3L4MD

Crystal structure of the maug/pre-methylamine dehydrogenase complex.
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords Methylamine utilization protein mauG
publication title In crystallo posttranslational modification within a MauG/pre-methylamine dehydrogenase complex.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 92
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3l4mD00
4GGCA 2PM9B 1PGUA 2YBAA 4J73A 3EI3A 4K3JB 5IJ7E 3UVMA 4A0AB 3IJ1A 4L3GD 2B5MA 3SVWD 3EI3B 1TYQC 3UVKA 4FB1D 3VA6A 2P9UC 1TBGA 1N6FA 3L4OD 5CYKA 4J81A 4E5ZA 3RFHA 3RLMD 3DWLC 4X60B 3UVOA 4ZOZA 4JD2C 2Z2NA 4L9OA 4A2MA 4L1QD 4A0BB 3VH0A 4FA5D 1B9XA 5TEEA 2MTAH 1SQ9A 3EU7A 3BWSA 5IC7A 4A08A 2YNOA 2I3SA 3SCYA 4J0WA 5EAMA 1JMZB 5JWZA 2OJYA 4H5JA 3CIKB 5CXBA 2H3XA 4E54A 3GREA 1OMWB 2TRCB 4FA9D 1MDAH 3F3GA 4PC0A 3C5MA 5K1CC 5IGQA 2IAAA 1OLZA 3SFZA 3EG6A 4E54B 2IUVA 3IIWA 4ERYA 4LG9A 1U2VC 1XKSA 2PM6B 4L3HD 3I7HA 3PXWD 5THAA 3SWSD 3K26A 4CZVA 2HYEA 1NEXB 1U4CA 3JAMg 2BBKH 5EAPA 3EI2B 4CY2A 1SHYB 3L4MD 3AL8A 2GC4A 3IJ0A 2I3TA 2AH0A 2QXVA 2P9IC 4CI1A 4QRJA 4O3TB 2IWFA 3DXKC 3I2NA 5EARA 4Y7RA 5EMMB 3B7FA 4GQ1A 4J82A 1GG2B 1S4UX 3KRXB 3IKOA 4JSNC 4AEZA 3V5WB 5FLXg 1JMXB 4GQBB 3OW8A 4CY3A 4FAVD 1FWXA 1GP2B 3ULEC 2XYIA 3MKQA 4GMBA 3OKYA 4EWRA 2CN3A 2EBSA 4N14A 3OKYB 4PSWB 4J78A 5HYNB 2AGZA 3DXMC 5H14A 4A0AA 2J56H 3ODTA 3I8CA 3PVUB 4Y5RD 3I8EA 2H9MA 3NVNA 4J0XA 3I7OA 2I0RA 4TZ4A 1A0RB 2H6KA 2OVRB 4QL1A 2XL2A 4YVDA 3PXSD 3CFSB 2H9LA 3OTTA 2CE8A 1L0QA 2B5NA 1RI6A 4X63B 3UKUC 2P9PC 4A0BA 4X61B 1XIPA 3UVLA 4H5IA 4R7AB 2GNQA 3IIYA 1PI6A 4J84A 4PBZA 2Z2PA 4U7AA 4GM8A 2AH1A 3SBQA 3RMZD 4J8GA 5C2VB 1PBYB 2H13A 2BCJB 3PSLA 4G56B 2J55H 2HKRA 4BUJC 4IA9A 2CNXA 3OKWA 2AQ5A 4PNKB 5I5JA 3JROA 4U1EI 3SN6B 3JZHA 5K19A 4JXMA 3P4FA 5EMJB 2AGWA 3RSEC 4BH6A 4XYIA 3JB9L 5KDOB 2P9KC 4I79A 4D0KA 2XL3A 1R5MA 4ERQA 3SXTD 3ZWLB 5GSAA 1GOTB 1QNIA 2AGYA 4J79A 3AL9A 3NVQA 4JSPC 4FAND 4GM9A 4GQ2P 3FGBA 4UI9R 5AJAA 5C9ZB 5TEFA 2P9LC 5IGOA 3AFCA 4LGNA 3J81g 4J77A 4CI8A 3EI2A 4A09A 2H6QA 5B4WA 2H47A 2UZXB 4CC9A 4A7JA 4J8BA 5FQDA 2CO0A 2OK4A 3JRPA 4A09B 2Q7QA 5H1MA 3F3FA 4ES0A 4CI2A 5EM2B 3V9FA 5HQGA 3OL2B 5C2WB 4FWWA 3RFGA 2W18A 4CY1A 3W15A 4D6VA 2O9KA 3KRWB 4NSXA 5EALA 1XHMA 4PBYA 3FRXA 3EWEA 3RN0D 2YB8B 5EMKB 1MG3A 5CXCA 4A11B 3RN1D 4JSVC 3NVXA 3JZNA 5IJ8E 4AOWA 2IUPA 3I7KA 4PXWA 4XEIC 4FA4D 2XU7A 3CFVA 5CXCB 3DM0A 3SMRA 3HFQA 5HE1B 2P9NC 4GGAA 4IMMA 4ERZA 2OIZA 2QC5A 3MZLA 4MK0B 2IWKA 4GZ8A 4OWRA 3OKTA 4J87A 2B4EA 3N0EA 2H14A 2HKMA 5SXMA 2H68A 1JJUB 3C75H 3N0DA 2H6NA 3EI4A 4QT8A 3JPXA 3UVNA 3C99A 4OZUA 2G9AA 3EI4B 3SLED 1K32A 4J86A 1YFQA 4CY5A 1Q47A 4ESGA 4X3EA 3GFCA 3ORVD 3I7PA 5A2Qg 2PBIB 4ZN4A 2I0TA 3A0FA 5FXYA 5GMKn 2I0SA 3MXXA 5AMSA 2YNPA 5TF2A 2OVQB 4Z8LA 2AGLA 2OVPB 4CZYA 5I5MA 2HXCA 4BL0A 2YNNA 2AGXA 3FM0A 4HDJA 3AH8B 4CZXA 5FKQA 5CYKB 3BG0A 4E5ZB 3UKRC 3SJLD 3MMYA 1N6DA 4JT6C 4O1QD 5FA5B 5FKTA 3JZGA 2B5LA 4K3ID 3J80g 4FHLA 4GGDA 5AFU3 2HJ4A 2IUQA 2G99A 4A08B 3SHFA 2PM7B 4XYHA 5EM2A 3SBPA 5I5IA 1SQJA 2YMUA 3OL2A 4PSXB 3E0CA 1PEVA 5CXBB 2OK6A 2J57G 4GM3A 3PE7A 2HJBA 3DSMA 3PSCB 4LG8A 4CI3A 5HE2B 1JOFA 5HE0B 3K27A 4FA1D 4A11A 3U4YA 2CN2A 3V7DB 3MKSB 5GXHA 4JT5C 3UR4A 3EMHA 2IURA 2P9SC 3RRMC 1GXRA 1N6EA 4O3UB 2CO0C 4O9DA 3AL8B 2H9PA 3F3PA 4JSXC 3PVWB 5FKRA 3I89A 1K8KC 2H9NA 1B9YA 4O45A 3I7LA 5HE3B 1VYHC 5GXIA 3MZKA 3IJCA 2CE9A 2GC7A 4QQEA 5H17A 2Z2OA 4ZOXA 3I7NA 3PXTD 3BG1A 3SBRA 2UZYB 5EMLB 3C9CA 4ZOVA 5FKSA 3VGZA 1ERJA 3EI1A 4KFMB 5TDHB 1P22A 2PM9A 1MG2A 2HESX 4ZOYA 1NR0A 4A2LA 3EI1B 5IT9g
