3SLED

Crystal structure of the p107c-maug/pre-methylamine dehydrogenase complex
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords Methylamine utilization protein MauG
publication title Proline 107 is a major determinant in maintaining the structure of the distal pocket and reactivity of the high-spin heme of MauG.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 93
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3sleD00
5A2Qg 3SBQA 5EMJB 5K1CC 2H9MA 3EI3A 3I8CA 4ERZA 3JZHA 1JMXB 4X61B 4CC9A 3MKQA 3FGBA 3KRXB 5HE2B 3AH8B 4PSXB 2H68A 3FM0A 4J8GA 3JRPA 4H5IA 3MZKA 2AGZA 2GNQA 2IUVA 3I7HA 3DXMC 4JSPC 2UZYB 2B5LA 4AEZA 5GXHA 3ZWLB 3EI4B 4A11A 5JWZA 5H17A 1A0RB 4L3HD 5EMLB 1U2VC 2QXVA 1JJUB 1NEXB 1NR0A 5SXMA 3OL2A 3I7PA 4HDJA 2P9UC 4PBZA 2IURA 5HE1B 4A0AB 3I7NA 1PBYB 5TEFA 2PM9B 1XKSA 3OTTA 2OJYA 2PM9A 1SQJA 2XYIA 3PXWD 2HJBA 3IKOA 4GGDA 3EI1A 4D0KA 4IA9A 3I8EA 3KRWB 3NVXA 1N6EA 4QRJA 2AGYA 4O9DA 1QNIA 4JT6C 5H1MA 3MXXA 4J84A 2OVPB 3F3FA 2CNXA 3L4OD 4KFMB 3EU7A 5FKTA 1PI6A 5B4WA 3SFZA 3PXSD 3MZLA 4QT8A 2H14A 5EM2A 2P9NC 1MG2A 4GM3A 5K19A 4FA4D 4GQBB 1JMZB 3CFSB 3SBPA 4ZOVA 2CO0C 4JD2C 2YNOA 4J73A 5IGOA 5C2WB 5FKRA 4GQ2P 4J82A 2PM7B 4CI3A 2CO0A 5FXYA 5HE0B 2YNNA 3NVQA 3UKRC 3UVKA 1PEVA 3OKYB 4CI1A 4FA5D 3GFCA 4CI8A 1GP2B 3F3PA 3A0FA 5IJ8E 2G9AA 4IMMA 2HYEA 3SVWD 4BUJC 3U4YA 3RN1D 2B4EA 2J57G 4LG8A 3EI2B 4FA1D 3EI2A 5AMSA 4PSWB 3V7DB 1ERJA 3JPXA 4YVDA 4CZYA 4FWWA 3E0CA 3JZGA 1FWXA 3OKWA 3SBRA 4FHLA 3RSEC 4PNKB 5GMKn 2YNPA 4FAVD 2G99A 3VH0A 5I5MA 1N6DA 2HKMA 2XL2A 4Y5RD 1JOFA 2AQ5A 5HQGA 3DXKC 4JT5C 4FB1D 3UVOA 3PVUB 2I3SA 2QC5A 4J0XA 4GGAA 4BL0A 5TF2A 4CY3A 3EI4A 4X63B 2Z2NA 1K8KC 5I5JA 5EALA 3F3GA 5HYNB 1N6FA 2IUPA 3NVNA 1PGUA 2O9KA 3PXTD 4ERYA 2OVRB 2PM6B 3DSMA 5CXCB 3JAMg 4ZOYA 4J81A 4Y7RA 4JSVC 4A0AA 2MTAH 4E5ZB 4ES0A 5I5IA 2HKRA 4A09B 3UVNA 2I3TA 4A09A 4A7JA 2OK6A 3RFHA 2AH0A 3JZNA 3VGZA 2CE9A 2XU7A 4J79A 3CIKB 1XIPA 4OWRA 3PSLA 4BH6A 2Z2OA 5FKSA 4U7AA 3I2NA 3FRXA 5EMMB 2I0TA 4GMBA 4XYHA 4ZOXA 4A2LA 4A08B 1OLZA 3ORVD 2AGXA 4Z8LA 3PVWB 3C99A 3K27A 4A08A 1R5MA 4A0BB 4MK0B 2GC7A 2GC4A 1L0QA 1TYQC 1B9YA 3DM0A 2AGWA 4G56B 3I7LA 2H6NA 3RRMC 4I79A 4O1QD 4O45A 2HJ4A 3C5MA 4CI2A 4L3GD 5FLXg 4GQ1A 3UKUC 3OKTA 5CYKB 3J80g 2IWFA 4QL1A 2HXCA 5FQDA 1XHMA 3SN6B 4J87A 1K32A 3K26A 4K3JB 3RFGA 2P9LC 2BCJB 4U1EI 4GM9A 2B5NA 5GXIA 4GM8A 2IAAA 5EARA 3OKYA 3EWEA 4X3EA 3VA6A 2OVQB 5IGQA 3J81g 3AFCA 3N0DA 2AH1A 2W18A 2UZXB 4AOWA 2TRCB 3GREA 1YFQA 4JSNC 1SHYB 4FAND 1S4UX 1B9XA 3C9CA 1MDAH 4CY5A 4E54B 3W15A 3BWSA 1GOTB 3CFVA 3PE7A 3MMYA 5EMKB 2BBKH 5H14A 4D6VA 4CZXA 4ZN4A 3SWSD 4PBYA 2H13A 5AJAA 4H5JA 2J56H 3IJCA 5FKQA 2PBIB 3OW8A 3EMHA 2P9PC 2I0SA 3EI3B 4X60B 4A2MA 2XL3A 5EAPA 4J0WA 3P4FA 4J86A 4CY2A 3ULEC 5C2VB 2IWKA 3IJ0A 4JSXC 4CY1A 4L1QD 5CXBB 5HE3B 2HESX 5IJ7E 4TZ4A 5CXBA 3SHFA 2YB8B 4QQEA 2CN2A 3PSCB 2P9SC 3C75H 5FA5B 3EG6A 5CXCA 2H6KA 4A11B 3RMZD 4E5ZA 4GZ8A 4ERQA 3UVMA 1OMWB 4R7AB 4J8BA 3RN0D 5TEEA 3OL2B 1VYHC 3SCYA 1P22A 5KDOB 3I7KA 4XYIA 3V5WB 5IC7A 3AL9A 2YMUA 3EI1B 2EBSA 2H3XA 4A0BA 3B7FA 1MG3A 3I7OA 2Q7QA 4PXWA 3IIWA 4L9OA 4K3ID 1Q47A 3ODTA 2Z2PA 3SLED 3UR4A 5TDHB 2CN3A 4FA9D 2OK4A 4GGCA 2OIZA 3N0EA 1TBGA 2B5MA 2AGLA 4J77A 4JXMA 3RLMD 4CZVA 5CYKA 3SXTD 5EM2B 1RI6A 3SJLD 3BG0A 3JB9L 3MKSB 2P9IC 5THAA 4LGNA 5GSAA 3SMRA 2H6QA 2H9NA 4XEIC 2P9KC 4EWRA 2CE8A 4NSXA 2I0RA 3IJ1A 4ESGA 3UVLA 4LG9A 5C9ZB 2H9LA 4O3UB 2J55H 4UI9R 4E54A 3IIYA 4O3TB 2YBAA 4J78A 3L4MD 5EAMA 3HFQA 3DWLC 3BG1A 3V9FA 5IT9g 4OZUA 1U4CA 2IUQA 4N14A 1GG2B 3JROA 4PC0A 3AL8B 3AL8A 2H9PA 1GXRA 3I89A 5AFU3 2H47A 4ZOZA 1SQ9A
