3RN1D

Crystal structure of the w199e-maug/pre-methylamine dehydrogenase complex
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords Methylamine utilization protein MauG
publication title Mutagenesis of tryptophan199 reveals that electron hopping is required for MauG-dependent tryptophan tryptophylquinone biosynthesis
rcsb
source organism Paracoccus denitrificans
total genus 93
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2011-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3rn1D00
2H68A 4J8GA 5GXIA 2TRCB 3EU7A 3NVQA 4GM8A 3RMZD 4D6VA 4ZOXA 5HYNB 5H17A 4I79A 2J55H 3IKOA 3SLED 4ZOVA 4X63B 2BCJB 3RN1D 3EI2A 3N0EA 2QC5A 1NEXB 3IIWA 4XYIA 3MKSB 3F3GA 3MXXA 2CE9A 4GZ8A 4QQEA 3RFHA 4AEZA 4JD2C 1U2VC 3CIKB 1Q47A 4N14A 1MG3A 1U4CA 4CY1A 4J87A 2H14A 1SQ9A 3OL2A 4CI3A 5AJAA 4A0BB 4HDJA 5GMKn 1PEVA 3OKYB 5I5JA 2AH1A 4J82A 4JSXC 2OIZA 4ERZA 5EMKB 3JZNA 3UVNA 4E54A 2H6QA 3DSMA 5TEEA 3VH0A 4MK0B 4J79A 4JSVC 4O3TB 5JWZA 5EMJB 4CZYA 4FAVD 1JOFA 5A2Qg 3EI4A 2J56H 4OWRA 2CO0C 4EWRA 4A08B 3SXTD 2W18A 2IWFA 5CXCA 4IA9A 2P9SC 2HJ4A 3PE7A 5FXYA 4JT5C 2GNQA 3SBQA 5HE3B 2I0TA 2OVQB 2HYEA 3C5MA 3FRXA 3RSEC 2PM9A 4XEIC 3I7PA 3BWSA 5K1CC 4LG9A 3JPXA 4QL1A 3PXSD 4J86A 3JROA 2QXVA 3SBRA 2B5LA 3OKTA 3BG1A 3P4FA 2P9NC 2XL3A 3JZGA 5HE2B 2XU7A 4KFMB 2HESX 4FAND 4J0XA 3I89A 4G56B 4E5ZB 3L4OD 5H1MA 4GM3A 5KDOB 4FA4D 5IGQA 3SVWD 1MDAH 4L1QD 4A09B 4K3ID 4A11B 2I0RA 2AH0A 2IAAA 4OZUA 4XYHA 4GMBA 2AQ5A 3EI3B 1L0QA 1R5MA 4ESGA 5FKRA 3EI1A 4TZ4A 3MZLA 1PBYB 3SN6B 3NVXA 1B9XA 1TBGA 3K27A 2B4EA 2J57G 4J78A 3ORVD 3I7OA 3IJ0A 4J8BA 3V5WB 4Y7RA 2YMUA 1XIPA 3EMHA 2IUVA 3CFVA 3PVWB 3DXMC 2IURA 2Q7QA 3F3FA 5FQDA 3CFSB 4CY2A 1MG2A 1K8KC 4FWWA 3AL8B 3F3PA 2Z2OA 2GC4A 3JAMg 3SCYA 3SFZA 2CN2A 4X3EA 2CN3A 2AGWA 4UI9R 2AGZA 3PSLA 4ES0A 4A0BA 3W15A 2HJBA 2HKMA 2OVPB 4LG8A 5TEFA 4X60B 2I3SA 3PSCB 2YNNA 2IUQA 4X61B 5K19A 1XHMA 5C2VB 1N6DA 4FA5D 5SXMA 2H6NA 1YFQA 4CI1A 1N6EA 3DXKC 2P9UC 5B4WA 4A08A 3SBPA 3FM0A 3JB9L 3EWEA 2O9KA 3SHFA 5IJ7E 2H3XA 3JZHA 1OLZA 3SWSD 5GSAA 4GQ1A 3OTTA 4A0AB 2XL2A 4E54B 1FWXA 1XKSA 4L9OA 4K3JB 3PXWD 4L3GD 4BH6A 4U1EI 3K26A 4YVDA 1GP2B 3VGZA 5TDHB 5CXBB 4J73A 4FA9D 2P9IC 2YB8B 5CYKB 2P9PC 3OW8A 5FKTA 5HE1B 1RI6A 3JRPA 1SQJA 4JT6C 3UVLA 4E5ZA 2B5NA 2HKRA 5EM2B 3C9CA 4BUJC 4GQ2P 4O45A 4PSXB 2Z2PA 4CC9A 4FB1D 3N0DA 4A09A 4A11A 5I5MA 4O1QD 3SMRA 3UVOA 2P9KC 3VA6A 4ZOZA 3EI3A 1S4UX 4J84A 2H9LA 3V9FA 4IMMA 5C9ZB 2OK6A 2MTAH 5EMMB 3AH8B 4FHLA 3PVUB 3UKUC 3I8CA 3I7LA 5H14A 3OKWA 5IGOA 2CE8A 2EBSA 5HQGA 2OVRB 4J0WA 1JMZB 2GC7A 4QT8A 3MKQA 3IIYA 2I0SA 5AMSA 1PGUA 4GQBB 2P9LC 4CY3A 2G99A 5EARA 3UVKA 4Z8LA 4ERYA 2H13A 2AGLA 3L4MD 4NSXA 1VYHC 3MZKA 3KRWB 3AL8A 3RFGA 4ZN4A 4JSNC 2CO0A 1NR0A 3EI2B 2IUPA 1GXRA 2AGYA 1N6FA 4LGNA 3I7NA 4CI8A 3ZWLB 1PI6A 4A2MA 3FGBA 2IWKA 2YBAA 4A7JA 2BBKH 3I7HA 5FKQA 3OKYA 3MMYA 1JJUB 3A0FA 1JMXB 4A2LA 2OK4A 4CY5A 2H9MA 4PXWA 1OMWB 2PM7B 2HXCA 5EMLB 4PBZA 2I3TA 4U7AA 4CI2A 4L3HD 4GGDA 5EAMA 2AGXA 5GXHA 2H9NA 3U4YA 1GOTB 3OL2B 5I5IA 5TF2A 5IJ8E 4Y5RD 2G9AA 1QNIA 5IC7A 3I7KA 2H6KA 3AFCA 2H9PA 3EG6A 3AL9A 1TYQC 3B7FA 5THAA 1GG2B 5EALA 2PM6B 4A0AA 4D0KA 5FLXg 2YNOA 2XYIA 3UR4A 3ODTA 3EI4B 3DM0A 3E0CA 4JXMA 4FA1D 1SHYB 3I2NA 3IJ1A 5IT9g 5C2WB 4J77A 2H47A 2PBIB 5CXBA 3KRXB 5CXCB 3V7DB 2Z2NA 4PC0A 5CYKA 3J80g 2CNXA 3PXTD 3RLMD 4R7AB 3GREA 3RRMC 5HE0B 1A0RB 2PM9B 3DWLC 5EM2A 3SJLD 4H5JA 4AOWA 5EAPA 3C75H 1ERJA 4O9DA 4GGCA 5FKSA 3I8EA 5FA5B 4CZXA 3RN0D 2YNPA 4GM9A 4BL0A 4PNKB 3GFCA 4GGAA 4ERQA 3HFQA 1K32A 4CZVA 4ZOYA 4O3UB 3NVNA 4PBYA 3BG0A 4H5IA 3C99A 1P22A 3ULEC 4QRJA 2UZXB 4PSWB 3UVMA 4JSPC 3IJCA 4J81A 1B9YA 3J81g 2OJYA 3EI1B 3UKRC 5AFU3 2UZYB 2B5MA
