4Y7RA

Crystal structure of wdr5 in complex with myc mbiiib peptide
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords WD repeat-containing protein 5
publication title Interaction with WDR5 Promotes Target Gene Recognition and Tumorigenesis by MYC.
pubmed doi rcsb
source organism Homo sapiens
total genus 110
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4y7rA00
2AGWA 4CI2A 2YBAA 4MK0B 5HE1B 3OL2A 4GQ1A 2AGLA 4A7JA 4A2MA 4J81A 3UR4A 2OIZA 3PSCB 5GMKn 2YNNA 2P9SC 4JSVC 2CN2A 3EWEA 4TZ4A 4J87A 1PBYB 4JSNC 2Z2NA 4J86A 5TEEA 3RMZD 4GQBB 5IC7A 1SQJA 3ORVD 2IURA 4JSPC 4UI9R 3AL8B 3K26A 2PM9B 4CZVA 3MXXA 2B5LA 3DM0A 4J0WA 4JD2C 3SN6B 3DXMC 3V9FA 4XEIC 4CI1A 4N14A 2EBSA 3SJLD 2GC7A 2G99A 4BL0A 2TRCB 3L4MD 4A08B 3ZWLB 4CY5A 2CN3A 4A09B 1XHMA 3W15A 3DWLC 3JROA 4AOWA 3PXWD 3RRMC 5FKTA 4FHLA 4ZN4A 4FA9D 3EMHA 5AFU3 2I0RA 4J0XA 4BH6A 2IUQA 1JOFA 2XL3A 2UZYB 4JT6C 4X61B 5AMSA 3I89A 3UVNA 2PM6B 3SVWD 4ZOXA 3EI2B 3MKSB 1FWXA 3MZLA 5FKSA 3CIKB 3FGBA 5HQGA 5FLXg 4J78A 3PE7A 3AL8A 2PM9A 2HKRA 4PSWB 2H6KA 3I8EA 4GGCA 3RSEC 1JMZB 4A08A 2HESX 4A09A 1XKSA 3F3GA 2H9NA 5HYNB 5FXYA 3IJCA 1QNIA 5EAPA 3VH0A 3SCYA 4QT8A 2P9PC 4JXMA 3V5WB 1GP2B 3UVOA 4OZUA 4A11B 5FKRA 2GNQA 1SHYB 4J73A 1GOTB 4J84A 3JZHA 4PSXB 3EI2A 2YMUA 3VGZA 1K8KC 4QRJA 5FKQA 4L1QD 5H17A 2HKMA 2B4EA 3UVLA 2HYEA 3KRWB 4GM8A 4K3ID 3UKUC 3L4OD 4IA9A 5IGOA 4J77A 1S4UX 3SMRA 1OMWB 4LG8A 5C2VB 3I2NA 2J57G 5SXMA 5GXIA 3SLED 3DSMA 1SQ9A 3IKOA 4LGNA 4QL1A 2P9IC 4AEZA 4FWWA 3OTTA 4BUJC 2XL2A 3UKRC 2P9LC 3FM0A 3RFGA 4CZXA 4J79A 1GXRA 4GQ2P 2IWKA 1TYQC 4D6VA 5A2Qg 3C99A 2XYIA 3SXTD 4J8BA 5K1CC 2I3TA 3AH8B 2Z2OA 2H6NA 3VA6A 4Y5RD 4A11A 2OK6A 3SBPA 3BWSA 3GREA 1A0RB 4ERYA 4L3HD 3OKYB 2YB8B 5CYKB 5I5MA 2H68A 3CFSB 2UZXB 3HFQA 3EG6A 5EMJB 4J82A 1MG3A 1N6EA 1N6DA 3NVQA 2MTAH 4O3TB 3IIYA 2H9LA 2H9MA 1B9YA 3ODTA 2G9AA 5EALA 2GC4A 3AFCA 3DXKC 5GXHA 5GSAA 4ERZA 2PBIB 2H47A 5I5JA 3F3PA 3SWSD 5EMMB 5EMLB 2I0TA 3I7KA 2Z2PA 4PXWA 4FA4D 4O45A 1YFQA 1U4CA 4NSXA 2BCJB 2AGZA 3OKYA 5CYKA 1PI6A 2H9PA 2AGXA 4O3UB 4X60B 3JRPA 3MMYA 3GFCA 1XIPA 3I7LA 3MKQA 4GMBA 3C5MA 1K32A 2H3XA 5IGQA 3BG1A 5I5IA 2CO0A 3JZGA 2J55H 4CY2A 4A0AA 4YVDA 5FQDA 5IT9g 4U1EI 3OKTA 5HE2B 3MZKA 4FB1D 4PBZA 2IUPA 3I7OA 1P22A 5EM2B 5HE0B 2P9UC 1MDAH 4U7AA 3RLMD 3NVNA 4GGDA 2IWFA 4CI8A 5EMKB 2AH0A 4GM9A 2AGYA 4Z8LA 1NR0A 3JB9L 3I8CA 4Y7RA 1GG2B 1RI6A 1L0QA 2HXCA 3PXSD 4PC0A 2H14A 3PVWB 4FAVD 4ZOYA 3EI4B 4OWRA 3EI3B 3PXTD 4X63B 5B4WA 3RN0D 2CO0C 3C75H 4ES0A 3J80g 4X3EA 3JZNA 4O1QD 2OVQB 3RN1D 3EI1B 2YNOA 4CC9A 3N0DA 4ESGA 3P4FA 3FRXA 4A0BB 2HJBA 2IUVA 4A2LA 2H13A 4QQEA 1OLZA 4FA5D 5FA5B 2W18A 5H14A 2YNPA 3OKWA 1TBGA 5C9ZB 1PEVA 1JMXB 5EAMA 2QC5A 2IAAA 5EM2A 3UVKA 4ZOZA 2J56H 3SHFA 2Q7QA 4E54B 3SBRA 3U4YA 3I7HA 4L3GD 2OVRB 2P9KC 3IIWA 5AJAA 3UVMA 4A0AB 1B9XA 4CZYA 4I79A 3ULEC 3E0CA 2CE8A 3I7PA 3EI4A 1NEXB 3EI3A 4CY3A 1PGUA 2BBKH 2HJ4A 5JWZA 5C2WB 3J81g 3JPXA 3N0EA 5CXBB 5TF2A 3K27A 1R5MA 2AH1A 3EI1A 5CXCB 4GGAA 3I7NA 4A0BA 1MG2A 4FAND 3JAMg 4CY1A 2B5NA 3C9CA 3OW8A 3AL9A 4LG9A 4R7AB 2I0SA 4E5ZB 1ERJA 4PNKB 4D0KA 2CE9A 2OK4A 4H5JA 3PVUB 1U2VC 2O9KA 4PBYA 4XYHA 3IJ0A 4IMMA 3SFZA 3IJ1A 1N6FA 2PM7B 4E54A 3SBQA 3EU7A 3OL2B 2CNXA 2AQ5A 3PSLA 2OVPB 3CFVA 4G56B 3A0FA 4JT5C 1JJUB 2P9NC 5IJ7E 4J8GA 3BG0A 3V7DB 4FA1D 5H1MA 2QXVA 5THAA 4HDJA 5K19A 4K3JB 5EARA 5CXBA 2XU7A 4GM3A 5TDHB 3B7FA 4ERQA 5CXCA 2I3SA 5TEFA 3NVXA 4ZOVA 4XYIA 3KRXB 5HE3B 4O9DA 4H5IA 3RFHA 4CI3A 3F3FA 5IJ8E 5KDOB 2B5MA 4JSXC 1VYHC 4E5ZA 2H6QA 2OJYA 4GZ8A 4EWRA 4KFMB 1Q47A 4L9OA
