3RN1D

Crystal structure of the w199e-maug/pre-methylamine dehydrogenase complex
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
376
structure length
376
Chain Sequence
b'QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Mutagenesis of tryptophan199 reveals that electron hopping is required for MauG-dependent tryptophan tryptophylquinone biosynthesis
rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 93
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2011-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3rn1D00
5A2Qg 4A2MA 3I7KA 5IC7A 4FAND 3DM0A 3PVWB 3N0DA 5TF2A 5FKQA 4GQ1A 1MG3A 2P9LC 4FAVD 3B7FA 3K27A 4O1QD 5FXYA 1U2VC 4QRJA 1N6EA 2CN3A 3JZGA 2HYEA 5AMSA 2Z2PA 3IIYA 2XL3A 4ES0A 1GP2B 3BG0A 2BBKH 3EG6A 1PI6A 3EI1B 2UZYB 1N6FA 3OKYB 3RRMC 3EU7A 2YNNA 5TEFA 5FLXg 3OW8A 3SJLD 4XYIA 3PXTD 4GZ8A 4ZOZA 4D0KA 2CE9A 4JT6C 5GMKn 4GM8A 4BUJC 5I5JA 3AL8A 4H5IA 3KRXB 1SQJA 4I79A 2J56H 4J0WA 4GM3A 4BL0A 1RI6A 3UKUC 3NVQA 4GMBA 2H3XA 3JAMg 1S4UX 3IIWA 3UKRC 3OKWA 4A0AB 3F3FA 2MTAH 3VA6A 4GGDA 4E5ZA 2CO0A 4J81A 1SQ9A 4JSNC 4FA5D 4L9OA 2AGWA 4ZOVA 5JWZA 3J81g 5K19A 3EI3B 2IWKA 5EMMB 2BCJB 3VGZA 4ERQA 4Y7RA 2UZXB 2H13A 2O9KA 4UI9R 1R5MA 5GSAA 3MZLA 3BG1A 3UVOA 2AH0A 4G56B 1XKSA 1B9XA 2PM9A 4O45A 2IAAA 3UR4A 2CE8A 2IUPA 4J79A 3V5WB 4ZN4A 5I5MA 4PNKB 5B4WA 3EI2B 1N6DA 2PBIB 4HDJA 1U4CA 4E54B 2HJBA 3PXSD 5FKRA 1SHYB 2P9PC 1JOFA 2P9NC 4YVDA 3KRWB 4L1QD 5HE0B 3I2NA 4TZ4A 4AEZA 5EAPA 1TYQC 4A11A 3EI4B 5FA5B 4GQBB 4A7JA 2PM6B 4H5JA 5EM2A 3OKTA 2HKMA 5FKTA 5AFU3 5EMLB 3DXMC 3SXTD 1YFQA 2H9LA 2P9KC 2H6QA 5C2WB 5IJ8E 2J57G 2IURA 3SCYA 4BH6A 4CY3A 5HYNB 4Z8LA 4FA9D 1JMXB 2GNQA 2AGYA 5HE1B 2YB8B 3JZNA 4J8BA 5H14A 2XYIA 2QXVA 2IUQA 3SMRA 1VYHC 5TDHB 5C9ZB 3EI1A 3L4MD 3BWSA 5EMJB 4CI1A 3SFZA 2P9SC 5KDOB 5IGOA 3EWEA 1XHMA 5CYKB 4JT5C 3FRXA 2I3TA 3PSCB 4QT8A 4ESGA 1MDAH 5CXBA 4CI3A 2YMUA 3SHFA 1NEXB 4D6VA 2H9MA 3ODTA 2G9AA 2J55H 3AL8B 4J0XA 5GXIA 1TBGA 4GM9A 3J80g 2HESX 2I0SA 4A0AA 3JRPA 4A0BB 4A08B 3GREA 3PXWD 4A2LA 1JMZB 4ERYA 1MG2A 2HXCA 4N14A 5K1CC 3C99A 4NSXA 4JD2C 3E0CA 3MXXA 3RLMD 4E5ZB 3F3PA 4X63B 2YNOA 4K3JB 4X60B 3FM0A 4J82A 1PBYB 5IT9g 3EI3A 2OK6A 4A09A 4JSXC 3W15A 4K3ID 3UVLA 3RFGA 4GGAA 4O9DA 2QC5A 5EARA 5TEEA 3OL2B 4U7AA 5HE2B 5H17A 3V9FA 5GXHA 3I7LA 4ZOXA 3A0FA 3IJ0A 3SWSD 3ORVD 3MKQA 4QL1A 3CIKB 3IJCA 4PSXB 4EWRA 3VH0A 3V7DB 3I89A 4FWWA 3ULEC 3EI2A 4X3EA 4U1EI 1NR0A 2P9UC 4E54A 1Q47A 2AH1A 2CN2A 3GFCA 3I8CA 3RMZD 4OWRA 2OVRB 4AOWA 4XEIC 2H68A 2Z2NA 3DWLC 2PM7B 2TRCB 2CO0C 3I8EA 3EI4A 3DSMA 2OJYA 5FKSA 5CXCB 2OVPB 4A11B 1GXRA 1QNIA 4JXMA 4J77A 4J86A 4FHLA 4QQEA 5EALA 3SBRA 4CY1A 4CY2A 2B4EA 4L3GD 5HE3B 4CI2A 3F3GA 4GGCA 2Z2OA 3K26A 1OMWB 5EM2B 1K8KC 3SVWD 2P9IC 1PGUA 2H6KA 3JPXA 3SBQA 3RN1D 2I0TA 2AGLA 5EMKB 2HKRA 4PSWB 3PE7A 5IJ7E 5C2VB 4JSVC 3C9CA 2XU7A 4O3TB 3RFHA 3ZWLB 5THAA 4X61B 2IWFA 3MKSB 1L0QA 3NVNA 1PEVA 4CZVA 4J73A 4KFMB 4Y5RD 3P4FA 3MMYA 3OKYA 1B9YA 3FGBA 3MZKA 4PC0A 3N0EA 4MK0B 2W18A 3HFQA 3L4OD 4R7AB 5CYKA 2AQ5A 2YNPA 4PBZA 2Q7QA 3C75H 2H14A 1K32A 2IUVA 2G99A 2H9PA 5CXBB 4IMMA 3CFVA 3PVUB 2CNXA 2B5LA 3EMHA 3SBPA 4ERZA 5FQDA 2I0RA 4LGNA 2OK4A 1ERJA 4A0BA 4ZOYA 2GC4A 4J87A 4XYHA 1A0RB 4A08A 4FA1D 5EAMA 5H1MA 3DXKC 4LG9A 4CI8A 2XL2A 3RN0D 4J78A 5IGQA 3OTTA 3C5MA 3I7HA 4FA4D 4OZUA 3UVMA 2B5MA 3AFCA 2OVQB 4A09B 3OL2A 3SLED 4CZYA 2I3SA 4CC9A 1P22A 4L3HD 4PXWA 2AGXA 1OLZA 2PM9B 3UVKA 3IJ1A 4J84A 2AGZA 4J8GA 3JB9L 4O3UB 2YBAA 3AH8B 3I7NA 3IKOA 4FB1D 4CZXA 3PSLA 4GQ2P 2OIZA 1JJUB 3NVXA 3I7PA 3U4YA 1FWXA 3RSEC 2GC7A 3JROA 5AJAA 5HQGA 4JSPC 3UVNA 3JZHA 5CXCA 4LG8A 4IA9A 1GG2B 3I7OA 2H6NA 2B5NA 1XIPA 3SN6B 5I5IA 2EBSA 3AL9A 3CFSB 4CY5A 2HJ4A 4PBYA 5SXMA 2H9NA 1GOTB 2H47A