chains in the Genus database with same CATH superfamily
2H68A 4J8GA 5GXIA 2TRCB 3EU7A 3NVQA 3EQ7A 4MMXA 4GM8A 3VI4A 1VE7A 3RMZD 4D6VA 4ZOXA 5HYNB 1H2WA 5H17A 4I79A 2J55H 3IKOA 2VDQA 3SLED 4ZOVA 4Z7QA 4X63B 2BCJB 3RN1D 4BCDA 3EI2A 4Z7OA 3MUOA 3N0EA 2QC5A 3IURA 1NEXB 5E6RA 4IRZA 2QR5A 3IIWA 4XYIA 3MKSB 3F3GA 3MXXA 2CE9A 4GZ8A 4QQEA 3RFHA 4AEZA 5HDBA 4JD2C 1UOPA 1U2VC 3CIKB 3FCSA 4JHNA 1Q47A 4N14A 1MG3A 1U4CA 4CY1A 4J87A 2JKXA 2H14A 1SQ9A 3OL2A 4CI3A 5AJAA 4A0BB 3O4IA 4HDJA 5GMKn 1PEVA 3OKYB 5I5JA 2AH1A 4J82A 2VDLA 4JSXC 1H2YA 2OIZA 4ERZA 5EMKB 1E5TA 4NC4A 3JZNA 3UVNA 3OF7A 2H6QA 4E54A 3DSMA 5TEEA 3VH0A 4MK0B 4J79A 4JSVC 4O3TB 5JWZA 5EMJB 4CZYA 4FAVD 1JOFA 4UM9A 1H2ZA 1I2MB 3EI4A 5A2Qg 2J56H 4OWRA 2CO0C 4EWRA 4A08B 3SXTD 2W18A 2IWFA 5CXCA 1U8CA 4IA9A 2P9SC 2HJ4A 3PE7A 5FXYA 4JT5C 2HU7A 2GNQA 1O6FA 3DDUA 3SBQA 1YR2A 5HE3B 5E6UA 2I0TA 2OVQB 2HYEA 2XDWA 3C5MA 3FRXA 3RSEC 2PM9A 4XEIC 3I7PA 3BWSA 5K1CC 4LG9A 5E6SA 1C9LA 3JPXA 4QL1A 3PXSD 4J86A 5M5SA 3JROA 2QXVA 3SBRA 2B5LA 3ZE2A 3OKTA 3BG1A 3IUNA 3P4FA 2P9NC 1UOQA 3KCIA 2XL3A 3JZGA 5HE2B 2XU7A 4KFMB 2HESX 4FAND 4J0XA 4UM8A 3I89A 5C92A 4G56B 2WQ8A 4E5ZB 3L4OD 5H1MA 4GM3A 5KDOB 3ZE1A 3T3PA 4FA4D 5IGQA 3SVWD 1MDAH 4L1QD 4A09B 4K3ID 1BPOA 2I0RA 4A11B 2AH0A 2IAAA 2XZGA 4OZUA 5M5VA 4XYHA 4GMBA 2AQ5A 3EI3B 1L0QA 4AMZA 1R5MA 4ESGA 1GOHA 5FKRA 3EI1A 1K3IA 4TZ4A 3MZLA 4DNUA 1PBYB 3SN6B 3NVXA 1B9XA 4O02A 2VDRA 1C9IA 1TBGA 3K27A 2B4EA 2J57G 3QI0A 4BCBA 4J78A 3ORVD 3I7OA 4WK0A 3IJ0A 4J8BA 3V5WB 4Y7RA 2YMUA 1XIPA 1L5GA 3EMHA 2IUVA 3CFVA 3PVWB 3DXMC 2IURA 2Q7QA 3F3FA 4G1EA 5C86A 5FFOA 4O2WA 5FQDA 3CFSB 4CY2A 1MG2A 1K8KC 3V4VA 4FWWA 3AL8B 3F3PA 2Z2OA 2GC4A 3JAMg 3SCYA 3SFZA 2CN2A 4X3EA 2CN3A 2HU5A 2AGWA 4UI9R 2AGZA 3PSLA 2VDOA 4ES0A 3EQ8A 3T3MA 4A0BA 2XE4A 4NENA 3W15A 3FCUA 2HJBA 2HKMA 2OVPB 3NIGA 4LG8A 5TEFA 4X60B 2I3SA 3PSCB 2YNNA 2IUQA 4X61B 5K19A 1UTCA 1XHMA 5C2VB 3ZE0A 1N6DA 4RE6A 5SXMA 1GOGA 4FA5D 1O6GA 3NIDA 2H6NA 1YFQA 3NIFA 4CI1A 1N6EA 3DXKC 3O4GA 2P9UC 5B4WA 4A08A 3SBPA 4MMZA 3FM0A 3JB9L 3EWEA 2O9KA 3SHFA 5IJ7E 2H3XA 3JZHA 1OLZA 3SWSD 5GSAA 4GQ1A 3O4JA 3OTTA 4A0AB 2XL2A 4E54B 4G1MA 1FWXA 1XKSA 4L9OA 1JTDB 4K3JB 3PXWD 4L3GD 4BH6A 4U1EI 4DNWA 3K26A 4YVDA 1GP2B 3VGZA 5TDHB 5CXBB 4J73A 4FA9D 1VZ3A 2P9IC 2YB8B 5CYKB 2P9PC 3OW8A 5FKTA 5HE1B 1RI6A 3JRPA 1SQJA 4JT6C 3UVLA 4E5ZA 4AX4A 2B5NA 2HKRA 5EM2B 3C9CA 4BUJC 4GQ2P 4O45A 4PSXB 2Z2PA 2VZ1A 4CC9A 4FB1D 2EIBA 3N0DA 4A09A 1T2XA 4A11A 1E8NA 5I5MA 4O1QD 3SMRA 3UVOA 2P9KC 3VA6A 4ZOZA 3EI3A 1S4UX 4J84A 2H9LA 4L1MA 3V9FA 3O4HA 4IMMA 5C9ZB 2OK6A 2VZ3A 2MTAH 5FFGA 5EMMB 3AH8B 2BKLA 4FHLA 3PVUB 3UKUC 4WJKA 3I8CA 3I7LA 5H14A 3OKWA 4RE5A 4BP9A 5IGOA 2CE8A 2EBSA 5HQGA 3MVDK 2OVRB 1VZ2A 4J0WA 1JMZB 2VDPA 2GC7A 4QT8A 3MKQA 3IIYA 2I0SA 5AMSA 3GC3B 5M61A 1PGUA 4GQBB 2P9LC 4AMYA 4CY3A 2G99A 5EARA 4NAAA 3UVKA 4Z8LA 3IUQA 3VI3A 4WK4A 4ERYA 2H13A 3L4MD 2AGLA 3MZKA 1VYHC 2EIEA 4NSXA 3KRWB 3AL8A 3RFGA 4ZN4A 4JSNC 2VC2A 1A12A 1VE6A 4NBMA 5M5RA 2CO0A 1NR0A 3EI2B 2IUPA 3K72A 1GXRA 1N6FA 2AGYA 3ZDZA 4LGNA 3I7NA 4CI8A 3ZWLB 3GD1I 1PI6A 