3RN1D

Crystal structure of the w199e-maug/pre-methylamine dehydrogenase complex
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutagenesis of tryptophan199 reveals that electron hopping is required for MauG-dependent tryptophan tryptophylquinone biosynthesis
rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
molecule keywords Methylamine utilization protein MauG
total genus 93
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2011-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3rn1D00
4TZ4A 5CXBB 3L4OD 3SXTD 3C75H 2CO0C 1VYHC 4CZYA 2P9SC 4ZN4A 4R7AB 5TEFA 5H17A 3C5MA 4QRJA 3RRMC 1MDAH 3DXMC 3NVNA 4GMBA 4H5IA 2EBSA 5SXMA 1U4CA 3MZKA 2PM9B 5HYNB 2I3TA 3BWSA 1R5MA 1P22A 3F3PA 3OTTA 4L3GD 3EI3B 3IKOA 3SFZA 5CYKB 3EI2B 2YNOA 4XYHA 4IMMA 4A0BB 4GGCA 5GXIA 3EG6A 3EU7A 2J57G 4ZOXA 1PEVA 4J73A 4UI9R 4EWRA 4GZ8A 1S4UX 1PGUA 3L4MD 3RSEC 2MTAH 3RN0D 2UZXB 4QQEA 4ZOYA 5FKSA 4AOWA 2G99A 4OZUA 3OW8A 5CXBA 4KFMB 5CYKA 3I7PA 5THAA 4D6VA 2B5NA 2BCJB 3DWLC 3PVUB 5EMJB 3JZNA 5GSAA 4OWRA 5FQDA 3UVMA 5I5MA 4N14A 3PE7A 3AL8A 3I7LA 3DXKC 5CXCB 5A2Qg 4FA9D 5EMKB 4E5ZA 4O3UB 3EI1A 2OIZA 2CE8A 2OVQB 4PSXB 2Q7QA 3F3GA 4AEZA 5IT9g 2CNXA 4FB1D 4J84A 2YNPA 3UKUC 3V5WB 1PI6A 4A7JA 4Y5RD 4A08A 2BBKH 4ESGA 3IJ1A 3V7DB 4BL0A 4O9DA 2O9KA 5EM2A 2XU7A 3I7OA 4L3HD 3ZWLB 2AH1A 2HJBA 4PBYA 2OJYA 4A11A 3GFCA 3JZGA 4JXMA 4GQ2P 3V9FA 5TEEA 2IUPA 2PM6B 3DSMA 5TDHB 2XL2A 1SQJA 1PBYB 4LG9A 2H13A 3W15A 2IAAA 3GREA 5FKRA 3OL2A 3UVKA 4J0WA 1GOTB 4JT6C 1QNIA 2IUQA 5GMKn 4ZOVA 5EMMB 3F3FA 4X63B 4K3ID 3VH0A 4ERQA 3SLED 3ORVD 3EI4A 2OK6A 4JSXC 5EALA 2OVPB 4A11B 5AMSA 3SCYA 4JD2C 2OK4A 5HE0B 4J86A 3PSCB 4J8GA 1JMZB 3CFVA 4J87A 4PXWA 3MMYA 4ERYA 3JZHA 1N6DA 4A09B 1B9YA 3EI3A 4QL1A 4CI3A 3I89A 1RI6A 4FAND 4BUJC 3FRXA 3AL8B 4PBZA 3HFQA 3I8EA 3ULEC 5EM2B 2H6QA 2H9NA 4JSVC 3EI4B 4GQ1A 3NVQA 1XKSA 5B4WA 3J80g 2Z2PA 4LG8A 1N6FA 4Z8LA 3JAMg 2YB8B 4CY1A 3SWSD 2YMUA 3I8CA 4U1EI 4CI2A 5AJAA 3MKQA 3RMZD 2HXCA 4GGDA 4MK0B 5C2WB 2AGXA 1SHYB 3IIWA 5FKTA 2CO0A 1N6EA 3OKTA 5FXYA 1GP2B 3UVOA 2GC7A 2H6NA 3VGZA 4L9OA 1NR0A 4CZXA 5KDOB 4A0BA 5HE3B 4E54A 2HJ4A 5HE1B 5IGQA 4FA4D 1K32A 2YBAA 4O1QD 2AQ5A 3A0FA 3OKYB 3SBRA 3K26A 3P4FA 1JJUB 1GXRA 1U2VC 3C99A 3UR4A 3SBPA 2TRCB 3JB9L 3JROA 4BH6A 2CN3A 5K1CC 4CY5A 5EARA 3IJ0A 3I2NA 2H9PA 2I3SA 1YFQA 4J8BA 4PSWB 5I5JA 2P9PC 4X60B 2IWFA 4IA9A 2YNNA 2P9IC 1TYQC 5EAMA 3CFSB 3EI1B 2CN2A 3IJCA 2P9KC 2AGLA 2XL3A 3UKRC 3OL2B 1A0RB 3OKWA 1NEXB 3AH8B 5EAPA 2H9LA 3UVLA 2HESX 4ES0A 3I7KA 4O3TB 3SJLD 5FA5B 2IURA 1JOFA 3DM0A 5EMLB 5TF2A 5IJ8E 3FGBA 3KRWB 4FAVD 3PXWD 4A2LA 4E54B 2Z2OA 4A2MA 3PVWB 4I79A 1XIPA 2HKRA 4FA1D 4J0XA 4J82A 1TBGA 2I0SA 4O45A 4U7AA 2GC4A 2J56H 5JWZA 5H1MA 4JT5C 1Q47A 4XYIA 2I0RA 2QXVA 4K3JB 2B5LA 2H3XA 4NSXA 4FWWA 2XYIA 3BG0A 3VA6A 4PNKB 3SHFA 2QC5A 3SMRA 5IGOA 1FWXA 2AGZA 2W18A 3E0CA 1OLZA 3EWEA 3CIKB 3RFGA 3PXSD 3RFHA 4E5ZB 3MKSB 2HKMA 4A0AB 2P9LC 4QT8A 3C9CA 2J55H 2P9UC 4GGAA 3RN1D 4ERZA 5K19A 3EMHA 3B7FA 3U4YA 3I7NA 3SBQA 4CY2A 2IWKA 3PSLA 1B9XA 5C9ZB 2AGWA 2B5MA 2AH0A 4GM3A 2PM7B 2GNQA 3PXTD 4Y7RA 2H6KA 4FA5D 1XHMA 4CZVA 4L1QD 2OVRB 3JPXA 3J81g 4J78A 1ERJA 3RLMD 1MG3A 3N0DA 3N0EA 3ODTA 4CY3A 1GG2B 4GM9A 5H14A 2P9NC 1JMXB 3FM0A 5AFU3 2H9MA 5GXHA 5I5IA 3OKYA 4CI1A 2B4EA 2CE9A 4JSPC 3SN6B 4ZOZA 2HYEA 3SVWD 5HQGA 3JRPA 4YVDA 1OMWB 1MG2A 2AGYA 4JSNC 4J79A 4X61B 4XEIC 3MZLA 4GQBB 1L0QA 3EI2A 2G9AA 3MXXA 3KRXB 3AFCA 3BG1A 5IC7A 4HDJA 5C2VB 1SQ9A 5FLXg 3NVXA 4J77A 4X3EA 2PM9A 2I0TA 2H14A 4CI8A 3I7HA 3IIYA 3K27A 2Z2NA 4G56B 1K8KC 4PC0A 4D0KA 3AL9A 2PBIB 5IJ7E 4GM8A 2UZYB 4FHLA 5HE2B 3UVNA 2IUVA 4H5JA 4J81A 4LGNA 4A08B 4A0AA 2H47A 2H68A 4CC9A 5CXCA 5FKQA 4A09A