chains in the Genus database with same CATH superfamily
4GGCA 2PM9B 1PGUA 2YBAA 4J73A 3EI3A 3FCSA 3ZDYA 4K3JB 5IJ7E 3UVMA 4A0AB 4O2WA 3IJ1A 4L3GD 2B5MA 3T3PA 3SVWD 1O6GA 3EI3B 1TYQC 3UVKA 4FB1D 3VA6A 2P9UC 1TBGA 3ZE0A 3FCUA 3NIGA 1N6FA 1T2XA 3L4OD 2VC2A 5CYKA 4J81A 4E5ZA 1GOHA 3RFHA 4BCDA 4RE6A 3RLMD 3DWLC 4X60B 3UVOA 4ZOZA 4JD2C 2Z2NA 1UTCA 4L9OA 4G55A 4A2MA 4L1QD 4A0BB 1A12A 3VH0A 4FA5D 4AMZA 1B9XA 5TEEA 3O4GA 2MTAH 1SQ9A 3EU7A 3BWSA 5IC7A 3V4PA 2EIEA 4NENA 4A08A 2YNOA 1JTDB 2I3SA 3SCYA 4J0WA 5EAMA 4BP9A 3NIDA 1JMZB 5JWZA 4NBMA 2OJYA 4WK4A 4H5JA 3CIKB 5CXBA 2QR5A 3V4VA 2H3XA 4E54A 3IUNA 3GREA 1OMWB 2TRCB 4FA9D 1H2YA 1MDAH 4Z7QA 3F3GA 4PC0A 1VZ2A 3C5MA 5K1CC 5IGQA 2IAAA 1OLZA 3T3MA 3SFZA 3EG6A 2VDLA 4E54B 2IUVA 3IIWA 4L1MA 4ERYA 4LG9A 1U2VC 1XKSA 2PM6B 4L3HD 3K6SA 3I7HA 3PXWD 5THAA 1I2MB 3IUQA 3SWSD 3ZDXA 3K26A 4CZVA 2HYEA 1NEXB 1U4CA 3JAMg 2BBKH 2VDQA 5EAPA 3EI2B 4CY2A 4DNVA 4Z7NA 1SHYB 3L4MD 3AL8A 2GC4A 3IJ0A 2I3TA 2VZ1A 2AH0A 2QXVA 2P9IC 3VI4A 1E8MA 4QRJA 4CI1A 4O3TB 2IWFA 3DXKC 3I2NA 5EARA 4Y7RA 5EMMB 3B7FA 4GQ1A 4UM9A 4J82A 1GG2B 1S4UX 3KRXB 3IKOA 4JSNC 4AEZA 3V5WB 3O4JA 5FLXg 1UOQA 1JMXB 4GQBB 3OW8A 4CY3A 4FAVD 4WK0A 1FWXA 1GP2B 3ULEC 2XYIA 3MKQA 4GMBA 1GOFA 3OKYA 3MVDK 3K71A 4EWRA 5M5SA 2CN3A 2EBSA 4N14A 3OKYB 4PSWB 4J78A 5HYNB 2AGZA 3DXMC 5H14A 3MUOA 4A0AA 3OF7A 2J56H 3ODTA 3I8CA 3PVUB 1E5TA 4Y5RD 3I8EA 1C9IA 2H9MA 3NVNA 4J0XA 3I7OA 2I0RA 4NC4A 4TZ4A 1A0RB 2H6KA 5M5VA 2OVRB 4QL1A 2XL2A 4RE5A 2XDWA 4D9SA 4YVDA 3PXSD 3CFSB 2H9LA 3OTTA 4MMZA 1QFMA 1K3IA 2CE8A 1L0QA 2B5NA 2VDNA 1RI6A 2VZ3A 4X63B 3UKUC 2P9PC 4A0BA 4X61B 4JHPC 1XIPA 3UVLA 2JKXA 4H5IA 4G1MA 4R7AB 2GNQA 3IIYA 1PI6A 4J84A 3K72A 4PBZA 2Z2PA 3IUJA 2BKLA 4GM8A 4U7AA 2AH1A 2VDPA 3SBQA 4AMYA 3RMZD 3ZE1A 4BP8A 4J8GA 5C2VB 1PBYB 2H13A 2BCJB 3PSLA 4G56B 2J55H 2HKRA 4BUJC 4IA9A 2CNXA 3OKWA 2AQ5A 3O4HA 4PNKB 5I5JA 3JROA 4U1EI 3SN6B 3IJEA 3JZHA 5K19A 4JXMA 3P4FA 5EMJB 2AGWA 3RSEC 3GD1I 4BH6A 4XYIA 4O02A 3JB9L 5KDOB 2P9KC 4I79A 2VDRA 4D0KA 2XL3A 1R5MA 4ERQA 3SXTD 3ZWLB 5GSAA 1GOTB 1QNIA 2AGYA 4J79A 3AL9A 3NVQA 4JSPC 4FAND 2HU7A 4GM9A 4GQ2P 3FGBA 4UI9R 5AJAA 5C9ZB 5TEFA 2P9LC 5IGOA 3AFCA 4LGNA 3J81g 5C92A 4J77A 4CI8A 3EI2A 4A09A 2H6QA 5B4WA 2H47A 1TYEA 2UZXB 5FFGA 4CC9A 4A7JA 1C9LA 4J8BA 5FQDA 2CO0A 2OK4A 3JRPA 5M5UA 3IVMA 3GC3B 4A09B 2Q7QA 5H1MA 5M5TA 3F3FA 2HU8A 4ES0A 4CI2A 5EM2B 3V9FA 5HQGA 3OL2B 5C2WB 4FWWA 3RFGA 2W18A 4CY1A 3W15A 4IRZA 3NIFA 5C86A 4D6VA 2O9KA 2VDOA 3KRWB 4NSXA 5EALA 1XHMA 4PBYA 3FRXA 3EWEA 4NAAA 5E6RA 3RN0D 2YB8B 5EMKB 1MG3A 5CXCA 4A11B 3RN1D 4JSVC 3DDUA 3NVXA 3JZNA 5IJ8E 4AOWA 2XE4A 2IUPA 1JV2A 3I7KA 4PXWA 4XEIC 4FA4D 2XU7A 3CFVA 5CXCB 3DM0A 3SMRA 1M1XA 3HFQA 5HE1B 2P9NC 4GGAA 4IMMA 4ERZA 2OIZA 4MMXA 2QC5A 3MZLA 4MK0B 2IWKA 4GZ8A 4OWRA 3OKTA 4J87A 2B4EA 2EIDA 3N0EA 2H14A 1BPOA 2HKMA 5SXMA 2H68A 5M61A 3ZDZA 1JJUB 3C75H 3N0DA 2H6NA 4WJKA 3EI4A 5HDBA 2QZPA 4QT8A 3JPXA 4MMYA 3UVNA 3C99A 4OZUA 2G9AA 3EI4B 1YR2A 3SLED 1K32A 4J86A 1YFQA 4CY5A 1Q47A 1VE7A 4X3EA 4ESGA 5E6UA 3GFCA 3ORVD 3I7PA 5A2Qg 2PBIB 4ZN4A 2I0TA 3A0FA 3QHYB 3QI0A 5FXYA 5GMKn 2I0SA 1UOOA 3MXXA 3KCIA 5AMSA 4UM8A 2YNPA 5TF2A 1H2ZA 