2VDKA 3FGBA 4A2MA 2IWKA 2YBAA 4A7JA 1TYEA 2BBKH 3I7HA 5FKQA 3OKYA 3K71A 3MMYA 1JJUB 3A0FA 1JMXB 2EICA 3EQ9A 4A2LA 2OK4A 4CY5A 2H9MA 2VDMA 4PXWA 1OMWB 2PM7B 4G55A 2HXCA 5EMLB 4PBZA 3ZDXA 2I3TA 4U7AA 4CI2A 4L3HD 4GGDA 5EAMA 3IVMA 2AGXA 5GXHA 4WK2A 2H9NA 3U4YA 1GOTB 3OL2B 1QFMA 5I5IA 3K6SA 5TF2A 3QHYB 5IJ8E 4Y5RD 2G9AA 1QNIA 5IC7A 4AN0A 3I7KA 2H6KA 3V4PA 3AFCA 2H9PA 3EG6A 3AL9A 1TYQC 1H2XA 3B7FA 5THAA 1GG2B 5EALA 2PM6B 3MUNA 4A0AA 4D0KA 5FLXg 2YNOA 2XYIA 3UR4A 3ODTA 2EIDA 3EI4B 3DM0A 3E0CA 3IUJA 3IULA 4JXMA 4FA1D 1SHYB 3I2NA 3IJ1A 5IT9g 5C2WB 3IUMA 2H47A 2PBIB 4J77A 3KRXB 5CXBA 5CXCB 3V7DB 4BCCA 2Z2NA 4PC0A 5CYKA 3J80g 2CNXA 3ZDYA 3PXTD 4BP8A 3RLMD 4R7AB 3GREA 3RRMC 4AN1A 5HE0B 1A0RB 2PM9B 3DWLC 1QFSA 5EM2A 4H5JA 3SJLD 5EAPA 4AOWA 3C75H 4D9SA 1ERJA 1JV2A 4MMYA 4O9DA 4GGCA 5FKSA 2QZPA 3I8EA 5FA5B 4CZXA 3RN0D 4QAMA 2YNPA 4GM9A 4BL0A 4PNKB 4Z7NA 4JHPC 3GFCA 4GGAA 4ERQA 5M5TA 3HFQA 1K32A 4CZVA 2HU8A 4ZOYA 3NVNA 2VDNA 4O3UB 4PBYA 3BG0A 4H5IA 3IJEA 3C99A 1P22A 3ULEC 4QRJA 1UOOA 2UZXB 4PSWB 3UVMA 1GOFA 5M5UA 4JSPC 3IJCA 4J81A 1B9YA 3J81g 1M1XA 4DNVA 2OJYA 3EI1B 3UKRC 5AFU3 2UZYB 1E8MA 2B5MA
chains in the Genus database with same CATH topology
2H68A 4J8GA 5GXIA 2TRCB 3EU7A 3NVQA 4GM8A 3RMZD 4D6VA 4ZOXA 5HYNB 5H17A 4I79A 2J55H 3IKOA 3SLED 4ZOVA 4X63B 2BCJB 3RN1D 3EI2A 3N0EA 2QC5A 1NEXB 3IIWA 4XYIA 3MKSB 3F3GA 3MXXA 2CE9A 4GZ8A 4QQEA 3RFHA 4AEZA 4JD2C 1U2VC 3CIKB 1Q47A 4N14A 1MG3A 1U4CA 4CY1A 4J87A 2H14A 1SQ9A 3OL2A 4CI3A 5AJAA 4A0BB 4HDJA 5GMKn 1PEVA 3OKYB 5I5JA 2AH1A 4J82A 4JSXC 2OIZA 4ERZA 5EMKB 3JZNA 3UVNA 4E54A 2H6QA 3DSMA 5TEEA 3VH0A 4MK0B 4J79A 4JSVC 4O3TB 5JWZA 5EMJB 4CZYA 4FAVD 1JOFA 5A2Qg 3EI4A 2J56H 4OWRA 2CO0C 4EWRA 4A08B 3SXTD 2W18A 2IWFA 5CXCA 4IA9A 2P9SC 2HJ4A 3PE7A 5FXYA 4JT5C 2GNQA 3SBQA 5HE3B 2I0TA 2OVQB 2HYEA 3C5MA 3FRXA 3RSEC 2PM9A 4XEIC 3I7PA 3BWSA 5K1CC 4LG9A 3JPXA 4QL1A 3PXSD 4J86A 3JROA 2QXVA 3SBRA 2B5LA 3OKTA 3BG1A 3P4FA 2P9NC 2XL3A 3JZGA 5HE2B 2XU7A 4KFMB 2HESX 4FAND 4J0XA 3I89A 4G56B 4E5ZB 3L4OD 5H1MA 4GM3A 5KDOB 4FA4D 5IGQA 3SVWD 1MDAH 4L1QD 4A09B 4K3ID 4A11B 2I0RA 2AH0A 2IAAA 4OZUA 4XYHA 4GMBA 2AQ5A 3EI3B 1L0QA 1R5MA 4ESGA 5FKRA 3EI1A 4TZ4A 3MZLA 1PBYB 3SN6B 3NVXA 1B9XA 1TBGA 3K27A 2B4EA 2J57G 4J78A 3ORVD 3I7OA 3IJ0A 4J8BA 3V5WB 4Y7RA 2YMUA 1XIPA 3EMHA 2IUVA 3CFVA 3PVWB 3DXMC 2IURA 2Q7QA 3F3FA 5FQDA 3CFSB 4CY2A 1MG2A 1K8KC 4FWWA 3AL8B 3F3PA 2Z2OA 2GC4A 3JAMg 3SCYA 3SFZA 2CN2A 4X3EA 2CN3A 2AGWA 4UI9R 2AGZA 3PSLA 4ES0A 4A0BA 3W15A 2HJBA 2HKMA 2OVPB 4LG8A 5TEFA 4X60B 2I3SA 3PSCB 2YNNA 2IUQA 4X61B 5K19A 1XHMA 5C2VB 1N6DA 4FA5D 5SXMA 2H6NA 1YFQA 4CI1A 1N6EA 3DXKC 2P9UC 5B4WA 4A08A 3SBPA 3FM0A 3JB9L 3EWEA 2O9KA 3SHFA 5IJ7E 2H3XA 3JZHA 1OLZA 3SWSD 5GSAA 4GQ1A 3OTTA 4A0AB 2XL2A 4E54B 1FWXA 1XKSA 4L9OA 4K3JB 3PXWD 4L3GD 4BH6A 4U1EI 3K26A 4YVDA 1GP2B 3VGZA 5TDHB 5CXBB 4J73A 4FA9D 2P9IC 2YB8B 5CYKB 2P9PC 3OW8A 5FKTA 5HE1B 1RI6A 3JRPA 1SQJA 4JT6C 3UVLA 4E5ZA 2B5NA 2HKRA 5EM2B 3C9CA 4BUJC 4GQ2P 4O45A 4PSXB 2Z2PA 4CC9A 4FB1D 3N0DA 4A09A 4A11A 5I5MA 4O1QD 3SMRA 3UVOA 2P9KC 3VA6A 4ZOZA 3EI3A 1S4UX 4J84A 2H9LA 3V9FA 4IMMA 5C9ZB 2OK6A 2MTAH 5EMMB 3AH8B 4FHLA 3PVUB 3UKUC 3I8CA 3I7LA 5H14A 3OKWA 5IGOA 2CE8A 2EBSA 5HQGA 2OVRB 4J0WA 1JMZB 2GC7A 4QT8A 3MKQA 3IIYA 2I0SA 5AMSA 1PGUA 4GQBB 2P9LC 4CY3A 2G99A 5EARA 3UVKA 4Z8LA 4ERYA 2H13A 2AGLA 3L4MD 4NSXA 1VYHC 3MZKA 3KRWB 3AL8A 