chains in the Genus database with same CATH superfamily
5A2Qg 3SBQA 5EMJB 5K1CC 2H9MA 3EI3A 3I8CA 4ERZA 3JZHA 1JMXB 4X61B 4CC9A 3MKQA 3FGBA 3KRXB 5HE2B 2VZ1A 3AH8B 4PSXB 2H68A 3FM0A 4J8GA 3JRPA 4H5IA 3MZKA 2AGZA 3T3PA 2EICA 3EQ8A 2GNQA 4QAMA 2IUVA 3I7HA 3DXMC 4JSPC 2UZYB 2B5LA 4AEZA 5GXHA 3ZWLB 3EI4B 3IVMA 4A11A 3K6SA 5JWZA 5H17A 1A0RB 3ZDXA 4L3HD 5EMLB 1U2VC 2QXVA 1JJUB 1NEXB 1NR0A 5SXMA 3OL2A 3I7PA 4HDJA 2P9UC 4PBZA 2IURA 5HE1B 4A0AB 3I7NA 1PBYB 3O4GA 3T3MA 5TEFA 2PM9B 1XKSA 3OTTA 2OJYA 2PM9A 1SQJA 2XYIA 3PXWD 2EIDA 2HJBA 3IKOA 4GGDA 3EI1A 4D0KA 4IA9A 3I8EA 3KRWB 3IULA 3NVXA 1N6EA 2VDPA 4QRJA 2AGYA 4O9DA 1QNIA 4JT6C 5H1MA 3MXXA 4J84A 2OVPB 3F3FA 3IUNA 1GOGA 2CNXA 3L4OD 4KFMB 3EU7A 4RE6A 5FKTA 1PI6A 5B4WA 3SFZA 3PXSD 3MZLA 4QT8A 2H14A 1VZ2A 5EM2A 2P9NC 1JV2A 1MG2A 4GM3A 5K19A 4FA4D 3EQ7A 4GQBB 1JMZB 3CFSB 3SBPA 4ZOVA 1O6FA 2CO0C 4JD2C 4NC4A 2YNOA 4J73A 4DNWA 5IGOA 5C2WB 5FKRA 4GQ2P 4J82A 2PM7B 3IUJA 4CI3A 2CO0A 5FXYA 4MMYA 5HE0B 2YNNA 3NVQA 3UKRC 1O6GA 3UVKA 2VDRA 3NIFA 1PEVA 3OKYB 1A12A 4CI1A 4Z7OA 3EQ9A 4NAAA 4FA5D 3GFCA 2XDWA 4CI8A 1GP2B 3F3PA 4DNUA 3A0FA 5IJ8E 2G9AA 4IMMA 2HYEA 3SVWD 4BUJC 3U4YA 3RN1D 1TYEA 3MUOA 3IUMA 2B4EA 2J57G 4LG8A 3EI2B 2EIEA 4FA1D 3EI2A 5AMSA 4PSWB 3V7DB 4O2WA 4WK0A 1ERJA 3JPXA 4YVDA 4CZYA 4FWWA 1QFSA 3E0CA 3JZGA 1FWXA 3OKWA 3SBRA 4FHLA 3RSEC 4PNKB 5GMKn 1VE6A 2YNPA 4FAVD 2G99A 1QFMA 3QI0A 5M5SA 1H2ZA 5I5MA 1N6DA 3VH0A 2VZ3A 2HKMA 2XL2A 4Y5RD 1JOFA 3ZDYA 2AQ5A 5HQGA 3DXKC 1C9IA 1VZ3A 4JT5C 4FB1D 3UVOA 3PVUB 2I3SA 2QC5A 4J0XA 3FCSA 4GGAA 4BL0A 4IRZA 5TF2A 4CY3A 3EI4A 4X63B 2Z2NA 3ZDZA 3OF7A 1K8KC 5I5JA 4WJKA 5EALA 3F3GA 5HYNB 1N6FA 2IUPA 3NVNA 1PGUA 3K72A 4UM8A 2O9KA 3PXTD 1YR2A 4ERYA 2OVRB 2PM6B 3DSMA 1UTCA 5CXCB 3JAMg 4ZOYA 4J81A 4Y7RA 4JSVC 4A0AA 2MTAH 4E5ZB 4ES0A 4JHNA 5I5IA 2HKRA 4A09B 3UVNA 1U8CA 2I3TA 4A09A 4A7JA 2OK6A 3RFHA 2AH0A 3JZNA 3VGZA 2CE9A 2XU7A 4D9SA 4J79A 3CIKB 2QZPA 3O4IA 2HU7A 1XIPA 4OWRA 3PSLA 4BH6A 2Z2OA 3VI4A 5FKSA 4U7AA 1I2MB 3I2NA 5M5TA 2VDQA 3FRXA 5EMMB 3KCIA 2I0TA 4GMBA 4XYHA 4A08B 4ZOXA 5E6RA 4A2LA 3MVDK 1OLZA 3ORVD 2AGXA 4Z8LA 3PVWB 3C99A 3K27A 4A08A 1R5MA 4A0BB 4MK0B 2GC7A 3O4JA 2GC4A 1UOPA 1L0QA 1TYQC 1B9YA 3DM0A 2AGWA 4O02A 4G56B 3I7LA 2H6NA 3RRMC 4I79A 3MUNA 4O1QD 4MMXA 4O45A 2HJ4A 3C5MA 4CI2A 2VDLA 3ZE0A 2XE4A 4L3GD 5FLXg 4GQ1A 1T2XA 3UKUC 4AX4A 3OKTA 1E8NA 5CYKB 3J80g 2IWFA 4QL1A 2HXCA 5FQDA 1XHMA 3SN6B 4J87A 1K32A 3K26A 4K3JB 3RFGA 4MMZA 3VI3A 2P9LC 2BCJB 5FFOA 4U1EI 4GM9A 2B5NA 5GXIA 4GM8A 2IAAA 4JHPC 5EARA 3OKYA 3EWEA 4X3EA 3VA6A 2OVQB 4RE5A 5IGQA 3J81g 3AFCA 3N0DA 1JTDB 2AH1A 2VDNA 2W18A 2UZXB 3NIGA 1GOHA 5M5RA 1H2WA 2TRCB 4AOWA 3GREA 3FCUA 1YFQA 1SHYB 4JSNC 4FAND 1S4UX 1B9XA 3C9CA 1MDAH 4WK4A 4L1MA 4CY5A 4E54B 3W15A 3BWSA 1GOTB 3CFVA 3PE7A 4UM9A 3MMYA 4WK2A 5EMKB 2BBKH 5H14A 4AN0A 4D6VA 2VDKA 4CZXA 3SWSD 4ZN4A 4PBYA 2H13A 1GOFA 5AJAA 4H5JA 4NENA 2J56H 3IJCA 5FKQA 2PBIB 1M1XA 3OW8A 3IURA 3EMHA 2P9PC 3IJEA 2I0SA 3EI3B 4X60B 4A2MA 2XL3A 5EAPA 4J0WA 3ZE2A 3P4FA 4J86A 4CY2A 3ULEC 5C2VB 3DDUA 5C92A 4G1MA 4BP9A 2BKLA 2IWKA 3IJ0A 4Z7QA 4JSXC 4CY1A 4L1QD 5CXBB 5HE3B 2HESX 5IJ7E 