chains in the Genus database with same CATH superfamily
4AMYA 2AGWA 4CI2A 2YBAA 4MK0B 5HE1B 3OL2A 4GQ1A 5E6UA 2AGLA 4D9SA 4A7JA 4A2MA 4J81A 2VDRA 3UR4A 2OIZA 3PSCB 5GMKn 2YNNA 2P9SC 4JSVC 2CN2A 3EWEA 4TZ4A 4J87A 1PBYB 4JSNC 1L5GA 2Z2NA 3IUMA 4J86A 5M61A 5TEEA 3RMZD 2HU7A 1GOHA 4GQBB 5IC7A 1SQJA 4JHNA 3ORVD 2IURA 4JSPC 4UI9R 3AL8B 3K26A 2PM9B 4CZVA 3MXXA 3IUNA 2B5LA 3DM0A 4J0WA 4IRZA 4JD2C 3DXMC 4O02A 3SN6B 4XEIC 3V9FA 4WJKA 5C92A 3NIDA 4CI1A 4N14A 2EBSA 3SJLD 2GC7A 2G99A 4BL0A 2TRCB 3L4MD 4A08B 1C9LA 3ZWLB 4CY5A 2CN3A 4A09B 1XHMA 3W15A 3DWLC 3JROA 4AOWA 3PXWD 3RRMC 5FKTA 1H2ZA 4FHLA 1U8CA 5FFOA 4ZN4A 4FA9D 3EMHA 5AFU3 2I0RA 4J0XA 3V4VA 4BH6A 2IUQA 1H2XA 1JOFA 2XL3A 2UZYB 4JT6C 4X61B 5AMSA 3I89A 3UVNA 2PM6B 3IVMA 3O4JA 3SVWD 4ZOXA 3EI2B 3MKSB 1FWXA 3MZLA 1UOOA 5FKSA 3CIKB 3FGBA 5HQGA 5FLXg 4J78A 3PE7A 2HU5A 3EQ9A 1H2WA 1BPOA 3AL8A 2PM9A 2HKRA 4PSWB 2H6KA 3I8EA 4GGCA 3RSEC 1JMZB 4A08A 2HESX 4A09A 1XKSA 3F3GA 3MUOA 2H9NA 5HYNB 5FXYA 3IJCA 1QNIA 5EAPA 3VH0A 4UM8A 3SCYA 4QT8A 2P9PC 4JXMA 1I2MB 4G1MA 2XE4A 3V5WB 4DNWA 4G1EA 1GP2B 3UVOA 4Z7NA 1C9IA 4OZUA 4A11B 4JHPC 5FKRA 4UM9A 5M5RA 2VDMA 2GNQA 2VDKA 3VI3A 1SHYB 4J73A 1VZ3A 1GOTB 4J84A 3JZHA 4PSXB 3EI2A 2YMUA 3VGZA 5M5TA 3IUJA 1K8KC 4QRJA 5FKQA 4L1QD 4NENA 5H17A 2HKMA 2B4EA 3UVLA 2HYEA 3KRWB 4GM8A 4K3ID 3UKUC 3L4OD 4IA9A 5IGOA 4J77A 1S4UX 3OF7A 3SMRA 1OMWB 3FCUA 4LG8A 5C2VB 3I2NA 1VE6A 2J57G 5SXMA 5GXIA 3SLED 3DSMA 1SQ9A 2VDPA 4DNUA 3IKOA 4LGNA 4QL1A 4BP9A 2QZPA 2P9IC 4AEZA 4FWWA 2QR5A 4WK0A 3OTTA 4BUJC 2XL2A 2VDLA 5M5UA 3UKRC 2P9LC 3FM0A 3RFGA 4CZXA 4J79A 1GXRA 2VZ1A 2WQ8A 4GQ2P 3K72A 2IWKA 3O4IA 1TYQC 4D6VA 5A2Qg 3C99A 2XYIA 3KCIA 3SXTD 4J8BA 5K1CC 2I3TA 3AH8B 2Z2OA 1E8NA 4MMZA 2H6NA 3VA6A 4Y5RD 4A11A 4AN1A 2OK6A 3NIFA 3SBPA 3BWSA 2XDWA 3GREA 3ZE0A 1A0RB 4ERYA 4L3HD 3OKYB 2YB8B 5CYKB 5I5MA 2H68A 1H2YA 3CFSB 2UZXB 3HFQA 4RE5A 3EG6A 4NBMA 4J82A 5EMJB 2VZ3A 1MG3A 3QI0A 4G55A 1N6EA 1N6DA 2EIBA 5FFGA 3NVQA 2MTAH 4O3TB 3IIYA 2H9LA 4DNVA 2H9MA 1E5TA 1B9YA 3ODTA 2G9AA 5EALA 4WK2A 1E8MA 2GC4A 5E6SA 4MMXA 3AFCA 2VDNA 4BCBA 3DXKC 5GXHA 2XZGA 5GSAA 4ERZA 2PBIB 2H47A 5I5JA 1GOGA 3F3PA 3SWSD 5EMMB 5EMLB 2I0TA 3I7KA 1YR2A 3K71A 2Z2PA 4PXWA 4L1MA 4FA4D 4NAAA 4O45A 3EQ7A 1YFQA 4AMZA 1GOFA 1U4CA 4QAMA 4NSXA 2BCJB 3ZDXA 2AGZA 3OKYA 5CYKA 1PI6A 1T2XA 2H9PA 2AGXA 4O3UB 4X60B 3JRPA 3MMYA 3GFCA 1XIPA 3I7LA 3MKQA 4GMBA 3C5MA 1K32A 2H3XA 5IGQA 3BG1A 4Z7QA 5I5IA 2CO0A 3JZGA 2J55H 4CY2A 4A0AA 4YVDA 5FQDA 5IT9g 4BCDA 4U1EI 3OKTA 3O4GA 5HE2B 3MZKA 4FB1D 4PBZA 2IUPA 3I7OA 1P22A 2BKLA 5EM2B 5HE0B 2P9UC 1MDAH 4U7AA 3RLMD 3NVNA 4GGDA 2IWFA 4CI8A 5EMKB 1K3IA 2AH0A 4GM9A 2AGYA 4Z8LA 1NR0A 1JV2A 3JB9L 3I8CA 3T3PA 4Y7RA 1GG2B 1RI6A 1L0QA 2HXCA 3PXSD 4PC0A 2H14A 3PVWB 4FAVD 4ZOYA 1O6FA 3FCSA 3EI4B 4OWRA 5C86A 1TYEA 3EI3B 3PXTD 4X63B 5B4WA 3RN0D 4RE6A 2CO0C 2VDOA 3C75H 3ZDZA 4ES0A 3J80g 4X3EA 1A12A 3JZNA 3T3MA 4O1QD 2OVQB 3RN1D 3EI1B 1QFSA 2YNOA 4CC9A 3N0DA 4ESGA 3P4FA 2HU8A 3FRXA 4A0BB 2HJBA 2IUVA 4A2LA 2H13A 4QQEA 1M1XA 1OLZA 4AX4A 4FA5D 5FA5B 3K6SA 2W18A 5HDBA 5H14A 2YNPA 4WK4A 3OKWA 1TBGA 3IUQA 5C9ZB 1PEVA 3MUNA 1JMXB 5EAMA 2QC5A 2IAAA 5EM2A 3UVKA 4ZOZA 2J56H 3SHFA 2Q7QA 