3RFGA 4ZN4A 4JSNC 2CO0A 1NR0A 3EI2B 2IUPA 1GXRA 2AGYA 1N6FA 4LGNA 3I7NA 4CI8A 3ZWLB 1PI6A 4A2MA 3FGBA 2IWKA 2YBAA 4A7JA 2BBKH 3I7HA 5FKQA 3OKYA 3MMYA 1JJUB 3A0FA 1JMXB 4A2LA 2OK4A 4CY5A 2H9MA 4PXWA 1OMWB 2PM7B 2HXCA 5EMLB 4PBZA 2I3TA 4U7AA 4CI2A 4L3HD 4GGDA 5EAMA 2AGXA 5GXHA 2H9NA 3U4YA 1GOTB 3OL2B 5I5IA 5TF2A 5IJ8E 4Y5RD 2G9AA 1QNIA 5IC7A 3I7KA 2H6KA 3AFCA 2H9PA 3EG6A 3AL9A 1TYQC 3B7FA 5THAA 1GG2B 5EALA 2PM6B 4A0AA 4D0KA 5FLXg 2YNOA 2XYIA 3UR4A 3ODTA 3EI4B 3DM0A 3E0CA 4JXMA 4FA1D 1SHYB 3I2NA 3IJ1A 5IT9g 5C2WB 4J77A 2H47A 2PBIB 5CXBA 3KRXB 5CXCB 3V7DB 2Z2NA 4PC0A 5CYKA 3J80g 2CNXA 3PXTD 3RLMD 4R7AB 3GREA 3RRMC 5HE0B 1A0RB 2PM9B 3DWLC 5EM2A 3SJLD 4H5JA 4AOWA 5EAPA 3C75H 1ERJA 4O9DA 4GGCA 5FKSA 3I8EA 5FA5B 4CZXA 3RN0D 2YNPA 4GM9A 4BL0A 4PNKB 3GFCA 4GGAA 4ERQA 3HFQA 1K32A 4CZVA 4ZOYA 4O3UB 3NVNA 4PBYA 3BG0A 4H5IA 3C99A 1P22A 3ULEC 4QRJA 2UZXB 4PSWB 3UVMA 4JSPC 3IJCA 4J81A 1B9YA 3J81g 2OJYA 3EI1B 3UKRC 5AFU3 2UZYB 2B5MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H68 A;  4J8G A;  5GXI A;  2TRC B;  3EU7 A;  3NVQ A;  4GM8 A;  3RMZ D;  4D6V A;  4ZOX A;  5HYN B;  5H17 A;  4I79 A;  2J55 H;  3IKO A;  3SLE D;  4ZOV A;  4X63 B;  2BCJ B;  3RN1 D;  3EI2 A;  3N0E A;  2QC5 A;  1NEX B;  3IIW A;  4XYI A;  3MKS B;  3F3G A;  3MXX A;  2CE9 A;  4GZ8 A;  4QQE A;  3RFH A;  4AEZ A;  4JD2 C;  1U2V C;  3CIK B;  1Q47 A;  4N14 A;  1MG3 A;  1U4C A;  4CY1 A;  4J87 A;  2H14 A;  1SQ9 A;  3OL2 A;  4CI3 A;  5AJA A;  4A0B B;  4HDJ A;  5GMK n;  1PEV A;  3OKY B;  5I5J A;  2AH1 A;  4J82 A;  4JSX C;  2OIZ A;  4ERZ A;  5EMK B;  3JZN A;  3UVN A;  4E54 A;  2H6Q A;  3DSM A;  5TEE A;  3VH0 A;  4MK0 B;  4J79 A;  4JSV C;  4O3T B;  5JWZ A;  5EMJ B;  4CZY A;  4FAV D;  1JOF A;  5A2Q g;  3EI4 A;  2J56 H;  4OWR A;  2CO0 C;  4EWR A;  4A08 B;  3SXT D;  2W18 A;  2IWF A;  5CXC A;  4IA9 A;  2P9S C;  2HJ4 A;  3PE7 A;  5FXY A;  4JT5 C;  2GNQ A;  3SBQ A;  5HE3 B;  2I0T A;  2OVQ B;  2HYE A;  3C5M A;  3FRX A;  3RSE C;  2PM9 A;  4XEI C;  3I7P A;  3BWS A;  5K1C C;  4LG9 A;  3JPX A;  4QL1 A;  3PXS D;  4J86 A;  3JRO A;  2QXV A;  3SBR A;  2B5L A;  3OKT A;  3BG1 A;  3P4F A;  2P9N C;  2XL3 A;  3JZG A;  5HE2 B;  2XU7 A;  4KFM B;  2HES X;  4FAN D;  4J0X A;  3I89 A;  4G56 B;  4E5Z B;  3L4O D;  5H1M A;  4GM3 A;  5KDO B;  4FA4 D;  5IGQ A;  3SVW D;  1MDA H;  4L1Q D;  4A09 B;  4K3I D;  4A11 B;  2I0R A;  2AH0 A;  2IAA A;  4OZU A;  4XYH A;  4GMB A;  2AQ5 A;  3EI3 B;  1L0Q A;  1R5M A;  4ESG A;  5FKR A;  3EI1 A;  4TZ4 A;  3MZL A;  1PBY B;  3SN6 B;  3NVX A;  1B9X A;  1TBG A;  3K27 A;  2B4E A;  2J57 G;  4J78 A;  3ORV D;  3I7O A;  3IJ0 A;  4J8B A;  3V5W B;  4Y7R A;  2YMU A;  1XIP A;  3EMH A;  2IUV A;  3CFV A;  3PVW B;  3DXM C;  2IUR A;  2Q7Q A;  3F3F A;  5FQD A;  3CFS B;  4CY2 A;  1MG2 A;  1K8K C;  4FWW A;  3AL8 B;  3F3P A;  2Z2O A;  2GC4 A;  3JAM g;  3SCY A;  3SFZ A;  2CN2 A;  4X3E A;  2CN3 A;  2AGW A;  4UI9 R;  2AGZ A;  3PSL A;  4ES0 A;  4A0B A;  3W15 A;  2HJB A;  2HKM A;  2OVP B;  4LG8 A;  5TEF A;  4X60 B;  2I3S A;  3PSC B;  2YNN A;  2IUQ A;  4X61 B;  5K19 A;  1XHM A;  5C2V B;  1N6D A;  4FA5 D;  5SXM A;  2H6N A;  1YFQ A;  4CI1 A;  1N6E A;  3DXK C;  2P9U C;  5B4W A;  4A08 A;  3SBP A;  3FM0 A;  3JB9 L;  3EWE A;  2O9K A;  3SHF A;  5IJ7 E;  2H3X A;  3JZH A;  1OLZ A;  3SWS D;  5GSA A;  4GQ1 A;  3OTT A;  4A0A B;  2XL2 A;  4E54 B;  1FWX A;  1XKS