chains in the Genus database with same CATH superfamily
4WJKA 4TZ4A 5CXBB 3L4OD 3SXTD 3C75H 2CO0C 1VYHC 2JKXA 4CZYA 2P9SC 4ZN4A 4R7AB 5TEFA 5H17A 3C5MA 4QRJA 3RRMC 1MDAH 4NENA 3DXMC 3NVNA 4GMBA 2VZ1A 4H5IA 4NAAA 2EBSA 5SXMA 4O02A 1U4CA 3MZKA 2PM9B 5HYNB 2I3TA 4MMXA 3BWSA 1R5MA 1P22A 3F3PA 3OTTA 4L3GD 3EI3B 3IKOA 3SFZA 5CYKB 3EI2B 2YNOA 4XYHA 4IMMA 4A0BB 4GGCA 5GXIA 3EG6A 3EU7A 1H2YA 4UM8A 5C86A 2J57G 4ZOXA 1PEVA 4WK4A 4J73A 4UI9R 4EWRA 5M5UA 5E6SA 4GZ8A 1S4UX 1PGUA 1E8MA 3L4MD 4MMYA 3RSEC 1U8CA 1UOQA 2MTAH 4BCDA 3RN0D 1H2ZA 2UZXB 4QQEA 5M5RA 3NIDA 5FFOA 4ZOYA 3IVMA 5FKSA 4AOWA 2EIDA 2G99A 4OZUA 3OW8A 5CXBA 1I2MB 4KFMB 4G1EA 5M5TA 5CYKA 3I7PA 5THAA 4D6VA 2B5NA 2BCJB 3DWLC 3PVUB 5EMJB 3JZNA 5GSAA 4OWRA 3DDUA 5FQDA 3UVMA 5I5MA 4N14A 4NC4A 3IUJA 3PE7A 3AL8A 3I7LA 2VDNA 3DXKC 5CXCB 5A2Qg 1A12A 1VZ3A 4FA9D 5EMKB 4E5ZA 4O3UB 3EI1A 2OIZA 2CE8A 1QFSA 2OVQB 2Q7QA 3F3GA 4PSXB 4AEZA 5IT9g 2CNXA 1K3IA 4FB1D 4J84A 2YNPA 3UKUC 1H2XA 4L1MA 1JTDB 3V5WB 2EIBA 1PI6A 3EQ8A 3OF7A 4A7JA 3ZDZA 4Y5RD 3MVDK 4A08A 2BBKH 4ESGA 2EIEA 1O6FA 2EICA 4G1MA 3IJ1A 3V7DB 4BL0A 4O9DA 2O9KA 5EM2A 2XU7A 3T3MA 3I7OA 4L3HD 3ZWLB 2AH1A 2HJBA 4PBYA 2OJYA 4A11A 3GFCA 3JZGA 2XDWA 4JXMA 4GQ2P 1UOPA 3V9FA 5TEEA 2IUPA 2PM6B 2VZ3A 3DSMA 2WQ8A 5TDHB 2XL2A 3K72A 1SQJA 1PBYB 4AX4A 4LG9A 2H13A 3W15A 4JHPC 2IAAA 3IUNA 1VE6A 1GOFA 3EQ9A 3GREA 5FKRA 3OL2A 3UVKA 3KCIA 4J0WA 1GOTB 4JT6C 1QNIA 2IUQA 5GMKn 4ZOVA 5EMMB 3F3FA 4X63B 4K3ID 3VH0A 4ERQA 3SLED 3ORVD 3EI4A 2OK6A 4JSXC 5EALA 2OVPB 4A11B 5AMSA 3SCYA 4WK0A 4JD2C 2OK4A 5HE0B 4J86A 3PSCB 4J8GA 1JMZB 3CFVA 4J87A 4PXWA 3V4VA 3MMYA 4ERYA 3JZHA 1N6DA 4A09B 3O4IA 1B9YA 3EI3A 4QL1A 4CI3A 3I89A 4BCBA 1RI6A 4FAND 4BUJC 4IRZA 3FRXA 4BP9A 3AL8B 4PBZA 3HFQA 2QZPA 3I8EA 3ULEC 1GOGA 4QAMA 1C9IA 4UM9A 5EM2B 2H6QA 2H9NA 4JSVC 3EI4B 4GQ1A 3NVQA 1XKSA 5B4WA 3J80g 2Z2PA 4LG8A 1N6FA 4Z8LA 3JAMg 1YR2A 2YB8B 4CY1A 3SWSD 2YMUA 3I8CA 4U1EI 4CI2A 5AJAA 3MKQA 3RMZD 2HXCA 3K71A 4GGDA 4MK0B 5C2WB 2AGXA 1M1XA 1SHYB 3IIWA 5FKTA 2CO0A 1N6EA 1TYEA 3OKTA 5FXYA 1GP2B 3MUOA 3UVOA 2GC7A 3IUMA 2BKLA 2H6NA 4L9OA 4RE6A 3VGZA 3FCSA 1NR0A 4DNUA 4CZXA 5KDOB 4A0BA 3ZDYA 5HE3B 4Z7QA 4E54A 1VZ2A 1UOOA 2HJ4A 5HE1B 5IGQA 4FA4D 1K32A 2YBAA 4O1QD 5E6UA 2AQ5A 2XZGA 3A0FA 3OKYB 3SBRA 3K26A 3P4FA 4NBMA 1JJUB 1GXRA 1U2VC 3C99A 1VE7A 3UR4A 3SBPA 2TRCB 4JHNA 3T3PA 2QR5A 3JB9L 3JROA 4BH6A 4BP8A 2CN3A 5K1CC 4CY5A 4Z7OA 5EARA 3IJ0A 3I2NA 2H9PA 2I3SA 1YFQA 4J8BA 4PSWB 4AMZA 3K6SA 5I5JA 2P9PC 4X60B 2IWFA 4IA9A 3ZDXA 2YNNA 3QI0A 2P9IC 1TYQC 5EAMA 3CFSB 3EI1B 2CN2A 3IJCA 2P9KC 2AGLA 2XL3A 3UKRC 4BCCA 4DNWA 3ZE2A 3OL2B 1A0RB 3OKWA 1NEXB 3AH8B 5EAPA 2H9LA 3UVLA 2VDLA 2HESX 4ES0A 3I7KA 4O3TB 3SJLD 3O4HA 5FA5B 2IURA 1JOFA 4Z7NA 3DM0A 1H2WA 5EMLB 5TF2A 5IJ8E 3FGBA 1T2XA 2VDMA 3KRWB 4FAVD 2XE4A 3PXWD 4A2LA 4E54B 3VI4A 3GD1I 2HU8A 2Z2OA 4A2MA 3PVWB 4I79A 1XIPA 2HKRA 4FA1D 4J0XA 2VDOA 4J82A 1TBGA 2I0SA 4O45A 4U7AA 2GC4A 2J56H 5JWZA 5H1MA 4JT5C 1Q47A 4XYIA 2I0RA 1BPOA 2QXVA 4K3JB 2B5LA 2H3XA 4MMZA 3NIGA 4FWWA 2XYIA 4NSXA 3BG0A 3VA6A 4PNKB 3SHFA 3VI3A 2QC5A 3SMRA 