3K71A

Structure of integrin alphax beta2 ectodomain
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
1081
structure length
880
Chain Sequence
FNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAANQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPELEMAQEGFSAVFTPDGPVLGAVGSFTWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQSLVLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGAPHYYEQTRGGQVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVVIGAPGEEENRGAVYLFHGVLGPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRVLGLKAHCENFNLLLPSCVEDSVTPITLRLNFTLVGKPLLAFRNLRPMLAADAQRYFTASLPFEKNCGADHICQDNLGISFSFPGLKSLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRYVAEGQKQGQLRSLHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANVSSENNTPRTSKTTFQLELPVKYAVYTVVSSHEQFTKYLNFSESEEKESHVAMHRYQVNNLGQRDLPVSINFWVPVELNQEAVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVLDCSIAGCLRFRCDVPSFSVQEELDFTLKGNLSFGWVRQILQKKVSVVSVAEITFDTSVYSQLPGQEAFMRAQTTTVLEKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of an integrin with an alphaI domain, complement receptor type 4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Integrin alpha-X
total genus 119
structure length 880
sequence length 1081
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2009-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
A PF01839 FG-GAP FG-GAP repeat
A PF08441 Integrin_alpha2 Integrin alpha
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1460 Mainly Beta Sandwich Immunoglobulin-like Integrin domains. Chain A, domain 2 3k71A02
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3k71A03
2.60.40.1530 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 4 3k71A04
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3k71A01
4G1EB 1TYEB 4Z7OB 4UM9B 3VI4A 4Z7NA 3K6SB 4MMXB 2VDOA 2VDQA 2VDPA 3V4PB 3V4VB 3K72A 5FFOA 3VI3A 1JV2B 4MMXA 2VDQB 3NIDB 2VDRB 3ZE2B 4NENA 3ZDXA 4JX0A 2VDNB 3NIFB 4G1MB 2VC2A 4G1EA 1TYEA 2VDPB 2VDNA 3NIFA 4WK4A 4WK0B 3K71A 4UM8A 4MMZB 2VDMB 5E6RA 4UM9A 3V4VA 4WK2A 4O02B 4MMZA 4UM8B 2VDMA 3T3PB 3NIDA 2VDRA 3ZE0B 3ZE1B 3IJEB 5E6UA 4MMYA 5ES4B 4O02A 3K72B 3VI3B 1M1XA 4WJKB 5E6RB 1L5GB 2VDKA 3FCUA 3ZE1A 3ZDZA 4NENB 4WK2B 2VDLB 5E6SA 4WJKA 4Z7OA 3ZE0A 3ZDYB 3IJEA 4MMYB 3K71B 4NEHB 1L5GA 1M1XB 4Z7QB 3FCUB 2VDKB 5HDBA 3V4PA 5E6UB 3NIGA 2VDLA 1U8CB 4IRZA 5E6SB 3ZDZB 3T3MA 4Z7QA 5HDBB 3T3PA 5FFGA 3ZDYA 3FCSB 3VI4B 3NIGB 1JV2A 4G1MA 2VC2B 3K6SA 2VDOB 3ZE2A 2P26A 3FCSA 4UM9D 3ZDXB 4WK4B 4WK0A 4Z7NB 1U8CA 3T3MB