2OVQB 3EQ7A 4Z8LA 2AGLA 2OVPB 4CZYA 5I5MA 2HXCA 4WK2A 4BL0A 2YNNA 2AGXA 2VDMA 3FM0A 4HDJA 3AH8B 4Z7OA 4CZXA 5FKQA 5CYKB 3BG0A 4E5ZB 2XZGA 2WQ8A 3UKRC 1L5GA 3SJLD 3MMYA 1N6DA 4BCCA 4JT6C 4O1QD 1QFSA 5FA5B 5FKTA 3JZGA 3VI3A 5M5RA 2B5LA 4K3ID 3J80g 4FHLA 4GGDA 5AFU3 2HJ4A 2IUQA 4G1EA 2EICA 2G99A 4A08B 3SHFA 3IULA 2PM7B 4XYHA 5EM2A 3SBPA 5I5IA 2EIBA 1SQJA 2YMUA 3OL2A 4PSXB 3E0CA 2VDKA 4AN0A 1PEVA 5CXBB 2OK6A 1H2XA 4AX4A 2J57G 4DNWA 4GM3A 3PE7A 2HJBA 3DSMA 3PSCB 4LG8A 1GOGA 4CI3A 5HE2B 1JOFA 5HE0B 3ZE2A 4BCBA 3K27A 4FA1D 4A11A 3U4YA 2CN2A 3V7DB 1E8NA 1H2WA 3MKSB 5GXHA 4JT5C 3UR4A 3EMHA 2IURA 2P9SC 3RRMC 1GXRA 1N6EA 1O6FA 1UOPA 3IURA 4O3UB 2CO0C 4O9DA 3AL8B 2H9PA 3F3PA 4JSXC 3IUMA 3PVWB 5FKRA 3I89A 1K8KC 2H9NA 1B9YA 4O45A 3I7LA 5HE3B 1VYHC 5GXIA 3MZKA 3IJCA 2CE9A 2GC7A 4QQEA 5H17A 2Z2OA 4ZOXA 5FFOA 3I7NA 3PXTD 3BG1A 3SBRA 1VE6A 4DNUA 2UZYB 5EMLB 3C9CA 3O4IA 4ZOVA 5FKSA 2HU5A 3VGZA 1ERJA 3EI1A 4AN1A 4KFMB 5TDHB 1P22A 1U8CA 2PM9A 3MUNA 4JHNA 1MG2A 2HESX 4ZOYA 3EQ8A 1NR0A 4A2LA 3EI1B 3EQ9A 5IT9g 5E6SA 1VZ3A 4QAMA
chains in the Genus database with same CATH topology
4GGCA 2PM9B 1PGUA 2YBAA 4J73A 3EI3A 4K3JB 5IJ7E 3UVMA 4A0AB 3IJ1A 4L3GD 2B5MA 3SVWD 3EI3B 1TYQC 3UVKA 4FB1D 3VA6A 2P9UC 1TBGA 1N6FA 3L4OD 5CYKA 4J81A 4E5ZA 3RFHA 3RLMD 3DWLC 4X60B 3UVOA 4ZOZA 4JD2C 2Z2NA 4L9OA 4A2MA 4L1QD 4A0BB 3VH0A 4FA5D 1B9XA 5TEEA 2MTAH 1SQ9A 3EU7A 3BWSA 5IC7A 4A08A 2YNOA 2I3SA 3SCYA 4J0WA 5EAMA 1JMZB 5JWZA 2OJYA 4H5JA 3CIKB 5CXBA 2H3XA 4E54A 3GREA 1OMWB 2TRCB 4FA9D 1MDAH 3F3GA 4PC0A 3C5MA 5K1CC 5IGQA 2IAAA 1OLZA 3SFZA 3EG6A 4E54B 2IUVA 3IIWA 4ERYA 4LG9A 1U2VC 1XKSA 2PM6B 4L3HD 3I7HA 3PXWD 5THAA 3SWSD 3K26A 4CZVA 2HYEA 1NEXB 1U4CA 3JAMg 2BBKH 5EAPA 3EI2B 4CY2A 1SHYB 3L4MD 3AL8A 2GC4A 3IJ0A 2I3TA 2AH0A 2QXVA 2P9IC 4CI1A 4QRJA 4O3TB 2IWFA 3DXKC 3I2NA 5EARA 4Y7RA 5EMMB 3B7FA 4GQ1A 4J82A 1GG2B 1S4UX 3KRXB 3IKOA 4JSNC 4AEZA 3V5WB 5FLXg 1JMXB 4GQBB 3OW8A 4CY3A 4FAVD 1FWXA 1GP2B 3ULEC 2XYIA 3MKQA 4GMBA 3OKYA 4EWRA 2CN3A 2EBSA 4N14A 3OKYB 4PSWB 4J78A 5HYNB 2AGZA 3DXMC 5H14A 4A0AA 2J56H 3ODTA 3I8CA 3PVUB 4Y5RD 3I8EA 2H9MA 3NVNA 4J0XA 3I7OA 2I0RA 4TZ4A 1A0RB 2H6KA 2OVRB 4QL1A 2XL2A 4YVDA 3PXSD 3CFSB 2H9LA 3OTTA 2CE8A 1L0QA 2B5NA 1RI6A 4X63B 3UKUC 2P9PC 4A0BA 4X61B 1XIPA 3UVLA 4H5IA 4R7AB 2GNQA 3IIYA 1PI6A 4J84A 4PBZA 2Z2PA 4U7AA 4GM8A 2AH1A 3SBQA 3RMZD 4J8GA 5C2VB 1PBYB 2H13A 2BCJB 3PSLA 4G56B 2J55H 2HKRA 4BUJC 4IA9A 2CNXA 3OKWA 2AQ5A 4PNKB 5I5JA 3JROA 4U1EI 3SN6B 3JZHA 5K19A 4JXMA 3P4FA 5EMJB 2AGWA 3RSEC 4BH6A 4XYIA 3JB9L 5KDOB 2P9KC 4I79A 4D0KA 2XL3A 1R5MA 4ERQA 3SXTD 3ZWLB 5GSAA 1GOTB 1QNIA 2AGYA 4J79A 3AL9A 3NVQA 4JSPC 4FAND 4GM9A 4GQ2P 3FGBA 4UI9R 5AJAA 5C9ZB 5TEFA 2P9LC 5IGOA 3AFCA 4LGNA 3J81g 4J77A 4CI8A 3EI2A 4A09A 2H6QA 5B4WA 2H47A 2UZXB 4CC9A 4A7JA 4J8BA 5FQDA 2CO0A 2OK4A 3JRPA 4A09B 2Q7QA 5H1MA 3F3FA 4ES0A 4CI2A 5EM2B 3V9FA 5HQGA 3OL2B 5C2WB 4FWWA 3RFGA 2W18A 4CY1A 3W15A 4D6VA 2O9KA 3KRWB 4NSXA 5EALA 1XHMA 4PBYA 3FRXA 3EWEA 3RN0D 2YB8B 5EMKB 1MG3A 5CXCA 4A11B 3RN1D 4JSVC 3NVXA 3JZNA 5IJ8E 4AOWA 2IUPA 3I7KA 4PXWA 4XEIC 4FA4D 2XU7A 3CFVA 5CXCB 3DM0A 3SMRA 3HFQA 5HE1B 2P9NC 4GGAA 4IMMA 4ERZA 2OIZA 2QC5A 3MZLA 4MK0B 2IWKA 4GZ8A 4OWRA 3OKTA 4J87A 2B4EA 3N0EA 2H14A 2HKMA 5SXMA 2H68A 1JJUB 3C75H 3N0DA 2H6NA 3EI4A 4QT8A 3JPXA 3UVNA 3C99A 4OZUA 2G9AA 3EI4B 3SLED 1K32A 4J86A 1YFQA 4CY5A 1Q47A 