4E54B 3SBRA 3U4YA 3I7HA 4L3GD 2OVRB 3IJEA 3NIGA 2P9KC 3IIWA 5AJAA 3UVMA 4A0AB 1B9XA 4CZYA 4I79A 3ULEC 2EIEA 3EQ8A 3E0CA 2CE8A 2EIDA 3I7PA 3EI4A 1NEXB 3EI3A 2VDQA 4CY3A 1PGUA 2BBKH 2HJ4A 5JWZA 5C2WB 3J81g 4AN0A 3JPXA 3N0EA 5CXBB 1UTCA 5TF2A 3K27A 3ZE2A 3VI4A 1R5MA 2AH1A 3EI1A 5CXCB 4GGAA 5M5SA 3I7NA 2JKXA 4O2WA 4A0BA 1MG2A 1O6GA 4BCCA 4FAND 3JAMg 4CY1A 2B5NA 3C9CA 3OW8A 3AL9A 4LG9A 4R7AB 2I0SA 1VZ2A 1ERJA 4E5ZB 4PNKB 4D0KA 2CE9A 2OK4A 4H5JA 4MMYA 3PVUB 1QFMA 1U2VC 2O9KA 4PBYA 4XYHA 3IJ0A 4IMMA 3SFZA 3IJ1A 1N6FA 2PM7B 4E54A 3O4HA 3SBQA 3EU7A 3OL2B 4NC4A 2CNXA 2AQ5A 3PSLA 3DDUA 4Z7OA 2OVPB 3CFVA 4G56B 3A0FA 4JT5C 3ZDYA 3MVDK 1JJUB 2P9NC 4BP8A 5IJ7E 4J8GA 3BG0A 3GC3B 3V7DB 3GD1I 2EICA 4FA1D 5H1MA 3V4PA 2QXVA 5THAA 3IULA 5M5VA 4HDJA 5K19A 1JTDB 4K3JB 5EARA 5CXBA 2XU7A 4GM3A 5TDHB 3B7FA 4ERQA 5CXCA 2I3SA 5TEFA 5E6RA 3NVXA 4ZOVA 4XYIA 3IURA 3KRXB 5HE3B 3QHYB 4O9DA 3ZE1A 4H5IA 1UOPA 1VE7A 3RFHA 4CI3A 3F3FA 5IJ8E 2VC2A 1UOQA 5KDOB 2B5MA 4JSXC 1VYHC 4E5ZA 2H6QA 2OJYA 4GZ8A 4EWRA 4KFMB 1Q47A 4L9OA
chains in the Genus database with same CATH topology
2AGWA 4CI2A 2YBAA 4MK0B 5HE1B 3OL2A 4GQ1A 2AGLA 4A7JA 4A2MA 4J81A 3UR4A 2OIZA 3PSCB 5GMKn 2YNNA 2P9SC 4JSVC 2CN2A 3EWEA 4TZ4A 4J87A 1PBYB 4JSNC 2Z2NA 4J86A 5TEEA 3RMZD 4GQBB 5IC7A 1SQJA 3ORVD 2IURA 4JSPC 4UI9R 3AL8B 3K26A 2PM9B 4CZVA 3MXXA 2B5LA 3DM0A 4J0WA 4JD2C 3SN6B 3DXMC 3V9FA 4XEIC 4CI1A 4N14A 2EBSA 3SJLD 2GC7A 2G99A 4BL0A 2TRCB 3L4MD 4A08B 3ZWLB 4CY5A 2CN3A 4A09B 1XHMA 3W15A 3DWLC 3JROA 4AOWA 3PXWD 3RRMC 5FKTA 4FHLA 4ZN4A 4FA9D 3EMHA 5AFU3 2I0RA 4J0XA 4BH6A 2IUQA 1JOFA 2XL3A 2UZYB 4JT6C 4X61B 5AMSA 3I89A 3UVNA 2PM6B 3SVWD 4ZOXA 3EI2B 3MKSB 1FWXA 3MZLA 5FKSA 3CIKB 3FGBA 5HQGA 5FLXg 4J78A 3PE7A 3AL8A 2PM9A 2HKRA 4PSWB 2H6KA 3I8EA 4GGCA 3RSEC 1JMZB 4A08A 2HESX 4A09A 1XKSA 3F3GA 2H9NA 5HYNB 5FXYA 3IJCA 1QNIA 5EAPA 3VH0A 3SCYA 4QT8A 2P9PC 4JXMA 3V5WB 1GP2B 3UVOA 4OZUA 4A11B 5FKRA 2GNQA 1SHYB 4J73A 1GOTB 4J84A 3JZHA 4PSXB 3EI2A 2YMUA 3VGZA 1K8KC 4QRJA 5FKQA 4L1QD 5H17A 2HKMA 2B4EA 3UVLA 2HYEA 3KRWB 4GM8A 4K3ID 3UKUC 3L4OD 4IA9A 5IGOA 4J77A 1S4UX 3SMRA 1OMWB 4LG8A 5C2VB 3I2NA 2J57G 5SXMA 5GXIA 3SLED 3DSMA 1SQ9A 3IKOA 4LGNA 4QL1A 2P9IC 4AEZA 4FWWA 3OTTA 4BUJC 2XL2A 3UKRC 2P9LC 3FM0A 3RFGA 4CZXA 4J79A 1GXRA 4GQ2P 2IWKA 1TYQC 4D6VA 5A2Qg 3C99A 2XYIA 3SXTD 4J8BA 5K1CC 2I3TA 3AH8B 2Z2OA 2H6NA 3VA6A 4Y5RD 4A11A 2OK6A 3SBPA 3BWSA 3GREA 1A0RB 4ERYA 4L3HD 3OKYB 2YB8B 5CYKB 5I5MA 2H68A 3CFSB 2UZXB 3HFQA 3EG6A 5EMJB 4J82A 1MG3A 1N6EA 1N6DA 3NVQA 2MTAH 4O3TB 3IIYA 2H9LA 2H9MA 1B9YA 3ODTA 2G9AA 5EALA 2GC4A 3AFCA 3DXKC 5GXHA 5GSAA 4ERZA 2PBIB 2H47A 5I5JA 3F3PA 3SWSD 5EMMB 5EMLB 2I0TA 3I7KA 2Z2PA 4PXWA 4FA4D 4O45A 1YFQA 1U4CA 4NSXA 2BCJB 2AGZA 3OKYA 5CYKA 1PI6A 2H9PA 2AGXA 4O3UB 4X60B 3JRPA 3MMYA 3GFCA 1XIPA 3I7LA 3MKQA 4GMBA 3C5MA 1K32A 2H3XA 5IGQA 3BG1A 5I5IA 2CO0A 3JZGA 2J55H 4CY2A 4A0AA 4YVDA 5FQDA 5IT9g 4U1EI 3OKTA 5HE2B 3MZKA 4FB1D 4PBZA 2IUPA 3I7OA 1P22A 5EM2B 5HE0B 2P9UC 1MDAH 4U7AA 3RLMD 3NVNA 4GGDA 2IWFA 4CI8A 5EMKB 2AH0A 4GM9A 2AGYA 4Z8LA 1NR0A 3JB9L 3I8CA 4Y7RA 1GG2B 1RI6A 1L0QA 2HXCA 3PXSD 4PC0A 2H14A 3PVWB 4FAVD 4ZOYA 3EI4B 4OWRA 3EI3B 3PXTD 4X63B 5B4WA 3RN0D 2CO0C 3C75H 4ES0A 3J80g 4X3EA 3JZNA 4O1QD 2OVQB 3RN1D 3EI1B 2YNOA 4CC9A 3N0DA 4ESGA 3P4FA 3FRXA 4A0BB 2HJBA 2IUVA 4A2LA 2H13A 4QQEA 1OLZA 4FA5D 5FA5B 2W18A 5H14A 