4TZ4A 5CXBA 1K3IA 1UOQA 2WQ8A 5HDBA 3SHFA 1L5GA 2YB8B 2VC2A 3GD1I 4QQEA 2CN2A 3PSCB 2P9SC 3C75H 5FA5B 4G1EA 3EG6A 5CXCA 3GC3B 2H6KA 1C9LA 2XZGA 4A11B 3RMZD 3V4PA 1E5TA 4E5ZA 4GZ8A 4ERQA 3UVMA 1OMWB 4R7AB 4J8BA 3RN0D 4BCCA 5TEEA 3OL2B 1VYHC 3SCYA 5FFGA 2QR5A 1P22A 1VE7A 5KDOB 3K71A 3I7KA 2HU8A 4XYIA 5E6SA 3O4HA 3V5WB 5IC7A 3V4VA 4BCBA 4BCDA 3AL9A 2VDOA 2YMUA 1E8MA 3EI1B 2EBSA 2H3XA 4A0BA 2EIBA 3B7FA 1MG3A 3I7OA 2Q7QA 5E6UA 4PXWA 3IIWA 4L9OA 4K3ID 1UOOA 1Q47A 3ODTA 2Z2PA 3SLED 4BP8A 3UR4A 3IUQA 5TDHB 2CN3A 4FA9D 2OK4A 1H2XA 4GGCA 2OIZA 3N0EA 1TBGA 2VDMA 2B5MA 2AGLA 4J77A 4JXMA 4AMYA 3RLMD 4CZVA 4AMZA 5CYKA 3SXTD 5EM2B 1RI6A 3ZE1A 3SJLD 4G55A 4NBMA 3BG0A 3JB9L 3MKSB 2P9IC 5THAA 4LGNA 5GSAA 1BPOA 3SMRA 2H6QA 2H9NA 4XEIC 3NIDA 2P9KC 4EWRA 2CE8A 4DNVA 4NSXA 2I0RA 3IJ1A 5M5UA 4ESGA 3UVLA 4LG9A 5C9ZB 2H9LA 4O3UB 5C86A 2JKXA 5M5VA 2J55H 4UI9R 4E54A 3IIYA 4O3TB 2YBAA 4J78A 3L4MD 5EAMA 3HFQA 1H2YA 3DWLC 3BG1A 3V9FA 2HU5A 5IT9g 4OZUA 3QHYB 1U4CA 2IUQA 4N14A 4AN1A 1GG2B 3JROA 4PC0A 3AL8B 3AL8A 2H9PA 1GXRA 3I89A 5M61A 5AFU3 2H47A 4ZOZA 1SQ9A 4Z7NA
chains in the Genus database with same CATH topology
5A2Qg 3SBQA 5EMJB 5K1CC 2H9MA 3EI3A 3I8CA 4ERZA 3JZHA 1JMXB 4X61B 4CC9A 3MKQA 3FGBA 3KRXB 5HE2B 3AH8B 4PSXB 2H68A 3FM0A 4J8GA 3JRPA 4H5IA 3MZKA 2AGZA 2GNQA 2IUVA 3I7HA 3DXMC 4JSPC 2UZYB 2B5LA 4AEZA 5GXHA 3ZWLB 3EI4B 4A11A 5JWZA 5H17A 1A0RB 4L3HD 5EMLB 1U2VC 2QXVA 1JJUB 1NEXB 1NR0A 5SXMA 3OL2A 3I7PA 4HDJA 2P9UC 4PBZA 2IURA 5HE1B 4A0AB 3I7NA 1PBYB 5TEFA 2PM9B 1XKSA 3OTTA 2OJYA 2PM9A 1SQJA 2XYIA 3PXWD 2HJBA 3IKOA 4GGDA 3EI1A 4D0KA 4IA9A 3I8EA 3KRWB 3NVXA 1N6EA 4QRJA 2AGYA 4O9DA 1QNIA 4JT6C 5H1MA 3MXXA 4J84A 2OVPB 3F3FA 2CNXA 3L4OD 4KFMB 3EU7A 5FKTA 1PI6A 5B4WA 3SFZA 3PXSD 3MZLA 4QT8A 2H14A 5EM2A 2P9NC 1MG2A 4GM3A 5K19A 4FA4D 4GQBB 1JMZB 3CFSB 3SBPA 4ZOVA 2CO0C 4JD2C 2YNOA 4J73A 5IGOA 5C2WB 5FKRA 4GQ2P 4J82A 2PM7B 4CI3A 2CO0A 5FXYA 5HE0B 2YNNA 3NVQA 3UKRC 3UVKA 1PEVA 3OKYB 4CI1A 4FA5D 3GFCA 4CI8A 1GP2B 3F3PA 3A0FA 5IJ8E 2G9AA 4IMMA 2HYEA 3SVWD 4BUJC 3U4YA 3RN1D 2B4EA 2J57G 4LG8A 3EI2B 4FA1D 3EI2A 5AMSA 4PSWB 3V7DB 1ERJA 3JPXA 4YVDA 4CZYA 4FWWA 3E0CA 3JZGA 1FWXA 3OKWA 3SBRA 4FHLA 3RSEC 4PNKB 5GMKn 2YNPA 4FAVD 2G99A 3VH0A 5I5MA 1N6DA 2HKMA 2XL2A 4Y5RD 1JOFA 2AQ5A 5HQGA 3DXKC 4JT5C 4FB1D 3UVOA 3PVUB 2I3SA 2QC5A 4J0XA 4GGAA 4BL0A 5TF2A 4CY3A 3EI4A 4X63B 2Z2NA 1K8KC 5I5JA 5EALA 3F3GA 5HYNB 1N6FA 2IUPA 3NVNA 1PGUA 2O9KA 3PXTD 4ERYA 2OVRB 2PM6B 3DSMA 5CXCB 3JAMg 4ZOYA 4J81A 4Y7RA 4JSVC 4A0AA 2MTAH 4E5ZB 4ES0A 5I5IA 2HKRA 4A09B 3UVNA 2I3TA 4A09A 4A7JA 2OK6A 3RFHA 2AH0A 3JZNA 3VGZA 2CE9A 2XU7A 4J79A 3CIKB 1XIPA 4OWRA 3PSLA 4BH6A 2Z2OA 5FKSA 4U7AA 3I2NA 3FRXA 5EMMB 2I0TA 4GMBA 4XYHA 4ZOXA 4A2LA 4A08B 1OLZA 3ORVD 2AGXA 4Z8LA 3PVWB 3C99A 3K27A 4A08A 1R5MA 4A0BB 4MK0B 2GC7A 2GC4A 1L0QA 1TYQC 1B9YA 3DM0A 2AGWA 4G56B 3I7LA 2H6NA 3RRMC 4I79A 4O1QD 4O45A 2HJ4A 3C5MA 4CI2A 4L3GD 5FLXg 4GQ1A 3UKUC 3OKTA 5CYKB 3J80g 2IWFA 4QL1A 2HXCA 5FQDA 1XHMA 3SN6B 4J87A 1K32A 3K26A 4K3JB 3RFGA 2P9LC 2BCJB 4U1EI 4GM9A 2B5NA 5GXIA 4GM8A 2IAAA 5EARA 3OKYA 3EWEA 4X3EA 3VA6A 2OVQB 5IGQA 3J81g 3AFCA 3N0DA 2AH1A 2W18A 2UZXB 4AOWA 2TRCB 3GREA 1YFQA 4JSNC 1SHYB 4FAND 1S4UX 1B9XA 3C9CA 1MDAH 4CY5A 4E54B 3W15A 3BWSA 1GOTB 3CFVA 3PE7A 3MMYA 5EMKB 2BBKH 5H14A 4D6VA 4CZXA 4ZN4A 3SWSD 4PBYA 2H13A 5AJAA 4H5JA 2J56H 3IJCA 5FKQA 2PBIB 