4ESGA 4X3EA 3GFCA 3ORVD 3I7PA 5A2Qg 2PBIB 4ZN4A 2I0TA 3A0FA 5FXYA 5GMKn 2I0SA 3MXXA 5AMSA 2YNPA 5TF2A 2OVQB 4Z8LA 2AGLA 2OVPB 4CZYA 5I5MA 2HXCA 4BL0A 2YNNA 2AGXA 3FM0A 4HDJA 3AH8B 4CZXA 5FKQA 5CYKB 3BG0A 4E5ZB 3UKRC 3SJLD 3MMYA 1N6DA 4JT6C 4O1QD 5FA5B 5FKTA 3JZGA 2B5LA 4K3ID 3J80g 4FHLA 4GGDA 5AFU3 2HJ4A 2IUQA 2G99A 4A08B 3SHFA 2PM7B 4XYHA 5EM2A 3SBPA 5I5IA 1SQJA 2YMUA 3OL2A 4PSXB 3E0CA 1PEVA 5CXBB 2OK6A 2J57G 4GM3A 3PE7A 2HJBA 3DSMA 3PSCB 4LG8A 4CI3A 5HE2B 1JOFA 5HE0B 3K27A 4FA1D 4A11A 3U4YA 2CN2A 3V7DB 3MKSB 5GXHA 4JT5C 3UR4A 3EMHA 2IURA 2P9SC 3RRMC 1GXRA 1N6EA 4O3UB 2CO0C 4O9DA 3AL8B 2H9PA 3F3PA 4JSXC 3PVWB 5FKRA 3I89A 1K8KC 2H9NA 1B9YA 4O45A 3I7LA 5HE3B 1VYHC 5GXIA 3MZKA 3IJCA 2CE9A 2GC7A 4QQEA 5H17A 2Z2OA 4ZOXA 3I7NA 3PXTD 3BG1A 3SBRA 2UZYB 5EMLB 3C9CA 4ZOVA 5FKSA 3VGZA 1ERJA 3EI1A 4KFMB 5TDHB 1P22A 2PM9A 1MG2A 2HESX 4ZOYA 1NR0A 4A2LA 3EI1B 5IT9g
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GGC A;  2PM9 B;  1PGU A;  2YBA A;  4J73 A;  3EI3 A;  4K3J B;  5IJ7 E;  3UVM A;  4A0A B;  3IJ1 A;  4L3G D;  2B5M A;  3SVW D;  3EI3 B;  1TYQ C;  3UVK A;  4FB1 D;  3VA6 A;  2P9U C;  1TBG A;  1N6F A;  3L4O D;  5CYK A;  4J81 A;  4E5Z A;  3RFH A;  3RLM D;  3DWL C;  4X60 B;  3UVO A;  4ZOZ A;  4JD2 C;  2Z2N A;  4L9O A;  4A2M A;  4L1Q D;  4A0B B;  3VH0 A;  4FA5 D;  1B9X A;  5TEE A;  2MTA H;  1SQ9 A;  3EU7 A;  3BWS A;  5IC7 A;  4A08 A;  2YNO A;  2I3S A;  3SCY A;  4J0W A;  5EAM A;  1JMZ B;  5JWZ A;  2OJY A;  4H5J A;  3CIK B;  5CXB A;  2H3X A;  4E54 A;  3GRE A;  1OMW B;  2TRC B;  4FA9 D;  1MDA H;  3F3G A;  4PC0 A;  3C5M A;  5K1C C;  5IGQ A;  2IAA A;  1OLZ A;  3SFZ A;  3EG6 A;  4E54 B;  2IUV A;  3IIW A;  4ERY A;  4LG9 A;  1U2V C;  1XKS A;  2PM6 B;  4L3H D;  3I7H A;  3PXW D;  5THA A;  3SWS D;  3K26 A;  4CZV A;  2HYE A;  1NEX B;  1U4C A;  3JAM g;  2BBK H;  5EAP A;  3EI2 B;  4CY2 A;  1SHY B;  3L4M D;  3AL8 A;  2GC4 A;  3IJ0 A;  2I3T A;  2AH0 A;  2QXV A;  2P9I C;  4CI1 A;  4QRJ A;  4O3T B;  2IWF A;  3DXK C;  3I2N A;  5EAR A;  4Y7R A;  5EMM B;  3B7F A;  4GQ1 A;  4J82 A;  1GG2 B;  1S4U X;  3KRX B;  3IKO A;  4JSN C;  4AEZ A;  3V5W B;  5FLX g;  1JMX B;  4GQB B;  3OW8 A;  4CY3 A;  4FAV D;  1FWX A;  1GP2 B;  3ULE C;  2XYI A;  3MKQ A;  4GMB A;  3OKY A;  4EWR A;  2CN3 A;  2EBS A;  4N14 A;  3OKY B;  4PSW B;  4J78 A;  5HYN B;  2AGZ A;  3DXM C;  5H14 A;  4A0A A;  2J56 H;  3ODT A;  3I8C A;  3PVU B;  4Y5R D;  3I8E A;  2H9M A;  3NVN A;  4J0X A;  3I7O A;  2I0R A;  4TZ4 A;  1A0R B;  2H6K A;  2OVR B;  4QL1 A;  2XL2 A;  4YVD A;  3PXS D;  3CFS B;  2H9L A;  3OTT A;  2CE8 A;  1L0Q A;  2B5N A;  1RI6 A;  4X63 B;  3UKU C;  2P9P C;  4A0B A;  4X61 B;  1XIP A;  3UVL A;  4H5I A;  4R7A B;  2GNQ A;  3IIY A;  1PI6 A;  4J84 A;  4PBZ A;  2Z2P A;  4U7A A;  4GM8 A;  2AH1 A;  3SBQ A;  3RMZ D;  4J8G A;  5C2V B;  1PBY B;  2H13 A;  2BCJ B;  3PSL A;  4G56 B;  2J55 H;  2HKR A;  4BUJ C;  4IA9 A;  2CNX A;  3OKW A;  2AQ5 A;  4PNK B;  5I5J A;  3JRO A;  4U1E I;  3SN6 B;  3JZH A;  5K19 A;  4JXM A;  3P4F A;  5EMJ B;  2AGW A;  3RSE C;  4BH6 A;  4XYI A;  3JB9 L;  5KDO B;  2P9K C;  4I79 A;  4D0K A;  2XL3 A;  1R5M A;  4ERQ A;  3SXT D;  3ZWL B;  5GSA A;  1GOT B;  1QNI A;  2AGY A;  4J79 A;  3AL9 A;  3NVQ A;  4JSP C;  4FAN D;  4GM9 A;  4GQ2 P;  3FGB A;  4UI9 R;  5AJA A;  5C9Z B;  5TEF A;  2P9L C;  5IGO A;  3AFC A;  4LGN A;  3J81 