A;  4L9O A;  4K3J B;  3PXW D;  4L3G D;  4BH6 A;  4U1E I;  3K26 A;  4YVD A;  1GP2 B;  3VGZ A;  5TDH B;  5CXB B;  4J73 A;  4FA9 D;  2P9I C;  2YB8 B;  5CYK B;  2P9P C;  3OW8 A;  5FKT A;  5HE1 B;  1RI6 A;  3JRP A;  1SQJ A;  4JT6 C;  3UVL A;  4E5Z A;  2B5N A;  2HKR A;  5EM2 B;  3C9C A;  4BUJ C;  4GQ2 P;  4O45 A;  4PSX B;  2Z2P A;  4CC9 A;  4FB1 D;  3N0D A;  4A09 A;  4A11 A;  5I5M A;  4O1Q D;  3SMR A;  3UVO A;  2P9K C;  3VA6 A;  4ZOZ A;  3EI3 A;  1S4U X;  4J84 A;  2H9L A;  3V9F A;  4IMM A;  5C9Z B;  2OK6 A;  2MTA H;  5EMM B;  3AH8 B;  4FHL A;  3PVU B;  3UKU C;  3I8C A;  3I7L A;  5H14 A;  3OKW A;  5IGO A;  2CE8 A;  2EBS A;  5HQG A;  2OVR B;  4J0W A;  1JMZ B;  2GC7 A;  4QT8 A;  3MKQ A;  3IIY A;  2I0S A;  5AMS A;  1PGU A;  4GQB B;  2P9L C;  4CY3 A;  2G99 A;  5EAR A;  3UVK A;  4Z8L A;  4ERY A;  2H13 A;  2AGL A;  3L4M D;  4NSX A;  1VYH C;  3MZK A;  3KRW B;  3AL8 A;  3RFG A;  4ZN4 A;  4JSN C;  2CO0 A;  1NR0 A;  3EI2 B;  2IUP A;  1GXR A;  2AGY A;  1N6F A;  4LGN A;  3I7N A;  4CI8 A;  3ZWL B;  1PI6 A;  4A2M A;  3FGB A;  2IWK A;  2YBA A;  4A7J A;  2BBK H;  3I7H A;  5FKQ A;  3OKY A;  3MMY A;  1JJU B;  3A0F A;  1JMX B;  4A2L A;  2OK4 A;  4CY5 A;  2H9M A;  4PXW A;  1OMW B;  2PM7 B;  2HXC A;  5EML B;  4PBZ A;  2I3T A;  4U7A A;  4CI2 A;  4L3H D;  4GGD A;  5EAM A;  2AGX A;  5GXH A;  2H9N A;  3U4Y A;  1GOT B;  3OL2 B;  5I5I A;  5TF2 A;  5IJ8 E;  4Y5R D;  2G9A A;  1QNI A;  5IC7 A;  3I7K A;  2H6K A;  3AFC A;  2H9P A;  3EG6 A;  3AL9 A;  1TYQ C;  3B7F A;  5THA A;  1GG2 B;  5EAL A;  2PM6 B;  4A0A A;  4D0K A;  5FLX g;  2YNO A;  2XYI A;  3UR4 A;  3ODT A;  3EI4 B;  3DM0 A;  3E0C A;  4JXM A;  4FA1 D;  1SHY B;  3I2N A;  3IJ1 A;  5IT9 g;  5C2W B;  4J77 A;  2H47 A;  2PBI B;  5CXB A;  3KRX B;  5CXC B;  3V7D B;  2Z2N A;  4PC0 A;  5CYK A;  3J80 g;  2CNX A;  3PXT D;  3RLM D;  4R7A B;  3GRE A;  3RRM C;  5HE0 B;  1A0R B;  2PM9 B;  3DWL C;  5EM2 A;  3SJL D;  4H5J A;  4AOW A;  5EAP A;  3C75 H;  1ERJ A;  4O9D A;  4GGC A;  5FKS A;  3I8E A;  5FA5 B;  4CZX A;  3RN0 D;  2YNP A;  4GM9 A;  4BL0 A;  4PNK B;  3GFC A;  4GGA A;  4ERQ A;  3HFQ A;  1K32 A;  4CZV A;  4ZOY A;  4O3U B;  3NVN A;  4PBY A;  3BG0 A;  4H5I A;  3C99 A;  1P22 A;  3ULE C;  4QRJ A;  2UZX B;  4PSW B;  3UVM A;  4JSP C;  3IJC A;  4J81 A;  1B9Y A;  3J81 g;  2OJY A;  3EI1 B;  3UKR C;  5AFU 3;  2UZY B;  2B5M A; 
#chains in the Genus database with same CATH topology
 2H68 A;  4J8G A;  5GXI A;  2TRC B;  3EU7 A;  3NVQ A;  3EQ7 A;  4MMX A;  4GM8 A;  3VI4 A;  1VE7 A;  3RMZ D;  4D6V A;  4ZOX A;  5HYN B;  1H2W A;  5H17 A;  4I79 A;  2J55 H;  3IKO A;  2VDQ A;  3SLE D;  4ZOV A;  4Z7Q A;  4X63 B;  2BCJ B;  3RN1 D;  4BCD A;  3EI2 A;  4Z7O A;  3MUO A;  3N0E A;  2QC5 A;  3IUR A;  1NEX B;  5E6R A;  4IRZ A;  2QR5 A;  3IIW A;  4XYI A;  3MKS B;  3F3G A;  3MXX A;  2CE9 A;  4GZ8 A;  4QQE A;  3RFH A;  4AEZ A;  5HDB A;  4JD2 C;  1UOP A;  1U2V C;  3CIK B;  3FCS A;  4JHN A;  1Q47 A;  4N14 A;  1MG3 A;  1U4C A;  4CY1 A;  4J87 A;  2JKX A;  2H14 A;  1SQ9 A;  3OL2 A;  4CI3 A;  5AJA A;  4A0B B;  3O4I A;  4HDJ A;  5GMK n;  1PEV A;  3OKY B;  5I5J A;  2AH1 A;  4J82 A;  2VDL A;  4JSX C;  1H2Y A;  2OIZ A;  4ERZ A;  5EMK B;  1E5T A;  4NC4 A;  3JZN A;  3UVN A;  3OF7 A;  2H6Q A;  4E54 A;  3DSM A;  5TEE A;  3VH0 A;  4MK0 B;  4J79 A;  4JSV C;  4O3T B;  5JWZ A;  5EMJ B;  4CZY A;  4FAV D;  1JOF A;  