2YNPA 3OKWA 1TBGA 5C9ZB 1PEVA 1JMXB 5EAMA 2QC5A 2IAAA 5EM2A 3UVKA 4ZOZA 2J56H 3SHFA 2Q7QA 4E54B 3SBRA 3U4YA 3I7HA 4L3GD 2OVRB 2P9KC 3IIWA 5AJAA 3UVMA 4A0AB 1B9XA 4CZYA 4I79A 3ULEC 3E0CA 2CE8A 3I7PA 3EI4A 1NEXB 3EI3A 4CY3A 1PGUA 2BBKH 2HJ4A 5JWZA 5C2WB 3J81g 3JPXA 3N0EA 5CXBB 5TF2A 3K27A 1R5MA 2AH1A 3EI1A 5CXCB 4GGAA 3I7NA 4A0BA 1MG2A 4FAND 3JAMg 4CY1A 2B5NA 3C9CA 3OW8A 3AL9A 4LG9A 4R7AB 2I0SA 4E5ZB 1ERJA 4PNKB 4D0KA 2CE9A 2OK4A 4H5JA 3PVUB 1U2VC 2O9KA 4PBYA 4XYHA 3IJ0A 4IMMA 3SFZA 3IJ1A 1N6FA 2PM7B 4E54A 3SBQA 3EU7A 3OL2B 2CNXA 2AQ5A 3PSLA 2OVPB 3CFVA 4G56B 3A0FA 4JT5C 1JJUB 2P9NC 5IJ7E 4J8GA 3BG0A 3V7DB 4FA1D 5H1MA 2QXVA 5THAA 4HDJA 5K19A 4K3JB 5EARA 5CXBA 2XU7A 4GM3A 5TDHB 3B7FA 4ERQA 5CXCA 2I3SA 5TEFA 3NVXA 4ZOVA 4XYIA 3KRXB 5HE3B 4O9DA 4H5IA 3RFHA 4CI3A 3F3FA 5IJ8E 5KDOB 2B5MA 4JSXC 1VYHC 4E5ZA 2H6QA 2OJYA 4GZ8A 4EWRA 4KFMB 1Q47A 4L9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AGW A;  4CI2 A;  2YBA A;  4MK0 B;  5HE1 B;  3OL2 A;  4GQ1 A;  2AGL A;  4A7J A;  4A2M A;  4J81 A;  3UR4 A;  2OIZ A;  3PSC B;  5GMK n;  2YNN A;  2P9S C;  4JSV C;  2CN2 A;  3EWE A;  4TZ4 A;  4J87 A;  1PBY B;  4JSN C;  2Z2N A;  4J86 A;  5TEE A;  3RMZ D;  4GQB B;  5IC7 A;  1SQJ A;  3ORV D;  2IUR A;  4JSP C;  4UI9 R;  3AL8 B;  3K26 A;  2PM9 B;  4CZV A;  3MXX A;  2B5L A;  3DM0 A;  4J0W A;  4JD2 C;  3SN6 B;  3DXM C;  3V9F A;  4XEI C;  4CI1 A;  4N14 A;  2EBS A;  3SJL D;  2GC7 A;  2G99 A;  4BL0 A;  2TRC B;  3L4M D;  4A08 B;  3ZWL B;  4CY5 A;  2CN3 A;  4A09 B;  1XHM A;  3W15 A;  3DWL C;  3JRO A;  4AOW A;  3PXW D;  3RRM C;  5FKT A;  4FHL A;  4ZN4 A;  4FA9 D;  3EMH A;  5AFU 3;  2I0R A;  4J0X A;  4BH6 A;  2IUQ A;  1JOF A;  2XL3 A;  2UZY B;  4JT6 C;  4X61 B;  5AMS A;  3I89 A;  3UVN A;  2PM6 B;  3SVW D;  4ZOX A;  3EI2 B;  3MKS B;  1FWX A;  3MZL A;  5FKS A;  3CIK B;  3FGB A;  5HQG A;  5FLX g;  4J78 A;  3PE7 A;  3AL8 A;  2PM9 A;  2HKR A;  4PSW B;  2H6K A;  3I8E A;  4GGC A;  3RSE C;  1JMZ B;  4A08 A;  2HES X;  4A09 A;  1XKS A;  3F3G A;  2H9N A;  5HYN B;  5FXY A;  3IJC A;  1QNI A;  5EAP A;  3VH0 A;  3SCY A;  4QT8 A;  2P9P C;  4JXM A;  3V5W B;  1GP2 B;  3UVO A;  4OZU A;  4A11 B;  5FKR A;  2GNQ A;  1SHY B;  4J73 A;  1GOT B;  4J84 A;  3JZH A;  4PSX B;  3EI2 A;  2YMU A;  3VGZ A;  1K8K C;  4QRJ A;  5FKQ A;  4L1Q D;  5H17 A;  2HKM A;  2B4E A;  3UVL A;  2HYE A;  3KRW B;  4GM8 A;  4K3I D;  3UKU C;  3L4O D;  4IA9 A;  5IGO A;  4J77 A;  1S4U X;  3SMR A;  1OMW B;  4LG8 A;  5C2V B;  3I2N A;  2J57 G;  5SXM A;  5GXI A;  3SLE D;  3DSM A;  1SQ9 A;  3IKO A;  4LGN A;  4QL1 A;  2P9I C;  4AEZ A;  4FWW A;  3OTT A;  4BUJ C;  2XL2 A;  3UKR C;  2P9L C;  3FM0 A;  3RFG A;  4CZX A;  4J79 A;  1GXR A;  4GQ2 P;  2IWK A;  1TYQ C;  4D6V A;  5A2Q g;  3C99 A;  2XYI A;  3SXT D;  4J8B A;  5K1C C;  2I3T A;  3AH8 B;  2Z2O A;  2H6N A;  3VA6 A;  4Y5R D;  4A11 A;  2OK6 A;  3SBP A;  3BWS A;  3GRE A;  1A0R B;  4ERY A;  4L3H D;  3OKY B;  2YB8 B;  5CYK B;  5I5M A;  2H68 A;  3CFS B;  2UZX B;  3HFQ A;  3EG6 A;  5EMJ B;  4J82 A;  1MG3 A;  1N6E A;  1N6D A;  3NVQ A;  2MTA H;  4O3T B;  3IIY A;  2H9L A;  2H9M A;  1B9Y A;  3ODT A;  2G9A A;  5EAL A;  2GC4 A;  3AFC A;  3DXK C;  5GXH A;  5GSA A;  4ERZ A;  2PBI B;  2H47 A;  5I5J A;  3F3P A;  3SWS D;  5EMM B;  5EML B;  2I0T A;  3I7K A;  2Z2P A;  4PXW A;  4FA4 D;  4O45 A;  1YFQ A;  1U4C A;  4NSX