chains in the Genus database with same CATH superfamily
5A2Qg 4A2MA 3I7KA 4WK4A 3MUNA 5IC7A 1E5TA 3DM0A 4FAND 3PVWB 3N0DA 5TF2A 5FKQA 4GQ1A 1MG3A 2P9LC 1GOGA 4FAVD 3EQ9A 3B7FA 3K27A 5M5UA 4AMYA 4O1QD 5FXYA 2XE4A 4Z7NA 1U2VC 2VDPA 4QRJA 1N6EA 2CN3A 3JZGA 2HYEA 5AMSA 2Z2PA 3IIYA 2XL3A 4ES0A 1GP2B 3BG0A 2BBKH 3EG6A 1PI6A 3EI1B 2UZYB 1C9IA 1N6FA 3OKYB 3RRMC 3EU7A 2YNNA 5TEFA 5FLXg 3OW8A 3SJLD 4XYIA 3PXTD 4GZ8A 4ZOZA 4D0KA 2VDLA 2CE9A 4JT6C 5GMKn 4GM8A 4BUJC 5I5JA 4RE5A 3AL8A 4H5IA 3KRXB 1SQJA 4AX4A 4I79A 2J56H 4J0WA 4GM3A 4BL0A 1RI6A 3UKUC 3NVQA 2JKXA 3OF7A 1UTCA 4GMBA 2EICA 2H3XA 3JAMg 1S4UX 3IIWA 3UKRC 3OKWA 4A0AB 3F3FA 2MTAH 3VA6A 5E6SA 4GGDA 4E5ZA 4MMZA 2CO0A 4J81A 1JTDB 1SQ9A 3ZDYA 3O4JA 4JSNC 4FA5D 4L9OA 2AGWA 4ZOVA 4UM9A 1O6FA 5JWZA 3J81g 5FFGA 5K19A 3EI3B 3FCUA 2IWKA 2VDNA 5EMMB 2BCJB 3IURA 3O4IA 2HU8A 3VGZA 4ERQA 3T3PA 4Y7RA 2UZXB 2H13A 2O9KA 4UI9R 1R5MA 5GSAA 3MZLA 3BG1A 3IUMA 3UVOA 2AH0A 4G56B 1XKSA 1B9XA 5M5TA 2PM9A 4O45A 2IAAA 3UR4A 2CE8A 2IUPA 1A12A 4J79A 3V5WB 3QI0A 4ZN4A 4PNKB 5I5MA 5B4WA 3EI2B 1N6DA 2EIDA 2PBIB 4HDJA 1U4CA 4E54B 2HJBA 3PXSD 5FKRA 1SHYB 2P9PC 1JOFA 2P9NC 4YVDA 3KRWB 4L1QD 5HE0B 3VI4A 3I2NA 4TZ4A 4AEZA 1VE7A 5EAPA 3K71A 4AN0A 1TYQC 4A11A 3EI4B 2XDWA 1E8MA 1YR2A 5FA5B 4GQBB 4A7JA 4D9SA 2VDKA 2PM6B 4H5JA 5EM2A 3OKTA 3GD1I 2HKMA 5FKTA 4Z7QA 5AFU3 4JHNA 5EMLB 3DXMC 3SXTD 1YFQA 4G1MA 2H9LA 4IRZA 2P9KC 2H6QA 5C2WB 5IJ8E 2J57G 2IURA 3SCYA 4BH6A 3GC3B 4UM8A 4CY3A 5HYNB 4Z8LA 4FA9D 1JMXB 2GNQA 2AGYA 5HE1B 3MVDK 2YB8B 3JZNA 4J8BA 5H14A 2XYIA 2QXVA 2IUQA 2QR5A 1H2ZA 4DNWA 3SMRA 1VYHC 5TDHB 5C9ZB 3EI1A 3L4MD 3BWSA 5EMJB 4CI1A 3O4GA 2P9SC 3SFZA 5KDOB 5IGOA 1VZ3A 3EWEA 1XHMA 5CYKB 4JT5C 3FRXA 2I3TA 5M61A 3PSCB 4QT8A 4ESGA 1MDAH 5CXBA 4CI3A 5C86A 2YMUA 3SHFA 1NEXB 4D6VA 2H9MA 3ODTA 2G9AA 2J55H 3AL8B 4J0XA 5GXIA 1QFMA 5M5VA 1TBGA 1I2MB 4GM9A 4DNVA 3ZDXA 3J80g 2HESX 2I0SA 5E6RA 4Z7OA 4A0AA 3JRPA 4A0BB 4O2WA 4A08B 3GREA 3K72A 3ZE1A 2VZ1A 3PXWD 4MMXA 4A2LA 1M1XA 1JMZB 4ERYA 1MG2A 2HXCA 4N14A 5K1CC 3C99A 4NSXA 4JD2C 2VZ3A 3E0CA 3MUOA 4G1EA 5HDBA 3MXXA 3RLMD 4E5ZB 3F3PA 4X63B 3V4PA 2YNOA 4K3JB 4X60B 3FM0A 4J82A 1PBYB 2VDQA 5IT9g 3EI3A 2OK6A 4A09A 4JSXC 3W15A 4K3ID 3UVLA 3RFGA 4GGAA 4O9DA 2QC5A 5EARA 5TEEA 4BCDA 3OL2B 2HU7A 4U7AA 5H17A 5HE2B 3V9FA 3IJEA 5GXHA 3I7LA 4ZOXA 3A0FA 3IJ0A 5C92A 3SWSD 3ORVD 3MKQA 1K3IA 4QL1A 3CIKB 3EQ8A 3IJCA 4PSXB 2VDMA 4EWRA 3V7DB 3VH0A 3I89A 4FWWA 3ULEC 3EI2A 4X3EA 4U1EI 1NR0A 2P9UC 4E54A 1Q47A 2AH1A 1H2XA 2CN2A 3IUNA 4NBMA 3GFCA 3I8CA 3RMZD 4OWRA 1BPOA 2OVRB 4AOWA 4RE6A 4XEIC 2H68A 2QZPA 2Z2NA 3DWLC 2PM7B 2TRCB 2CO0C 3I8EA 3EI4A 5FFOA 3DSMA 2OJYA 1VE6A 5FKSA 3ZE0A 5CXCB 2OVPB 4A11B 2BKLA 4AN1A 1GXRA 1QNIA 4JXMA 3ZDZA 4J77A 4J86A 4FHLA 4QQEA 5EALA 3SBRA 4CY1A 4CY2A 2B4EA 3KCIA 4L3GD 5HE3B 4CI2A 1L5GA 3F3GA 4GGCA 2Z2OA 3K26A 1OMWB 5EM2B 1K8KC 3SVWD 2P9IC 1PGUA 2H6KA 3JPXA 2EIBA 4MMYA 3RN1D 3SBQA 1O6GA 2I0TA 2AGLA 5EMKB 3V4VA 2HKRA 4PSWB 3PE7A 5IJ7E 5C2VB 4JSVC 3C9CA 4WK2A 2XU7A 4O3TB 3RFHA 2VDOA 3ZWLB 5THAA 4X61B 2XZGA 2IWFA 3IVMA 