3L4MD

Crystal structure of the maug/pre-methylamine dehydrogenase complex.
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein mauG
publication title In crystallo posttranslational modification within a MauG/pre-methylamine dehydrogenase complex.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 92
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3l4mD00
1RI6A 4CZVA 4CI3A 3UVNA 2B5LA 1ERJA 2I0SA 4HDJA 2XL2A 4LG9A 5FLXg 2XL3A 4L3HD 4FA1D 2IWFA 4BH6A 5HQGA 3DWLC 3KRWB 5TEEA 4X63B 4JT5C 4J84A 3UKUC 1NEXB 4I79A 3I7KA 3RMZD 4E54A 4OZUA 5K1CC 4D0KA 5THAA 2AGZA 3RSEC 4A0AA 4A0AB 2Z2OA 4O3TB 2I3SA 1PEVA 1K32A 3AH8B 3I8CA 4ZOVA 2H6QA 5EMKB 4CY2A 5C9ZB 1XHMA 3SVWD 2G9AA 4FAVD 2CE9A 2OIZA 3MKQA 3VH0A 3RN0D 3JAMg 4Y7RA 4G56B 3JZHA 5FKSA 3OKTA 5GMKn 4GGDA 4XEIC 3JPXA 5IGQA 3DXMC 4ERYA 1OMWB 2H9NA 2HESX 4FAND 2O9KA 3RN1D 3MKSB 4J0XA 4A2MA 4LGNA 4A7JA 2CO0C 5TF2A 5EAMA 2XYIA 2H68A 3NVNA 1K8KC 3I8EA 3IJCA 2YNOA 4X60B 4QQEA 4A08A 4N14A 4A08B 2YBAA 2TRCB 3ORVD 3IIWA 3PXTD 3I7OA 3W15A 1TBGA 2H6NA 1JMXB 4J78A 4PBYA 4KFMB 3PSLA 2AGXA 3JROA 2YNNA 5FKRA 4GGAA 5EARA 1GOTB 2H3XA 2UZXB 4ERZA 4GQ1A 2AQ5A 1XKSA 4MK0B 4LG8A 4A09A 4A09B 5C2VB 5IT9g 1MG3A 3SJLD 5I5MA 4JSVC 3AFCA 4ZOXA 4CY5A 3J80g 2I0RA 1MDAH 4R7AB 2YB8B 4GMBA 3EG6A 4J87A 3C75H 5KDOB 4D6VA 4YVDA 2OK4A 3MXXA 4Y5RD 3P4FA 5AFU3 4J82A 2HXCA 4X61B 1QNIA 4XYIA 3KRXB 3I2NA 3CFSB 2HJ4A 4GM9A 3NVXA 3F3FA 4IA9A 1N6DA 5H14A 2BCJB 3SBRA 4E54B 2QXVA 3VA6A 4K3ID 5GXHA 2AH0A 1SHYB 3K26A 3ODTA 4ERQA 5CXCA 4PNKB 3OW8A 5CXCB 1GXRA 4ZOYA 1JJUB 5FXYA 4FB1D 5HYNB 1B9YA 2CN3A 3RLMD 2PM9A 2PM9B 3JZNA 4FHLA 3CFVA 2OVRB 5A2Qg 4CZYA 4EWRA 3PXWD 4A2LA 3IIYA 5AJAA 3EU7A 3DXKC 5SXMA 5IGOA 3EWEA 1GP2B 2H47A 3SHFA 3OKYA 3OKYB 4J0WA 4L3GD 2HJBA 3SBQA 5EM2A 5EM2B 4TZ4A 1XIPA 4CI8A 4U7AA 3MZKA 3C5MA 4H5IA 4PBZA 3RFHA 2H9PA 4ESGA 5IJ8E 4OWRA 4FA5D 2XU7A 3SXTD 2IWKA 2H9LA 1B9XA 4JXMA 4L9OA 3PXSD 4K3JB 2Z2NA 5GSAA 2PM6B 1MG2A 5I5JA 2J56H 2YNPA 2OVPB 3EI1A 3EI1B 2BBKH 2OJYA 4PSWB 5HE0B 2HYEA 3I7PA 4J73A 3A0FA 2Z2PA 1PI6A 5H17A 2H13A 3OL2A 3OL2B 4A0BA 5EMJB 4A0BB 4ZOZA 1U4CA 2P9LC 3AL8A 1N6FA 3AL8B 3OTTA 4CY3A 1S4UX 2J57G 4O45A 3K27A 4GM3A 4JD2C 2P9SC 2OK6A 3EMHA 4QL1A 4J79A 2H9MA 3I7HA 3NVQA 4PXWA 3JRPA 3ULEC 5H1MA 5HE1B 3B7FA 3N0EA 5EAPA 4GQ2P 2PBIB 4ES0A 3C9CA 2IUPA 1JOFA 1PBYB 4NSXA 4U1EI 1JMZB 2B5NA 4CZXA 4J86A 4J8GA 2CN2A 3VGZA 1FWXA 5C2WB 2B5MA 4QT8A 4CI1A 3PVUB 2P9NC 3SMRA 1P22A 4BL0A 4PC0A 3BG0A 3EI3A 4O9DA 4CC9A 4CI2A 3L4MD 4J77A 4J81A 4UI9R 4QRJA 5CXBA 5CXBB 5FKQA 5EMMB 3FRXA 2IUVA 5IJ7E 3MMYA 3SLED 4H5JA 3UKRC 1VYHC 2AH1A 4JSPC 3BG1A 4J8BA 5EMLB 3SN6B 4L1QD 1A0RB 2AGWA 5AMSA 3MZLA 4AEZA 3I89A 5TDHB 4FA9D 4GQBB 3SCYA 4GGCA 3V9FA 3ZWLB 2J55H 5B4WA 4E5ZB 4E5ZA 2H6KA 2P9IC 3UVLA 2P9PC 1N6EA 5IC7A 3FM0A 2IUQA 1Q47A 4O3UB 1SQ9A 4BUJC 2OVQB 3SFZA 2W18A 1YFQA 3I7LA 2I3TA 2AGYA 3V5WB 1OLZA 3F3GA 5K19A 3DM0A 3PSCB 3PVWB 2P9UC 3IJ1A 3EI4A 3EI4B 3J81g 2Q7QA 4X3EA 3V7DB 2IAAA 5HE2B 3SBPA 3UVKA 3AL9A 4Z8LA 2P9KC 3F3PA 5I5IA 3JB9L 3SWSD 3CIKB 4O1QD 4ZN4A 3BWSA 3IJ0A 2GC4A 1R5MA 3I7NA 3EI2A 3EI2B 2B4EA 1U2VC 3OKWA 5GXIA 2GC7A 3GFCA 5FKTA 2GNQA 2CNXA 3DSMA 3UVOA 3JZGA 5HE3B 2H14A 3UVMA 4A11A 4A11B 1SQJA 3C99A 2HKRA 4JT6C 3HFQA 2PM7B 4XYHA 3N0DA 4CY1A 3PE7A 3FGBA 2HKMA 4FWWA 4FA4D 5FA5B 4JSNC 4IMMA 2IURA 2CE8A 2AGLA 4JSXC 4GM8A 4PSXB 5FQDA 1L0QA 3GREA 3RRMC 5CYKA 5CYKB 4AOWA 5JWZA 2EBSA 1GG2B 3UR4A 3L4OD 1PGUA 2CO0A 5EALA 3RFGA 2MTAH 3IKOA 2I0TA 2QC5A 2G99A 4GZ8A 1TYQC 5TEFA 3E0CA 3U4YA 2UZYB 3EI3B 1NR0A 2YMUA