A;  2BCJ B;  2AGZ A;  3OKY A;  5CYK A;  1PI6 A;  2H9P A;  2AGX A;  4O3U B;  4X60 B;  3JRP A;  3MMY A;  3GFC A;  1XIP A;  3I7L A;  3MKQ A;  4GMB A;  3C5M A;  1K32 A;  2H3X A;  5IGQ A;  3BG1 A;  5I5I A;  2CO0 A;  3JZG A;  2J55 H;  4CY2 A;  4A0A A;  4YVD A;  5FQD A;  5IT9 g;  4U1E I;  3OKT A;  5HE2 B;  3MZK A;  4FB1 D;  4PBZ A;  2IUP A;  3I7O A;  1P22 A;  5EM2 B;  5HE0 B;  2P9U C;  1MDA H;  4U7A A;  3RLM D;  3NVN A;  4GGD A;  2IWF A;  4CI8 A;  5EMK B;  2AH0 A;  4GM9 A;  2AGY A;  4Z8L A;  1NR0 A;  3JB9 L;  3I8C A;  4Y7R A;  1GG2 B;  1RI6 A;  1L0Q A;  2HXC A;  3PXS D;  4PC0 A;  2H14 A;  3PVW B;  4FAV D;  4ZOY A;  3EI4 B;  4OWR A;  3EI3 B;  3PXT D;  4X63 B;  5B4W A;  3RN0 D;  2CO0 C;  3C75 H;  4ES0 A;  3J80 g;  4X3E A;  3JZN A;  4O1Q D;  2OVQ B;  3RN1 D;  3EI1 B;  2YNO A;  4CC9 A;  3N0D A;  4ESG A;  3P4F A;  3FRX A;  4A0B B;  2HJB A;  2IUV A;  4A2L A;  2H13 A;  4QQE A;  1OLZ A;  4FA5 D;  5FA5 B;  2W18 A;  5H14 A;  2YNP A;  3OKW A;  1TBG A;  5C9Z B;  1PEV A;  1JMX B;  5EAM A;  2QC5 A;  2IAA A;  5EM2 A;  3UVK A;  4ZOZ A;  2J56 H;  3SHF A;  2Q7Q A;  4E54 B;  3SBR A;  3U4Y A;  3I7H A;  4L3G D;  2OVR B;  2P9K C;  3IIW A;  5AJA A;  3UVM A;  4A0A B;  1B9X A;  4CZY A;  4I79 A;  3ULE C;  3E0C A;  2CE8 A;  3I7P A;  3EI4 A;  1NEX B;  3EI3 A;  4CY3 A;  1PGU A;  2BBK H;  2HJ4 A;  5JWZ A;  5C2W B;  3J81 g;  3JPX A;  3N0E A;  5CXB B;  5TF2 A;  3K27 A;  1R5M A;  2AH1 A;  3EI1 A;  5CXC B;  4GGA A;  3I7N A;  4A0B A;  1MG2 A;  4FAN D;  3JAM g;  4CY1 A;  2B5N A;  3C9C A;  3OW8 A;  3AL9 A;  4LG9 A;  4R7A B;  2I0S A;  4E5Z B;  1ERJ A;  4PNK B;  4D0K A;  2CE9 A;  2OK4 A;  4H5J A;  3PVU B;  1U2V C;  2O9K A;  4PBY A;  4XYH A;  3IJ0 A;  4IMM A;  3SFZ A;  3IJ1 A;  1N6F A;  2PM7 B;  4E54 A;  3SBQ A;  3EU7 A;  3OL2 B;  2CNX A;  2AQ5 A;  3PSL A;  2OVP B;  3CFV A;  4G56 B;  3A0F A;  4JT5 C;  1JJU B;  2P9N C;  5IJ7 E;  4J8G A;  3BG0 A;  3V7D B;  4FA1 D;  5H1M A;  2QXV A;  5THA A;  4HDJ A;  5K19 A;  4K3J B;  5EAR A;  5CXB A;  2XU7 A;  4GM3 A;  5TDH B;  3B7F A;  4ERQ A;  5CXC A;  2I3S A;  5TEF A;  3NVX A;  4ZOV A;  4XYI A;  3KRX B;  5HE3 B;  4O9D A;  4H5I A;  3RFH A;  4CI3 A;  3F3F A;  5IJ8 E;  5KDO B;  2B5M A;  4JSX C;  1VYH C;  4E5Z A;  2H6Q A;  2OJY A;  4GZ8 A;  4EWR A;  4KFM B;  1Q47 A;  4L9O A; 
#chains in the Genus database with same CATH topology
 4AMY A;  2AGW A;  4CI2 A;  2YBA A;  4MK0 B;  5HE1 B;  3OL2 A;  4GQ1 A;  5E6U A;  2AGL A;  4D9S A;  4A7J A;  4A2M A;  4J81 A;  2VDR A;  3UR4 A;  2OIZ A;  3PSC B;  5GMK n;  2YNN A;  2P9S C;  4JSV C;  2CN2 A;  3EWE A;  4TZ4 A;  4J87 A;  1PBY B;  4JSN C;  1L5G A;  2Z2N A;  3IUM A;  4J86 A;  5M61 A;  5TEE A;  3RMZ D;  2HU7 A;  1GOH A;  4GQB B;  5IC7 A;  1SQJ A;  4JHN A;  3ORV D;  2IUR A;  4JSP C;  4UI9 R;  3AL8 B;  3K26 A;  2PM9 B;  4CZV A;  3MXX A;  3IUN A;  2B5L A;  3DM0 A;  4J0W A;  4IRZ A;  4JD2 C;  3DXM C;  4O02 A;  3SN6 B;  4XEI C;  3V9F A;  4WJK A;  5C92 A;  3NID A;  4CI1 A;  4N14 A;  2EBS A;  3SJL D;  2GC7 A;  2G99 A;  4BL0 A;  2TRC B;  3L4M D;  4A08 B;  1C9L A;  3ZWL B;  4CY5 A;  2CN3 A;  4A09 B;  1XHM A;  3W15 A;  3DWL C;  3JRO A;  4AOW A;  3PXW D;  3RRM C;  5FKT A;  1H2Z A;  4FHL A;  1U8C A;  5FFO A;  4ZN4 A;  4FA9 D;  3EMH A;  5AFU 3;  2I0R A;  4J0X A;  3V4V A;  4BH6 A;  2IUQ A;  1H2X A;  1JOF A;  2XL3 A;  2UZY B;  4JT6 C;  4X61 B;  5AMS