3MKSB 1L0QA 3NVNA 1PEVA 4CZVA 4J73A 4KFMB 1UOPA 4Y5RD 4L1MA 2HU5A 3P4FA 3EQ7A 3MMYA 3OKYA 1B9YA 3FGBA 3MZKA 4PC0A 5M5SA 3N0EA 4DNUA 4MK0B 4BP8A 2W18A 3HFQA 3L4OD 1TYEA 1GOHA 4R7AB 1T2XA 3DDUA 3ZE2A 5CYKA 2AQ5A 2YNPA 4PBZA 2Q7QA 3IUQA 1JV2A 3C75H 2H14A 1K32A 2IUVA 2G99A 2H9PA 5CXBB 1GOFA 4IMMA 3CFVA 4G55A 3PVUB 2CNXA 2B5LA 3EMHA 3SBPA 4ERZA 5FQDA 2I0RA 4LGNA 3FCSA 2OK4A 1ERJA 1VZ2A 4A0BA 4ZOYA 2GC4A 4J87A 4XYHA 1A0RB 4A08A 4FA1D 5EAMA 5E6UA 4QAMA 5H1MA 3DXKC 4LG9A 4CI8A 2WQ8A 2XL2A 3NIGA 3RN0D 4J78A 5IGQA 3OTTA 3NIFA 4BP9A 3C5MA 3I7HA 4FA4D 4OZUA 3UVMA 2B5MA 3AFCA 4NAAA 2OVQB 4A09B 3O4HA 3OL2A 3SLED 4CZYA 2I3SA 4CC9A 5M5RA 3VI3A 1P22A 4L3HD 3K6SA 4PXWA 2AGXA 1U8CA 1OLZA 2PM9B 3UVKA 4BCBA 3IJ1A 3QHYB 4J84A 2AGZA 4J8GA 3JB9L 2EIEA 4O3UB 4WJKA 2YBAA 3AH8B 3I7NA 2VDRA 3IKOA 4FB1D 4CZXA 3PSLA 1UOQA 3IUJA 4GQ2P 4BCCA 2OIZA 3NIDA 1JJUB 3NVXA 3I7PA 4NENA 1H2YA 3U4YA 1FWXA 2VC2A 3RSEC 2GC7A 3JROA 1C9LA 5AJAA 5HQGA 4JSPC 4JHPC 3UVNA 3JZHA 5CXCA 1UOOA 4LG8A 1GG2B 3I7OA 4IA9A 2H6NA 4AMZA 1E8NA 2B5NA 4NC4A 3T3MA 4WK0A 4O02A 1XIPA 3IULA 3SN6B 5I5IA 2EBSA 3AL9A 3CFSB 4CY5A 2HJ4A 4PBYA 1H2WA 1QFSA 5SXMA 2H9NA 1GOTB 2H47A
chains in the Genus database with same CATH topology
5A2Qg 4A2MA 3I7KA 5IC7A 4FAND 3DM0A 3PVWB 3N0DA 5TF2A 5FKQA 4GQ1A 1MG3A 2P9LC 4FAVD 3B7FA 3K27A 4O1QD 5FXYA 1U2VC 4QRJA 1N6EA 2CN3A 3JZGA 2HYEA 5AMSA 2Z2PA 3IIYA 2XL3A 4ES0A 1GP2B 3BG0A 2BBKH 3EG6A 1PI6A 3EI1B 2UZYB 1N6FA 3OKYB 3RRMC 3EU7A 2YNNA 5TEFA 5FLXg 3OW8A 3SJLD 4XYIA 3PXTD 4GZ8A 4ZOZA 4D0KA 2CE9A 4JT6C 5GMKn 4GM8A 4BUJC 5I5JA 3AL8A 4H5IA 3KRXB 1SQJA 4I79A 2J56H 4J0WA 4GM3A 4BL0A 1RI6A 3UKUC 3NVQA 4GMBA 2H3XA 3JAMg 1S4UX 3IIWA 3UKRC 3OKWA 4A0AB 3F3FA 2MTAH 3VA6A 4GGDA 4E5ZA 2CO0A 4J81A 1SQ9A 4JSNC 4FA5D 4L9OA 2AGWA 4ZOVA 5JWZA 3J81g 5K19A 3EI3B 2IWKA 5EMMB 2BCJB 3VGZA 4ERQA 4Y7RA 2UZXB 2H13A 2O9KA 4UI9R 1R5MA 5GSAA 3MZLA 3BG1A 3UVOA 2AH0A 4G56B 1XKSA 1B9XA 2PM9A 4O45A 2IAAA 3UR4A 2CE8A 2IUPA 4J79A 3V5WB 4ZN4A 5I5MA 4PNKB 5B4WA 3EI2B 1N6DA 2PBIB 4HDJA 1U4CA 4E54B 2HJBA 3PXSD 5FKRA 1SHYB 2P9PC 1JOFA 2P9NC 4YVDA 3KRWB 4L1QD 5HE0B 3I2NA 4TZ4A 4AEZA 5EAPA 1TYQC 4A11A 3EI4B 5FA5B 4GQBB 4A7JA 2PM6B 4H5JA 5EM2A 3OKTA 2HKMA 5FKTA 5AFU3 5EMLB 3DXMC 3SXTD 1YFQA 2H9LA 2P9KC 2H6QA 5C2WB 5IJ8E 2J57G 2IURA 3SCYA 4BH6A 4CY3A 5HYNB 4Z8LA 4FA9D 1JMXB 2GNQA 2AGYA 5HE1B 2YB8B 3JZNA 4J8BA 5H14A 2XYIA 2QXVA 2IUQA 3SMRA 1VYHC 5TDHB 5C9ZB 3EI1A 3L4MD 3BWSA 5EMJB 4CI1A 3SFZA 2P9SC 5KDOB 5IGOA 3EWEA 1XHMA 5CYKB 4JT5C 3FRXA 2I3TA 3PSCB 4QT8A 4ESGA 1MDAH 5CXBA 4CI3A 2YMUA 3SHFA 1NEXB 4D6VA 2H9MA 3ODTA 2G9AA 2J55H 3AL8B 4J0XA 5GXIA 1TBGA 4GM9A 3J80g 2HESX 2I0SA 4A0AA 3JRPA 4A0BB 4A08B 3GREA 3PXWD 4A2LA 1JMZB 4ERYA 1MG2A 2HXCA 4N14A 5K1CC 3C99A 4NSXA 4JD2C 3E0CA 3MXXA 3RLMD 4E5ZB 3F3PA 4X63B 2YNOA 4K3JB 4X60B 3FM0A 4J82A 1PBYB 5IT9g 3EI3A 2OK6A 4A09A 4JSXC 3W15A 4K3ID 3UVLA 3RFGA 4GGAA 4O9DA 2QC5A 5EARA 5TEEA 3OL2B 4U7AA 5HE2B 5H17A 3V9FA 5GXHA 3I7LA 4ZOXA 3A0FA 3IJ0A 3SWSD 3ORVD 3MKQA 4QL1A 3CIKB 3IJCA 4PSXB 4EWRA 3VH0A 3V7DB 3I89A 4FWWA 3ULEC 3EI2A 4X3EA 4U1EI 1NR0A 2P9UC 4E54A 1Q47A 2AH1A 2CN2A 3GFCA 3I8CA 3RMZD 4OWRA 2OVRB 4AOWA 4XEIC 2H68A 2Z2NA 3DWLC 2PM7B 2TRCB 2CO0C 3I8EA 3EI4A 3DSMA 2OJYA 5FKSA 5CXCB 2OVPB 4A11B 1GXRA 1QNIA 4JXMA 4J77A 4J86A 4FHLA 4QQEA 5EALA 3SBRA 4CY1A 4CY2A 2B4EA 4L3GD 5HE3B 4CI2A 3F3GA 4GGCA 2Z2OA 3K26A 1OMWB 