g;  4J77 A;  4CI8 A;  3EI2 A;  4A09 A;  2H6Q A;  5B4W A;  2H47 A;  2UZX B;  4CC9 A;  4A7J A;  4J8B A;  5FQD A;  2CO0 A;  2OK4 A;  3JRP A;  4A09 B;  2Q7Q A;  5H1M A;  3F3F A;  4ES0 A;  4CI2 A;  5EM2 B;  3V9F A;  5HQG A;  3OL2 B;  5C2W B;  4FWW A;  3RFG A;  2W18 A;  4CY1 A;  3W15 A;  4D6V A;  2O9K A;  3KRW B;  4NSX A;  5EAL A;  1XHM A;  4PBY A;  3FRX A;  3EWE A;  3RN0 D;  2YB8 B;  5EMK B;  1MG3 A;  5CXC A;  4A11 B;  3RN1 D;  4JSV C;  3NVX A;  3JZN A;  5IJ8 E;  4AOW A;  2IUP A;  3I7K A;  4PXW A;  4XEI C;  4FA4 D;  2XU7 A;  3CFV A;  5CXC B;  3DM0 A;  3SMR A;  3HFQ A;  5HE1 B;  2P9N C;  4GGA A;  4IMM A;  4ERZ A;  2OIZ A;  2QC5 A;  3MZL A;  4MK0 B;  2IWK A;  4GZ8 A;  4OWR A;  3OKT A;  4J87 A;  2B4E A;  3N0E A;  2H14 A;  2HKM A;  5SXM A;  2H68 A;  1JJU B;  3C75 H;  3N0D A;  2H6N A;  3EI4 A;  4QT8 A;  3JPX A;  3UVN A;  3C99 A;  4OZU A;  2G9A A;  3EI4 B;  3SLE D;  1K32 A;  4J86 A;  1YFQ A;  4CY5 A;  1Q47 A;  4ESG A;  4X3E A;  3GFC A;  3ORV D;  3I7P A;  5A2Q g;  2PBI B;  4ZN4 A;  2I0T A;  3A0F A;  5FXY A;  5GMK n;  2I0S A;  3MXX A;  5AMS A;  2YNP A;  5TF2 A;  2OVQ B;  4Z8L A;  2AGL A;  2OVP B;  4CZY A;  5I5M A;  2HXC A;  4BL0 A;  2YNN A;  2AGX A;  3FM0 A;  4HDJ A;  3AH8 B;  4CZX A;  5FKQ A;  5CYK B;  3BG0 A;  4E5Z B;  3UKR C;  3SJL D;  3MMY A;  1N6D A;  4JT6 C;  4O1Q D;  5FA5 B;  5FKT A;  3JZG A;  2B5L A;  4K3I D;  3J80 g;  4FHL A;  4GGD A;  5AFU 3;  2HJ4 A;  2IUQ A;  2G99 A;  4A08 B;  3SHF A;  2PM7 B;  4XYH A;  5EM2 A;  3SBP A;  5I5I A;  1SQJ A;  2YMU A;  3OL2 A;  4PSX B;  3E0C A;  1PEV A;  5CXB B;  2OK6 A;  2J57 G;  4GM3 A;  3PE7 A;  2HJB A;  3DSM A;  3PSC B;  4LG8 A;  4CI3 A;  5HE2 B;  1JOF A;  5HE0 B;  3K27 A;  4FA1 D;  4A11 A;  3U4Y A;  2CN2 A;  3V7D B;  3MKS B;  5GXH A;  4JT5 C;  3UR4 A;  3EMH A;  2IUR A;  2P9S C;  3RRM C;  1GXR A;  1N6E A;  4O3U B;  2CO0 C;  4O9D A;  3AL8 B;  2H9P A;  3F3P A;  4JSX C;  3PVW B;  5FKR A;  3I89 A;  1K8K C;  2H9N A;  1B9Y A;  4O45 A;  3I7L A;  5HE3 B;  1VYH C;  5GXI A;  3MZK A;  3IJC A;  2CE9 A;  2GC7 A;  4QQE A;  5H17 A;  2Z2O A;  4ZOX A;  3I7N A;  3PXT D;  3BG1 A;  3SBR A;  2UZY B;  5EML B;  3C9C A;  4ZOV A;  5FKS A;  3VGZ A;  1ERJ A;  3EI1 A;  4KFM B;  5TDH B;  1P22 A;  2PM9 A;  1MG2 A;  2HES X;  4ZOY A;  1NR0 A;  4A2L A;  3EI1 B;  5IT9 g; 
#chains in the Genus database with same CATH topology
 4GGC A;  2PM9 B;  1PGU A;  2YBA A;  4J73 A;  3EI3 A;  3FCS A;  3ZDY A;  4K3J B;  5IJ7 E;  3UVM A;  4A0A B;  4O2W A;  3IJ1 A;  4L3G D;  2B5M A;  3T3P A;  3SVW D;  1O6G A;  3EI3 B;  1TYQ C;  3UVK A;  4FB1 D;  3VA6 A;  2P9U C;  1TBG A;  3ZE0 A;  3FCU A;  3NIG A;  1N6F A;  1T2X A;  3L4O D;  2VC2 A;  5CYK A;  4J81 A;  4E5Z A;  1GOH A;  3RFH A;  4BCD A;  4RE6 A;  3RLM D;  3DWL C;  4X60 B;  3UVO A;  4ZOZ A;  4JD2 C;  2Z2N A;  1UTC A;  4L9O A;  4G55 A;  4A2M A;  4L1Q D;  4A0B B;  1A12 A;  3VH0 A;  4FA5 D;  4AMZ A;  1B9X A;  5TEE A;  3O4G A;  2MTA H;  1SQ9 A;  3EU7 A;  3BWS A;  5IC7 A;  3V4P A;  2EIE A;  4NEN A;  4A08 A;  2YNO A;  1JTD B;  2I3S A;  3SCY A;  4J0W A;  5EAM A;  4BP9 A;  3NID A;  1JMZ B;  5JWZ A;  4NBM A;  2OJY A;  4WK4 A;  4H5J A;  3CIK B;  5CXB A;  2QR5 A;  3V4V A;  2H3X A;  4E54 A;  3IUN A;  3GRE A;  1OMW B;  2TRC B;  4FA9 D;  1H2Y A;  1MDA H;  4Z7Q A;  3F3G A;  4PC0 A;  1VZ2 A;  3C5M A;  5K1C C;  5IGQ A;  2IAA A;  1OLZ A;  3T3M