5IGOA 1FWXA 1JV2A 1C9LA 1UTCA 2VDQA 2VC2A 2AGZA 2HU7A 2W18A 3E0CA 1OLZA 2VDPA 3EWEA 3FCUA 3CIKB 3RFGA 3PXSD 3RFHA 3ZE1A 4D9SA 4E5ZB 3MKSB 2HKMA 4A0AB 2P9LC 4QT8A 3C9CA 2J55H 2P9UC 4GGAA 3RN1D 4ERZA 5K19A 3EMHA 3IURA 3B7FA 3U4YA 3I7NA 3SBQA 4CY2A 2IWKA 3PSLA 1B9XA 5C9ZB 2AGWA 2B5MA 2AH0A 4GM3A 2PM7B 3MUNA 2GNQA 3PXTD 1E5TA 4Y7RA 2H6KA 4FA5D 3GC3B 1XHMA 3ZE0A 4CZVA 4L1QD 2OVRB 4AN0A 1L5GA 3JPXA 3J81g 4J78A 1ERJA 3RLMD 1MG3A 3IULA 3N0DA 3N0EA 4AN1A 5M5SA 3ODTA 4CY3A 1GG2B 1O6GA 4GM9A 5H14A 2P9NC 3IUQA 1JMXB 3FM0A 5AFU3 3NIFA 2H9MA 2VDKA 5C92A 3V4PA 5GXHA 5I5IA 5FFGA 2VDRA 3OKYA 4CI1A 2B4EA 2CE9A 4JSPC 3SN6B 4WK2A 4ZOZA 4DNVA 2HYEA 3SVWD 5HQGA 3O4JA 4AMYA 3JRPA 5M61A 4YVDA 1OMWB 1MG2A 2AGYA 4JSNC 4J79A 4X61B 3IJEA 4RE5A 4XEIC 3MZLA 4GQBB 2HU5A 1L0QA 3EI2A 2G9AA 3O4GA 3MXXA 3KRXB 3AFCA 3BG1A 5IC7A 4HDJA 5C2VB 1SQ9A 5FLXg 5HDBA 3NVXA 5CXCA 4J77A 4X3EA 2PM9A 2I0TA 2H14A 4CI8A 3I7HA 3IIYA 3K27A 2Z2NA 4G56B 1GOHA 1E8NA 1K8KC 4PC0A 4D0KA 3AL9A 5M5VA 2PBIB 5IJ7E 3EQ7A 3QHYB 5E6RA 4GM8A 2UZYB 4FHLA 4G55A 5HE2B 3UVNA 2IUVA 4H5JA 4J81A 4O2WA 4LGNA 4A08B 4A0AA 2H47A 2H68A 4CC9A 1QFMA 5FKQA 4A09A
chains in the Genus database with same CATH topology
4TZ4A 5CXBB 3L4OD 3SXTD 3C75H 2CO0C 1VYHC 4CZYA 2P9SC 4ZN4A 4R7AB 5TEFA 5H17A 3C5MA 4QRJA 3RRMC 1MDAH 3DXMC 3NVNA 4GMBA 4H5IA 2EBSA 5SXMA 1U4CA 3MZKA 2PM9B 5HYNB 2I3TA 3BWSA 1R5MA 1P22A 3F3PA 3OTTA 4L3GD 3EI3B 3IKOA 3SFZA 5CYKB 3EI2B 2YNOA 4XYHA 4IMMA 4A0BB 4GGCA 5GXIA 3EG6A 3EU7A 2J57G 4ZOXA 1PEVA 4J73A 4UI9R 4EWRA 4GZ8A 1S4UX 1PGUA 3L4MD 3RSEC 2MTAH 3RN0D 2UZXB 4QQEA 4ZOYA 5FKSA 4AOWA 2G99A 4OZUA 3OW8A 5CXBA 4KFMB 5CYKA 3I7PA 5THAA 4D6VA 2B5NA 2BCJB 3DWLC 3PVUB 5EMJB 3JZNA 5GSAA 4OWRA 5FQDA 3UVMA 5I5MA 4N14A 3PE7A 3AL8A 3I7LA 3DXKC 5CXCB 5A2Qg 4FA9D 5EMKB 4E5ZA 4O3UB 3EI1A 2OIZA 2CE8A 2OVQB 4PSXB 2Q7QA 3F3GA 4AEZA 5IT9g 2CNXA 4FB1D 4J84A 2YNPA 3UKUC 3V5WB 1PI6A 4A7JA 4Y5RD 4A08A 2BBKH 4ESGA 3IJ1A 3V7DB 4BL0A 4O9DA 2O9KA 5EM2A 2XU7A 3I7OA 4L3HD 3ZWLB 2AH1A 2HJBA 4PBYA 2OJYA 4A11A 3GFCA 3JZGA 4JXMA 4GQ2P 3V9FA 5TEEA 2IUPA 2PM6B 3DSMA 5TDHB 2XL2A 1SQJA 1PBYB 4LG9A 2H13A 3W15A 2IAAA 3GREA 5FKRA 3OL2A 3UVKA 4J0WA 1GOTB 4JT6C 1QNIA 2IUQA 5GMKn 4ZOVA 5EMMB 3F3FA 4X63B 4K3ID 3VH0A 4ERQA 3SLED 3ORVD 3EI4A 2OK6A 4JSXC 5EALA 2OVPB 4A11B 5AMSA 3SCYA 4JD2C 2OK4A 5HE0B 4J86A 3PSCB 4J8GA 1JMZB 3CFVA 4J87A 4PXWA 3MMYA 4ERYA 3JZHA 1N6DA 4A09B 1B9YA 3EI3A 4QL1A 4CI3A 3I89A 1RI6A 4FAND 4BUJC 3FRXA 3AL8B 4PBZA 3HFQA 3I8EA 3ULEC 5EM2B 2H6QA 2H9NA 4JSVC 3EI4B 4GQ1A 3NVQA 1XKSA 5B4WA 3J80g 2Z2PA 4LG8A 1N6FA 4Z8LA 3JAMg 2YB8B 4CY1A 3SWSD 2YMUA 3I8CA 4U1EI 4CI2A 5AJAA 3MKQA 3RMZD 2HXCA 4GGDA 4MK0B 5C2WB 2AGXA 1SHYB 3IIWA 5FKTA 2CO0A 1N6EA 3OKTA 5FXYA 1GP2B 3UVOA 2GC7A 2H6NA 3VGZA 4L9OA 1NR0A 4CZXA 5KDOB 4A0BA 5HE3B 4E54A 2HJ4A 5HE1B 5IGQA 4FA4D 1K32A 2YBAA 4O1QD 2AQ5A 3A0FA 3OKYB 3SBRA 3K26A 3P4FA 1JJUB 1GXRA 1U2VC 3C99A 3UR4A 3SBPA 2TRCB 3JB9L 3JROA 4BH6A 2CN3A 5K1CC 4CY5A 5EARA 3IJ0A 3I2NA 2H9PA 2I3SA 1YFQA 4J8BA 4PSWB 5I5JA 2P9PC 4X60B 2IWFA 4IA9A 2YNNA 2P9IC 1TYQC 5EAMA 3CFSB 3EI1B 2CN2A 3IJCA 2P9KC 2AGLA 2XL3A 3UKRC 3OL2B 1A0RB 3OKWA 1NEXB 3AH8B 5EAPA 2H9LA 3UVLA 2HESX 4ES0A 3I7KA 4O3TB 3SJLD 5FA5B 2IURA 1JOFA 3DM0A 5EMLB 5TF2A 5IJ8E 3FGBA 3KRWB 4FAVD 3PXWD 4A2LA 4E54B 2Z2OA 4A2MA 3PVWB 4I79A 1XIPA 2HKRA 4FA1D 4J0XA 4J82A 1TBGA 2I0SA 4O45A 4U7AA 2GC4A 2J56H 