5EM2B 1K8KC 3SVWD 2P9IC 1PGUA 2H6KA 3JPXA 3SBQA 3RN1D 2I0TA 2AGLA 5EMKB 2HKRA 4PSWB 3PE7A 5IJ7E 5C2VB 4JSVC 3C9CA 2XU7A 4O3TB 3RFHA 3ZWLB 5THAA 4X61B 2IWFA 3MKSB 1L0QA 3NVNA 1PEVA 4CZVA 4J73A 4KFMB 4Y5RD 3P4FA 3MMYA 3OKYA 1B9YA 3FGBA 3MZKA 4PC0A 3N0EA 4MK0B 2W18A 3HFQA 3L4OD 4R7AB 5CYKA 2AQ5A 2YNPA 4PBZA 2Q7QA 3C75H 2H14A 1K32A 2IUVA 2G99A 2H9PA 5CXBB 4IMMA 3CFVA 3PVUB 2CNXA 2B5LA 3EMHA 3SBPA 4ERZA 5FQDA 2I0RA 4LGNA 2OK4A 1ERJA 4A0BA 4ZOYA 2GC4A 4J87A 4XYHA 1A0RB 4A08A 4FA1D 5EAMA 5H1MA 3DXKC 4LG9A 4CI8A 2XL2A 3RN0D 4J78A 5IGQA 3OTTA 3C5MA 3I7HA 4FA4D 4OZUA 3UVMA 2B5MA 3AFCA 2OVQB 4A09B 3OL2A 3SLED 4CZYA 2I3SA 4CC9A 1P22A 4L3HD 4PXWA 2AGXA 1OLZA 2PM9B 3UVKA 3IJ1A 4J84A 2AGZA 4J8GA 3JB9L 4O3UB 2YBAA 3AH8B 3I7NA 3IKOA 4FB1D 4CZXA 3PSLA 4GQ2P 2OIZA 1JJUB 3NVXA 3I7PA 3U4YA 1FWXA 3RSEC 2GC7A 3JROA 5AJAA 5HQGA 4JSPC 3UVNA 3JZHA 5CXCA 4LG8A 4IA9A 1GG2B 3I7OA 2H6NA 2B5NA 1XIPA 3SN6B 5I5IA 2EBSA 3AL9A 3CFSB 4CY5A 2HJ4A 4PBYA 5SXMA 2H9NA 1GOTB 2H47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A2Q g;  4A2M A;  3I7K A;  5IC7 A;  4FAN D;  3DM0 A;  3PVW B;  3N0D A;  5TF2 A;  5FKQ A;  4GQ1 A;  1MG3 A;  2P9L C;  4FAV D;  3B7F A;  3K27 A;  4O1Q D;  5FXY A;  1U2V C;  4QRJ A;  1N6E A;  2CN3 A;  3JZG A;  2HYE A;  5AMS A;  2Z2P A;  3IIY A;  2XL3 A;  4ES0 A;  1GP2 B;  3BG0 A;  2BBK H;  3EG6 A;  1PI6 A;  3EI1 B;  2UZY B;  1N6F A;  3OKY B;  3RRM C;  3EU7 A;  2YNN A;  5TEF A;  5FLX g;  3OW8 A;  3SJL D;  4XYI A;  3PXT D;  4GZ8 A;  4ZOZ A;  4D0K A;  2CE9 A;  4JT6 C;  5GMK n;  4GM8 A;  4BUJ C;  5I5J A;  3AL8 A;  4H5I A;  3KRX B;  1SQJ A;  4I79 A;  2J56 H;  4J0W A;  4GM3 A;  4BL0 A;  1RI6 A;  3UKU C;  3NVQ A;  4GMB A;  2H3X A;  3JAM g;  1S4U X;  3IIW A;  3UKR C;  3OKW A;  4A0A B;  3F3F A;  2MTA H;  3VA6 A;  4GGD A;  4E5Z A;  2CO0 A;  4J81 A;  1SQ9 A;  4JSN C;  4FA5 D;  4L9O A;  2AGW A;  4ZOV A;  5JWZ A;  3J81 g;  5K19 A;  3EI3 B;  2IWK A;  5EMM B;  2BCJ B;  3VGZ A;  4ERQ A;  4Y7R A;  2UZX B;  2H13 A;  2O9K A;  4UI9 R;  1R5M A;  5GSA A;  3MZL A;  3BG1 A;  3UVO A;  2AH0 A;  4G56 B;  1XKS A;  1B9X A;  2PM9 A;  4O45 A;  2IAA A;  3UR4 A;  2CE8 A;  2IUP A;  4J79 A;  3V5W B;  4ZN4 A;  5I5M A;  4PNK B;  5B4W A;  3EI2 B;  1N6D A;  2PBI B;  4HDJ A;  1U4C A;  4E54 B;  2HJB A;  3PXS D;  5FKR A;  1SHY B;  2P9P C;  1JOF A;  2P9N C;  4YVD A;  3KRW B;  4L1Q D;  5HE0 B;  3I2N A;  4TZ4 A;  4AEZ A;  5EAP A;  1TYQ C;  4A11 A;  3EI4 B;  5FA5 B;  4GQB B;  4A7J A;  2PM6 B;  4H5J A;  5EM2 A;  3OKT A;  2HKM A;  5FKT A;  5AFU 3;  5EML B;  3DXM C;  3SXT D;  1YFQ A;  2H9L A;  2P9K C;  2H6Q A;  5C2W B;  5IJ8 E;  2J57 G;  2IUR A;  3SCY A;  4BH6 A;  4CY3 A;  5HYN B;  4Z8L A;  4FA9 D;  1JMX B;  2GNQ A;  2AGY A;  5HE1 B;  2YB8 B;  3JZN A;  4J8B A;  5H14 A;  2XYI A;  2QXV A;  2IUQ A;  3SMR A;  1VYH C;  5TDH B;  5C9Z B;  3EI1 A;  3L4M D;  3BWS A;  5EMJ B;  4CI1 A;  3SFZ A;  2P9S C;  5KDO B;  5IGO A;  3EWE A;  1XHM A;  5CYK B;  4JT5 C;  3FRX A;  2I3T A;  3PSC B;  4QT8 A;  4ESG A;  1MDA H;  5CXB A;  4CI3 A;  2YMU A;  3SHF A;  1NEX B;  4D6V A;  2H9M A;  3ODT A;  2G9A A;  2J55 H;  3AL8 B;  4J0X A;  5GXI A;  1TBG A;  4GM9 A;  3J80 g;  2HES X;  2I0S A;  4A0A A;  3JRP A;  4A0B B;  4A08 B;  3GRE A;  3PXW D;  4A2L A;  1JMZ B;  4ERY A;  1MG2 A;  2HXC A;  4N14 A;  5K1C C;  3C99 A;  4NSX A;  4JD2 C;  3E0C A;  3MXX A;  3RLM D;  4E5Z B;  3F3P