A;  3I89 A;  3UVN A;  2PM6 B;  3IVM A;  3O4J A;  3SVW D;  4ZOX A;  3EI2 B;  3MKS B;  1FWX A;  3MZL A;  1UOO A;  5FKS A;  3CIK B;  3FGB A;  5HQG A;  5FLX g;  4J78 A;  3PE7 A;  2HU5 A;  3EQ9 A;  1H2W A;  1BPO A;  3AL8 A;  2PM9 A;  2HKR A;  4PSW B;  2H6K A;  3I8E A;  4GGC A;  3RSE C;  1JMZ B;  4A08 A;  2HES X;  4A09 A;  1XKS A;  3F3G A;  3MUO A;  2H9N A;  5HYN B;  5FXY A;  3IJC A;  1QNI A;  5EAP A;  3VH0 A;  4UM8 A;  3SCY A;  4QT8 A;  2P9P C;  4JXM A;  1I2M B;  4G1M A;  2XE4 A;  3V5W B;  4DNW A;  4G1E A;  1GP2 B;  3UVO A;  4Z7N A;  1C9I A;  4OZU A;  4A11 B;  4JHP C;  5FKR A;  4UM9 A;  5M5R A;  2VDM A;  2GNQ A;  2VDK A;  3VI3 A;  1SHY B;  4J73 A;  1VZ3 A;  1GOT B;  4J84 A;  3JZH A;  4PSX B;  3EI2 A;  2YMU A;  3VGZ A;  5M5T A;  3IUJ A;  1K8K C;  4QRJ A;  5FKQ A;  4L1Q D;  4NEN A;  5H17 A;  2HKM A;  2B4E A;  3UVL A;  2HYE A;  3KRW B;  4GM8 A;  4K3I D;  3UKU C;  3L4O D;  4IA9 A;  5IGO A;  4J77 A;  1S4U X;  3OF7 A;  3SMR A;  1OMW B;  3FCU A;  4LG8 A;  5C2V B;  3I2N A;  1VE6 A;  2J57 G;  5SXM A;  5GXI A;  3SLE D;  3DSM A;  1SQ9 A;  2VDP A;  4DNU A;  3IKO A;  4LGN A;  4QL1 A;  4BP9 A;  2QZP A;  2P9I C;  4AEZ A;  4FWW A;  2QR5 A;  4WK0 A;  3OTT A;  4BUJ C;  2XL2 A;  2VDL A;  5M5U A;  3UKR C;  2P9L C;  3FM0 A;  3RFG A;  4CZX A;  4J79 A;  1GXR A;  2VZ1 A;  2WQ8 A;  4GQ2 P;  3K72 A;  2IWK A;  3O4I A;  1TYQ C;  4D6V A;  5A2Q g;  3C99 A;  2XYI A;  3KCI A;  3SXT D;  4J8B A;  5K1C C;  2I3T A;  3AH8 B;  2Z2O A;  1E8N A;  4MMZ A;  2H6N A;  3VA6 A;  4Y5R D;  4A11 A;  4AN1 A;  2OK6 A;  3NIF A;  3SBP A;  3BWS A;  2XDW A;  3GRE A;  3ZE0 A;  1A0R B;  4ERY A;  4L3H D;  3OKY B;  2YB8 B;  5CYK B;  5I5M A;  2H68 A;  1H2Y A;  3CFS B;  2UZX B;  3HFQ A;  4RE5 A;  3EG6 A;  4NBM A;  4J82 A;  5EMJ B;  2VZ3 A;  1MG3 A;  3QI0 A;  4G55 A;  1N6E A;  1N6D A;  2EIB A;  5FFG A;  3NVQ A;  2MTA H;  4O3T B;  3IIY A;  2H9L A;  4DNV A;  2H9M A;  1E5T A;  1B9Y A;  3ODT A;  2G9A A;  5EAL A;  4WK2 A;  1E8M A;  2GC4 A;  5E6S A;  4MMX A;  3AFC A;  2VDN A;  4BCB A;  3DXK C;  5GXH A;  2XZG A;  5GSA A;  4ERZ A;  2PBI B;  2H47 A;  5I5J A;  1GOG A;  3F3P A;  3SWS D;  5EMM B;  5EML B;  2I0T A;  3I7K A;  1YR2 A;  3K71 A;  2Z2P A;  4PXW A;  4L1M A;  4FA4 D;  4NAA A;  4O45 A;  3EQ7 A;  1YFQ A;  4AMZ A;  1GOF A;  1U4C A;  4QAM A;  4NSX A;  2BCJ B;  3ZDX A;  2AGZ A;  3OKY A;  5CYK A;  1PI6 A;  1T2X A;  2H9P A;  2AGX A;  4O3U B;  4X60 B;  3JRP A;  3MMY A;  3GFC A;  1XIP A;  3I7L A;  3MKQ A;  4GMB A;  3C5M A;  1K32 A;  2H3X A;  5IGQ A;  3BG1 A;  4Z7Q A;  5I5I A;  2CO0 A;  3JZG A;  2J55 H;  4CY2 A;  4A0A A;  4YVD A;  5FQD A;  5IT9 g;  4BCD A;  4U1E I;  3OKT A;  3O4G A;  5HE2 B;  3MZK A;  4FB1 D;  4PBZ A;  2IUP A;  3I7O A;  1P22 A;  2BKL A;  5EM2 B;  5HE0 B;  2P9U C;  1MDA H;  4U7A A;  3RLM D;  3NVN A;  4GGD A;  2IWF A;  4CI8 A;  5EMK B;  1K3I A;  2AH0 A;  4GM9 A;  2AGY A;  4Z8L A;  1NR0 A;  1JV2 A;  3JB9 L;  3I8C A;  3T3P A;  4Y7R A;  1GG2 B;  1RI6 A;  1L0Q A;  2HXC A;  3PXS D;  4PC0 A;  2H14 A;  3PVW B;  4FAV D;  4ZOY A;  1O6F A;  3FCS A;  3EI4 B;  4OWR A;  5C86 A;  1TYE A;  3EI3 B;  3PXT D;  4X63 B;  5B4W A;  3RN0 D;  4RE6 A;  2CO0 C;  2VDO A;  3C75 H;  3ZDZ A;  4ES0 A;  3J80 g;  4X3E A;  1A12 A;  3JZN A;  3T3M A;  4O1Q D;  2OVQ B;  3RN1 D;  3EI1 B;  1QFS A;  2YNO A;  4CC9 A;  3N0D A;  4ESG A;  3P4F A;  2HU8 A;  