5JWZA 5H1MA 4JT5C 1Q47A 4XYIA 2I0RA 2QXVA 4K3JB 2B5LA 2H3XA 4NSXA 4FWWA 2XYIA 3BG0A 3VA6A 4PNKB 3SHFA 2QC5A 3SMRA 5IGOA 1FWXA 2AGZA 2W18A 3E0CA 1OLZA 3EWEA 3CIKB 3RFGA 3PXSD 3RFHA 4E5ZB 3MKSB 2HKMA 4A0AB 2P9LC 4QT8A 3C9CA 2J55H 2P9UC 4GGAA 3RN1D 4ERZA 5K19A 3EMHA 3B7FA 3U4YA 3I7NA 3SBQA 4CY2A 2IWKA 3PSLA 1B9XA 5C9ZB 2AGWA 2B5MA 2AH0A 4GM3A 2PM7B 2GNQA 3PXTD 4Y7RA 2H6KA 4FA5D 1XHMA 4CZVA 4L1QD 2OVRB 3JPXA 3J81g 4J78A 1ERJA 3RLMD 1MG3A 3N0DA 3N0EA 3ODTA 4CY3A 1GG2B 4GM9A 5H14A 2P9NC 1JMXB 3FM0A 5AFU3 2H9MA 5GXHA 5I5IA 3OKYA 4CI1A 2B4EA 2CE9A 4JSPC 3SN6B 4ZOZA 2HYEA 3SVWD 5HQGA 3JRPA 4YVDA 1OMWB 1MG2A 2AGYA 4JSNC 4J79A 4X61B 4XEIC 3MZLA 4GQBB 1L0QA 3EI2A 2G9AA 3MXXA 3KRXB 3AFCA 3BG1A 5IC7A 4HDJA 5C2VB 1SQ9A 5FLXg 3NVXA 4J77A 4X3EA 2PM9A 2I0TA 2H14A 4CI8A 3I7HA 3IIYA 3K27A 2Z2NA 4G56B 1K8KC 4PC0A 4D0KA 3AL9A 2PBIB 5IJ7E 4GM8A 2UZYB 4FHLA 5HE2B 3UVNA 2IUVA 4H5JA 4J81A 4LGNA 4A08B 4A0AA 2H47A 2H68A 4CC9A 5CXCA 5FKQA 4A09A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TZ4 A;  5CXB B;  3L4O D;  3SXT D;  3C75 H;  2CO0 C;  1VYH C;  4CZY A;  2P9S C;  4ZN4 A;  4R7A B;  5TEF A;  5H17 A;  3C5M A;  4QRJ A;  3RRM C;  1MDA H;  3DXM C;  3NVN A;  4GMB A;  4H5I A;  2EBS A;  5SXM A;  1U4C A;  3MZK A;  2PM9 B;  5HYN B;  2I3T A;  3BWS A;  1R5M A;  1P22 A;  3F3P A;  3OTT A;  4L3G D;  3EI3 B;  3IKO A;  3SFZ A;  5CYK B;  3EI2 B;  2YNO A;  4XYH A;  4IMM A;  4A0B B;  4GGC A;  5GXI A;  3EG6 A;  3EU7 A;  2J57 G;  4ZOX A;  1PEV A;  4J73 A;  4UI9 R;  4EWR A;  4GZ8 A;  1S4U X;  1PGU A;  3L4M D;  3RSE C;  2MTA H;  3RN0 D;  2UZX B;  4QQE A;  4ZOY A;  5FKS A;  4AOW A;  2G99 A;  4OZU A;  3OW8 A;  5CXB A;  4KFM B;  5CYK A;  3I7P A;  5THA A;  4D6V A;  2B5N A;  2BCJ B;  3DWL C;  3PVU B;  5EMJ B;  3JZN A;  5GSA A;  4OWR A;  5FQD A;  3UVM A;  5I5M A;  4N14 A;  3PE7 A;  3AL8 A;  3I7L A;  3DXK C;  5CXC B;  5A2Q g;  4FA9 D;  5EMK B;  4E5Z A;  4O3U B;  3EI1 A;  2OIZ A;  2CE8 A;  2OVQ B;  4PSX B;  2Q7Q A;  3F3G A;  4AEZ A;  5IT9 g;  2CNX A;  4FB1 D;  4J84 A;  2YNP A;  3UKU C;  3V5W B;  1PI6 A;  4A7J A;  4Y5R D;  4A08 A;  2BBK H;  4ESG A;  3IJ1 A;  3V7D B;  4BL0 A;  4O9D A;  2O9K A;  5EM2 A;  2XU7 A;  3I7O A;  4L3H D;  3ZWL B;  2AH1 A;  2HJB A;  4PBY A;  2OJY A;  4A11 A;  3GFC A;  3JZG A;  4JXM A;  4GQ2 P;  3V9F A;  5TEE A;  2IUP A;  2PM6 B;  3DSM A;  5TDH B;  2XL2 A;  1SQJ A;  1PBY B;  4LG9 A;  2H13 A;  3W15 A;  2IAA A;  3GRE A;  5FKR A;  3OL2 A;  3UVK A;  4J0W A;  1GOT B;  4JT6 C;  1QNI A;  2IUQ A;  5GMK n;  4ZOV A;  5EMM B;  3F3F A;  4X63 B;  4K3I D;  3VH0 A;  4ERQ A;  3SLE D;  3ORV D;  3EI4 A;  2OK6 A;  4JSX C;  5EAL A;  2OVP B;  4A11 B;  5AMS A;  3SCY A;  4JD2 C;  2OK4 A;  5HE0 B;  4J86 A;  3PSC B;  4J8G A;  1JMZ B;  3CFV A;  4J87 A;  4PXW A;  3MMY A;  4ERY A;  3JZH A;  1N6D A;  4A09 B;  1B9Y A;  3EI3 A;  4QL1 A;  4CI3 A;  3I89 A;  1RI6 A;  4FAN D;  4BUJ C;  3FRX A;  3AL8 B;  4PBZ A;  3HFQ A;  3I8E A;  3ULE C;  5EM2 B;  2H6Q A;  2H9N A;  4JSV C;  3EI4 B;  4GQ1 A;  3NVQ A;  1XKS A;  5B4W A;  3J80 g;  2Z2P A;  4LG8 A;  1N6F A;  4Z8L A;  3JAM g;  2YB8 B;  4CY1 A;  3SWS D;  2YMU A;  3I8C A;  4U1E I;  4CI2 A;  5AJA A;  3MKQ A;  3RMZ D;  2HXC A;  4GGD A;  4MK0 B;  5C2W B;  2AGX A;  1SHY B;  3IIW A;  5FKT A;  2CO0 A;  1N6E A;  3OKT A;  5FXY A;  1GP2 B;  3UVO A;  2GC7 A;  2H6N A;  3VGZ A;  4L9O A;  1NR0 A;  4CZX