chains in the Genus database with same CATH superfamily
1RI6A 4CZVA 4CI3A 3UVNA 2B5LA 1ERJA 2I0SA 2WQ8A 2XL2A 4HDJA 4LG9A 5FLXg 2XL3A 4L3HD 4WJKA 4FA1D 2IWFA 4BH6A 5HQGA 3DWLC 4JHNA 3KRWB 5TEEA 4X63B 4JT5C 4J84A 4MMXA 3UKUC 1NEXB 4I79A 3I7KA 4O02A 3RMZD 3O4IA 4E54A 4OZUA 5K1CC 4D0KA 5THAA 2AGZA 3RSEC 4A0AA 4A0AB 2Z2OA 2VDRA 4Z7QA 4MMZA 4O3TB 2I3SA 3K6SA 1PEVA 3EQ9A 1L5GA 3NIDA 1K32A 3AH8B 1VZ2A 2EICA 3I8CA 4ZOVA 2H6QA 5EMKB 4CY2A 5C9ZB 4UM8A 1XHMA 3SVWD 2G9AA 1E5TA 3IUQA 3ZDYA 4FAVD 2CE9A 2OIZA 4G1EA 3MKQA 3VH0A 3RN0D 3JAMg 4Y7RA 3MUNA 4G56B 3JZHA 5FKSA 3OKTA 3IULA 5GMKn 4GGDA 4G1MA 4XEIC 3JPXA 2XE4A 3O4JA 5IGQA 3DXMC 4ERYA 1OMWB 2H9NA 2HESX 1O6GA 1VZ3A 4FAND 2O9KA 3RN1D 3MKSB 4J0XA 4QAMA 4A2MA 4LGNA 4A7JA 4AN1A 2CO0C 4NAAA 5TF2A 3V4PA 4BCCA 5EAMA 2XYIA 2H68A 3NVNA 1K8KC 3I8EA 3IJCA 2YNOA 4X60B 4QQEA 4A08A 4N14A 4A08B 2YBAA 4BP8A 5C86A 1GOFA 2TRCB 3ORVD 3IIWA 3PXTD 3I7OA 3W15A 1TBGA 2H6NA 1JMXB 4J78A 4PBYA 4KFMB 3PSLA 2AGXA 3JROA 2YNNA 5FKRA 4GGAA 5EARA 1GOTB 2H3XA 2UZXB 5E6SA 4ERZA 4GQ1A 1UTCA 5HDBA 2AQ5A 1XKSA 4MK0B 4LG8A 2EIEA 5M61A 4A09B 4A09A 4D9SA 4BP9A 5C2VB 3O4GA 5IT9g 1MG3A 4NC4A 1E8NA 3SJLD 5I5MA 1UOPA 4JSVC 3AFCA 4ZOXA 4CY5A 3K72A 3J80g 3NIGA 3FCSA 2I0RA 1MDAH 4R7AB 2EIBA 2YB8B 4GMBA 3EG6A 1H2ZA 3OF7A 4J87A 3C75H 1YR2A 5KDOB 4D6VA 4YVDA 2OK4A 3MXXA 1O6FA 4Y5RD 2VZ1A 5E6UA 3DDUA 3P4FA 5AFU3 4J82A 2HXCA 4X61B 4DNVA 4WK0A 1QNIA 3ZE0A 4XYIA 3KRXB 1H2YA 3NIFA 3I2NA 3CFSB 2HJ4A 2HU7A 4GM9A 3NVXA 3F3FA 4IA9A 1N6DA 3K71A 5H14A 2BCJB 3SBRA 2VDKA 4E54B 2QXVA 3VA6A 4K3ID 5GXHA 2AH0A 1SHYB 2VDOA 3K26A 3ODTA 4ERQA 1K3IA 5CXCA 4PNKB 3OW8A 5CXCB 1GXRA 3ZE2A 4DNUA 4ZOYA 1JJUB 3MVDK 5FFGA 5FXYA 1U8CA 3T3PA 4FB1D 5HYNB 1B9YA 2CN3A 3RLMD 2PM9A 2PM9B 3JZNA 4FHLA 3CFVA 2OVRB 5A2Qg 4CZYA 5M5UA 4EWRA 1JTDB 3PXWD 4A2LA 5C92A 3GC3B 3IIYA 5AJAA 3EU7A 3T3MA 2XDWA 3DXKC 3QHYB 5SXMA 5IGOA 3EWEA 4AMYA 1GP2B 3MUOA 2H47A 3SHFA 3OKYA 3OKYB 4J0WA 4L3GD 2HJBA 3SBQA 5EM2A 5EM2B 1T2XA 4TZ4A 1XIPA 2VDPA 3IUJA 4CI8A 3IUNA 4U7AA 3MZKA 3C5MA 3EQ8A 3O4HA 3VI3A 4H5IA 4AMZA 2VC2A 4PBZA 3RFHA 2H9PA 4ESGA 5IJ8E 4OWRA 2HU8A 4IRZA 4FA5D 2QR5A 2XZGA 2XU7A 3SXTD 2IWKA 2H9LA 1B9XA 1TYEA 4JXMA 4L9OA 3PXSD 4K3JB 5FFOA 2Z2NA 5GSAA 2PM6B 1MG2A 2QZPA 5I5JA 2J56H 2YNPA 2OVPB 4BCDA 3EI1B 3EI1A 2BBKH 2OJYA 3ZDZA 4PSWB 4RE6A 5HE0B 2HYEA 3I7PA 4J73A 3A0FA 2Z2PA 1PI6A 5H17A 2H13A 3OL2A 3OL2B 4A0BA 5EMJB 4A0BB 4ZOZA 1U4CA 2P9LC 3AL8A 1N6FA 3AL8B 3OTTA 4CY3A 1S4UX 2J57G 4O45A 3ZE1A 3K27A 4GM3A 4JD2C 4UM9A 2P9SC 2OK6A 3EMHA 4QL1A 4J79A 2H9MA 4DNWA 3I7HA 1C9LA 3NVQA 4PXWA 3JRPA 3ULEC 5H1MA 5HE1B 3B7FA 3N0EA 5EAPA 4GQ2P 2PBIB 4ES0A 3C9CA 2IUPA 1JOFA 1PBYB 4NSXA 5M5TA 4MMYA 1UOQA 4U1EI 1M1XA 4G55A 1JMZB 4NENA 1A12A 2B5NA 4CZXA 5M5SA 3VI4A 4J86A 4J8GA 2CN2A 3IUMA 4Z7OA 3VGZA 1GOHA 1FWXA 5C2WB 2B5MA 4JHPC 4QT8A 3IURA 4CI1A 2VDNA 3PVUB 2P9NC 3SMRA 1P22A 2BKLA 1C9IA 3KCIA 4BL0A 4PC0A 3BG0A 3EI3A 4O9DA 4CC9A 2VDLA 4CI2A 1VE7A 3L4MD 4J77A 4J81A 4UI9R 4QRJA 3ZDXA 3FCUA 5CXBA 5CXBB 5FKQA 5EMMB 3FRXA 4Z7NA 4L1MA 2IUVA 5IJ7E 3MMYA 3SLED 4H5JA 4RE5A 3UKRC 1VYHC 2AH1A 4JSPC 3BG1A 4J8BA 5EMLB 3SN6B 4L1QD 1A0RB 2AGWA 5AMSA 3MZLA 4AEZA 1JV2A 3I89A 2HU5A 5TDHB 