M A;  1JMX B;  3F3P A;  4A11 B;  3JB9 L;  4JSV C;  3UVN A;  4PSX B;  4FB1 D;  2P9S C;  4J81 A;  2AGY A;  4FA9 D;  5GMK n;  4PNK B;  3OW8 A;  3NVX A;  3SJL D;  1XKS A;  4E54 A;  3RLM D;  3SVW D;  3MMY A;  5FKS A;  2IUP A;  3UKU C;  3KRX B;  3EG6 A;  5AMS A;  2YBA A;  5FKT A;  5A2Q g;  2HYE A;  3C5M A;  3EI2 A;  1S4U X;  2P9L C;  2YNO A;  4A7J A;  4CY5 A;  3FGB A;  4ZOX A;  4IA9 A;  4PXW A;  1B9X A;  4G56 B;  5EM2 B;  4EWR A;  2XU7 A;  3P4F A;  4GM8 A;  2I0T A;  2PM6 B;  4GQ1 A;  1U4C A;  4TZ4 A;  4YVD A;  3EWE A;  5GXI A;  2H68 A;  3SHF A;  1N6F A;  4E5Z B;  3IIY A;  3DWL C;  4O9D A;  1FWX A;  2CNX A;  4QT8 A;  4JT6 C;  3I89 A;  4GM9 A;  4X63 B;  2I0S A;  3EI4 A;  2OK4 A;  4H5I A;  3K26 A;  3SWS D;  4GQ2 P;  4A0B B;  3GFC A;  3JZH A;  3EI1 B;  2Z2P A;  3I7O A;  3I7N A;  5EM2 A;  3DSM A;  5FKQ A;  5CYK A;  3A0F A;  2PBI B;  4J78 A;  4LGN A;  2B4E A;  4CI3 A;  5TEE A;  2AGL A;  4ZN4 A;  2UZX B;  1SQ9 A;  2PM9 B;  2B5L A;  5EMJ B;  4ERZ A;  5THA A;  3CFV A;  4IMM A;  1MG2 A;  4ES0 A;  2H6Q A;  2OVP B;  4J73 A;  5JWZ A;  4E5Z A;  5B4W A;  2HJB A;  4ESG A;  1GG2 B;  5SXM A;  4XYI A;  5TF2 A;  1L0Q A;  3IJ0 A;  4K3J B;  2J56 H;  4J86 A;  5EMM B;  3SBR A;  4A0B A;  2HES X;  2H9P A;  2IWF A;  3I7K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...