A;  5KDO B;  4A0B A;  5HE3 B;  4E54 A;  2HJ4 A;  5HE1 B;  5IGQ A;  4FA4 D;  1K32 A;  2YBA A;  4O1Q D;  2AQ5 A;  3A0F A;  3OKY B;  3SBR A;  3K26 A;  3P4F A;  1JJU B;  1GXR A;  1U2V C;  3C99 A;  3UR4 A;  3SBP A;  2TRC B;  3JB9 L;  3JRO A;  4BH6 A;  2CN3 A;  5K1C C;  4CY5 A;  5EAR A;  3IJ0 A;  3I2N A;  2H9P A;  2I3S A;  1YFQ A;  4J8B A;  4PSW B;  5I5J A;  2P9P C;  4X60 B;  2IWF A;  4IA9 A;  2YNN A;  2P9I C;  1TYQ C;  5EAM A;  3CFS B;  3EI1 B;  2CN2 A;  3IJC A;  2P9K C;  2AGL A;  2XL3 A;  3UKR C;  3OL2 B;  1A0R B;  3OKW A;  1NEX B;  3AH8 B;  5EAP A;  2H9L A;  3UVL A;  2HES X;  4ES0 A;  3I7K A;  4O3T B;  3SJL D;  5FA5 B;  2IUR A;  1JOF A;  3DM0 A;  5EML B;  5TF2 A;  5IJ8 E;  3FGB A;  3KRW B;  4FAV D;  3PXW D;  4A2L A;  4E54 B;  2Z2O A;  4A2M A;  3PVW B;  4I79 A;  1XIP A;  2HKR A;  4FA1 D;  4J0X A;  4J82 A;  1TBG A;  2I0S A;  4O45 A;  4U7A A;  2GC4 A;  2J56 H;  5JWZ A;  5H1M A;  4JT5 C;  1Q47 A;  4XYI A;  2I0R A;  2QXV A;  4K3J B;  2B5L A;  2H3X A;  4NSX A;  4FWW A;  2XYI A;  3BG0 A;  3VA6 A;  4PNK B;  3SHF A;  2QC5 A;  3SMR A;  5IGO A;  1FWX A;  2AGZ A;  2W18 A;  3E0C A;  1OLZ A;  3EWE A;  3CIK B;  3RFG A;  3PXS D;  3RFH A;  4E5Z B;  3MKS B;  2HKM A;  4A0A B;  2P9L C;  4QT8 A;  3C9C A;  2J55 H;  2P9U C;  4GGA A;  3RN1 D;  4ERZ A;  5K19 A;  3EMH A;  3B7F A;  3U4Y A;  3I7N A;  3SBQ A;  4CY2 A;  2IWK A;  3PSL A;  1B9X A;  5C9Z B;  2AGW A;  2B5M A;  2AH0 A;  4GM3 A;  2PM7 B;  2GNQ A;  3PXT D;  4Y7R A;  2H6K A;  4FA5 D;  1XHM A;  4CZV A;  4L1Q D;  2OVR B;  3JPX A;  3J81 g;  4J78 A;  1ERJ A;  3RLM D;  1MG3 A;  3N0D A;  3N0E A;  3ODT A;  4CY3 A;  1GG2 B;  4GM9 A;  5H14 A;  2P9N C;  1JMX B;  3FM0 A;  5AFU 3;  2H9M A;  5GXH A;  5I5I A;  3OKY A;  4CI1 A;  2B4E A;  2CE9 A;  4JSP C;  3SN6 B;  4ZOZ A;  2HYE A;  3SVW D;  5HQG A;  3JRP A;  4YVD A;  1OMW B;  1MG2 A;  2AGY A;  4JSN C;  4J79 A;  4X61 B;  4XEI C;  3MZL A;  4GQB B;  1L0Q A;  3EI2 A;  2G9A A;  3MXX A;  3KRX B;  3AFC A;  3BG1 A;  5IC7 A;  4HDJ A;  5C2V B;  1SQ9 A;  5FLX g;  3NVX A;  4J77 A;  4X3E A;  2PM9 A;  2I0T A;  2H14 A;  4CI8 A;  3I7H A;  3IIY A;  3K27 A;  2Z2N A;  4G56 B;  1K8K C;  4PC0 A;  4D0K A;  3AL9 A;  2PBI B;  5IJ7 E;  4GM8 A;  2UZY B;  4FHL A;  5HE2 B;  3UVN A;  2IUV A;  4H5J A;  4J81 A;  4LGN A;  4A08 B;  4A0A A;  2H47 A;  2H68 A;  4CC9 A;  5CXC A;  5FKQ A;  4A09 A; 
#chains in the Genus database with same CATH topology
 4WJK A;  4TZ4 A;  5CXB B;  3L4O D;  3SXT D;  3C75 H;  2CO0 C;  1VYH C;  2JKX A;  4CZY A;  2P9S C;  4ZN4 A;  4R7A B;  5TEF A;  5H17 A;  3C5M A;  4QRJ A;  3RRM C;  1MDA H;  4NEN A;  3DXM C;  3NVN A;  4GMB A;  2VZ1 A;  4H5I A;  4NAA A;  2EBS A;  5SXM A;  4O02 A;  1U4C A;  3MZK A;  2PM9 B;  5HYN B;  2I3T A;  4MMX A;  3BWS A;  1R5M A;  1P22 A;  3F3P A;  3OTT A;  4L3G D;  3EI3 B;  3IKO A;  3SFZ A;  5CYK B;  3EI2 B;  2YNO A;  4XYH A;  4IMM A;  4A0B B;  4GGC A;  5GXI A;  3EG6 A;  3EU7 A;  1H2Y A;  4UM8 A;  5C86 A;  2J57 G;  4ZOX A;  1PEV A;  4WK4 A;  4J73 A;  4UI9 R;  4EWR A;  5M5U A;  5E6S A;  4GZ8 A;  1S4U X;  1PGU A;  1E8M A;  3L4M D;  4MMY A;  3RSE C;  1U8C A;  1UOQ A;  2MTA H;  4BCD A;  3RN0 D;  1H2Z A;  2UZX B;  4QQE A;  5M5R A;  3NID A;  5FFO A;  4ZOY A;  3IVM A;  5FKS A;  4AOW A;  2EID A;  2G99 A;  4OZU A;  3OW8 A;  5CXB A;  1I2M B;  4KFM B;  4G1E A;  5M5T A;  5CYK A;  3I7P A;  5THA A;  4D6V A;  