4FA9D 4GQBB 1UOOA 2VDQA 3SCYA 4GGCA 3V9FA 3ZWLB 2J55H 3IJEA 4BCBA 5B4WA 4E5ZB 4E5ZA 2H6KA 4WK2A 2P9IC 3UVLA 2P9PC 1N6EA 4WK4A 5IC7A 3FM0A 2IUQA 1Q47A 4O3UB 1SQ9A 4BUJC 2OVQB 3SFZA 2W18A 3GD1I 1YFQA 3I7LA 2I3TA 2JKXA 2AGYA 3V5WB 1QFSA 1OLZA 3F3GA 5K19A 3DM0A 3PSCB 4O2WA 3PVWB 2P9UC 1VE6A 3IJ1A 3QI0A 3EI4A 3EI4B 3J81g 2VDMA 2Q7QA 4X3EA 3V7DB 2IAAA 5HE2B 3SBPA 3UVKA 3AL9A 4Z8LA 2P9KC 3F3PA 5I5IA 3JB9L 3SWSD 3CIKB 4O1QD 4ZN4A 3BWSA 3V4VA 3IJ0A 2GC4A 1R5MA 3I7NA 3EI2A 3EI2B 2B4EA 1U2VC 1H2XA 2VZ3A 3OKWA 5GXIA 1GOGA 1I2MB 2GC7A 3GFCA 5FKTA 2GNQA 2CNXA 1BPOA 3DSMA 3UVOA 3JZGA 5HE3B 2H14A 3UVMA 4A11A 4A11B 1SQJA 3C99A 2HKRA 4JT6C 3HFQA 2PM7B 4XYHA 5E6RA 3N0DA 5M5RA 4CY1A 3PE7A 3FGBA 2HKMA 4FWWA 4FA4D 5FA5B 4JSNC 3IVMA 4IMMA 2IURA 2CE8A 1E8MA 2AGLA 4GM8A 4JSXC 4PSXB 5FQDA 5M5VA 1L0QA 3GREA 3RRMC 2EIDA 5CYKA 5CYKB 4AOWA 5JWZA 2EBSA 1GG2B 3UR4A 4AX4A 3L4OD 1PGUA 2CO0A 5EALA 3RFGA 2MTAH 1H2WA 1QFMA 3IKOA 2I0TA 2QC5A 2G99A 4NBMA 4GZ8A 1TYQC 5TEFA 3E0CA 3U4YA 2UZYB 3EQ7A 3EI3B 1NR0A 2YMUA 4AN0A
chains in the Genus database with same CATH topology
1RI6A 4CZVA 4CI3A 3UVNA 2B5LA 1ERJA 2I0SA 4HDJA 2XL2A 4LG9A 5FLXg 2XL3A 4L3HD 4FA1D 2IWFA 4BH6A 5HQGA 3DWLC 3KRWB 5TEEA 4X63B 4JT5C 4J84A 3UKUC 1NEXB 4I79A 3I7KA 3RMZD 4E54A 4OZUA 5K1CC 4D0KA 5THAA 2AGZA 3RSEC 4A0AA 4A0AB 2Z2OA 4O3TB 2I3SA 1PEVA 1K32A 3AH8B 3I8CA 4ZOVA 2H6QA 5EMKB 4CY2A 5C9ZB 1XHMA 3SVWD 2G9AA 4FAVD 2CE9A 2OIZA 3MKQA 3VH0A 3RN0D 3JAMg 4Y7RA 4G56B 3JZHA 5FKSA 3OKTA 5GMKn 4GGDA 4XEIC 3JPXA 5IGQA 3DXMC 4ERYA 1OMWB 2H9NA 2HESX 4FAND 2O9KA 3RN1D 3MKSB 4J0XA 4A2MA 4LGNA 4A7JA 2CO0C 5TF2A 5EAMA 2XYIA 2H68A 3NVNA 1K8KC 3I8EA 3IJCA 2YNOA 4X60B 4QQEA 4A08A 4N14A 4A08B 2YBAA 2TRCB 3ORVD 3IIWA 3PXTD 3I7OA 3W15A 1TBGA 2H6NA 1JMXB 4J78A 4PBYA 4KFMB 3PSLA 2AGXA 3JROA 2YNNA 5FKRA 4GGAA 5EARA 1GOTB 2H3XA 2UZXB 4ERZA 4GQ1A 2AQ5A 1XKSA 4MK0B 4LG8A 4A09A 4A09B 5C2VB 5IT9g 1MG3A 3SJLD 5I5MA 4JSVC 3AFCA 4ZOXA 4CY5A 3J80g 2I0RA 1MDAH 4R7AB 2YB8B 4GMBA 3EG6A 4J87A 3C75H 5KDOB 4D6VA 4YVDA 2OK4A 3MXXA 4Y5RD 3P4FA 5AFU3 4J82A 2HXCA 4X61B 1QNIA 4XYIA 3KRXB 3I2NA 3CFSB 2HJ4A 4GM9A 3NVXA 3F3FA 4IA9A 1N6DA 5H14A 2BCJB 3SBRA 4E54B 2QXVA 3VA6A 4K3ID 5GXHA 2AH0A 1SHYB 3K26A 3ODTA 4ERQA 5CXCA 4PNKB 3OW8A 5CXCB 1GXRA 4ZOYA 1JJUB 5FXYA 4FB1D 5HYNB 1B9YA 2CN3A 3RLMD 2PM9A 2PM9B 3JZNA 4FHLA 3CFVA 2OVRB 5A2Qg 4CZYA 4EWRA 3PXWD 4A2LA 3IIYA 5AJAA 3EU7A 3DXKC 5SXMA 5IGOA 3EWEA 1GP2B 2H47A 3SHFA 3OKYA 3OKYB 4J0WA 4L3GD 2HJBA 3SBQA 5EM2A 5EM2B 4TZ4A 1XIPA 4CI8A 4U7AA 3MZKA 3C5MA 4H5IA 4PBZA 3RFHA 2H9PA 4ESGA 5IJ8E 4OWRA 4FA5D 2XU7A 3SXTD 2IWKA 2H9LA 1B9XA 4JXMA 4L9OA 3PXSD 4K3JB 2Z2NA 5GSAA 2PM6B 1MG2A 5I5JA 2J56H 2YNPA 2OVPB 3EI1A 3EI1B 2BBKH 2OJYA 4PSWB 5HE0B 2HYEA 3I7PA 4J73A 3A0FA 2Z2PA 1PI6A 5H17A 2H13A 3OL2A 3OL2B 4A0BA 5EMJB 4A0BB 4ZOZA 1U4CA 2P9LC 3AL8A 1N6FA 3AL8B 3OTTA 4CY3A 1S4UX 2J57G 4O45A 3K27A 4GM3A 4JD2C 2P9SC 2OK6A 3EMHA 4QL1A 4J79A 2H9MA 3I7HA 3NVQA 4PXWA 3JRPA 3ULEC 5H1MA 5HE1B 3B7FA 3N0EA 5EAPA 4GQ2P 2PBIB 4ES0A 3C9CA 2IUPA 1JOFA 1PBYB 4NSXA 4U1EI 1JMZB 2B5NA 4CZXA 4J86A 4J8GA 2CN2A 3VGZA 1FWXA 5C2WB 2B5MA 4QT8A 4CI1A 3PVUB 2P9NC 3SMRA 1P22A 4BL0A 4PC0A 3BG0A 3EI3A 4O9DA 4CC9A 4CI2A 3L4MD 4J77A 4J81A 4UI9R 4QRJA 5CXBA 5CXBB 5FKQA 5EMMB 3FRXA 2IUVA 5IJ7E 3MMYA 3SLED 4H5JA 3UKRC 1VYHC 2AH1A 4JSPC 3BG1A 4J8BA 5EMLB 3SN6B 4L1QD 1A0RB 