3OW8A 3EMHA 2P9PC 2I0SA 3EI3B 4X60B 4A2MA 2XL3A 5EAPA 4J0WA 3P4FA 4J86A 4CY2A 3ULEC 5C2VB 2IWKA 3IJ0A 4JSXC 4CY1A 4L1QD 5CXBB 5HE3B 2HESX 5IJ7E 4TZ4A 5CXBA 3SHFA 2YB8B 4QQEA 2CN2A 3PSCB 2P9SC 3C75H 5FA5B 3EG6A 5CXCA 2H6KA 4A11B 3RMZD 4E5ZA 4GZ8A 4ERQA 3UVMA 1OMWB 4R7AB 4J8BA 3RN0D 5TEEA 3OL2B 1VYHC 3SCYA 1P22A 5KDOB 3I7KA 4XYIA 3V5WB 5IC7A 3AL9A 2YMUA 3EI1B 2EBSA 2H3XA 4A0BA 3B7FA 1MG3A 3I7OA 2Q7QA 4PXWA 3IIWA 4L9OA 4K3ID 1Q47A 3ODTA 2Z2PA 3SLED 3UR4A 5TDHB 2CN3A 4FA9D 2OK4A 4GGCA 2OIZA 3N0EA 1TBGA 2B5MA 2AGLA 4J77A 4JXMA 3RLMD 4CZVA 5CYKA 3SXTD 5EM2B 1RI6A 3SJLD 3BG0A 3JB9L 3MKSB 2P9IC 5THAA 4LGNA 5GSAA 3SMRA 2H6QA 2H9NA 4XEIC 2P9KC 4EWRA 2CE8A 4NSXA 2I0RA 3IJ1A 4ESGA 3UVLA 4LG9A 5C9ZB 2H9LA 4O3UB 2J55H 4UI9R 4E54A 3IIYA 4O3TB 2YBAA 4J78A 3L4MD 5EAMA 3HFQA 3DWLC 3BG1A 3V9FA 5IT9g 4OZUA 1U4CA 2IUQA 4N14A 1GG2B 3JROA 4PC0A 3AL8B 3AL8A 2H9PA 1GXRA 3I89A 5AFU3 2H47A 4ZOZA 1SQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A2Q g;  3SBQ A;  5EMJ B;  5K1C C;  2H9M A;  3EI3 A;  3I8C A;  4ERZ A;  3JZH A;  1JMX B;  4X61 B;  4CC9 A;  3MKQ A;  3FGB A;  3KRX B;  5HE2 B;  3AH8 B;  4PSX B;  2H68 A;  3FM0 A;  4J8G A;  3JRP A;  4H5I A;  3MZK A;  2AGZ A;  2GNQ A;  2IUV A;  3I7H A;  3DXM C;  4JSP C;  2UZY B;  2B5L A;  4AEZ A;  5GXH A;  3ZWL B;  3EI4 B;  4A11 A;  5JWZ A;  5H17 A;  1A0R B;  4L3H D;  5EML B;  1U2V C;  2QXV A;  1JJU B;  1NEX B;  1NR0 A;  5SXM A;  3OL2 A;  3I7P A;  4HDJ A;  2P9U C;  4PBZ A;  2IUR A;  5HE1 B;  4A0A B;  3I7N A;  1PBY B;  5TEF A;  2PM9 B;  1XKS A;  3OTT A;  2OJY A;  2PM9 A;  1SQJ A;  2XYI A;  3PXW D;  2HJB A;  3IKO A;  4GGD A;  3EI1 A;  4D0K A;  4IA9 A;  3I8E A;  3KRW B;  3NVX A;  1N6E A;  4QRJ A;  2AGY A;  4O9D A;  1QNI A;  4JT6 C;  5H1M A;  3MXX A;  4J84 A;  2OVP B;  3F3F A;  2CNX A;  3L4O D;  4KFM B;  3EU7 A;  5FKT A;  1PI6 A;  5B4W A;  3SFZ A;  3PXS D;  3MZL A;  4QT8 A;  2H14 A;  5EM2 A;  2P9N C;  1MG2 A;  4GM3 A;  5K19 A;  4FA4 D;  4GQB B;  1JMZ B;  3CFS B;  3SBP A;  4ZOV A;  2CO0 C;  4JD2 C;  2YNO A;  4J73 A;  5IGO A;  5C2W B;  5FKR A;  4GQ2 P;  4J82 A;  2PM7 B;  4CI3 A;  2CO0 A;  5FXY A;  5HE0 B;  2YNN A;  3NVQ A;  3UKR C;  3UVK A;  1PEV A;  3OKY B;  4CI1 A;  4FA5 D;  3GFC A;  4CI8 A;  1GP2 B;  3F3P A;  3A0F A;  5IJ8 E;  2G9A A;  4IMM A;  2HYE A;  3SVW D;  4BUJ C;  3U4Y A;  3RN1 D;  2B4E A;  2J57 G;  4LG8 A;  3EI2 B;  4FA1 D;  3EI2 A;  5AMS A;  4PSW B;  3V7D B;  1ERJ A;  3JPX A;  4YVD A;  4CZY A;  4FWW A;  3E0C A;  3JZG A;  1FWX A;  3OKW A;  3SBR A;  4FHL A;  3RSE C;  4PNK B;  5GMK n;  2YNP A;  4FAV D;  2G99 A;  3VH0 A;  5I5M A;  1N6D A;  2HKM A;  2XL2 A;  4Y5R D;  1JOF A;  2AQ5 A;  5HQG A;  3DXK C;  4JT5 C;  4FB1 D;  3UVO A;  3PVU B;  2I3S A;  2QC5 A;  4J0X A;  4GGA A;  4BL0 A;  5TF2 A;  4CY3 A;  3EI4 A;  4X63 B;  2Z2N A;  1K8K C;  5I5J A;  5EAL A;  3F3G A;  5HYN B;  1N6F A;  2IUP A;  3NVN A;  1PGU A;  2O9K A;  3PXT D;  4ERY A;  2OVR B;  2PM6 B;  3DSM A;  5CXC B;  3JAM g;  4ZOY A;  4J81 A;  4Y7R A;  4JSV C;  4A0A A;  2MTA H;  4E5Z B;  4ES0 A;  5I5I A;  2HKR A;  4A09 B;  3UVN A;  2I3T A;  4A09 A;  4A7J A;  2OK6 A;  3RFH A;  2AH0 A;  3JZN A;  3VGZ A;  2CE9 A;  2XU7 A;  4J79 A;  3CIK B;  1XIP A;  4OWR A;  3PSL A;  4BH6 A;  2Z2O A;  5FKS A;  4U7A A;  3I2N A;  3FRX A;  5EMM B;  2I0T A;  4GMB A;  4XYH A;  4ZOX A;  4A2L A;  4A08 B;  1OLZ A;  