A;  3SFZ A;  3EG6 A;  2VDL A;  4E54 B;  2IUV A;  3IIW A;  4L1M A;  4ERY A;  4LG9 A;  1U2V C;  1XKS A;  2PM6 B;  4L3H D;  3K6S A;  3I7H A;  3PXW D;  5THA A;  1I2M B;  3IUQ A;  3SWS D;  3ZDX A;  3K26 A;  4CZV A;  2HYE A;  1NEX B;  1U4C A;  3JAM g;  2BBK H;  2VDQ A;  5EAP A;  3EI2 B;  4CY2 A;  4DNV A;  4Z7N A;  1SHY B;  3L4M D;  3AL8 A;  2GC4 A;  3IJ0 A;  2I3T A;  2VZ1 A;  2AH0 A;  2QXV A;  2P9I C;  3VI4 A;  1E8M A;  4QRJ A;  4CI1 A;  4O3T B;  2IWF A;  3DXK C;  3I2N A;  5EAR A;  4Y7R A;  5EMM B;  3B7F A;  4GQ1 A;  4UM9 A;  4J82 A;  1GG2 B;  1S4U X;  3KRX B;  3IKO A;  4JSN C;  4AEZ A;  3V5W B;  3O4J A;  5FLX g;  1UOQ A;  1JMX B;  4GQB B;  3OW8 A;  4CY3 A;  4FAV D;  4WK0 A;  1FWX A;  1GP2 B;  3ULE C;  2XYI A;  3MKQ A;  4GMB A;  1GOF A;  3OKY A;  3MVD K;  3K71 A;  4EWR A;  5M5S A;  2CN3 A;  2EBS A;  4N14 A;  3OKY B;  4PSW B;  4J78 A;  5HYN B;  2AGZ A;  3DXM C;  5H14 A;  3MUO A;  4A0A A;  3OF7 A;  2J56 H;  3ODT A;  3I8C A;  3PVU B;  1E5T A;  4Y5R D;  3I8E A;  1C9I A;  2H9M A;  3NVN A;  4J0X A;  3I7O A;  2I0R A;  4NC4 A;  4TZ4 A;  1A0R B;  2H6K A;  5M5V A;  2OVR B;  4QL1 A;  2XL2 A;  4RE5 A;  2XDW A;  4D9S A;  4YVD A;  3PXS D;  3CFS B;  2H9L A;  3OTT A;  4MMZ A;  1QFM A;  1K3I A;  2CE8 A;  1L0Q A;  2B5N A;  2VDN A;  1RI6 A;  2VZ3 A;  4X63 B;  3UKU C;  2P9P C;  4A0B A;  4X61 B;  4JHP C;  1XIP A;  3UVL A;  2JKX A;  4H5I A;  4G1M A;  4R7A B;  2GNQ A;  3IIY A;  1PI6 A;  4J84 A;  3K72 A;  4PBZ A;  2Z2P A;  3IUJ A;  2BKL A;  4GM8 A;  4U7A A;  2AH1 A;  2VDP A;  3SBQ A;  4AMY A;  3RMZ D;  3ZE1 A;  4BP8 A;  4J8G A;  5C2V B;  1PBY B;  2H13 A;  2BCJ B;  3PSL A;  4G56 B;  2J55 H;  2HKR A;  4BUJ C;  4IA9 A;  2CNX A;  3OKW A;  2AQ5 A;  3O4H A;  4PNK B;  5I5J A;  3JRO A;  4U1E I;  3SN6 B;  3IJE A;  3JZH A;  5K19 A;  4JXM A;  3P4F A;  5EMJ B;  2AGW A;  3RSE C;  3GD1 I;  4BH6 A;  4XYI A;  4O02 A;  3JB9 L;  5KDO B;  2P9K C;  4I79 A;  2VDR A;  4D0K A;  2XL3 A;  1R5M A;  4ERQ A;  3SXT D;  3ZWL B;  5GSA A;  1GOT B;  1QNI A;  2AGY A;  4J79 A;  3AL9 A;  3NVQ A;  4JSP C;  4FAN D;  2HU7 A;  4GM9 A;  4GQ2 P;  3FGB A;  4UI9 R;  5AJA A;  5C9Z B;  5TEF A;  2P9L C;  5IGO A;  3AFC A;  4LGN A;  3J81 g;  5C92 A;  4J77 A;  4CI8 A;  3EI2 A;  4A09 A;  2H6Q A;  5B4W A;  2H47 A;  1TYE A;  2UZX B;  5FFG A;  4CC9 A;  4A7J A;  1C9L A;  4J8B A;  5FQD A;  2CO0 A;  2OK4 A;  3JRP A;  5M5U A;  3IVM A;  3GC3 B;  4A09 B;  2Q7Q A;  5H1M A;  5M5T A;  3F3F A;  2HU8 A;  4ES0 A;  4CI2 A;  5EM2 B;  3V9F A;  5HQG A;  3OL2 B;  5C2W B;  4FWW A;  3RFG A;  2W18 A;  4CY1 A;  3W15 A;  4IRZ A;  3NIF A;  5C86 A;  4D6V A;  2O9K A;  2VDO A;  3KRW B;  4NSX A;  5EAL A;  1XHM A;  4PBY A;  3FRX A;  3EWE A;  4NAA A;  5E6R A;  3RN0 D;  2YB8 B;  5EMK B;  1MG3 A;  5CXC A;  4A11 B;  3RN1 D;  4JSV C;  3DDU A;  3NVX A;  3JZN A;  5IJ8 E;  4AOW A;  2XE4 A;  2IUP A;  1JV2 A;  3I7K A;  4PXW A;  4XEI C;  4FA4 D;  2XU7 A;  3CFV A;  5CXC B;  3DM0 A;  3SMR A;  1M1X A;  3HFQ A;  5HE1 B;  2P9N C;  4GGA A;  4IMM A;  4ERZ A;  2OIZ A;  4MMX A;  2QC5 A;  3MZL A;  4MK0 B;  2IWK A;  4GZ8 A;  4OWR A;  3OKT A;  4J87 A;  2B4E A;  2EID A;  3N0E A;  2H14 A;  1BPO A;  2HKM A;  5SXM A;  2H68 A;  5M61 A;  3ZDZ A;  1JJU B;  3C75 H;  3N0D A;  2H6N A;  4WJK A;  3EI4 A;  5HDB A;  2QZP A;  4QT8 A;  3JPX A;  4MMY A;  3UVN A;  3C99 A;  4OZU A;  2G9A A;  3EI4 B;  1YR2 