2AGWA 5AMSA 3MZLA 4AEZA 3I89A 5TDHB 4FA9D 4GQBB 3SCYA 4GGCA 3V9FA 3ZWLB 2J55H 5B4WA 4E5ZB 4E5ZA 2H6KA 2P9IC 3UVLA 2P9PC 1N6EA 5IC7A 3FM0A 2IUQA 1Q47A 4O3UB 1SQ9A 4BUJC 2OVQB 3SFZA 2W18A 1YFQA 3I7LA 2I3TA 2AGYA 3V5WB 1OLZA 3F3GA 5K19A 3DM0A 3PSCB 3PVWB 2P9UC 3IJ1A 3EI4A 3EI4B 3J81g 2Q7QA 4X3EA 3V7DB 2IAAA 5HE2B 3SBPA 3UVKA 3AL9A 4Z8LA 2P9KC 3F3PA 5I5IA 3JB9L 3SWSD 3CIKB 4O1QD 4ZN4A 3BWSA 3IJ0A 2GC4A 1R5MA 3I7NA 3EI2A 3EI2B 2B4EA 1U2VC 3OKWA 5GXIA 2GC7A 3GFCA 5FKTA 2GNQA 2CNXA 3DSMA 3UVOA 3JZGA 5HE3B 2H14A 3UVMA 4A11A 4A11B 1SQJA 3C99A 2HKRA 4JT6C 3HFQA 2PM7B 4XYHA 3N0DA 4CY1A 3PE7A 3FGBA 2HKMA 4FWWA 4FA4D 5FA5B 4JSNC 4IMMA 2IURA 2CE8A 2AGLA 4JSXC 4GM8A 4PSXB 5FQDA 1L0QA 3GREA 3RRMC 5CYKA 5CYKB 4AOWA 5JWZA 2EBSA 1GG2B 3UR4A 3L4OD 1PGUA 2CO0A 5EALA 3RFGA 2MTAH 3IKOA 2I0TA 2QC5A 2G99A 4GZ8A 1TYQC 5TEFA 3E0CA 3U4YA 2UZYB 3EI3B 1NR0A 2YMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RI6 A;  4CZV A;  4CI3 A;  3UVN A;  2B5L A;  1ERJ A;  2I0S A;  4HDJ A;  2XL2 A;  4LG9 A;  5FLX g;  2XL3 A;  4L3H D;  4FA1 D;  2IWF A;  4BH6 A;  5HQG A;  3DWL C;  3KRW B;  5TEE A;  4X63 B;  4JT5 C;  4J84 A;  3UKU C;  1NEX B;  4I79 A;  3I7K A;  3RMZ D;  4E54 A;  4OZU A;  5K1C C;  4D0K A;  5THA A;  2AGZ A;  3RSE C;  4A0A A;  4A0A B;  2Z2O A;  4O3T B;  2I3S A;  1PEV A;  1K32 A;  3AH8 B;  3I8C A;  4ZOV A;  2H6Q A;  5EMK B;  4CY2 A;  5C9Z B;  1XHM A;  3SVW D;  2G9A A;  4FAV D;  2CE9 A;  2OIZ A;  3MKQ A;  3VH0 A;  3RN0 D;  3JAM g;  4Y7R A;  4G56 B;  3JZH A;  5FKS A;  3OKT A;  5GMK n;  4GGD A;  4XEI C;  3JPX A;  5IGQ A;  3DXM C;  4ERY A;  1OMW B;  2H9N A;  2HES X;  4FAN D;  2O9K A;  3RN1 D;  3MKS B;  4J0X A;  4A2M A;  4LGN A;  4A7J A;  2CO0 C;  5TF2 A;  5EAM A;  2XYI A;  2H68 A;  3NVN A;  1K8K C;  3I8E A;  3IJC A;  2YNO A;  4X60 B;  4QQE A;  4A08 A;  4N14 A;  4A08 B;  2YBA A;  2TRC B;  3ORV D;  3IIW A;  3PXT D;  3I7O A;  3W15 A;  1TBG A;  2H6N A;  1JMX B;  4J78 A;  4PBY A;  4KFM B;  3PSL A;  2AGX A;  3JRO A;  2YNN A;  5FKR A;  4GGA A;  5EAR A;  1GOT B;  2H3X A;  2UZX B;  4ERZ A;  4GQ1 A;  2AQ5 A;  1XKS A;  4MK0 B;  4LG8 A;  4A09 A;  4A09 B;  5C2V B;  5IT9 g;  1MG3 A;  3SJL D;  5I5M A;  4JSV C;  3AFC A;  4ZOX A;  4CY5 A;  3J80 g;  2I0R A;  1MDA H;  4R7A B;  2YB8 B;  4GMB A;  3EG6 A;  4J87 A;  3C75 H;  5KDO B;  4D6V A;  4YVD A;  2OK4 A;  3MXX A;  4Y5R D;  3P4F A;  5AFU 3;  4J82 A;  2HXC A;  4X61 B;  1QNI A;  4XYI A;  3KRX B;  3I2N A;  3CFS B;  2HJ4 A;  4GM9 A;  3NVX A;  3F3F A;  4IA9 A;  1N6D A;  5H14 A;  2BCJ B;  3SBR A;  4E54 B;  2QXV A;  3VA6 A;  4K3I D;  5GXH A;  2AH0 A;  1SHY B;  3K26 A;  3ODT A;  4ERQ A;  5CXC A;  4PNK B;  3OW8 A;  5CXC B;  1GXR A;  4ZOY A;  1JJU B;  5FXY A;  4FB1 D;  5HYN B;  1B9Y A;  2CN3 A;  3RLM D;  2PM9 A;  2PM9 B;  3JZN A;  4FHL A;  3CFV A;  2OVR B;  5A2Q g;  4CZY A;  4EWR A;  3PXW D;  4A2L A;  3IIY A;  5AJA A;  3EU7 A;  3DXK C;  5SXM A;  5IGO A;  3EWE A;  1GP2 B;  2H47 A;  3SHF A;  3OKY A;  3OKY B;  4J0W A;  4L3G D;  2HJB A;  3SBQ A;  5EM2 A;  5EM2 B;  4TZ4 A;  1XIP A;  4CI8 A;  4U7A A;  3MZK A;  3C5M A;  4H5I A;  4PBZ A;  3RFH A;  2H9P A;  4ESG A;  5IJ8 E;  4OWR A;  4FA5 D;  2XU7 A;  3SXT D;  2IWK A;  2H9L A;  1B9X A;  4JXM A;  4L9O A;  3PXS D;  4K3J B;  2Z2N A;  5GSA A;  2PM6 B;  1MG2 A;  5I5J A;  2J56 H;  2YNP A;  2OVP B;  3EI1 A;  3EI1 B;  2BBK H;  