3FRX A;  4A0B B;  2HJB A;  2IUV A;  4A2L A;  2H13 A;  4QQE A;  1M1X A;  1OLZ A;  4AX4 A;  4FA5 D;  5FA5 B;  3K6S A;  2W18 A;  5HDB A;  5H14 A;  2YNP A;  4WK4 A;  3OKW A;  1TBG A;  3IUQ A;  5C9Z B;  1PEV A;  3MUN A;  1JMX B;  5EAM A;  2QC5 A;  2IAA A;  5EM2 A;  3UVK A;  4ZOZ A;  2J56 H;  3SHF A;  2Q7Q A;  4E54 B;  3SBR A;  3U4Y A;  3I7H A;  4L3G D;  2OVR B;  3IJE A;  3NIG A;  2P9K C;  3IIW A;  5AJA A;  3UVM A;  4A0A B;  1B9X A;  4CZY A;  4I79 A;  3ULE C;  2EIE A;  3EQ8 A;  3E0C A;  2CE8 A;  2EID A;  3I7P A;  3EI4 A;  1NEX B;  3EI3 A;  2VDQ A;  4CY3 A;  1PGU A;  2BBK H;  2HJ4 A;  5JWZ A;  5C2W B;  3J81 g;  4AN0 A;  3JPX A;  3N0E A;  5CXB B;  1UTC A;  5TF2 A;  3K27 A;  3ZE2 A;  3VI4 A;  1R5M A;  2AH1 A;  3EI1 A;  5CXC B;  4GGA A;  5M5S A;  3I7N A;  2JKX A;  4O2W A;  4A0B A;  1MG2 A;  1O6G A;  4BCC A;  4FAN D;  3JAM g;  4CY1 A;  2B5N A;  3C9C A;  3OW8 A;  3AL9 A;  4LG9 A;  4R7A B;  2I0S A;  1VZ2 A;  1ERJ A;  4E5Z B;  4PNK B;  4D0K A;  2CE9 A;  2OK4 A;  4H5J A;  4MMY A;  3PVU B;  1QFM A;  1U2V C;  2O9K A;  4PBY A;  4XYH A;  3IJ0 A;  4IMM A;  3SFZ A;  3IJ1 A;  1N6F A;  2PM7 B;  4E54 A;  3O4H A;  3SBQ A;  3EU7 A;  3OL2 B;  4NC4 A;  2CNX A;  2AQ5 A;  3PSL A;  3DDU A;  4Z7O A;  2OVP B;  3CFV A;  4G56 B;  3A0F A;  4JT5 C;  3ZDY A;  3MVD K;  1JJU B;  2P9N C;  4BP8 A;  5IJ7 E;  4J8G A;  3BG0 A;  3GC3 B;  3V7D B;  3GD1 I;  2EIC A;  4FA1 D;  5H1M A;  3V4P A;  2QXV A;  5THA A;  3IUL A;  5M5V A;  4HDJ A;  5K19 A;  1JTD B;  4K3J B;  5EAR A;  5CXB A;  2XU7 A;  4GM3 A;  5TDH B;  3B7F A;  4ERQ A;  5CXC A;  2I3S A;  5TEF A;  5E6R A;  3NVX A;  4ZOV A;  4XYI A;  3IUR A;  3KRX B;  5HE3 B;  3QHY B;  4O9D A;  3ZE1 A;  4H5I A;  1UOP A;  1VE7 A;  3RFH A;  4CI3 A;  3F3F A;  5IJ8 E;  2VC2 A;  1UOQ A;  5KDO B;  2B5M A;  4JSX C;  1VYH C;  4E5Z A;  2H6Q A;  2OJY A;  4GZ8 A;  4EWR A;  4KFM B;  1Q47 A;  4L9O A; 
#chains in the Genus database with same CATH homology
 2AGW A;  4CI2 A;  2YBA A;  4MK0 B;  5HE1 B;  3OL2 A;  4GQ1 A;  2AGL A;  4A7J A;  4A2M A;  4J81 A;  3UR4 A;  2OIZ A;  3PSC B;  5GMK n;  2YNN A;  2P9S C;  4JSV C;  2CN2 A;  3EWE A;  4TZ4 A;  4J87 A;  1PBY B;  4JSN C;  2Z2N A;  4J86 A;  5TEE A;  3RMZ D;  4GQB B;  5IC7 A;  1SQJ A;  3ORV D;  2IUR A;  4JSP C;  4UI9 R;  3AL8 B;  3K26 A;  2PM9 B;  4CZV A;  3MXX A;  2B5L A;  3DM0 A;  4J0W A;  4JD2 C;  3SN6 B;  3DXM C;  3V9F A;  4XEI C;  4CI1 A;  4N14 A;  2EBS A;  3SJL D;  2GC7 A;  2G99 A;  4BL0 A;  2TRC B;  3L4M D;  4A08 B;  3ZWL B;  4CY5 A;  2CN3 A;  4A09 B;  1XHM A;  3W15 A;  3DWL C;  3JRO A;  4AOW A;  3PXW D;  3RRM C;  5FKT A;  4FHL A;  4ZN4 A;  4FA9 D;  3EMH A;  5AFU 3;  2I0R A;  4J0X A;  4BH6 A;  2IUQ A;  1JOF A;  2XL3 A;  2UZY B;  4JT6 C;  4X61 B;  5AMS A;  3I89 A;  3UVN A;  2PM6 B;  3SVW D;  4ZOX A;  3EI2 B;  3MKS B;  1FWX A;  3MZL A;  5FKS A;  3CIK B;  3FGB A;  5HQG A;  5FLX g;  4J78 A;  3PE7 A;  3AL8 A;  2PM9 A;  2HKR A;  4PSW B;  2H6K A;  3I8E A;  4GGC A;  3RSE C;  1JMZ B;  4A08 A;  2HES X;  4A09 A;  1XKS A;  3F3G A;  2H9N A;  5HYN B;  5FXY A;  3IJC A;  1QNI A;  5EAP A;  3VH0 A;  3SCY A;  4QT8 A;  2P9P C;  4JXM A;  3V5W B;  1GP2 B;  3UVO A;  4OZU A;  4A11 B;  5FKR A;  2GNQ A;  1SHY B;  4J73 A;  1GOT B;  4J84 A;  3JZH A;  4PSX B;  3EI2 A;  2YMU A;  3VGZ A;  1K8K C;  4QRJ A;  5FKQ A;  4L1Q D;  5H17 A;  2HKM A;  2B4E A;  3UVL A;  