3ORV D;  2AGX A;  4Z8L A;  3PVW B;  3C99 A;  3K27 A;  4A08 A;  1R5M A;  4A0B B;  4MK0 B;  2GC7 A;  2GC4 A;  1L0Q A;  1TYQ C;  1B9Y A;  3DM0 A;  2AGW A;  4G56 B;  3I7L A;  2H6N A;  3RRM C;  4I79 A;  4O1Q D;  4O45 A;  2HJ4 A;  3C5M A;  4CI2 A;  4L3G D;  5FLX g;  4GQ1 A;  3UKU C;  3OKT A;  5CYK B;  3J80 g;  2IWF A;  4QL1 A;  2HXC A;  5FQD A;  1XHM A;  3SN6 B;  4J87 A;  1K32 A;  3K26 A;  4K3J B;  3RFG A;  2P9L C;  2BCJ B;  4U1E I;  4GM9 A;  2B5N A;  5GXI A;  4GM8 A;  2IAA A;  5EAR A;  3OKY A;  3EWE A;  4X3E A;  3VA6 A;  2OVQ B;  5IGQ A;  3J81 g;  3AFC A;  3N0D A;  2AH1 A;  2W18 A;  2UZX B;  4AOW A;  2TRC B;  3GRE A;  1YFQ A;  4JSN C;  1SHY B;  4FAN D;  1S4U X;  1B9X A;  3C9C A;  1MDA H;  4CY5 A;  4E54 B;  3W15 A;  3BWS A;  1GOT B;  3CFV A;  3PE7 A;  3MMY A;  5EMK B;  2BBK H;  5H14 A;  4D6V A;  4CZX A;  4ZN4 A;  3SWS D;  4PBY A;  2H13 A;  5AJA A;  4H5J A;  2J56 H;  3IJC A;  5FKQ A;  2PBI B;  3OW8 A;  3EMH A;  2P9P C;  2I0S A;  3EI3 B;  4X60 B;  4A2M A;  2XL3 A;  5EAP A;  4J0W A;  3P4F A;  4J86 A;  4CY2 A;  3ULE C;  5C2V B;  2IWK A;  3IJ0 A;  4JSX C;  4CY1 A;  4L1Q D;  5CXB B;  5HE3 B;  2HES X;  5IJ7 E;  4TZ4 A;  5CXB A;  3SHF A;  2YB8 B;  4QQE A;  2CN2 A;  3PSC B;  2P9S C;  3C75 H;  5FA5 B;  3EG6 A;  5CXC A;  2H6K A;  4A11 B;  3RMZ D;  4E5Z A;  4GZ8 A;  4ERQ A;  3UVM A;  1OMW B;  4R7A B;  4J8B A;  3RN0 D;  5TEE A;  3OL2 B;  1VYH C;  3SCY A;  1P22 A;  5KDO B;  3I7K A;  4XYI A;  3V5W B;  5IC7 A;  3AL9 A;  2YMU A;  3EI1 B;  2EBS A;  2H3X A;  4A0B A;  3B7F A;  1MG3 A;  3I7O A;  2Q7Q A;  4PXW A;  3IIW A;  4L9O A;  4K3I D;  1Q47 A;  3ODT A;  2Z2P A;  3SLE D;  3UR4 A;  5TDH B;  2CN3 A;  4FA9 D;  2OK4 A;  4GGC A;  2OIZ A;  3N0E A;  1TBG A;  2B5M A;  2AGL A;  4J77 A;  4JXM A;  3RLM D;  4CZV A;  5CYK A;  3SXT D;  5EM2 B;  1RI6 A;  3SJL D;  3BG0 A;  3JB9 L;  3MKS B;  2P9I C;  5THA A;  4LGN A;  5GSA A;  3SMR A;  2H6Q A;  2H9N A;  4XEI C;  2P9K C;  4EWR A;  2CE8 A;  4NSX A;  2I0R A;  3IJ1 A;  4ESG A;  3UVL A;  4LG9 A;  5C9Z B;  2H9L A;  4O3U B;  2J55 H;  4UI9 R;  4E54 A;  3IIY A;  4O3T B;  2YBA A;  4J78 A;  3L4M D;  5EAM A;  3HFQ A;  3DWL C;  3BG1 A;  3V9F A;  5IT9 g;  4OZU A;  1U4C A;  2IUQ A;  4N14 A;  1GG2 B;  3JRO A;  4PC0 A;  3AL8 B;  3AL8 A;  2H9P A;  1GXR A;  3I89 A;  5AFU 3;  2H47 A;  4ZOZ A;  1SQ9 A; 
#chains in the Genus database with same CATH topology
 5A2Q g;  3SBQ A;  5EMJ B;  5K1C C;  2H9M A;  3EI3 A;  3I8C A;  4ERZ A;  3JZH A;  1JMX B;  4X61 B;  4CC9 A;  3MKQ A;  3FGB A;  3KRX B;  5HE2 B;  2VZ1 A;  3AH8 B;  4PSX B;  2H68 A;  3FM0 A;  4J8G A;  3JRP A;  4H5I A;  3MZK A;  2AGZ A;  3T3P A;  2EIC A;  3EQ8 A;  2GNQ A;  4QAM A;  2IUV A;  3I7H A;  3DXM C;  4JSP C;  2UZY B;  2B5L A;  4AEZ A;  5GXH A;  3ZWL B;  3EI4 B;  3IVM A;  4A11 A;  3K6S A;  5JWZ A;  5H17 A;  1A0R B;  3ZDX A;  4L3H D;  5EML B;  1U2V C;  2QXV A;  1JJU B;  1NEX B;  1NR0 A;  5SXM A;  3OL2 A;  3I7P A;  4HDJ A;  2P9U C;  4PBZ A;  2IUR A;  5HE1 B;  4A0A B;  3I7N A;  1PBY B;  3O4G A;  3T3M A;  5TEF A;  2PM9 B;  1XKS A;  3OTT A;  2OJY A;  2PM9 A;  1SQJ A;  2XYI A;  3PXW D;  2EID A;  2HJB A;  3IKO A;  4GGD A;  3EI1 A;  4D0K A;  4IA9 A;  3I8E A;  3KRW B;  3IUL A;  3NVX A;  1N6E A;  2VDP A;  4QRJ A;  2AGY A;  4O9D A;  1QNI A;  4JT6 C;  5H1M A;  3MXX A;  4J84 A;  2OVP B;  3F3F A;  3IUN A;  1GOG A;  2CNX A;  3L4O