4UM9 A;  1H2Z A;  1I2M B;  3EI4 A;  5A2Q g;  2J56 H;  4OWR A;  2CO0 C;  4EWR A;  4A08 B;  3SXT D;  2W18 A;  2IWF A;  5CXC A;  1U8C A;  4IA9 A;  2P9S C;  2HJ4 A;  3PE7 A;  5FXY A;  4JT5 C;  2HU7 A;  2GNQ A;  1O6F A;  3DDU A;  3SBQ A;  1YR2 A;  5HE3 B;  5E6U A;  2I0T A;  2OVQ B;  2HYE A;  2XDW A;  3C5M A;  3FRX A;  3RSE C;  2PM9 A;  4XEI C;  3I7P A;  3BWS A;  5K1C C;  4LG9 A;  5E6S A;  1C9L A;  3JPX A;  4QL1 A;  3PXS D;  4J86 A;  5M5S A;  3JRO A;  2QXV A;  3SBR A;  2B5L A;  3ZE2 A;  3OKT A;  3BG1 A;  3IUN A;  3P4F A;  2P9N C;  1UOQ A;  3KCI A;  2XL3 A;  3JZG A;  5HE2 B;  2XU7 A;  4KFM B;  2HES X;  4FAN D;  4J0X A;  4UM8 A;  3I89 A;  5C92 A;  4G56 B;  2WQ8 A;  4E5Z B;  3L4O D;  5H1M A;  4GM3 A;  5KDO B;  3ZE1 A;  3T3P A;  4FA4 D;  5IGQ A;  3SVW D;  1MDA H;  4L1Q D;  4A09 B;  4K3I D;  1BPO A;  2I0R A;  4A11 B;  2AH0 A;  2IAA A;  2XZG A;  4OZU A;  5M5V A;  4XYH A;  4GMB A;  2AQ5 A;  3EI3 B;  1L0Q A;  4AMZ A;  1R5M A;  4ESG A;  1GOH A;  5FKR A;  3EI1 A;  1K3I A;  4TZ4 A;  3MZL A;  4DNU A;  1PBY B;  3SN6 B;  3NVX A;  1B9X A;  4O02 A;  2VDR A;  1C9I A;  1TBG A;  3K27 A;  2B4E A;  2J57 G;  3QI0 A;  4BCB A;  4J78 A;  3ORV D;  3I7O A;  4WK0 A;  3IJ0 A;  4J8B A;  3V5W B;  4Y7R A;  2YMU A;  1XIP A;  1L5G A;  3EMH A;  2IUV A;  3CFV A;  3PVW B;  3DXM C;  2IUR A;  2Q7Q A;  3F3F A;  4G1E A;  5C86 A;  5FFO A;  4O2W A;  5FQD A;  3CFS B;  4CY2 A;  1MG2 A;  1K8K C;  3V4V A;  4FWW A;  3AL8 B;  3F3P A;  2Z2O A;  2GC4 A;  3JAM g;  3SCY A;  3SFZ A;  2CN2 A;  4X3E A;  2CN3 A;  2HU5 A;  2AGW A;  4UI9 R;  2AGZ A;  3PSL A;  2VDO A;  4ES0 A;  3EQ8 A;  3T3M A;  4A0B A;  2XE4 A;  4NEN A;  3W15 A;  3FCU A;  2HJB A;  2HKM A;  2OVP B;  3NIG A;  4LG8 A;  5TEF A;  4X60 B;  2I3S A;  3PSC B;  2YNN A;  2IUQ A;  4X61 B;  5K19 A;  1UTC A;  1XHM A;  5C2V B;  3ZE0 A;  1N6D A;  4RE6 A;  5SXM A;  1GOG A;  4FA5 D;  1O6G A;  3NID A;  2H6N A;  1YFQ A;  3NIF A;  4CI1 A;  1N6E A;  3DXK C;  3O4G A;  2P9U C;  5B4W A;  4A08 A;  3SBP A;  4MMZ A;  3FM0 A;  3JB9 L;  3EWE A;  2O9K A;  3SHF A;  5IJ7 E;  2H3X A;  3JZH A;  1OLZ A;  3SWS D;  5GSA A;  4GQ1 A;  3O4J A;  3OTT A;  4A0A B;  2XL2 A;  4E54 B;  4G1M A;  1FWX A;  1XKS A;  4L9O A;  1JTD B;  4K3J B;  3PXW D;  4L3G D;  4BH6 A;  4U1E I;  4DNW A;  3K26 A;  4YVD A;  1GP2 B;  3VGZ A;  5TDH B;  5CXB B;  4J73 A;  4FA9 D;  1VZ3 A;  2P9I C;  2YB8 B;  5CYK B;  2P9P C;  3OW8 A;  5FKT A;  5HE1 B;  1RI6 A;  3JRP A;  1SQJ A;  4JT6 C;  3UVL A;  4E5Z A;  4AX4 A;  2B5N A;  2HKR A;  5EM2 B;  3C9C A;  4BUJ C;  4GQ2 P;  4O45 A;  4PSX B;  2Z2P A;  2VZ1 A;  4CC9 A;  4FB1 D;  2EIB A;  3N0D A;  4A09 A;  1T2X A;  4A11 A;  1E8N A;  5I5M A;  4O1Q D;  3SMR A;  3UVO A;  2P9K C;  3VA6 A;  4ZOZ A;  3EI3 A;  1S4U X;  4J84 A;  2H9L A;  4L1M A;  3V9F A;  3O4H A;  4IMM A;  5C9Z B;  2OK6 A;  2VZ3 A;  2MTA H;  5FFG A;  5EMM B;  3AH8 B;  2BKL A;  4FHL A;  3PVU B;  3UKU C;  4WJK A;  3I8C A;  3I7L A;  5H14 A;  3OKW A;  4RE5 A;  4BP9 A;  5IGO A;  2CE8 A;  2EBS A;  5HQG A;  3MVD K;  2OVR B;  1VZ2 A;  4J0W A;  1JMZ B;  2VDP A;  2GC7 A;  4QT8 A;  3MKQ A;  3IIY A;  2I0S A;  5AMS A;  3GC3 B;  5M61 A;  1PGU A;  4GQB B;  2P9L C;  4AMY A;  4CY3 A;  2G99 A;  5EAR A;  4NAA A;  3UVK A;  4Z8L A;  3IUQ A;  3VI3 A;  4WK4 A;  4ERY A;  2H13 A;  3L4M D;  2AGL A;  3MZK A;  1VYH C;  2EIE A;  4NSX A;  3KRW B;  3AL8 A;  3RFG A;  4ZN4 