A;  4X63 B;  2YNO A;  4K3J B;  4X60 B;  3FM0 A;  4J82 A;  1PBY B;  5IT9 g;  3EI3 A;  2OK6 A;  4A09 A;  4JSX C;  3W15 A;  4K3I D;  3UVL A;  3RFG A;  4GGA A;  4O9D A;  2QC5 A;  5EAR A;  5TEE A;  3OL2 B;  4U7A A;  5HE2 B;  5H17 A;  3V9F A;  5GXH A;  3I7L A;  4ZOX A;  3A0F A;  3IJ0 A;  3SWS D;  3ORV D;  3MKQ A;  4QL1 A;  3CIK B;  3IJC A;  4PSX B;  4EWR A;  3VH0 A;  3V7D B;  3I89 A;  4FWW A;  3ULE C;  3EI2 A;  4X3E A;  4U1E I;  1NR0 A;  2P9U C;  4E54 A;  1Q47 A;  2AH1 A;  2CN2 A;  3GFC A;  3I8C A;  3RMZ D;  4OWR A;  2OVR B;  4AOW A;  4XEI C;  2H68 A;  2Z2N A;  3DWL C;  2PM7 B;  2TRC B;  2CO0 C;  3I8E A;  3EI4 A;  3DSM A;  2OJY A;  5FKS A;  5CXC B;  2OVP B;  4A11 B;  1GXR A;  1QNI A;  4JXM A;  4J77 A;  4J86 A;  4FHL A;  4QQE A;  5EAL A;  3SBR A;  4CY1 A;  4CY2 A;  2B4E A;  4L3G D;  5HE3 B;  4CI2 A;  3F3G A;  4GGC A;  2Z2O A;  3K26 A;  1OMW B;  5EM2 B;  1K8K C;  3SVW D;  2P9I C;  1PGU A;  2H6K A;  3JPX A;  3SBQ A;  3RN1 D;  2I0T A;  2AGL A;  5EMK B;  2HKR A;  4PSW B;  3PE7 A;  5IJ7 E;  5C2V B;  4JSV C;  3C9C A;  2XU7 A;  4O3T B;  3RFH A;  3ZWL B;  5THA A;  4X61 B;  2IWF A;  3MKS B;  1L0Q A;  3NVN A;  1PEV A;  4CZV A;  4J73 A;  4KFM B;  4Y5R D;  3P4F A;  3MMY A;  3OKY A;  1B9Y A;  3FGB A;  3MZK A;  4PC0 A;  3N0E A;  4MK0 B;  2W18 A;  3HFQ A;  3L4O D;  4R7A B;  5CYK A;  2AQ5 A;  2YNP A;  4PBZ A;  2Q7Q A;  3C75 H;  2H14 A;  1K32 A;  2IUV A;  2G99 A;  2H9P A;  5CXB B;  4IMM A;  3CFV A;  3PVU B;  2CNX A;  2B5L A;  3EMH A;  3SBP A;  4ERZ A;  5FQD A;  2I0R A;  4LGN A;  2OK4 A;  1ERJ A;  4A0B A;  4ZOY A;  2GC4 A;  4J87 A;  4XYH A;  1A0R B;  4A08 A;  4FA1 D;  5EAM A;  5H1M A;  3DXK C;  4LG9 A;  4CI8 A;  2XL2 A;  3RN0 D;  4J78 A;  5IGQ A;  3OTT A;  3C5M A;  3I7H A;  4FA4 D;  4OZU A;  3UVM A;  2B5M A;  3AFC A;  2OVQ B;  4A09 B;  3OL2 A;  3SLE D;  4CZY A;  2I3S A;  4CC9 A;  1P22 A;  4L3H D;  4PXW A;  2AGX A;  1OLZ A;  2PM9 B;  3UVK A;  3IJ1 A;  4J84 A;  2AGZ A;  4J8G A;  3JB9 L;  4O3U B;  2YBA A;  3AH8 B;  3I7N A;  3IKO A;  4FB1 D;  4CZX A;  3PSL A;  4GQ2 P;  2OIZ A;  1JJU B;  3NVX A;  3I7P A;  3U4Y A;  1FWX A;  3RSE C;  2GC7 A;  3JRO A;  5AJA A;  5HQG A;  4JSP C;  3UVN A;  3JZH A;  5CXC A;  4LG8 A;  4IA9 A;  1GG2 B;  3I7O A;  2H6N A;  2B5N A;  1XIP A;  3SN6 B;  5I5I A;  2EBS A;  3AL9 A;  3CFS B;  4CY5 A;  2HJ4 A;  4PBY A;  5SXM A;  2H9N A;  1GOT B;  2H47 A; 
#chains in the Genus database with same CATH topology
 5A2Q g;  4A2M A;  3I7K A;  4WK4 A;  3MUN A;  5IC7 A;  1E5T A;  3DM0 A;  4FAN D;  3PVW B;  3N0D A;  5TF2 A;  5FKQ A;  4GQ1 A;  1MG3 A;  2P9L C;  1GOG A;  4FAV D;  3EQ9 A;  3B7F A;  3K27 A;  5M5U A;  4AMY A;  4O1Q D;  5FXY A;  2XE4 A;  4Z7N A;  1U2V C;  2VDP A;  4QRJ A;  1N6E A;  2CN3 A;  3JZG A;  2HYE A;  5AMS A;  2Z2P A;  3IIY A;  2XL3 A;  4ES0 A;  1GP2 B;  3BG0 A;  2BBK H;  3EG6 A;  1PI6 A;  3EI1 B;  2UZY B;  1C9I A;  1N6F A;  3OKY B;  3RRM C;  3EU7 A;  2YNN A;  5TEF A;  5FLX g;  3OW8 A;  3SJL D;  4XYI A;  3PXT D;  4GZ8 A;  4ZOZ A;  4D0K A;  2VDL A;  2CE9 A;  4JT6 C;  5GMK n;  4GM8 A;  4BUJ C;  5I5J A;  4RE5 A;  3AL8 A;  4H5I A;  3KRX B;  1SQJ A;  4AX4 A;  4I79 A;  2J56 H;  4J0W A;  4GM3 A;  4BL0 A;  1RI6 A;  3UKU C;  3NVQ A;  2JKX A;  3OF7 A;  1UTC A;  4GMB A;  2EIC A;  2H3X A;  3JAM g;  1S4U X;  3IIW A;  3UKR C;  3OKW A;  4A0A B;  3F3F A;  2MTA H;  3VA6 A;  5E6S A;  4GGD A;  4E5Z