D;  4KFM B;  3EU7 A;  4RE6 A;  5FKT A;  1PI6 A;  5B4W A;  3SFZ A;  3PXS D;  3MZL A;  4QT8 A;  2H14 A;  1VZ2 A;  5EM2 A;  2P9N C;  1JV2 A;  1MG2 A;  4GM3 A;  5K19 A;  4FA4 D;  3EQ7 A;  4GQB B;  1JMZ B;  3CFS B;  3SBP A;  4ZOV A;  1O6F A;  2CO0 C;  4JD2 C;  4NC4 A;  2YNO A;  4J73 A;  4DNW A;  5IGO A;  5C2W B;  5FKR A;  4GQ2 P;  4J82 A;  2PM7 B;  3IUJ A;  4CI3 A;  2CO0 A;  5FXY A;  4MMY A;  5HE0 B;  2YNN A;  3NVQ A;  3UKR C;  1O6G A;  3UVK A;  2VDR A;  3NIF A;  1PEV A;  3OKY B;  1A12 A;  4CI1 A;  4Z7O A;  3EQ9 A;  4NAA A;  4FA5 D;  3GFC A;  2XDW A;  4CI8 A;  1GP2 B;  3F3P A;  4DNU A;  3A0F A;  5IJ8 E;  2G9A A;  4IMM A;  2HYE A;  3SVW D;  4BUJ C;  3U4Y A;  3RN1 D;  1TYE A;  3MUO A;  3IUM A;  2B4E A;  2J57 G;  4LG8 A;  3EI2 B;  2EIE A;  4FA1 D;  3EI2 A;  5AMS A;  4PSW B;  3V7D B;  4O2W A;  4WK0 A;  1ERJ A;  3JPX A;  4YVD A;  4CZY A;  4FWW A;  1QFS A;  3E0C A;  3JZG A;  1FWX A;  3OKW A;  3SBR A;  4FHL A;  3RSE C;  4PNK B;  5GMK n;  1VE6 A;  2YNP A;  4FAV D;  2G99 A;  1QFM A;  3QI0 A;  5M5S A;  1H2Z A;  5I5M A;  1N6D A;  3VH0 A;  2VZ3 A;  2HKM A;  2XL2 A;  4Y5R D;  1JOF A;  3ZDY A;  2AQ5 A;  5HQG A;  3DXK C;  1C9I A;  1VZ3 A;  4JT5 C;  4FB1 D;  3UVO A;  3PVU B;  2I3S A;  2QC5 A;  4J0X A;  3FCS A;  4GGA A;  4BL0 A;  4IRZ A;  5TF2 A;  4CY3 A;  3EI4 A;  4X63 B;  2Z2N A;  3ZDZ A;  3OF7 A;  1K8K C;  5I5J A;  4WJK A;  5EAL A;  3F3G A;  5HYN B;  1N6F A;  2IUP A;  3NVN A;  1PGU A;  3K72 A;  4UM8 A;  2O9K A;  3PXT D;  1YR2 A;  4ERY A;  2OVR B;  2PM6 B;  3DSM A;  1UTC A;  5CXC B;  3JAM g;  4ZOY A;  4J81 A;  4Y7R A;  4JSV C;  4A0A A;  2MTA H;  4E5Z B;  4ES0 A;  4JHN A;  5I5I A;  2HKR A;  4A09 B;  3UVN A;  1U8C A;  2I3T A;  4A09 A;  4A7J A;  2OK6 A;  3RFH A;  2AH0 A;  3JZN A;  3VGZ A;  2CE9 A;  2XU7 A;  4D9S A;  4J79 A;  3CIK B;  2QZP A;  3O4I A;  2HU7 A;  1XIP A;  4OWR A;  3PSL A;  4BH6 A;  2Z2O A;  3VI4 A;  5FKS A;  4U7A A;  1I2M B;  3I2N A;  5M5T A;  2VDQ A;  3FRX A;  5EMM B;  3KCI A;  2I0T A;  4GMB A;  4XYH A;  4A08 B;  4ZOX A;  5E6R A;  4A2L A;  3MVD K;  1OLZ A;  3ORV D;  2AGX A;  4Z8L A;  3PVW B;  3C99 A;  3K27 A;  4A08 A;  1R5M A;  4A0B B;  4MK0 B;  2GC7 A;  3O4J A;  2GC4 A;  1UOP A;  1L0Q A;  1TYQ C;  1B9Y A;  3DM0 A;  2AGW A;  4O02 A;  4G56 B;  3I7L A;  2H6N A;  3RRM C;  4I79 A;  3MUN A;  4O1Q D;  4MMX A;  4O45 A;  2HJ4 A;  3C5M A;  4CI2 A;  2VDL A;  3ZE0 A;  2XE4 A;  4L3G D;  5FLX g;  4GQ1 A;  1T2X A;  3UKU C;  4AX4 A;  3OKT A;  1E8N A;  5CYK B;  3J80 g;  2IWF A;  4QL1 A;  2HXC A;  5FQD A;  1XHM A;  3SN6 B;  4J87 A;  1K32 A;  3K26 A;  4K3J B;  3RFG A;  4MMZ A;  3VI3 A;  2P9L C;  2BCJ B;  5FFO A;  4U1E I;  4GM9 A;  2B5N A;  5GXI A;  4GM8 A;  2IAA A;  4JHP C;  5EAR A;  3OKY A;  3EWE A;  4X3E A;  3VA6 A;  2OVQ B;  4RE5 A;  5IGQ A;  3J81 g;  3AFC A;  3N0D A;  1JTD B;  2AH1 A;  2VDN A;  2W18 A;  2UZX B;  3NIG A;  1GOH A;  5M5R A;  1H2W A;  2TRC B;  4AOW A;  3GRE A;  3FCU A;  1YFQ A;  1SHY B;  4JSN C;  4FAN D;  1S4U X;  1B9X A;  3C9C A;  1MDA H;  4WK4 A;  4L1M A;  4CY5 A;  4E54 B;  3W15 A;  3BWS A;  1GOT B;  3CFV A;  3PE7 A;  4UM9 A;  3MMY A;  4WK2 A;  5EMK B;  2BBK H;  5H14 A;  4AN0 A;  4D6V A;  2VDK A;  4CZX A;  3SWS D;  4ZN4 A;  4PBY A;  2H13 A;  1GOF A;  5AJA A;  4H5J A;  4NEN A;  2J56 H;  3IJC A;  5FKQ A;  2PBI B;  1M1X A;  3OW8 A;  3IUR A;  3EMH A;  2P9P C;  3IJE A;  2I0S