2B5N A;  2BCJ B;  3DWL C;  3PVU B;  5EMJ B;  3JZN A;  5GSA A;  4OWR A;  3DDU A;  5FQD A;  3UVM A;  5I5M A;  4N14 A;  4NC4 A;  3IUJ A;  3PE7 A;  3AL8 A;  3I7L A;  2VDN A;  3DXK C;  5CXC B;  5A2Q g;  1A12 A;  1VZ3 A;  4FA9 D;  5EMK B;  4E5Z A;  4O3U B;  3EI1 A;  2OIZ A;  2CE8 A;  1QFS A;  2OVQ B;  2Q7Q A;  3F3G A;  4PSX B;  4AEZ A;  5IT9 g;  2CNX A;  1K3I A;  4FB1 D;  4J84 A;  2YNP A;  3UKU C;  1H2X A;  4L1M A;  1JTD B;  3V5W B;  2EIB A;  1PI6 A;  3EQ8 A;  3OF7 A;  4A7J A;  3ZDZ A;  4Y5R D;  3MVD K;  4A08 A;  2BBK H;  4ESG A;  2EIE A;  1O6F A;  2EIC A;  4G1M A;  3IJ1 A;  3V7D B;  4BL0 A;  4O9D A;  2O9K A;  5EM2 A;  2XU7 A;  3T3M A;  3I7O A;  4L3H D;  3ZWL B;  2AH1 A;  2HJB A;  4PBY A;  2OJY A;  4A11 A;  3GFC A;  3JZG A;  2XDW A;  4JXM A;  4GQ2 P;  1UOP A;  3V9F A;  5TEE A;  2IUP A;  2PM6 B;  2VZ3 A;  3DSM A;  2WQ8 A;  5TDH B;  2XL2 A;  3K72 A;  1SQJ A;  1PBY B;  4AX4 A;  4LG9 A;  2H13 A;  3W15 A;  4JHP C;  2IAA A;  3IUN A;  1VE6 A;  1GOF A;  3EQ9 A;  3GRE A;  5FKR A;  3OL2 A;  3UVK A;  3KCI A;  4J0W A;  1GOT B;  4JT6 C;  1QNI A;  2IUQ A;  5GMK n;  4ZOV A;  5EMM B;  3F3F A;  4X63 B;  4K3I D;  3VH0 A;  4ERQ A;  3SLE D;  3ORV D;  3EI4 A;  2OK6 A;  4JSX C;  5EAL A;  2OVP B;  4A11 B;  5AMS A;  3SCY A;  4WK0 A;  4JD2 C;  2OK4 A;  5HE0 B;  4J86 A;  3PSC B;  4J8G A;  1JMZ B;  3CFV A;  4J87 A;  4PXW A;  3V4V A;  3MMY A;  4ERY A;  3JZH A;  1N6D A;  4A09 B;  3O4I A;  1B9Y A;  3EI3 A;  4QL1 A;  4CI3 A;  3I89 A;  4BCB A;  1RI6 A;  4FAN D;  4BUJ C;  4IRZ A;  3FRX A;  4BP9 A;  3AL8 B;  4PBZ A;  3HFQ A;  2QZP A;  3I8E A;  3ULE C;  1GOG A;  4QAM A;  1C9I A;  4UM9 A;  5EM2 B;  2H6Q A;  2H9N A;  4JSV C;  3EI4 B;  4GQ1 A;  3NVQ A;  1XKS A;  5B4W A;  3J80 g;  2Z2P A;  4LG8 A;  1N6F A;  4Z8L A;  3JAM g;  1YR2 A;  2YB8 B;  4CY1 A;  3SWS D;  2YMU A;  3I8C A;  4U1E I;  4CI2 A;  5AJA A;  3MKQ A;  3RMZ D;  2HXC A;  3K71 A;  4GGD A;  4MK0 B;  5C2W B;  2AGX A;  1M1X A;  1SHY B;  3IIW A;  5FKT A;  2CO0 A;  1N6E A;  1TYE A;  3OKT A;  5FXY A;  1GP2 B;  3MUO A;  3UVO A;  2GC7 A;  3IUM A;  2BKL A;  2H6N A;  4L9O A;  4RE6 A;  3VGZ A;  3FCS A;  1NR0 A;  4DNU A;  4CZX A;  5KDO B;  4A0B A;  3ZDY A;  5HE3 B;  4Z7Q A;  4E54 A;  1VZ2 A;  1UOO A;  2HJ4 A;  5HE1 B;  5IGQ A;  4FA4 D;  1K32 A;  2YBA A;  4O1Q D;  5E6U A;  2AQ5 A;  2XZG A;  3A0F A;  3OKY B;  3SBR A;  3K26 A;  3P4F A;  4NBM A;  1JJU B;  1GXR A;  1U2V C;  3C99 A;  1VE7 A;  3UR4 A;  3SBP A;  2TRC B;  4JHN A;  3T3P A;  2QR5 A;  3JB9 L;  3JRO A;  4BH6 A;  4BP8 A;  2CN3 A;  5K1C C;  4CY5 A;  4Z7O A;  5EAR A;  3IJ0 A;  3I2N A;  2H9P A;  2I3S A;  1YFQ A;  4J8B A;  4PSW B;  4AMZ A;  3K6S A;  5I5J A;  2P9P C;  4X60 B;  2IWF A;  4IA9 A;  3ZDX A;  2YNN A;  3QI0 A;  2P9I C;  1TYQ C;  5EAM A;  3CFS B;  3EI1 B;  2CN2 A;  3IJC A;  2P9K C;  2AGL A;  2XL3 A;  3UKR C;  4BCC A;  4DNW A;  3ZE2 A;  3OL2 B;  1A0R B;  3OKW A;  1NEX B;  3AH8 B;  5EAP A;  2H9L A;  3UVL A;  2VDL A;  2HES X;  4ES0 A;  3I7K A;  4O3T B;  3SJL D;  3O4H A;  5FA5 B;  2IUR A;  1JOF A;  4Z7N A;  3DM0 A;  1H2W A;  5EML B;  5TF2 A;  5IJ8 E;  3FGB A;  1T2X A;  2VDM A;  3KRW B;  4FAV D;  2XE4 A;  3PXW D;  4A2L A;  4E54 B;  3VI4 A;  3GD1 I;  2HU8 A;  2Z2O A;  4A2M A;  3PVW B;  4I79 A;  1XIP A;  2HKR A;  4FA1 D;  4J0X A;  2VDO A;  4J82 A;  1TBG A;  2I0S A;  4O45 A;  4U7A A;  2GC4 A;  2J56 H;  5JWZ A;  5H1M