2OJY A;  4PSW B;  5HE0 B;  2HYE A;  3I7P A;  4J73 A;  3A0F A;  2Z2P A;  1PI6 A;  5H17 A;  2H13 A;  3OL2 A;  3OL2 B;  4A0B A;  5EMJ B;  4A0B B;  4ZOZ A;  1U4C A;  2P9L C;  3AL8 A;  1N6F A;  3AL8 B;  3OTT A;  4CY3 A;  1S4U X;  2J57 G;  4O45 A;  3K27 A;  4GM3 A;  4JD2 C;  2P9S C;  2OK6 A;  3EMH A;  4QL1 A;  4J79 A;  2H9M A;  3I7H A;  3NVQ A;  4PXW A;  3JRP A;  3ULE C;  5H1M A;  5HE1 B;  3B7F A;  3N0E A;  5EAP A;  4GQ2 P;  2PBI B;  4ES0 A;  3C9C A;  2IUP A;  1JOF A;  1PBY B;  4NSX A;  4U1E I;  1JMZ B;  2B5N A;  4CZX A;  4J86 A;  4J8G A;  2CN2 A;  3VGZ A;  1FWX A;  5C2W B;  2B5M A;  4QT8 A;  4CI1 A;  3PVU B;  2P9N C;  3SMR A;  1P22 A;  4BL0 A;  4PC0 A;  3BG0 A;  3EI3 A;  4O9D A;  4CC9 A;  4CI2 A;  3L4M D;  4J77 A;  4J81 A;  4UI9 R;  4QRJ A;  5CXB A;  5CXB B;  5FKQ A;  5EMM B;  3FRX A;  2IUV A;  5IJ7 E;  3MMY A;  3SLE D;  4H5J A;  3UKR C;  1VYH C;  2AH1 A;  4JSP C;  3BG1 A;  4J8B A;  5EML B;  3SN6 B;  4L1Q D;  1A0R B;  2AGW A;  5AMS A;  3MZL A;  4AEZ A;  3I89 A;  5TDH B;  4FA9 D;  4GQB B;  3SCY A;  4GGC A;  3V9F A;  3ZWL B;  2J55 H;  5B4W A;  4E5Z B;  4E5Z A;  2H6K A;  2P9I C;  3UVL A;  2P9P C;  1N6E A;  5IC7 A;  3FM0 A;  2IUQ A;  1Q47 A;  4O3U B;  1SQ9 A;  4BUJ C;  2OVQ B;  3SFZ A;  2W18 A;  1YFQ A;  3I7L A;  2I3T A;  2AGY A;  3V5W B;  1OLZ A;  3F3G A;  5K19 A;  3DM0 A;  3PSC B;  3PVW B;  2P9U C;  3IJ1 A;  3EI4 A;  3EI4 B;  3J81 g;  2Q7Q A;  4X3E A;  3V7D B;  2IAA A;  5HE2 B;  3SBP A;  3UVK A;  3AL9 A;  4Z8L A;  2P9K C;  3F3P A;  5I5I A;  3JB9 L;  3SWS D;  3CIK B;  4O1Q D;  4ZN4 A;  3BWS A;  3IJ0 A;  2GC4 A;  1R5M A;  3I7N A;  3EI2 A;  3EI2 B;  2B4E A;  1U2V C;  3OKW A;  5GXI A;  2GC7 A;  3GFC A;  5FKT A;  2GNQ A;  2CNX A;  3DSM A;  3UVO A;  3JZG A;  5HE3 B;  2H14 A;  3UVM A;  4A11 A;  4A11 B;  1SQJ A;  3C99 A;  2HKR A;  4JT6 C;  3HFQ A;  2PM7 B;  4XYH A;  3N0D A;  4CY1 A;  3PE7 A;  3FGB A;  2HKM A;  4FWW A;  4FA4 D;  5FA5 B;  4JSN C;  4IMM A;  2IUR A;  2CE8 A;  2AGL A;  4JSX C;  4GM8 A;  4PSX B;  5FQD A;  1L0Q A;  3GRE A;  3RRM C;  5CYK A;  5CYK B;  4AOW A;  5JWZ A;  2EBS A;  1GG2 B;  3UR4 A;  3L4O D;  1PGU A;  2CO0 A;  5EAL A;  3RFG A;  2MTA H;  3IKO A;  2I0T A;  2QC5 A;  2G99 A;  4GZ8 A;  1TYQ C;  5TEF A;  3E0C A;  3U4Y A;  2UZY B;  3EI3 B;  1NR0 A;  2YMU A; 
#chains in the Genus database with same CATH topology
 1RI6 A;  4CZV A;  4CI3 A;  3UVN A;  2B5L A;  1ERJ A;  2I0S A;  2WQ8 A;  2XL2 A;  4HDJ A;  4LG9 A;  5FLX g;  2XL3 A;  4L3H D;  4WJK A;  4FA1 D;  2IWF A;  4BH6 A;  5HQG A;  3DWL C;  4JHN A;  3KRW B;  5TEE A;  4X63 B;  4JT5 C;  4J84 A;  4MMX A;  3UKU C;  1NEX B;  4I79 A;  3I7K A;  4O02 A;  3RMZ D;  3O4I A;  4E54 A;  4OZU A;  5K1C C;  4D0K A;  5THA A;  2AGZ A;  3RSE C;  4A0A A;  4A0A B;  2Z2O A;  2VDR A;  4Z7Q A;  4MMZ A;  4O3T B;  2I3S A;  3K6S A;  1PEV A;  3EQ9 A;  1L5G A;  3NID A;  1K32 A;  3AH8 B;  1VZ2 A;  2EIC A;  3I8C A;  4ZOV A;  2H6Q A;  5EMK B;  4CY2 A;  5C9Z B;  4UM8 A;  1XHM A;  3SVW D;  2G9A A;  1E5T A;  3IUQ A;  3ZDY A;  4FAV D;  2CE9 A;  2OIZ A;  4G1E A;  3MKQ A;  3VH0 A;  3RN0 D;  3JAM g;  4Y7R A;  3MUN A;  4G56 B;  3JZH A;  5FKS A;  3OKT A;  3IUL A;  5GMK n;  4GGD A;  4G1M A;  4XEI C;  3JPX A;  2XE4 A;  3O4J A;  5IGQ A;  3DXM C;  4ERY A;  1OMW B;  2H9N A;  2HES X;  1O6G A;  1VZ3 A;  4FAN D;  2O9K A;  3RN1 D;  3MKS B;  4J0X A;  4QAM