A;  4MMZ A;  2CO0 A;  4J81 A;  1JTD B;  1SQ9 A;  3ZDY A;  3O4J A;  4JSN C;  4FA5 D;  4L9O A;  2AGW A;  4ZOV A;  4UM9 A;  1O6F A;  5JWZ A;  3J81 g;  5FFG A;  5K19 A;  3EI3 B;  3FCU A;  2IWK A;  2VDN A;  5EMM B;  2BCJ B;  3IUR A;  3O4I A;  2HU8 A;  3VGZ A;  4ERQ A;  3T3P A;  4Y7R A;  2UZX B;  2H13 A;  2O9K A;  4UI9 R;  1R5M A;  5GSA A;  3MZL A;  3BG1 A;  3IUM A;  3UVO A;  2AH0 A;  4G56 B;  1XKS A;  1B9X A;  5M5T A;  2PM9 A;  4O45 A;  2IAA A;  3UR4 A;  2CE8 A;  2IUP A;  1A12 A;  4J79 A;  3V5W B;  3QI0 A;  4ZN4 A;  4PNK B;  5I5M A;  5B4W A;  3EI2 B;  1N6D A;  2EID A;  2PBI B;  4HDJ A;  1U4C A;  4E54 B;  2HJB A;  3PXS D;  5FKR A;  1SHY B;  2P9P C;  1JOF A;  2P9N C;  4YVD A;  3KRW B;  4L1Q D;  5HE0 B;  3VI4 A;  3I2N A;  4TZ4 A;  4AEZ A;  1VE7 A;  5EAP A;  3K71 A;  4AN0 A;  1TYQ C;  4A11 A;  3EI4 B;  2XDW A;  1E8M A;  1YR2 A;  5FA5 B;  4GQB B;  4A7J A;  4D9S A;  2VDK A;  2PM6 B;  4H5J A;  5EM2 A;  3OKT A;  3GD1 I;  2HKM A;  5FKT A;  4Z7Q A;  5AFU 3;  4JHN A;  5EML B;  3DXM C;  3SXT D;  1YFQ A;  4G1M A;  2H9L A;  4IRZ A;  2P9K C;  2H6Q A;  5C2W B;  5IJ8 E;  2J57 G;  2IUR A;  3SCY A;  4BH6 A;  3GC3 B;  4UM8 A;  4CY3 A;  5HYN B;  4Z8L A;  4FA9 D;  1JMX B;  2GNQ A;  2AGY A;  5HE1 B;  3MVD K;  2YB8 B;  3JZN A;  4J8B A;  5H14 A;  2XYI A;  2QXV A;  2IUQ A;  2QR5 A;  1H2Z A;  4DNW A;  3SMR A;  1VYH C;  5TDH B;  5C9Z B;  3EI1 A;  3L4M D;  3BWS A;  5EMJ B;  4CI1 A;  3O4G A;  2P9S C;  3SFZ A;  5KDO B;  5IGO A;  1VZ3 A;  3EWE A;  1XHM A;  5CYK B;  4JT5 C;  3FRX A;  2I3T A;  5M61 A;  3PSC B;  4QT8 A;  4ESG A;  1MDA H;  5CXB A;  4CI3 A;  5C86 A;  2YMU A;  3SHF A;  1NEX B;  4D6V A;  2H9M A;  3ODT A;  2G9A A;  2J55 H;  3AL8 B;  4J0X A;  5GXI A;  1QFM A;  5M5V A;  1TBG A;  1I2M B;  4GM9 A;  4DNV A;  3ZDX A;  3J80 g;  2HES X;  2I0S A;  5E6R A;  4Z7O A;  4A0A A;  3JRP A;  4A0B B;  4O2W A;  4A08 B;  3GRE A;  3K72 A;  3ZE1 A;  2VZ1 A;  3PXW D;  4MMX A;  4A2L A;  1M1X A;  1JMZ B;  4ERY A;  1MG2 A;  2HXC A;  4N14 A;  5K1C C;  3C99 A;  4NSX A;  4JD2 C;  2VZ3 A;  3E0C A;  3MUO A;  4G1E A;  5HDB A;  3MXX A;  3RLM D;  4E5Z B;  3F3P A;  4X63 B;  3V4P A;  2YNO A;  4K3J B;  4X60 B;  3FM0 A;  4J82 A;  1PBY B;  2VDQ A;  5IT9 g;  3EI3 A;  2OK6 A;  4A09 A;  4JSX C;  3W15 A;  4K3I D;  3UVL A;  3RFG A;  4GGA A;  4O9D A;  2QC5 A;  5EAR A;  5TEE A;  4BCD A;  3OL2 B;  2HU7 A;  4U7A A;  5H17 A;  5HE2 B;  3V9F A;  3IJE A;  5GXH A;  3I7L A;  4ZOX A;  3A0F A;  3IJ0 A;  5C92 A;  3SWS D;  3ORV D;  3MKQ A;  1K3I A;  4QL1 A;  3CIK B;  3EQ8 A;  3IJC A;  4PSX B;  2VDM A;  4EWR A;  3V7D B;  3VH0 A;  3I89 A;  4FWW A;  3ULE C;  3EI2 A;  4X3E A;  4U1E I;  1NR0 A;  2P9U C;  4E54 A;  1Q47 A;  2AH1 A;  1H2X A;  2CN2 A;  3IUN A;  4NBM A;  3GFC A;  3I8C A;  3RMZ D;  4OWR A;  1BPO A;  2OVR B;  4AOW A;  4RE6 A;  4XEI C;  2H68 A;  2QZP A;  2Z2N A;  3DWL C;  2PM7 B;  2TRC B;  2CO0 C;  3I8E A;  3EI4 A;  5FFO A;  3DSM A;  2OJY A;  1VE6 A;  5FKS A;  3ZE0 A;  5CXC B;  2OVP B;  4A11 B;  2BKL A;  4AN1 A;  1GXR A;  1QNI A;  4JXM A;  3ZDZ A;  4J77 A;  4J86 A;  4FHL A;  4QQE A;  5EAL A;  3SBR A;  4CY1 A;  4CY2 A;  2B4E A;  3KCI A;  4L3G D;  5HE3 B;  4CI2 A;  1L5G A;  3F3G A;  4GGC A;  2Z2O A;  3K26 A;  1OMW B;  5EM2 B;  1K8K C;  3SVW D;  2P9I C;  1PGU A;  2H6K A;  3JPX A;  2EIB A;  4MMY A;  3RN1 D;  3SBQ A;  1O6G A;  2I0T A;  2AGL A;  5EMK B;  3V4V