A;  3SLE D;  1K32 A;  4J86 A;  1YFQ A;  4CY5 A;  1Q47 A;  1VE7 A;  4X3E A;  4ESG A;  5E6U A;  3GFC A;  3ORV D;  3I7P A;  5A2Q g;  2PBI B;  4ZN4 A;  2I0T A;  3A0F A;  3QHY B;  3QI0 A;  5FXY A;  5GMK n;  2I0S A;  1UOO A;  3MXX A;  3KCI A;  5AMS A;  4UM8 A;  2YNP A;  5TF2 A;  1H2Z A;  2OVQ B;  3EQ7 A;  4Z8L A;  2AGL A;  2OVP B;  4CZY A;  5I5M A;  2HXC A;  4WK2 A;  4BL0 A;  2YNN A;  2AGX A;  2VDM A;  3FM0 A;  4HDJ A;  3AH8 B;  4Z7O A;  4CZX A;  5FKQ A;  5CYK B;  3BG0 A;  4E5Z B;  2XZG A;  2WQ8 A;  3UKR C;  1L5G A;  3SJL D;  3MMY A;  1N6D A;  4BCC A;  4JT6 C;  4O1Q D;  1QFS A;  5FA5 B;  5FKT A;  3JZG A;  3VI3 A;  5M5R A;  2B5L A;  4K3I D;  3J80 g;  4FHL A;  4GGD A;  5AFU 3;  2HJ4 A;  2IUQ A;  4G1E A;  2EIC A;  2G99 A;  4A08 B;  3SHF A;  3IUL A;  2PM7 B;  4XYH A;  5EM2 A;  3SBP A;  5I5I A;  2EIB A;  1SQJ A;  2YMU A;  3OL2 A;  4PSX B;  3E0C A;  2VDK A;  4AN0 A;  1PEV A;  5CXB B;  2OK6 A;  1H2X A;  4AX4 A;  2J57 G;  4DNW A;  4GM3 A;  3PE7 A;  2HJB A;  3DSM A;  3PSC B;  4LG8 A;  1GOG A;  4CI3 A;  5HE2 B;  1JOF A;  5HE0 B;  3ZE2 A;  4BCB A;  3K27 A;  4FA1 D;  4A11 A;  3U4Y A;  2CN2 A;  3V7D B;  1E8N A;  1H2W A;  3MKS B;  5GXH A;  4JT5 C;  3UR4 A;  3EMH A;  2IUR A;  2P9S C;  3RRM C;  1GXR A;  1N6E A;  1O6F A;  1UOP A;  3IUR A;  4O3U B;  2CO0 C;  4O9D A;  3AL8 B;  2H9P A;  3F3P A;  4JSX C;  3IUM A;  3PVW B;  5FKR A;  3I89 A;  1K8K C;  2H9N A;  1B9Y A;  4O45 A;  3I7L A;  5HE3 B;  1VYH C;  5GXI A;  3MZK A;  3IJC A;  2CE9 A;  2GC7 A;  4QQE A;  5H17 A;  2Z2O A;  4ZOX A;  5FFO A;  3I7N A;  3PXT D;  3BG1 A;  3SBR A;  1VE6 A;  4DNU A;  2UZY B;  5EML B;  3C9C A;  3O4I A;  4ZOV A;  5FKS A;  2HU5 A;  3VGZ A;  1ERJ A;  3EI1 A;  4AN1 A;  4KFM B;  5TDH B;  1P22 A;  1U8C A;  2PM9 A;  3MUN A;  4JHN A;  1MG2 A;  2HES X;  4ZOY A;  3EQ8 A;  1NR0 A;  4A2L A;  3EI1 B;  3EQ9 A;  5IT9 g;  5E6S A;  1VZ3 A;  4QAM A; 
#chains in the Genus database with same CATH homology
 4GGC A;  2PM9 B;  1PGU A;  2YBA A;  4J73 A;  3EI3 A;  4K3J B;  5IJ7 E;  3UVM A;  4A0A B;  3IJ1 A;  4L3G D;  2B5M A;  3SVW D;  3EI3 B;  1TYQ C;  3UVK A;  4FB1 D;  3VA6 A;  2P9U C;  1TBG A;  1N6F A;  3L4O D;  5CYK A;  4J81 A;  4E5Z A;  3RFH A;  3RLM D;  3DWL C;  4X60 B;  3UVO A;  4ZOZ A;  4JD2 C;  2Z2N A;  4L9O A;  4A2M A;  4L1Q D;  4A0B B;  3VH0 A;  4FA5 D;  1B9X A;  5TEE A;  2MTA H;  1SQ9 A;  3EU7 A;  3BWS A;  5IC7 A;  4A08 A;  2YNO A;  2I3S A;  3SCY A;  4J0W A;  5EAM A;  1JMZ B;  5JWZ A;  2OJY A;  4H5J A;  3CIK B;  5CXB A;  2H3X A;  4E54 A;  3GRE A;  1OMW B;  2TRC B;  4FA9 D;  1MDA H;  3F3G A;  4PC0 A;  3C5M A;  5K1C C;  5IGQ A;  2IAA A;  1OLZ A;  3SFZ A;  3EG6 A;  4E54 B;  2IUV A;  3IIW A;  4ERY A;  4LG9 A;  1U2V C;  1XKS A;  2PM6 B;  4L3H D;  3I7H A;  3PXW D;  5THA A;  3SWS D;  3K26 A;  4CZV A;  2HYE A;  1NEX B;  1U4C A;  3JAM g;  2BBK H;  5EAP A;  3EI2 B;  4CY2 A;  1SHY B;  3L4M D;  3AL8 A;  2GC4 A;  3IJ0 A;  2I3T A;  2AH0 A;  2QXV A;  2P9I C;  4CI1 A;  4QRJ A;  4O3T B;  2IWF A;  3DXK C;  3I2N A;  5EAR A;  4Y7R A;  5EMM B;  3B7F A;  4GQ1 A;  4J82 A;  1GG2 B;  1S4U X;  3KRX B;  3IKO A;  4JSN C;  4AEZ A;  3V5W B;  5FLX g;  1JMX B;  4GQB B;  3OW8 A;  4CY3 A;  4FAV D;  1FWX A;  1GP2 B;  3ULE C;  2XYI A;  3MKQ A;  4GMB A;  3OKY A;  4EWR A;  2CN3 A;  2EBS A;  4N14 A;  3OKY B;  4PSW B;  4J78 A;  5HYN B;  2AGZ A;  3DXM C;  5H14 A;  