A;  4A2M A;  4LGN A;  4A7J A;  4AN1 A;  2CO0 C;  4NAA A;  5TF2 A;  3V4P A;  4BCC A;  5EAM A;  2XYI A;  2H68 A;  3NVN A;  1K8K C;  3I8E A;  3IJC A;  2YNO A;  4X60 B;  4QQE A;  4A08 A;  4N14 A;  4A08 B;  2YBA A;  4BP8 A;  5C86 A;  1GOF A;  2TRC B;  3ORV D;  3IIW A;  3PXT D;  3I7O A;  3W15 A;  1TBG A;  2H6N A;  1JMX B;  4J78 A;  4PBY A;  4KFM B;  3PSL A;  2AGX A;  3JRO A;  2YNN A;  5FKR A;  4GGA A;  5EAR A;  1GOT B;  2H3X A;  2UZX B;  5E6S A;  4ERZ A;  4GQ1 A;  1UTC A;  5HDB A;  2AQ5 A;  1XKS A;  4MK0 B;  4LG8 A;  2EIE A;  5M61 A;  4A09 B;  4A09 A;  4D9S A;  4BP9 A;  5C2V B;  3O4G A;  5IT9 g;  1MG3 A;  4NC4 A;  1E8N A;  3SJL D;  5I5M A;  1UOP A;  4JSV C;  3AFC A;  4ZOX A;  4CY5 A;  3K72 A;  3J80 g;  3NIG A;  3FCS A;  2I0R A;  1MDA H;  4R7A B;  2EIB A;  2YB8 B;  4GMB A;  3EG6 A;  1H2Z A;  3OF7 A;  4J87 A;  3C75 H;  1YR2 A;  5KDO B;  4D6V A;  4YVD A;  2OK4 A;  3MXX A;  1O6F A;  4Y5R D;  2VZ1 A;  5E6U A;  3DDU A;  3P4F A;  5AFU 3;  4J82 A;  2HXC A;  4X61 B;  4DNV A;  4WK0 A;  1QNI A;  3ZE0 A;  4XYI A;  3KRX B;  1H2Y A;  3NIF A;  3I2N A;  3CFS B;  2HJ4 A;  2HU7 A;  4GM9 A;  3NVX A;  3F3F A;  4IA9 A;  1N6D A;  3K71 A;  5H14 A;  2BCJ B;  3SBR A;  2VDK A;  4E54 B;  2QXV A;  3VA6 A;  4K3I D;  5GXH A;  2AH0 A;  1SHY B;  2VDO A;  3K26 A;  3ODT A;  4ERQ A;  1K3I A;  5CXC A;  4PNK B;  3OW8 A;  5CXC B;  1GXR A;  3ZE2 A;  4DNU A;  4ZOY A;  1JJU B;  3MVD K;  5FFG A;  5FXY A;  1U8C A;  3T3P A;  4FB1 D;  5HYN B;  1B9Y A;  2CN3 A;  3RLM D;  2PM9 A;  2PM9 B;  3JZN A;  4FHL A;  3CFV A;  2OVR B;  5A2Q g;  4CZY A;  5M5U A;  4EWR A;  1JTD B;  3PXW D;  4A2L A;  5C92 A;  3GC3 B;  3IIY A;  5AJA A;  3EU7 A;  3T3M A;  2XDW A;  3DXK C;  3QHY B;  5SXM A;  5IGO A;  3EWE A;  4AMY A;  1GP2 B;  3MUO A;  2H47 A;  3SHF A;  3OKY A;  3OKY B;  4J0W A;  4L3G D;  2HJB A;  3SBQ A;  5EM2 A;  5EM2 B;  1T2X A;  4TZ4 A;  1XIP A;  2VDP A;  3IUJ A;  4CI8 A;  3IUN A;  4U7A A;  3MZK A;  3C5M A;  3EQ8 A;  3O4H A;  3VI3 A;  4H5I A;  4AMZ A;  2VC2 A;  4PBZ A;  3RFH A;  2H9P A;  4ESG A;  5IJ8 E;  4OWR A;  2HU8 A;  4IRZ A;  4FA5 D;  2QR5 A;  2XZG A;  2XU7 A;  3SXT D;  2IWK A;  2H9L A;  1B9X A;  1TYE A;  4JXM A;  4L9O A;  3PXS D;  4K3J B;  5FFO A;  2Z2N A;  5GSA A;  2PM6 B;  1MG2 A;  2QZP A;  5I5J A;  2J56 H;  2YNP A;  2OVP B;  4BCD A;  3EI1 B;  3EI1 A;  2BBK H;  2OJY A;  3ZDZ A;  4PSW B;  4RE6 A;  5HE0 B;  2HYE A;  3I7P A;  4J73 A;  3A0F A;  2Z2P A;  1PI6 A;  5H17 A;  2H13 A;  3OL2 A;  3OL2 B;  4A0B A;  5EMJ B;  4A0B B;  4ZOZ A;  1U4C A;  2P9L C;  3AL8 A;  1N6F A;  3AL8 B;  3OTT A;  4CY3 A;  1S4U X;  2J57 G;  4O45 A;  3ZE1 A;  3K27 A;  4GM3 A;  4JD2 C;  4UM9 A;  2P9S C;  2OK6 A;  3EMH A;  4QL1 A;  4J79 A;  2H9M A;  4DNW A;  3I7H A;  1C9L A;  3NVQ A;  4PXW A;  3JRP A;  3ULE C;  5H1M A;  5HE1 B;  3B7F A;  3N0E A;  5EAP A;  4GQ2 P;  2PBI B;  4ES0 A;  3C9C A;  2IUP A;  1JOF A;  1PBY B;  4NSX A;  5M5T A;  4MMY A;  1UOQ A;  4U1E I;  1M1X A;  4G55 A;  1JMZ B;  4NEN A;  1A12 A;  2B5N A;  4CZX A;  5M5S A;  3VI4 A;  4J86 A;  4J8G A;  2CN2 A;  3IUM A;  4Z7O A;  3VGZ A;  1GOH A;  1FWX A;  5C2W B;  2B5M A;  4JHP C;  4QT8 A;  3IUR A;  4CI1 A;  2VDN A;  3PVU B;  2P9N C;  3SMR A;  1P22 A;  2BKL A;  1C9I A;  3KCI A;  4BL0 A;  4PC0 A;  3BG0 A;  3EI3 A;  4O9D A;  4CC9 A;  2VDL A;  4CI2 A;  1VE7 A;  3L4M D;  4J77 A;  4J81 A;  4UI9 