A;  2HKR A;  4PSW B;  3PE7 A;  5IJ7 E;  5C2V B;  4JSV C;  3C9C A;  4WK2 A;  2XU7 A;  4O3T B;  3RFH A;  2VDO A;  3ZWL B;  5THA A;  4X61 B;  2XZG A;  2IWF A;  3IVM A;  3MKS B;  1L0Q A;  3NVN A;  1PEV A;  4CZV A;  4J73 A;  4KFM B;  1UOP A;  4Y5R D;  4L1M A;  2HU5 A;  3P4F A;  3EQ7 A;  3MMY A;  3OKY A;  1B9Y A;  3FGB A;  3MZK A;  4PC0 A;  5M5S A;  3N0E A;  4DNU A;  4MK0 B;  4BP8 A;  2W18 A;  3HFQ A;  3L4O D;  1TYE A;  1GOH A;  4R7A B;  1T2X A;  3DDU A;  3ZE2 A;  5CYK A;  2AQ5 A;  2YNP A;  4PBZ A;  2Q7Q A;  3IUQ A;  1JV2 A;  3C75 H;  2H14 A;  1K32 A;  2IUV A;  2G99 A;  2H9P A;  5CXB B;  1GOF A;  4IMM A;  3CFV A;  4G55 A;  3PVU B;  2CNX A;  2B5L A;  3EMH A;  3SBP A;  4ERZ A;  5FQD A;  2I0R A;  4LGN A;  3FCS A;  2OK4 A;  1ERJ A;  1VZ2 A;  4A0B A;  4ZOY A;  2GC4 A;  4J87 A;  4XYH A;  1A0R B;  4A08 A;  4FA1 D;  5EAM A;  5E6U A;  4QAM A;  5H1M A;  3DXK C;  4LG9 A;  4CI8 A;  2WQ8 A;  2XL2 A;  3NIG A;  3RN0 D;  4J78 A;  5IGQ A;  3OTT A;  3NIF A;  4BP9 A;  3C5M A;  3I7H A;  4FA4 D;  4OZU A;  3UVM A;  2B5M A;  3AFC A;  4NAA A;  2OVQ B;  4A09 B;  3O4H A;  3OL2 A;  3SLE D;  4CZY A;  2I3S A;  4CC9 A;  5M5R A;  3VI3 A;  1P22 A;  4L3H D;  3K6S A;  4PXW A;  2AGX A;  1U8C A;  1OLZ A;  2PM9 B;  3UVK A;  4BCB A;  3IJ1 A;  3QHY B;  4J84 A;  2AGZ A;  4J8G A;  3JB9 L;  2EIE A;  4O3U B;  4WJK A;  2YBA A;  3AH8 B;  3I7N A;  2VDR A;  3IKO A;  4FB1 D;  4CZX A;  3PSL A;  1UOQ A;  3IUJ A;  4GQ2 P;  4BCC A;  2OIZ A;  3NID A;  1JJU B;  3NVX A;  3I7P A;  4NEN A;  1H2Y A;  3U4Y A;  1FWX A;  2VC2 A;  3RSE C;  2GC7 A;  3JRO A;  1C9L A;  5AJA A;  5HQG A;  4JSP C;  4JHP C;  3UVN A;  3JZH A;  5CXC A;  1UOO A;  4LG8 A;  1GG2 B;  3I7O A;  4IA9 A;  2H6N A;  4AMZ A;  1E8N A;  2B5N A;  4NC4 A;  3T3M A;  4WK0 A;  4O02 A;  1XIP A;  3IUL A;  3SN6 B;  5I5I A;  2EBS A;  3AL9 A;  3CFS B;  4CY5 A;  2HJ4 A;  4PBY A;  1H2W A;  1QFS A;  5SXM A;  2H9N A;  1GOT B;  2H47 A; 
#chains in the Genus database with same CATH homology
 5A2Q g;  4A2M A;  3I7K A;  5IC7 A;  4FAN D;  3DM0 A;  3PVW B;  3N0D A;  5TF2 A;  5FKQ A;  4GQ1 A;  1MG3 A;  2P9L C;  4FAV D;  3B7F A;  3K27 A;  4O1Q D;  5FXY A;  1U2V C;  4QRJ A;  1N6E A;  2CN3 A;  3JZG A;  2HYE A;  5AMS A;  2Z2P A;  3IIY A;  2XL3 A;  4ES0 A;  1GP2 B;  3BG0 A;  2BBK H;  3EG6 A;  1PI6 A;  3EI1 B;  2UZY B;  1N6F A;  3OKY B;  3RRM C;  3EU7 A;  2YNN A;  5TEF A;  5FLX g;  3OW8 A;  3SJL D;  4XYI A;  3PXT D;  4GZ8 A;  4ZOZ A;  4D0K A;  2CE9 A;  4JT6 C;  5GMK n;  4GM8 A;  4BUJ C;  5I5J A;  3AL8 A;  4H5I A;  3KRX B;  1SQJ A;  4I79 A;  2J56 H;  4J0W A;  4GM3 A;  4BL0 A;  1RI6 A;  3UKU C;  3NVQ A;  4GMB A;  2H3X A;  3JAM g;  1S4U X;  3IIW A;  3UKR C;  3OKW A;  4A0A B;  3F3F A;  2MTA H;  3VA6 A;  4GGD A;  4E5Z A;  2CO0 A;  4J81 A;  1SQ9 A;  4JSN C;  4FA5 D;  4L9O A;  2AGW A;  4ZOV A;  5JWZ A;  3J81 g;  5K19 A;  3EI3 B;  2IWK A;  5EMM B;  2BCJ B;  3VGZ A;  4ERQ A;  4Y7R A;  2UZX B;  2H13 A;  2O9K A;  4UI9 R;  1R5M A;  5GSA A;  3MZL A;  3BG1 A;  3UVO A;  2AH0 A;  4G56 B;  1XKS A;  1B9X A;  2PM9 A;  4O45 A;  2IAA A;  3UR4 A;  2CE8 A;  2IUP A;  4J79 A;  3V5W B;  4ZN4 A;  5I5M A;  4PNK B;  5B4W A;  3EI2 B;  1N6D A;  2PBI B;  4HDJ A;  1U4C A;  4E54 B;  2HJB A;  3PXS D;  5FKR A;  1SHY B;  2P9P C;  1JOF A;  2P9N C;  4YVD A;  3KRW B;  4L1Q D;  5HE0 B;  3I2N A;  4TZ4 A;  4AEZ A;  5EAP A;  1TYQ C;  4A11 A;  3EI4 