A;  4JT5 C;  1Q47 A;  4XYI A;  2I0R A;  1BPO A;  2QXV A;  4K3J B;  2B5L A;  2H3X A;  4MMZ A;  3NIG A;  4FWW A;  2XYI A;  4NSX A;  3BG0 A;  3VA6 A;  4PNK B;  3SHF A;  3VI3 A;  2QC5 A;  3SMR A;  5IGO A;  1FWX A;  1JV2 A;  1C9L A;  1UTC A;  2VDQ A;  2VC2 A;  2AGZ A;  2HU7 A;  2W18 A;  3E0C A;  1OLZ A;  2VDP A;  3EWE A;  3FCU A;  3CIK B;  3RFG A;  3PXS D;  3RFH A;  3ZE1 A;  4D9S A;  4E5Z B;  3MKS B;  2HKM A;  4A0A B;  2P9L C;  4QT8 A;  3C9C A;  2J55 H;  2P9U C;  4GGA A;  3RN1 D;  4ERZ A;  5K19 A;  3EMH A;  3IUR A;  3B7F A;  3U4Y A;  3I7N A;  3SBQ A;  4CY2 A;  2IWK A;  3PSL A;  1B9X A;  5C9Z B;  2AGW A;  2B5M A;  2AH0 A;  4GM3 A;  2PM7 B;  3MUN A;  2GNQ A;  3PXT D;  1E5T A;  4Y7R A;  2H6K A;  4FA5 D;  3GC3 B;  1XHM A;  3ZE0 A;  4CZV A;  4L1Q D;  2OVR B;  4AN0 A;  1L5G A;  3JPX A;  3J81 g;  4J78 A;  1ERJ A;  3RLM D;  1MG3 A;  3IUL A;  3N0D A;  3N0E A;  4AN1 A;  5M5S A;  3ODT A;  4CY3 A;  1GG2 B;  1O6G A;  4GM9 A;  5H14 A;  2P9N C;  3IUQ A;  1JMX B;  3FM0 A;  5AFU 3;  3NIF A;  2H9M A;  2VDK A;  5C92 A;  3V4P A;  5GXH A;  5I5I A;  5FFG A;  2VDR A;  3OKY A;  4CI1 A;  2B4E A;  2CE9 A;  4JSP C;  3SN6 B;  4WK2 A;  4ZOZ A;  4DNV A;  2HYE A;  3SVW D;  5HQG A;  3O4J A;  4AMY A;  3JRP A;  5M61 A;  4YVD A;  1OMW B;  1MG2 A;  2AGY A;  4JSN C;  4J79 A;  4X61 B;  3IJE A;  4RE5 A;  4XEI C;  3MZL A;  4GQB B;  2HU5 A;  1L0Q A;  3EI2 A;  2G9A A;  3O4G A;  3MXX A;  3KRX B;  3AFC A;  3BG1 A;  5IC7 A;  4HDJ A;  5C2V B;  1SQ9 A;  5FLX g;  5HDB A;  3NVX A;  5CXC A;  4J77 A;  4X3E A;  2PM9 A;  2I0T A;  2H14 A;  4CI8 A;  3I7H A;  3IIY A;  3K27 A;  2Z2N A;  4G56 B;  1GOH A;  1E8N A;  1K8K C;  4PC0 A;  4D0K A;  3AL9 A;  5M5V A;  2PBI B;  5IJ7 E;  3EQ7 A;  3QHY B;  5E6R A;  4GM8 A;  2UZY B;  4FHL A;  4G55 A;  5HE2 B;  3UVN A;  2IUV A;  4H5J A;  4J81 A;  4O2W A;  4LGN A;  4A08 B;  4A0A A;  2H47 A;  2H68 A;  4CC9 A;  1QFM A;  5FKQ A;  4A09 A; 
#chains in the Genus database with same CATH homology
 4TZ4 A;  5CXB B;  3L4O D;  3SXT D;  3C75 H;  2CO0 C;  1VYH C;  4CZY A;  2P9S C;  4ZN4 A;  4R7A B;  5TEF A;  5H17 A;  3C5M A;  4QRJ A;  3RRM C;  1MDA H;  3DXM C;  3NVN A;  4GMB A;  4H5I A;  2EBS A;  5SXM A;  1U4C A;  3MZK A;  2PM9 B;  5HYN B;  2I3T A;  3BWS A;  1R5M A;  1P22 A;  3F3P A;  3OTT A;  4L3G D;  3EI3 B;  3IKO A;  3SFZ A;  5CYK B;  3EI2 B;  2YNO A;  4XYH A;  4IMM A;  4A0B B;  4GGC A;  5GXI A;  3EG6 A;  3EU7 A;  2J57 G;  4ZOX A;  1PEV A;  4J73 A;  4UI9 R;  4EWR A;  4GZ8 A;  1S4U X;  1PGU A;  3L4M D;  3RSE C;  2MTA H;  3RN0 D;  2UZX B;  4QQE A;  4ZOY A;  5FKS A;  4AOW A;  2G99 A;  4OZU A;  3OW8 A;  5CXB A;  4KFM B;  5CYK A;  3I7P A;  5THA A;  4D6V A;  2B5N A;  2BCJ B;  3DWL C;  3PVU B;  5EMJ B;  3JZN A;  5GSA A;  4OWR A;  5FQD A;  3UVM A;  5I5M A;  4N14 A;  3PE7 A;  3AL8 A;  3I7L A;  3DXK C;  5CXC B;  5A2Q g;  4FA9 D;  5EMK B;  4E5Z A;  4O3U B;  3EI1 A;  2OIZ A;  2CE8 A;  2OVQ B;  4PSX B;  2Q7Q A;  3F3G A;  4AEZ A;  5IT9 g;  2CNX A;  4FB1 D;  4J84 A;  2YNP A;  3UKU C;  3V5W B;  1PI6 A;  4A7J A;  4Y5R D;  4A08 A;  2BBK H;  4ESG A;  3IJ1 A;  3V7D B;  4BL0 A;  4O9D A;  2O9K A;  5EM2 A;  2XU7 A;  3I7O A;  4L3H D;  3ZWL B;  2AH1 A;  2HJB A;  4PBY A;  2OJY A;  4A11 A;  3GFC A;  3JZG A;  4JXM A;  4GQ2 P;  3V9F A;  5TEE A;  2IUP A;  2PM6 B;  3DSM A;  5TDH B;  2XL2 A;  1SQJ A;  1PBY B;  4LG9 A;  2H13 A;  3W15 A;  