R;  4QRJ A;  3ZDX A;  3FCU A;  5CXB A;  5CXB B;  5FKQ A;  5EMM B;  3FRX A;  4Z7N A;  4L1M A;  2IUV A;  5IJ7 E;  3MMY A;  3SLE D;  4H5J A;  4RE5 A;  3UKR C;  1VYH C;  2AH1 A;  4JSP C;  3BG1 A;  4J8B A;  5EML B;  3SN6 B;  4L1Q D;  1A0R B;  2AGW A;  5AMS A;  3MZL A;  4AEZ A;  1JV2 A;  3I89 A;  2HU5 A;  5TDH B;  4FA9 D;  4GQB B;  1UOO A;  2VDQ A;  3SCY A;  4GGC A;  3V9F A;  3ZWL B;  2J55 H;  3IJE A;  4BCB A;  5B4W A;  4E5Z B;  4E5Z A;  2H6K A;  4WK2 A;  2P9I C;  3UVL A;  2P9P C;  1N6E A;  4WK4 A;  5IC7 A;  3FM0 A;  2IUQ A;  1Q47 A;  4O3U B;  1SQ9 A;  4BUJ C;  2OVQ B;  3SFZ A;  2W18 A;  3GD1 I;  1YFQ A;  3I7L A;  2I3T A;  2JKX A;  2AGY A;  3V5W B;  1QFS A;  1OLZ A;  3F3G A;  5K19 A;  3DM0 A;  3PSC B;  4O2W A;  3PVW B;  2P9U C;  1VE6 A;  3IJ1 A;  3QI0 A;  3EI4 A;  3EI4 B;  3J81 g;  2VDM A;  2Q7Q A;  4X3E A;  3V7D B;  2IAA A;  5HE2 B;  3SBP A;  3UVK A;  3AL9 A;  4Z8L A;  2P9K C;  3F3P A;  5I5I A;  3JB9 L;  3SWS D;  3CIK B;  4O1Q D;  4ZN4 A;  3BWS A;  3V4V A;  3IJ0 A;  2GC4 A;  1R5M A;  3I7N A;  3EI2 A;  3EI2 B;  2B4E A;  1U2V C;  1H2X A;  2VZ3 A;  3OKW A;  5GXI A;  1GOG A;  1I2M B;  2GC7 A;  3GFC A;  5FKT A;  2GNQ A;  2CNX A;  1BPO A;  3DSM A;  3UVO A;  3JZG A;  5HE3 B;  2H14 A;  3UVM A;  4A11 A;  4A11 B;  1SQJ A;  3C99 A;  2HKR A;  4JT6 C;  3HFQ A;  2PM7 B;  4XYH A;  5E6R A;  3N0D A;  5M5R A;  4CY1 A;  3PE7 A;  3FGB A;  2HKM A;  4FWW A;  4FA4 D;  5FA5 B;  4JSN C;  3IVM A;  4IMM A;  2IUR A;  2CE8 A;  1E8M A;  2AGL A;  4GM8 A;  4JSX C;  4PSX B;  5FQD A;  5M5V A;  1L0Q A;  3GRE A;  3RRM C;  2EID A;  5CYK A;  5CYK B;  4AOW A;  5JWZ A;  2EBS A;  1GG2 B;  3UR4 A;  4AX4 A;  3L4O D;  1PGU A;  2CO0 A;  5EAL A;  3RFG A;  2MTA H;  1H2W A;  1QFM A;  3IKO A;  2I0T A;  2QC5 A;  2G99 A;  4NBM A;  4GZ8 A;  1TYQ C;  5TEF A;  3E0C A;  3U4Y A;  2UZY B;  3EQ7 A;  3EI3 B;  1NR0 A;  2YMU A;  4AN0 A; 
#chains in the Genus database with same CATH homology
 1RI6 A;  4CZV A;  4CI3 A;  3UVN A;  2B5L A;  1ERJ A;  2I0S A;  4HDJ A;  2XL2 A;  4LG9 A;  5FLX g;  2XL3 A;  4L3H D;  4FA1 D;  2IWF A;  4BH6 A;  5HQG A;  3DWL C;  3KRW B;  5TEE A;  4X63 B;  4JT5 C;  4J84 A;  3UKU C;  1NEX B;  4I79 A;  3I7K A;  3RMZ D;  4E54 A;  4OZU A;  5K1C C;  4D0K A;  5THA A;  2AGZ A;  3RSE C;  4A0A A;  4A0A B;  2Z2O A;  4O3T B;  2I3S A;  1PEV A;  1K32 A;  3AH8 B;  3I8C A;  4ZOV A;  2H6Q A;  5EMK B;  4CY2 A;  5C9Z B;  1XHM A;  3SVW D;  2G9A A;  4FAV D;  2CE9 A;  2OIZ A;  3MKQ A;  3VH0 A;  3RN0 D;  3JAM g;  4Y7R A;  4G56 B;  3JZH A;  5FKS A;  3OKT A;  5GMK n;  4GGD A;  4XEI C;  3JPX A;  5IGQ A;  3DXM C;  4ERY A;  1OMW B;  2H9N A;  2HES X;  4FAN D;  2O9K A;  3RN1 D;  3MKS B;  4J0X A;  4A2M A;  4LGN A;  4A7J A;  2CO0 C;  5TF2 A;  5EAM A;  2XYI A;  2H68 A;  3NVN A;  1K8K C;  3I8E A;  3IJC A;  2YNO A;  4X60 B;  4QQE A;  4A08 A;  4N14 A;  4A08 B;  2YBA A;  2TRC B;  3ORV D;  3IIW A;  3PXT D;  3I7O A;  3W15 A;  1TBG A;  2H6N A;  1JMX B;  4J78 A;  4PBY A;  4KFM B;  3PSL A;  2AGX A;  3JRO A;  2YNN A;  5FKR A;  4GGA A;  5EAR A;  1GOT B;  2H3X A;  2UZX B;  4ERZ A;  4GQ1 A;  2AQ5 A;  1XKS A;  4MK0 B;  4LG8 A;  4A09 A;  4A09 B;  5C2V B;  5IT9 g;  1MG3 A;  3SJL D;  5I5M A;  4JSV C;  3AFC A;  4ZOX A;  4CY5 A;  3J80 g;  2I0R A;  1MDA H;  4R7A B;  2YB8 B;  4GMB A;  3EG6 A;  4J87 A;  3C75 H;  5KDO B;  4D6V A;  4YVD A;  2OK4 A;  