B;  5FA5 B;  4GQB B;  4A7J A;  2PM6 B;  4H5J A;  5EM2 A;  3OKT A;  2HKM A;  5FKT A;  5AFU 3;  5EML B;  3DXM C;  3SXT D;  1YFQ A;  2H9L A;  2P9K C;  2H6Q A;  5C2W B;  5IJ8 E;  2J57 G;  2IUR A;  3SCY A;  4BH6 A;  4CY3 A;  5HYN B;  4Z8L A;  4FA9 D;  1JMX B;  2GNQ A;  2AGY A;  5HE1 B;  2YB8 B;  3JZN A;  4J8B A;  5H14 A;  2XYI A;  2QXV A;  2IUQ A;  3SMR A;  1VYH C;  5TDH B;  5C9Z B;  3EI1 A;  3L4M D;  3BWS A;  5EMJ B;  4CI1 A;  3SFZ A;  2P9S C;  5KDO B;  5IGO A;  3EWE A;  1XHM A;  5CYK B;  4JT5 C;  3FRX A;  2I3T A;  3PSC B;  4QT8 A;  4ESG A;  1MDA H;  5CXB A;  4CI3 A;  2YMU A;  3SHF A;  1NEX B;  4D6V A;  2H9M A;  3ODT A;  2G9A A;  2J55 H;  3AL8 B;  4J0X A;  5GXI A;  1TBG A;  4GM9 A;  3J80 g;  2HES X;  2I0S A;  4A0A A;  3JRP A;  4A0B B;  4A08 B;  3GRE A;  3PXW D;  4A2L A;  1JMZ B;  4ERY A;  1MG2 A;  2HXC A;  4N14 A;  5K1C C;  3C99 A;  4NSX A;  4JD2 C;  3E0C A;  3MXX A;  3RLM D;  4E5Z B;  3F3P A;  4X63 B;  2YNO A;  4K3J B;  4X60 B;  3FM0 A;  4J82 A;  1PBY B;  5IT9 g;  3EI3 A;  2OK6 A;  4A09 A;  4JSX C;  3W15 A;  4K3I D;  3UVL A;  3RFG A;  4GGA A;  4O9D A;  2QC5 A;  5EAR A;  5TEE A;  3OL2 B;  4U7A A;  5HE2 B;  5H17 A;  3V9F A;  5GXH A;  3I7L A;  4ZOX A;  3A0F A;  3IJ0 A;  3SWS D;  3ORV D;  3MKQ A;  4QL1 A;  3CIK B;  3IJC A;  4PSX B;  4EWR A;  3VH0 A;  3V7D B;  3I89 A;  4FWW A;  3ULE C;  3EI2 A;  4X3E A;  4U1E I;  1NR0 A;  2P9U C;  4E54 A;  1Q47 A;  2AH1 A;  2CN2 A;  3GFC A;  3I8C A;  3RMZ D;  4OWR A;  2OVR B;  4AOW A;  4XEI C;  2H68 A;  2Z2N A;  3DWL C;  2PM7 B;  2TRC B;  2CO0 C;  3I8E A;  3EI4 A;  3DSM A;  2OJY A;  5FKS A;  5CXC B;  2OVP B;  4A11 B;  1GXR A;  1QNI A;  4JXM A;  4J77 A;  4J86 A;  4FHL A;  4QQE A;  5EAL A;  3SBR A;  4CY1 A;  4CY2 A;  2B4E A;  4L3G D;  5HE3 B;  4CI2 A;  3F3G A;  4GGC A;  2Z2O A;  3K26 A;  1OMW B;  5EM2 B;  1K8K C;  3SVW D;  2P9I C;  1PGU A;  2H6K A;  3JPX A;  3SBQ A;  3RN1 D;  2I0T A;  2AGL A;  5EMK B;  2HKR A;  4PSW B;  3PE7 A;  5IJ7 E;  5C2V B;  4JSV C;  3C9C A;  2XU7 A;  4O3T B;  3RFH A;  3ZWL B;  5THA A;  4X61 B;  2IWF A;  3MKS B;  1L0Q A;  3NVN A;  1PEV A;  4CZV A;  4J73 A;  4KFM B;  4Y5R D;  3P4F A;  3MMY A;  3OKY A;  1B9Y A;  3FGB A;  3MZK A;  4PC0 A;  3N0E A;  4MK0 B;  2W18 A;  3HFQ A;  3L4O D;  4R7A B;  5CYK A;  2AQ5 A;  2YNP A;  4PBZ A;  2Q7Q A;  3C75 H;  2H14 A;  1K32 A;  2IUV A;  2G99 A;  2H9P A;  5CXB B;  4IMM A;  3CFV A;  3PVU B;  2CNX A;  2B5L A;  3EMH A;  3SBP A;  4ERZ A;  5FQD A;  2I0R A;  4LGN A;  2OK4 A;  1ERJ A;  4A0B A;  4ZOY A;  2GC4 A;  4J87 A;  4XYH A;  1A0R B;  4A08 A;  4FA1 D;  5EAM A;  5H1M A;  3DXK C;  4LG9 A;  4CI8 A;  2XL2 A;  3RN0 D;  4J78 A;  5IGQ A;  3OTT A;  3C5M A;  3I7H A;  4FA4 D;  4OZU A;  3UVM A;  2B5M A;  3AFC A;  2OVQ B;  4A09 B;  3OL2 A;  3SLE D;  4CZY A;  2I3S A;  4CC9 A;  1P22 A;  4L3H D;  4PXW A;  2AGX A;  1OLZ A;  2PM9 B;  3UVK A;  3IJ1 A;  4J84 A;  2AGZ A;  4J8G A;  3JB9 L;  4O3U B;  2YBA A;  3AH8 B;  3I7N A;  3IKO A;  4FB1 D;  4CZX A;  3PSL A;  4GQ2 P;  2OIZ A;  1JJU B;  3NVX A;  3I7P A;  3U4Y A;  1FWX A;  3RSE C;  2GC7 A;  3JRO A;  5AJA A;  5HQG A;  4JSP C;  3UVN A;  3JZH A;  5CXC A;  4LG8 A;  4IA9 A;  1GG2 B;  3I7O A;  2H6N A;  2B5N A;  1XIP A;  3SN6 B;  5I5I A;  2EBS A;  3AL9 A;  3CFS B;  4CY5 A;  2HJ4 A;  4PBY A;  5SXM A;  2H9N A;  1GOT B;  2H47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...