4A0A A;  2J56 H;  3ODT A;  3I8C A;  3PVU B;  4Y5R D;  3I8E A;  2H9M A;  3NVN A;  4J0X A;  3I7O A;  2I0R A;  4TZ4 A;  1A0R B;  2H6K A;  2OVR B;  4QL1 A;  2XL2 A;  4YVD A;  3PXS D;  3CFS B;  2H9L A;  3OTT A;  2CE8 A;  1L0Q A;  2B5N A;  1RI6 A;  4X63 B;  3UKU C;  2P9P C;  4A0B A;  4X61 B;  1XIP A;  3UVL A;  4H5I A;  4R7A B;  2GNQ A;  3IIY A;  1PI6 A;  4J84 A;  4PBZ A;  2Z2P A;  4U7A A;  4GM8 A;  2AH1 A;  3SBQ A;  3RMZ D;  4J8G A;  5C2V B;  1PBY B;  2H13 A;  2BCJ B;  3PSL A;  4G56 B;  2J55 H;  2HKR A;  4BUJ C;  4IA9 A;  2CNX A;  3OKW A;  2AQ5 A;  4PNK B;  5I5J A;  3JRO A;  4U1E I;  3SN6 B;  3JZH A;  5K19 A;  4JXM A;  3P4F A;  5EMJ B;  2AGW A;  3RSE C;  4BH6 A;  4XYI A;  3JB9 L;  5KDO B;  2P9K C;  4I79 A;  4D0K A;  2XL3 A;  1R5M A;  4ERQ A;  3SXT D;  3ZWL B;  5GSA A;  1GOT B;  1QNI A;  2AGY A;  4J79 A;  3AL9 A;  3NVQ A;  4JSP C;  4FAN D;  4GM9 A;  4GQ2 P;  3FGB A;  4UI9 R;  5AJA A;  5C9Z B;  5TEF A;  2P9L C;  5IGO A;  3AFC A;  4LGN A;  3J81 g;  4J77 A;  4CI8 A;  3EI2 A;  4A09 A;  2H6Q A;  5B4W A;  2H47 A;  2UZX B;  4CC9 A;  4A7J A;  4J8B A;  5FQD A;  2CO0 A;  2OK4 A;  3JRP A;  4A09 B;  2Q7Q A;  5H1M A;  3F3F A;  4ES0 A;  4CI2 A;  5EM2 B;  3V9F A;  5HQG A;  3OL2 B;  5C2W B;  4FWW A;  3RFG A;  2W18 A;  4CY1 A;  3W15 A;  4D6V A;  2O9K A;  3KRW B;  4NSX A;  5EAL A;  1XHM A;  4PBY A;  3FRX A;  3EWE A;  3RN0 D;  2YB8 B;  5EMK B;  1MG3 A;  5CXC A;  4A11 B;  3RN1 D;  4JSV C;  3NVX A;  3JZN A;  5IJ8 E;  4AOW A;  2IUP A;  3I7K A;  4PXW A;  4XEI C;  4FA4 D;  2XU7 A;  3CFV A;  5CXC B;  3DM0 A;  3SMR A;  3HFQ A;  5HE1 B;  2P9N C;  4GGA A;  4IMM A;  4ERZ A;  2OIZ A;  2QC5 A;  3MZL A;  4MK0 B;  2IWK A;  4GZ8 A;  4OWR A;  3OKT A;  4J87 A;  2B4E A;  3N0E A;  2H14 A;  2HKM A;  5SXM A;  2H68 A;  1JJU B;  3C75 H;  3N0D A;  2H6N A;  3EI4 A;  4QT8 A;  3JPX A;  3UVN A;  3C99 A;  4OZU A;  2G9A A;  3EI4 B;  3SLE D;  1K32 A;  4J86 A;  1YFQ A;  4CY5 A;  1Q47 A;  4ESG A;  4X3E A;  3GFC A;  3ORV D;  3I7P A;  5A2Q g;  2PBI B;  4ZN4 A;  2I0T A;  3A0F A;  5FXY A;  5GMK n;  2I0S A;  3MXX A;  5AMS A;  2YNP A;  5TF2 A;  2OVQ B;  4Z8L A;  2AGL A;  2OVP B;  4CZY A;  5I5M A;  2HXC A;  4BL0 A;  2YNN A;  2AGX A;  3FM0 A;  4HDJ A;  3AH8 B;  4CZX A;  5FKQ A;  5CYK B;  3BG0 A;  4E5Z B;  3UKR C;  3SJL D;  3MMY A;  1N6D A;  4JT6 C;  4O1Q D;  5FA5 B;  5FKT A;  3JZG A;  2B5L A;  4K3I D;  3J80 g;  4FHL A;  4GGD A;  5AFU 3;  2HJ4 A;  2IUQ A;  2G99 A;  4A08 B;  3SHF A;  2PM7 B;  4XYH A;  5EM2 A;  3SBP A;  5I5I A;  1SQJ A;  2YMU A;  3OL2 A;  4PSX B;  3E0C A;  1PEV A;  5CXB B;  2OK6 A;  2J57 G;  4GM3 A;  3PE7 A;  2HJB A;  3DSM A;  3PSC B;  4LG8 A;  4CI3 A;  5HE2 B;  1JOF A;  5HE0 B;  3K27 A;  4FA1 D;  4A11 A;  3U4Y A;  2CN2 A;  3V7D B;  3MKS B;  5GXH A;  4JT5 C;  3UR4 A;  3EMH A;  2IUR A;  2P9S C;  3RRM C;  1GXR A;  1N6E A;  4O3U B;  2CO0 C;  4O9D A;  3AL8 B;  2H9P A;  3F3P A;  4JSX C;  3PVW B;  5FKR A;  3I89 A;  1K8K C;  2H9N A;  1B9Y A;  4O45 A;  3I7L A;  5HE3 B;  1VYH C;  5GXI A;  3MZK A;  3IJC A;  2CE9 A;  2GC7 A;  4QQE A;  5H17 A;  2Z2O A;  4ZOX A;  3I7N A;  3PXT D;  3BG1 A;  3SBR A;  2UZY B;  5EML B;  3C9C A;  4ZOV A;  5FKS A;  3VGZ A;  1ERJ A;  3EI1 A;  4KFM B;  5TDH B;  1P22 A;  2PM9 A;  1MG2 A;  2HES X;  4ZOY A;  1NR0 A;  4A2L A;  3EI1 B;  5IT9 g; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...