3MXX A;  4Y5R D;  3P4F A;  5AFU 3;  4J82 A;  2HXC A;  4X61 B;  1QNI A;  4XYI A;  3KRX B;  3I2N A;  3CFS B;  2HJ4 A;  4GM9 A;  3NVX A;  3F3F A;  4IA9 A;  1N6D A;  5H14 A;  2BCJ B;  3SBR A;  4E54 B;  2QXV A;  3VA6 A;  4K3I D;  5GXH A;  2AH0 A;  1SHY B;  3K26 A;  3ODT A;  4ERQ A;  5CXC A;  4PNK B;  3OW8 A;  5CXC B;  1GXR A;  4ZOY A;  1JJU B;  5FXY A;  4FB1 D;  5HYN B;  1B9Y A;  2CN3 A;  3RLM D;  2PM9 A;  2PM9 B;  3JZN A;  4FHL A;  3CFV A;  2OVR B;  5A2Q g;  4CZY A;  4EWR A;  3PXW D;  4A2L A;  3IIY A;  5AJA A;  3EU7 A;  3DXK C;  5SXM A;  5IGO A;  3EWE A;  1GP2 B;  2H47 A;  3SHF A;  3OKY A;  3OKY B;  4J0W A;  4L3G D;  2HJB A;  3SBQ A;  5EM2 A;  5EM2 B;  4TZ4 A;  1XIP A;  4CI8 A;  4U7A A;  3MZK A;  3C5M A;  4H5I A;  4PBZ A;  3RFH A;  2H9P A;  4ESG A;  5IJ8 E;  4OWR A;  4FA5 D;  2XU7 A;  3SXT D;  2IWK A;  2H9L A;  1B9X A;  4JXM A;  4L9O A;  3PXS D;  4K3J B;  2Z2N A;  5GSA A;  2PM6 B;  1MG2 A;  5I5J A;  2J56 H;  2YNP A;  2OVP B;  3EI1 A;  3EI1 B;  2BBK H;  2OJY A;  4PSW B;  5HE0 B;  2HYE A;  3I7P A;  4J73 A;  3A0F A;  2Z2P A;  1PI6 A;  5H17 A;  2H13 A;  3OL2 A;  3OL2 B;  4A0B A;  5EMJ B;  4A0B B;  4ZOZ A;  1U4C A;  2P9L C;  3AL8 A;  1N6F A;  3AL8 B;  3OTT A;  4CY3 A;  1S4U X;  2J57 G;  4O45 A;  3K27 A;  4GM3 A;  4JD2 C;  2P9S C;  2OK6 A;  3EMH A;  4QL1 A;  4J79 A;  2H9M A;  3I7H A;  3NVQ A;  4PXW A;  3JRP A;  3ULE C;  5H1M A;  5HE1 B;  3B7F A;  3N0E A;  5EAP A;  4GQ2 P;  2PBI B;  4ES0 A;  3C9C A;  2IUP A;  1JOF A;  1PBY B;  4NSX A;  4U1E I;  1JMZ B;  2B5N A;  4CZX A;  4J86 A;  4J8G A;  2CN2 A;  3VGZ A;  1FWX A;  5C2W B;  2B5M A;  4QT8 A;  4CI1 A;  3PVU B;  2P9N C;  3SMR A;  1P22 A;  4BL0 A;  4PC0 A;  3BG0 A;  3EI3 A;  4O9D A;  4CC9 A;  4CI2 A;  3L4M D;  4J77 A;  4J81 A;  4UI9 R;  4QRJ A;  5CXB A;  5CXB B;  5FKQ A;  5EMM B;  3FRX A;  2IUV A;  5IJ7 E;  3MMY A;  3SLE D;  4H5J A;  3UKR C;  1VYH C;  2AH1 A;  4JSP C;  3BG1 A;  4J8B A;  5EML B;  3SN6 B;  4L1Q D;  1A0R B;  2AGW A;  5AMS A;  3MZL A;  4AEZ A;  3I89 A;  5TDH B;  4FA9 D;  4GQB B;  3SCY A;  4GGC A;  3V9F A;  3ZWL B;  2J55 H;  5B4W A;  4E5Z B;  4E5Z A;  2H6K A;  2P9I C;  3UVL A;  2P9P C;  1N6E A;  5IC7 A;  3FM0 A;  2IUQ A;  1Q47 A;  4O3U B;  1SQ9 A;  4BUJ C;  2OVQ B;  3SFZ A;  2W18 A;  1YFQ A;  3I7L A;  2I3T A;  2AGY A;  3V5W B;  1OLZ A;  3F3G A;  5K19 A;  3DM0 A;  3PSC B;  3PVW B;  2P9U C;  3IJ1 A;  3EI4 A;  3EI4 B;  3J81 g;  2Q7Q A;  4X3E A;  3V7D B;  2IAA A;  5HE2 B;  3SBP A;  3UVK A;  3AL9 A;  4Z8L A;  2P9K C;  3F3P A;  5I5I A;  3JB9 L;  3SWS D;  3CIK B;  4O1Q D;  4ZN4 A;  3BWS A;  3IJ0 A;  2GC4 A;  1R5M A;  3I7N A;  3EI2 A;  3EI2 B;  2B4E A;  1U2V C;  3OKW A;  5GXI A;  2GC7 A;  3GFC A;  5FKT A;  2GNQ A;  2CNX A;  3DSM A;  3UVO A;  3JZG A;  5HE3 B;  2H14 A;  3UVM A;  4A11 A;  4A11 B;  1SQJ A;  3C99 A;  2HKR A;  4JT6 C;  3HFQ A;  2PM7 B;  4XYH A;  3N0D A;  4CY1 A;  3PE7 A;  3FGB A;  2HKM A;  4FWW A;  4FA4 D;  5FA5 B;  4JSN C;  4IMM A;  2IUR A;  2CE8 A;  2AGL A;  4JSX C;  4GM8 A;  4PSX B;  5FQD A;  1L0Q A;  3GRE A;  3RRM C;  5CYK A;  5CYK B;  4AOW A;  5JWZ A;  2EBS A;  1GG2 B;  3UR4 A;  3L4O D;  1PGU A;  2CO0 A;  5EAL A;  3RFG A;  2MTA H;  3IKO A;  2I0T A;  2QC5 A;  2G99 A;  4GZ8 A;  1TYQ C;  5TEF A;  3E0C A;  3U4Y A;  2UZY B;  3EI3 B;  1NR0 A;  2YMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...