A;  4JSN C;  2VC2 A;  1A12 A;  1VE6 A;  4NBM A;  5M5R A;  2CO0 A;  1NR0 A;  3EI2 B;  2IUP A;  3K72 A;  1GXR A;  1N6F A;  2AGY A;  3ZDZ A;  4LGN A;  3I7N A;  4CI8 A;  3ZWL B;  3GD1 I;  1PI6 A;  2VDK A;  3FGB A;  4A2M A;  2IWK A;  2YBA A;  4A7J A;  1TYE A;  2BBK H;  3I7H A;  5FKQ A;  3OKY A;  3K71 A;  3MMY A;  1JJU B;  3A0F A;  1JMX B;  2EIC A;  3EQ9 A;  4A2L A;  2OK4 A;  4CY5 A;  2H9M A;  2VDM A;  4PXW A;  1OMW B;  2PM7 B;  4G55 A;  2HXC A;  5EML B;  4PBZ A;  3ZDX A;  2I3T A;  4U7A A;  4CI2 A;  4L3H D;  4GGD A;  5EAM A;  3IVM A;  2AGX A;  5GXH A;  4WK2 A;  2H9N A;  3U4Y A;  1GOT B;  3OL2 B;  1QFM A;  5I5I A;  3K6S A;  5TF2 A;  3QHY B;  5IJ8 E;  4Y5R D;  2G9A A;  1QNI A;  5IC7 A;  4AN0 A;  3I7K A;  2H6K A;  3V4P A;  3AFC A;  2H9P A;  3EG6 A;  3AL9 A;  1TYQ C;  1H2X A;  3B7F A;  5THA A;  1GG2 B;  5EAL A;  2PM6 B;  3MUN A;  4A0A A;  4D0K A;  5FLX g;  2YNO A;  2XYI A;  3UR4 A;  3ODT A;  2EID A;  3EI4 B;  3DM0 A;  3E0C A;  3IUJ A;  3IUL A;  4JXM A;  4FA1 D;  1SHY B;  3I2N A;  3IJ1 A;  5IT9 g;  5C2W B;  3IUM A;  2H47 A;  2PBI B;  4J77 A;  3KRX B;  5CXB A;  5CXC B;  3V7D B;  4BCC A;  2Z2N A;  4PC0 A;  5CYK A;  3J80 g;  2CNX A;  3ZDY A;  3PXT D;  4BP8 A;  3RLM D;  4R7A B;  3GRE A;  3RRM C;  4AN1 A;  5HE0 B;  1A0R B;  2PM9 B;  3DWL C;  1QFS A;  5EM2 A;  4H5J A;  3SJL D;  5EAP A;  4AOW A;  3C75 H;  4D9S A;  1ERJ A;  1JV2 A;  4MMY A;  4O9D A;  4GGC A;  5FKS A;  2QZP A;  3I8E A;  5FA5 B;  4CZX A;  3RN0 D;  4QAM A;  2YNP A;  4GM9 A;  4BL0 A;  4PNK B;  4Z7N A;  4JHP C;  3GFC A;  4GGA A;  4ERQ A;  5M5T A;  3HFQ A;  1K32 A;  4CZV A;  2HU8 A;  4ZOY A;  3NVN A;  2VDN A;  4O3U B;  4PBY A;  3BG0 A;  4H5I A;  3IJE A;  3C99 A;  1P22 A;  3ULE C;  4QRJ A;  1UOO A;  2UZX B;  4PSW B;  3UVM A;  1GOF A;  5M5U A;  4JSP C;  3IJC A;  4J81 A;  1B9Y A;  3J81 g;  1M1X A;  4DNV A;  2OJY A;  3EI1 B;  3UKR C;  5AFU 3;  2UZY B;  1E8M A;  2B5M A; 
#chains in the Genus database with same CATH homology
 2H68 A;  4J8G A;  5GXI A;  2TRC B;  3EU7 A;  3NVQ A;  4GM8 A;  3RMZ D;  4D6V A;  4ZOX A;  5HYN B;  5H17 A;  4I79 A;  2J55 H;  3IKO A;  3SLE D;  4ZOV A;  4X63 B;  2BCJ B;  3RN1 D;  3EI2 A;  3N0E A;  2QC5 A;  1NEX B;  3IIW A;  4XYI A;  3MKS B;  3F3G A;  3MXX A;  2CE9 A;  4GZ8 A;  4QQE A;  3RFH A;  4AEZ A;  4JD2 C;  1U2V C;  3CIK B;  1Q47 A;  4N14 A;  1MG3 A;  1U4C A;  4CY1 A;  4J87 A;  2H14 A;  1SQ9 A;  3OL2 A;  4CI3 A;  5AJA A;  4A0B B;  4HDJ A;  5GMK n;  1PEV A;  3OKY B;  5I5J A;  2AH1 A;  4J82 A;  4JSX C;  2OIZ A;  4ERZ A;  5EMK B;  3JZN A;  3UVN A;  4E54 A;  2H6Q A;  3DSM A;  5TEE A;  3VH0 A;  4MK0 B;  4J79 A;  4JSV C;  4O3T B;  5JWZ A;  5EMJ B;  4CZY A;  4FAV D;  1JOF A;  5A2Q g;  3EI4 A;  2J56 H;  4OWR A;  2CO0 C;  4EWR A;  4A08 B;  3SXT D;  2W18 A;  2IWF A;  5CXC A;  4IA9 A;  2P9S C;  2HJ4 A;  3PE7 A;  5FXY A;  4JT5 C;  2GNQ A;  3SBQ A;  5HE3 B;  2I0T A;  2OVQ B;  2HYE A;  3C5M A;  3FRX A;  3RSE C;  2PM9 A;  4XEI C;  3I7P A;  3BWS A;  5K1C C;  4LG9 A;  3JPX A;  4QL1 A;  3PXS D;  4J86 A;  3JRO A;  2QXV A;  3SBR A;  2B5L A;  3OKT A;  3BG1 A;  3P4F A;  2P9N C;  2XL3 A;  3JZG A;  5HE2 B;  2XU7 A;  4KFM B;  2HES X;  4FAN D;  4J0X A;  3I89 A;  4G56 B;  4E5Z B;  3L4O D;  5H1M A;  4GM3 A;  5KDO B;  4FA4 D;  5IGQ A;  3SVW D;  1MDA H;  4L1Q D;  4A09 B;  4K3I D;  4A11 B;  2I0R A;  2AH0 A;  2IAA A;  4OZU A;  4XYH A;  