A;  3EI3 B;  4X60 B;  4A2M A;  2XL3 A;  5EAP A;  4J0W A;  3ZE2 A;  3P4F A;  4J86 A;  4CY2 A;  3ULE C;  5C2V B;  3DDU A;  5C92 A;  4G1M A;  4BP9 A;  2BKL A;  2IWK A;  3IJ0 A;  4Z7Q A;  4JSX C;  4CY1 A;  4L1Q D;  5CXB B;  5HE3 B;  2HES X;  5IJ7 E;  4TZ4 A;  5CXB A;  1K3I A;  1UOQ A;  2WQ8 A;  5HDB A;  3SHF A;  1L5G A;  2YB8 B;  2VC2 A;  3GD1 I;  4QQE A;  2CN2 A;  3PSC B;  2P9S C;  3C75 H;  5FA5 B;  4G1E A;  3EG6 A;  5CXC A;  3GC3 B;  2H6K A;  1C9L A;  2XZG A;  4A11 B;  3RMZ D;  3V4P A;  1E5T A;  4E5Z A;  4GZ8 A;  4ERQ A;  3UVM A;  1OMW B;  4R7A B;  4J8B A;  3RN0 D;  4BCC A;  5TEE A;  3OL2 B;  1VYH C;  3SCY A;  5FFG A;  2QR5 A;  1P22 A;  1VE7 A;  5KDO B;  3K71 A;  3I7K A;  2HU8 A;  4XYI A;  5E6S A;  3O4H A;  3V5W B;  5IC7 A;  3V4V A;  4BCB A;  4BCD A;  3AL9 A;  2VDO A;  2YMU A;  1E8M A;  3EI1 B;  2EBS A;  2H3X A;  4A0B A;  2EIB A;  3B7F A;  1MG3 A;  3I7O A;  2Q7Q A;  5E6U A;  4PXW A;  3IIW A;  4L9O A;  4K3I D;  1UOO A;  1Q47 A;  3ODT A;  2Z2P A;  3SLE D;  4BP8 A;  3UR4 A;  3IUQ A;  5TDH B;  2CN3 A;  4FA9 D;  2OK4 A;  1H2X A;  4GGC A;  2OIZ A;  3N0E A;  1TBG A;  2VDM A;  2B5M A;  2AGL A;  4J77 A;  4JXM A;  4AMY A;  3RLM D;  4CZV A;  4AMZ A;  5CYK A;  3SXT D;  5EM2 B;  1RI6 A;  3ZE1 A;  3SJL D;  4G55 A;  4NBM A;  3BG0 A;  3JB9 L;  3MKS B;  2P9I C;  5THA A;  4LGN A;  5GSA A;  1BPO A;  3SMR A;  2H6Q A;  2H9N A;  4XEI C;  3NID A;  2P9K C;  4EWR A;  2CE8 A;  4DNV A;  4NSX A;  2I0R A;  3IJ1 A;  5M5U A;  4ESG A;  3UVL A;  4LG9 A;  5C9Z B;  2H9L A;  4O3U B;  5C86 A;  2JKX A;  5M5V A;  2J55 H;  4UI9 R;  4E54 A;  3IIY A;  4O3T B;  2YBA A;  4J78 A;  3L4M D;  5EAM A;  3HFQ A;  1H2Y A;  3DWL C;  3BG1 A;  3V9F A;  2HU5 A;  5IT9 g;  4OZU A;  3QHY B;  1U4C A;  2IUQ A;  4N14 A;  4AN1 A;  1GG2 B;  3JRO A;  4PC0 A;  3AL8 B;  3AL8 A;  2H9P A;  1GXR A;  3I89 A;  5M61 A;  5AFU 3;  2H47 A;  4ZOZ A;  1SQ9 A;  4Z7N A; 
#chains in the Genus database with same CATH homology
 5A2Q g;  3SBQ A;  5EMJ B;  5K1C C;  2H9M A;  3EI3 A;  3I8C A;  4ERZ A;  3JZH A;  1JMX B;  4X61 B;  4CC9 A;  3MKQ A;  3FGB A;  3KRX B;  5HE2 B;  3AH8 B;  4PSX B;  2H68 A;  3FM0 A;  4J8G A;  3JRP A;  4H5I A;  3MZK A;  2AGZ A;  2GNQ A;  2IUV A;  3I7H A;  3DXM C;  4JSP C;  2UZY B;  2B5L A;  4AEZ A;  5GXH A;  3ZWL B;  3EI4 B;  4A11 A;  5JWZ A;  5H17 A;  1A0R B;  4L3H D;  5EML B;  1U2V C;  2QXV A;  1JJU B;  1NEX B;  1NR0 A;  5SXM A;  3OL2 A;  3I7P A;  4HDJ A;  2P9U C;  4PBZ A;  2IUR A;  5HE1 B;  4A0A B;  3I7N A;  1PBY B;  5TEF A;  2PM9 B;  1XKS A;  3OTT A;  2OJY A;  2PM9 A;  1SQJ A;  2XYI A;  3PXW D;  2HJB A;  3IKO A;  4GGD A;  3EI1 A;  4D0K A;  4IA9 A;  3I8E A;  3KRW B;  3NVX A;  1N6E A;  4QRJ A;  2AGY A;  4O9D A;  1QNI A;  4JT6 C;  5H1M A;  3MXX A;  4J84 A;  2OVP B;  3F3F A;  2CNX A;  3L4O D;  4KFM B;  3EU7 A;  5FKT A;  1PI6 A;  5B4W A;  3SFZ A;  3PXS D;  3MZL A;  4QT8 A;  2H14 A;  5EM2 A;  2P9N C;  1MG2 A;  4GM3 A;  5K19 A;  4FA4 D;  4GQB B;  1JMZ B;  3CFS B;  3SBP A;  4ZOV A;  2CO0 C;  4JD2 C;  2YNO A;  4J73 A;  5IGO A;  5C2W B;  5FKR A;  4GQ2 P;  4J82 A;  2PM7 B;  4CI3 A;  2CO0 A;  5FXY A;  5HE0 B;  2YNN A;  3NVQ A;  3UKR C;  3UVK A;  1PEV A;  3OKY B;  4CI1 A;  4FA5 D;  3GFC A;  4CI8 A;  1GP2 B;  3F3P A;  3A0F A;  5IJ8 E;  2G9A A;  4IMM A;  2HYE A;  3SVW D;  4BUJ C;  3U4Y A;  3RN1 D;  2B4E A;  2J57 G;  4LG8 A;  3EI2 B;  