2HYE A;  3KRW B;  4GM8 A;  4K3I D;  3UKU C;  3L4O D;  4IA9 A;  5IGO A;  4J77 A;  1S4U X;  3SMR A;  1OMW B;  4LG8 A;  5C2V B;  3I2N A;  2J57 G;  5SXM A;  5GXI A;  3SLE D;  3DSM A;  1SQ9 A;  3IKO A;  4LGN A;  4QL1 A;  2P9I C;  4AEZ A;  4FWW A;  3OTT A;  4BUJ C;  2XL2 A;  3UKR C;  2P9L C;  3FM0 A;  3RFG A;  4CZX A;  4J79 A;  1GXR A;  4GQ2 P;  2IWK A;  1TYQ C;  4D6V A;  5A2Q g;  3C99 A;  2XYI A;  3SXT D;  4J8B A;  5K1C C;  2I3T A;  3AH8 B;  2Z2O A;  2H6N A;  3VA6 A;  4Y5R D;  4A11 A;  2OK6 A;  3SBP A;  3BWS A;  3GRE A;  1A0R B;  4ERY A;  4L3H D;  3OKY B;  2YB8 B;  5CYK B;  5I5M A;  2H68 A;  3CFS B;  2UZX B;  3HFQ A;  3EG6 A;  5EMJ B;  4J82 A;  1MG3 A;  1N6E A;  1N6D A;  3NVQ A;  2MTA H;  4O3T B;  3IIY A;  2H9L A;  2H9M A;  1B9Y A;  3ODT A;  2G9A A;  5EAL A;  2GC4 A;  3AFC A;  3DXK C;  5GXH A;  5GSA A;  4ERZ A;  2PBI B;  2H47 A;  5I5J A;  3F3P A;  3SWS D;  5EMM B;  5EML B;  2I0T A;  3I7K A;  2Z2P A;  4PXW A;  4FA4 D;  4O45 A;  1YFQ A;  1U4C A;  4NSX A;  2BCJ B;  2AGZ A;  3OKY A;  5CYK A;  1PI6 A;  2H9P A;  2AGX A;  4O3U B;  4X60 B;  3JRP A;  3MMY A;  3GFC A;  1XIP A;  3I7L A;  3MKQ A;  4GMB A;  3C5M A;  1K32 A;  2H3X A;  5IGQ A;  3BG1 A;  5I5I A;  2CO0 A;  3JZG A;  2J55 H;  4CY2 A;  4A0A A;  4YVD A;  5FQD A;  5IT9 g;  4U1E I;  3OKT A;  5HE2 B;  3MZK A;  4FB1 D;  4PBZ A;  2IUP A;  3I7O A;  1P22 A;  5EM2 B;  5HE0 B;  2P9U C;  1MDA H;  4U7A A;  3RLM D;  3NVN A;  4GGD A;  2IWF A;  4CI8 A;  5EMK B;  2AH0 A;  4GM9 A;  2AGY A;  4Z8L A;  1NR0 A;  3JB9 L;  3I8C A;  4Y7R A;  1GG2 B;  1RI6 A;  1L0Q A;  2HXC A;  3PXS D;  4PC0 A;  2H14 A;  3PVW B;  4FAV D;  4ZOY A;  3EI4 B;  4OWR A;  3EI3 B;  3PXT D;  4X63 B;  5B4W A;  3RN0 D;  2CO0 C;  3C75 H;  4ES0 A;  3J80 g;  4X3E A;  3JZN A;  4O1Q D;  2OVQ B;  3RN1 D;  3EI1 B;  2YNO A;  4CC9 A;  3N0D A;  4ESG A;  3P4F A;  3FRX A;  4A0B B;  2HJB A;  2IUV A;  4A2L A;  2H13 A;  4QQE A;  1OLZ A;  4FA5 D;  5FA5 B;  2W18 A;  5H14 A;  2YNP A;  3OKW A;  1TBG A;  5C9Z B;  1PEV A;  1JMX B;  5EAM A;  2QC5 A;  2IAA A;  5EM2 A;  3UVK A;  4ZOZ A;  2J56 H;  3SHF A;  2Q7Q A;  4E54 B;  3SBR A;  3U4Y A;  3I7H A;  4L3G D;  2OVR B;  2P9K C;  3IIW A;  5AJA A;  3UVM A;  4A0A B;  1B9X A;  4CZY A;  4I79 A;  3ULE C;  3E0C A;  2CE8 A;  3I7P A;  3EI4 A;  1NEX B;  3EI3 A;  4CY3 A;  1PGU A;  2BBK H;  2HJ4 A;  5JWZ A;  5C2W B;  3J81 g;  3JPX A;  3N0E A;  5CXB B;  5TF2 A;  3K27 A;  1R5M A;  2AH1 A;  3EI1 A;  5CXC B;  4GGA A;  3I7N A;  4A0B A;  1MG2 A;  4FAN D;  3JAM g;  4CY1 A;  2B5N A;  3C9C A;  3OW8 A;  3AL9 A;  4LG9 A;  4R7A B;  2I0S A;  4E5Z B;  1ERJ A;  4PNK B;  4D0K A;  2CE9 A;  2OK4 A;  4H5J A;  3PVU B;  1U2V C;  2O9K A;  4PBY A;  4XYH A;  3IJ0 A;  4IMM A;  3SFZ A;  3IJ1 A;  1N6F A;  2PM7 B;  4E54 A;  3SBQ A;  3EU7 A;  3OL2 B;  2CNX A;  2AQ5 A;  3PSL A;  2OVP B;  3CFV A;  4G56 B;  3A0F A;  4JT5 C;  1JJU B;  2P9N C;  5IJ7 E;  4J8G A;  3BG0 A;  3V7D B;  4FA1 D;  5H1M A;  2QXV A;  5THA A;  4HDJ A;  5K19 A;  4K3J B;  5EAR A;  5CXB A;  2XU7 A;  4GM3 A;  5TDH B;  3B7F A;  4ERQ A;  5CXC A;  2I3S A;  5TEF A;  3NVX A;  4ZOV A;  4XYI A;  3KRX B;  5HE3 B;  4O9D A;  4H5I A;  3RFH A;  4CI3 A;  3F3F A;  5IJ8 E;  5KDO B;  2B5M A;  4JSX C;  1VYH C;  4E5Z A;  2H6Q A;  2OJY A;  4GZ8 A;  4EWR A;  4KFM B;  1Q47 A;  4L9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...