2IAA A;  3GRE A;  5FKR A;  3OL2 A;  3UVK A;  4J0W A;  1GOT B;  4JT6 C;  1QNI A;  2IUQ A;  5GMK n;  4ZOV A;  5EMM B;  3F3F A;  4X63 B;  4K3I D;  3VH0 A;  4ERQ A;  3SLE D;  3ORV D;  3EI4 A;  2OK6 A;  4JSX C;  5EAL A;  2OVP B;  4A11 B;  5AMS A;  3SCY A;  4JD2 C;  2OK4 A;  5HE0 B;  4J86 A;  3PSC B;  4J8G A;  1JMZ B;  3CFV A;  4J87 A;  4PXW A;  3MMY A;  4ERY A;  3JZH A;  1N6D A;  4A09 B;  1B9Y A;  3EI3 A;  4QL1 A;  4CI3 A;  3I89 A;  1RI6 A;  4FAN D;  4BUJ C;  3FRX A;  3AL8 B;  4PBZ A;  3HFQ A;  3I8E A;  3ULE C;  5EM2 B;  2H6Q A;  2H9N A;  4JSV C;  3EI4 B;  4GQ1 A;  3NVQ A;  1XKS A;  5B4W A;  3J80 g;  2Z2P A;  4LG8 A;  1N6F A;  4Z8L A;  3JAM g;  2YB8 B;  4CY1 A;  3SWS D;  2YMU A;  3I8C A;  4U1E I;  4CI2 A;  5AJA A;  3MKQ A;  3RMZ D;  2HXC A;  4GGD A;  4MK0 B;  5C2W B;  2AGX A;  1SHY B;  3IIW A;  5FKT A;  2CO0 A;  1N6E A;  3OKT A;  5FXY A;  1GP2 B;  3UVO A;  2GC7 A;  2H6N A;  3VGZ A;  4L9O A;  1NR0 A;  4CZX A;  5KDO B;  4A0B A;  5HE3 B;  4E54 A;  2HJ4 A;  5HE1 B;  5IGQ A;  4FA4 D;  1K32 A;  2YBA A;  4O1Q D;  2AQ5 A;  3A0F A;  3OKY B;  3SBR A;  3K26 A;  3P4F A;  1JJU B;  1GXR A;  1U2V C;  3C99 A;  3UR4 A;  3SBP A;  2TRC B;  3JB9 L;  3JRO A;  4BH6 A;  2CN3 A;  5K1C C;  4CY5 A;  5EAR A;  3IJ0 A;  3I2N A;  2H9P A;  2I3S A;  1YFQ A;  4J8B A;  4PSW B;  5I5J A;  2P9P C;  4X60 B;  2IWF A;  4IA9 A;  2YNN A;  2P9I C;  1TYQ C;  5EAM A;  3CFS B;  3EI1 B;  2CN2 A;  3IJC A;  2P9K C;  2AGL A;  2XL3 A;  3UKR C;  3OL2 B;  1A0R B;  3OKW A;  1NEX B;  3AH8 B;  5EAP A;  2H9L A;  3UVL A;  2HES X;  4ES0 A;  3I7K A;  4O3T B;  3SJL D;  5FA5 B;  2IUR A;  1JOF A;  3DM0 A;  5EML B;  5TF2 A;  5IJ8 E;  3FGB A;  3KRW B;  4FAV D;  3PXW D;  4A2L A;  4E54 B;  2Z2O A;  4A2M A;  3PVW B;  4I79 A;  1XIP A;  2HKR A;  4FA1 D;  4J0X A;  4J82 A;  1TBG A;  2I0S A;  4O45 A;  4U7A A;  2GC4 A;  2J56 H;  5JWZ A;  5H1M A;  4JT5 C;  1Q47 A;  4XYI A;  2I0R A;  2QXV A;  4K3J B;  2B5L A;  2H3X A;  4NSX A;  4FWW A;  2XYI A;  3BG0 A;  3VA6 A;  4PNK B;  3SHF A;  2QC5 A;  3SMR A;  5IGO A;  1FWX A;  2AGZ A;  2W18 A;  3E0C A;  1OLZ A;  3EWE A;  3CIK B;  3RFG A;  3PXS D;  3RFH A;  4E5Z B;  3MKS B;  2HKM A;  4A0A B;  2P9L C;  4QT8 A;  3C9C A;  2J55 H;  2P9U C;  4GGA A;  3RN1 D;  4ERZ A;  5K19 A;  3EMH A;  3B7F A;  3U4Y A;  3I7N A;  3SBQ A;  4CY2 A;  2IWK A;  3PSL A;  1B9X A;  5C9Z B;  2AGW A;  2B5M A;  2AH0 A;  4GM3 A;  2PM7 B;  2GNQ A;  3PXT D;  4Y7R A;  2H6K A;  4FA5 D;  1XHM A;  4CZV A;  4L1Q D;  2OVR B;  3JPX A;  3J81 g;  4J78 A;  1ERJ A;  3RLM D;  1MG3 A;  3N0D A;  3N0E A;  3ODT A;  4CY3 A;  1GG2 B;  4GM9 A;  5H14 A;  2P9N C;  1JMX B;  3FM0 A;  5AFU 3;  2H9M A;  5GXH A;  5I5I A;  3OKY A;  4CI1 A;  2B4E A;  2CE9 A;  4JSP C;  3SN6 B;  4ZOZ A;  2HYE A;  3SVW D;  5HQG A;  3JRP A;  4YVD A;  1OMW B;  1MG2 A;  2AGY A;  4JSN C;  4J79 A;  4X61 B;  4XEI C;  3MZL A;  4GQB B;  1L0Q A;  3EI2 A;  2G9A A;  3MXX A;  3KRX B;  3AFC A;  3BG1 A;  5IC7 A;  4HDJ A;  5C2V B;  1SQ9 A;  5FLX g;  3NVX A;  4J77 A;  4X3E A;  2PM9 A;  2I0T A;  2H14 A;  4CI8 A;  3I7H A;  3IIY A;  3K27 A;  2Z2N A;  4G56 B;  1K8K C;  4PC0 A;  4D0K A;  3AL9 A;  2PBI B;  5IJ7 E;  4GM8 A;  2UZY B;  4FHL A;  5HE2 B;  3UVN A;  2IUV A;  4H5J A;  4J81 A;  4LGN A;  4A08 B;  4A0A A;  2H47 A;  2H68 A;  4CC9 A;  5CXC A;  5FKQ A;  4A09 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...