4GMB A;  2AQ5 A;  3EI3 B;  1L0Q A;  1R5M A;  4ESG A;  5FKR A;  3EI1 A;  4TZ4 A;  3MZL A;  1PBY B;  3SN6 B;  3NVX A;  1B9X A;  1TBG A;  3K27 A;  2B4E A;  2J57 G;  4J78 A;  3ORV D;  3I7O A;  3IJ0 A;  4J8B A;  3V5W B;  4Y7R A;  2YMU A;  1XIP A;  3EMH A;  2IUV A;  3CFV A;  3PVW B;  3DXM C;  2IUR A;  2Q7Q A;  3F3F A;  5FQD A;  3CFS B;  4CY2 A;  1MG2 A;  1K8K C;  4FWW A;  3AL8 B;  3F3P A;  2Z2O A;  2GC4 A;  3JAM g;  3SCY A;  3SFZ A;  2CN2 A;  4X3E A;  2CN3 A;  2AGW A;  4UI9 R;  2AGZ A;  3PSL A;  4ES0 A;  4A0B A;  3W15 A;  2HJB A;  2HKM A;  2OVP B;  4LG8 A;  5TEF A;  4X60 B;  2I3S A;  3PSC B;  2YNN A;  2IUQ A;  4X61 B;  5K19 A;  1XHM A;  5C2V B;  1N6D A;  4FA5 D;  5SXM A;  2H6N A;  1YFQ A;  4CI1 A;  1N6E A;  3DXK C;  2P9U C;  5B4W A;  4A08 A;  3SBP A;  3FM0 A;  3JB9 L;  3EWE A;  2O9K A;  3SHF A;  5IJ7 E;  2H3X A;  3JZH A;  1OLZ A;  3SWS D;  5GSA A;  4GQ1 A;  3OTT A;  4A0A B;  2XL2 A;  4E54 B;  1FWX A;  1XKS A;  4L9O A;  4K3J B;  3PXW D;  4L3G D;  4BH6 A;  4U1E I;  3K26 A;  4YVD A;  1GP2 B;  3VGZ A;  5TDH B;  5CXB B;  4J73 A;  4FA9 D;  2P9I C;  2YB8 B;  5CYK B;  2P9P C;  3OW8 A;  5FKT A;  5HE1 B;  1RI6 A;  3JRP A;  1SQJ A;  4JT6 C;  3UVL A;  4E5Z A;  2B5N A;  2HKR A;  5EM2 B;  3C9C A;  4BUJ C;  4GQ2 P;  4O45 A;  4PSX B;  2Z2P A;  4CC9 A;  4FB1 D;  3N0D A;  4A09 A;  4A11 A;  5I5M A;  4O1Q D;  3SMR A;  3UVO A;  2P9K C;  3VA6 A;  4ZOZ A;  3EI3 A;  1S4U X;  4J84 A;  2H9L A;  3V9F A;  4IMM A;  5C9Z B;  2OK6 A;  2MTA H;  5EMM B;  3AH8 B;  4FHL A;  3PVU B;  3UKU C;  3I8C A;  3I7L A;  5H14 A;  3OKW A;  5IGO A;  2CE8 A;  2EBS A;  5HQG A;  2OVR B;  4J0W A;  1JMZ B;  2GC7 A;  4QT8 A;  3MKQ A;  3IIY A;  2I0S A;  5AMS A;  1PGU A;  4GQB B;  2P9L C;  4CY3 A;  2G99 A;  5EAR A;  3UVK A;  4Z8L A;  4ERY A;  2H13 A;  2AGL A;  3L4M D;  4NSX A;  1VYH C;  3MZK A;  3KRW B;  3AL8 A;  3RFG A;  4ZN4 A;  4JSN C;  2CO0 A;  1NR0 A;  3EI2 B;  2IUP A;  1GXR A;  2AGY A;  1N6F A;  4LGN A;  3I7N A;  4CI8 A;  3ZWL B;  1PI6 A;  4A2M A;  3FGB A;  2IWK A;  2YBA A;  4A7J A;  2BBK H;  3I7H A;  5FKQ A;  3OKY A;  3MMY A;  1JJU B;  3A0F A;  1JMX B;  4A2L A;  2OK4 A;  4CY5 A;  2H9M A;  4PXW A;  1OMW B;  2PM7 B;  2HXC A;  5EML B;  4PBZ A;  2I3T A;  4U7A A;  4CI2 A;  4L3H D;  4GGD A;  5EAM A;  2AGX A;  5GXH A;  2H9N A;  3U4Y A;  1GOT B;  3OL2 B;  5I5I A;  5TF2 A;  5IJ8 E;  4Y5R D;  2G9A A;  1QNI A;  5IC7 A;  3I7K A;  2H6K A;  3AFC A;  2H9P A;  3EG6 A;  3AL9 A;  1TYQ C;  3B7F A;  5THA A;  1GG2 B;  5EAL A;  2PM6 B;  4A0A A;  4D0K A;  5FLX g;  2YNO A;  2XYI A;  3UR4 A;  3ODT A;  3EI4 B;  3DM0 A;  3E0C A;  4JXM A;  4FA1 D;  1SHY B;  3I2N A;  3IJ1 A;  5IT9 g;  5C2W B;  4J77 A;  2H47 A;  2PBI B;  5CXB A;  3KRX B;  5CXC B;  3V7D B;  2Z2N A;  4PC0 A;  5CYK A;  3J80 g;  2CNX A;  3PXT D;  3RLM D;  4R7A B;  3GRE A;  3RRM C;  5HE0 B;  1A0R B;  2PM9 B;  3DWL C;  5EM2 A;  3SJL D;  4H5J A;  4AOW A;  5EAP A;  3C75 H;  1ERJ A;  4O9D A;  4GGC A;  5FKS A;  3I8E A;  5FA5 B;  4CZX A;  3RN0 D;  2YNP A;  4GM9 A;  4BL0 A;  4PNK B;  3GFC A;  4GGA A;  4ERQ A;  3HFQ A;  1K32 A;  4CZV A;  4ZOY A;  4O3U B;  3NVN A;  4PBY A;  3BG0 A;  4H5I A;  3C99 A;  1P22 A;  3ULE C;  4QRJ A;  2UZX B;  4PSW B;  3UVM A;  4JSP C;  3IJC A;  4J81 A;  1B9Y A;  3J81 g;  2OJY A;  3EI1 B;  3UKR C;  5AFU 3;  2UZY B;  2B5M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...