4FA1 D;  3EI2 A;  5AMS A;  4PSW B;  3V7D B;  1ERJ A;  3JPX A;  4YVD A;  4CZY A;  4FWW A;  3E0C A;  3JZG A;  1FWX A;  3OKW A;  3SBR A;  4FHL A;  3RSE C;  4PNK B;  5GMK n;  2YNP A;  4FAV D;  2G99 A;  3VH0 A;  5I5M A;  1N6D A;  2HKM A;  2XL2 A;  4Y5R D;  1JOF A;  2AQ5 A;  5HQG A;  3DXK C;  4JT5 C;  4FB1 D;  3UVO A;  3PVU B;  2I3S A;  2QC5 A;  4J0X A;  4GGA A;  4BL0 A;  5TF2 A;  4CY3 A;  3EI4 A;  4X63 B;  2Z2N A;  1K8K C;  5I5J A;  5EAL A;  3F3G A;  5HYN B;  1N6F A;  2IUP A;  3NVN A;  1PGU A;  2O9K A;  3PXT D;  4ERY A;  2OVR B;  2PM6 B;  3DSM A;  5CXC B;  3JAM g;  4ZOY A;  4J81 A;  4Y7R A;  4JSV C;  4A0A A;  2MTA H;  4E5Z B;  4ES0 A;  5I5I A;  2HKR A;  4A09 B;  3UVN A;  2I3T A;  4A09 A;  4A7J A;  2OK6 A;  3RFH A;  2AH0 A;  3JZN A;  3VGZ A;  2CE9 A;  2XU7 A;  4J79 A;  3CIK B;  1XIP A;  4OWR A;  3PSL A;  4BH6 A;  2Z2O A;  5FKS A;  4U7A A;  3I2N A;  3FRX A;  5EMM B;  2I0T A;  4GMB A;  4XYH A;  4ZOX A;  4A2L A;  4A08 B;  1OLZ A;  3ORV D;  2AGX A;  4Z8L A;  3PVW B;  3C99 A;  3K27 A;  4A08 A;  1R5M A;  4A0B B;  4MK0 B;  2GC7 A;  2GC4 A;  1L0Q A;  1TYQ C;  1B9Y A;  3DM0 A;  2AGW A;  4G56 B;  3I7L A;  2H6N A;  3RRM C;  4I79 A;  4O1Q D;  4O45 A;  2HJ4 A;  3C5M A;  4CI2 A;  4L3G D;  5FLX g;  4GQ1 A;  3UKU C;  3OKT A;  5CYK B;  3J80 g;  2IWF A;  4QL1 A;  2HXC A;  5FQD A;  1XHM A;  3SN6 B;  4J87 A;  1K32 A;  3K26 A;  4K3J B;  3RFG A;  2P9L C;  2BCJ B;  4U1E I;  4GM9 A;  2B5N A;  5GXI A;  4GM8 A;  2IAA A;  5EAR A;  3OKY A;  3EWE A;  4X3E A;  3VA6 A;  2OVQ B;  5IGQ A;  3J81 g;  3AFC A;  3N0D A;  2AH1 A;  2W18 A;  2UZX B;  4AOW A;  2TRC B;  3GRE A;  1YFQ A;  4JSN C;  1SHY B;  4FAN D;  1S4U X;  1B9X A;  3C9C A;  1MDA H;  4CY5 A;  4E54 B;  3W15 A;  3BWS A;  1GOT B;  3CFV A;  3PE7 A;  3MMY A;  5EMK B;  2BBK H;  5H14 A;  4D6V A;  4CZX A;  4ZN4 A;  3SWS D;  4PBY A;  2H13 A;  5AJA A;  4H5J A;  2J56 H;  3IJC A;  5FKQ A;  2PBI B;  3OW8 A;  3EMH A;  2P9P C;  2I0S A;  3EI3 B;  4X60 B;  4A2M A;  2XL3 A;  5EAP A;  4J0W A;  3P4F A;  4J86 A;  4CY2 A;  3ULE C;  5C2V B;  2IWK A;  3IJ0 A;  4JSX C;  4CY1 A;  4L1Q D;  5CXB B;  5HE3 B;  2HES X;  5IJ7 E;  4TZ4 A;  5CXB A;  3SHF A;  2YB8 B;  4QQE A;  2CN2 A;  3PSC B;  2P9S C;  3C75 H;  5FA5 B;  3EG6 A;  5CXC A;  2H6K A;  4A11 B;  3RMZ D;  4E5Z A;  4GZ8 A;  4ERQ A;  3UVM A;  1OMW B;  4R7A B;  4J8B A;  3RN0 D;  5TEE A;  3OL2 B;  1VYH C;  3SCY A;  1P22 A;  5KDO B;  3I7K A;  4XYI A;  3V5W B;  5IC7 A;  3AL9 A;  2YMU A;  3EI1 B;  2EBS A;  2H3X A;  4A0B A;  3B7F A;  1MG3 A;  3I7O A;  2Q7Q A;  4PXW A;  3IIW A;  4L9O A;  4K3I D;  1Q47 A;  3ODT A;  2Z2P A;  3SLE D;  3UR4 A;  5TDH B;  2CN3 A;  4FA9 D;  2OK4 A;  4GGC A;  2OIZ A;  3N0E A;  1TBG A;  2B5M A;  2AGL A;  4J77 A;  4JXM A;  3RLM D;  4CZV A;  5CYK A;  3SXT D;  5EM2 B;  1RI6 A;  3SJL D;  3BG0 A;  3JB9 L;  3MKS B;  2P9I C;  5THA A;  4LGN A;  5GSA A;  3SMR A;  2H6Q A;  2H9N A;  4XEI C;  2P9K C;  4EWR A;  2CE8 A;  4NSX A;  2I0R A;  3IJ1 A;  4ESG A;  3UVL A;  4LG9 A;  5C9Z B;  2H9L A;  4O3U B;  2J55 H;  4UI9 R;  4E54 A;  3IIY A;  4O3T B;  2YBA A;  4J78 A;  3L4M D;  5EAM A;  3HFQ A;  3DWL C;  3BG1 A;  3V9F A;  5IT9 g;  4OZU A;  1U4C A;  2IUQ A;  4N14 A;  1GG2 B;  3JRO A;  4PC0 A;  3AL8 B;  3AL8 A;  2H9P A;  1GXR A;  3I89 A;  5AFU 3;  2H47 A;  4ZOZ A;  1SQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...