chains in the Genus database with same CATH superfamily
5EO0B 4K07A 3TFKD 2DQTL 4PGCB 3Q8EA 1DJHA 3U79A 3S36L 4NQDB 3IETB 4XP5L 3T8XB 4K15A 5I17A 4IK7A 1YJDC 1UUNA 2VR8A 4JPKL 3HB3D 3NFNB 2PTTB 1OP4A 4KKAD 1P5VB 3EGSA 4JT5C 4JLRA 4YWGL 1INDL 1W9XA 1OAKH 2QFPA 3GZQA 4J73A 3QPQD 3RGHA 2Q76A 4X5WA 2R23A 5T5FH 1MEXL 2IXQA 3S3CB 5AZEH 4LLUA 2WW8A 2X6UA 1LDSA 5B3SB 1TIUA 1FCGA 3B7YA 5EH1A 4P5RA 1AZZC 3IU3B 5GZNA 3DX7B 1UVQB 2BZCA 3QB7C 2H9GA 2KZ1B 4HK3N 3IFOB 5BXFA 1RIVH 1KBBA 3QK0A 5I1KL 5EOCL 4PCKA 2XRAL 4L4TA 1U9KA 4WO4C 5IEHB 2DLHA 4WK0B 4C4KT 2CO4A 4Z78B 5DEFB 1CU4H 3GSUA 5E6RA 2AJXH 3MRDB 2J5LB 4I1PA 1GYAA 1KN2L 3V0AC 5IZ7A 1GR7A 5J12C 2MTAH 2Z8SA 2E4TA 3DX8B 4XBGB 3ARTA 5T1KD 5E9DA 4AMKL 12E8L 4J12A 3RVTC 1COBA 1XCQB 1YCSA 1OZTG 1I8IB 4RLDA 1CQYA 1OAQL 4WV1A 2FH6A 3HA0A 4JFVA 2W65A 2H32H 4YIQA 3SDCA 2NY3B 4D9RE 5AJAA 1KTLB 1E0OB 4GKOA 3QP3A 2HRPH 3ZZQA 4PJ9B 4N8PA 4JQXA 1Q1JH 1N7ML 2HVJA 4HWEL 5AB2A 5IBLC 5JPNC 4P04A 2DQTH 1FPTH 3L5XL 3T3ME 4DOHE 4F7EA 2VUYA 4D0BA 2LFGA 3UTZB 1J8RA 3ZGIA 5C9JA 43CAB 1F3RB 4JQIH 4LGPB 4R3SB 3FB6B 2VM4A 3S7GA 3WUWG 1XDTT 2H2PC 1KG0B 5DK2B 2OK6A 1DVQA 3LCYA 4R7DA 4A1RA 3SIKA 3MO1A 2DQUH 2K8QA 5JHDA 4G55A 4QRUB 4UT9H 4HQQL 5EEYA 1IB5A 2VJ8A 4HWBA 4AV0A 1NUDA 2D03H 4H8PA 1VACB 3D7PA 3V5HB 2PWEA 3UGUA 4J84A 4AUYA 4NQSA 2GBTA 3RB5A 3TBWB 1OB1B 1THCA 5FB8B 3KPNB 4OJEH 2P26A 5I6OA 1BG1A 4TSAH 4YLBA 3NA9L 4X3EA 2K45A 2VLRD 2P5WE 3DX3A 4HXBL 3QWRA 4QOKE 4FXKA 1ZA6B 2Z1KA 1RJZA 2YQ3A 4GG8B 1QQDB 4NSKA 2P44B 5TH2A 5BXFB 2MNJB 3IDYB 2IGFL 3PIQB 5EO1B 3BH4A 1M7UA 3SGEI 1ASOA 5D7IE 4OFIA 3FK3A 1KZYA 1S7UB 2HJ4A 4HUUA 5L4JA 1WAPA 4Q56A 1DEDA 3QORA 3IDXH 1QEWA 25C8H 3ZTJG 1NFDE 5CLXA 2B0SH 4B5ZA 3AT9A 3D18A 3IBOA 5LCVL 4XZUB 1U6AH 3IUQA 1A4JB 1HSBA 1GS8A 2ZSWA 1MCQA 1BAFL 1KXTB 1EUTA 1ONQB 4N2KA 3VWJB 4D7BA 5IHZA 4GIPD 2F08A 4I0PD 1ZAGA 1JXJA 4GGCA 3CXFA 2J71A 4M8UA 3FUKA 4NPYA 1D2OA 2GUOB 3BGAA 1CBVH 3MBXH 2JKWA 4X4XA 2FTAA 2E6JA 4OIFA 2ICCA 2QR0A 2FX9H 3EMHA 1QMUA 4XNQA 3HE7C 3J81g 3ARVA 4XNMA 3VFNB 4EOWH 3TJEH 5HP5A 1MCDA 2EE3A 4N0UE 4ZSOA 1BYOA 4G9FD 3FU0A 3PSCB 5B4MD 1Q0YH 3DNKA 5EZPA 3CCHB 1IVLA 3ELAT 4KHTH 4HFUH 3WN5B 3HG1E 4WFGD 4PLJC 5T5NF 32C2B 5JR1L 5I9QC 2VLME 3VI4F 1PZCA 4L4VA 3S37X 3TO4B 4X4ME 1J87A 3MV9E 2LTQC 3MA7B 4QOKA 5KS9F 3BD4A 3BN9D 3HHSB 4K2UL 1UYWH 4LQFH 3S4SB 1T6BX 2CUMA 3KJ4B 1HT6A 2QADB 1SXNA 3R0NA 3T65A 5CZVL 3S97C 1WGVA 3UAAA 3VYOA 5EEUA 4FQQA 3WTXA 2CKBL 2QSTA 3GXDA 3QC5X 3L54A 2BVPA 1BD2A 4B9IA 3MRKA 1E65A 2ZOLA 1OE2A 4Z7OA 3WUWA 9PCYA 3E8VA 1MCCA 2CGRH 5D1XE 3P0YL 1OW0A 4FTVA 2NQCA 4B5EA 1BYPA 4FABL 3EG6A 3CXDH 4GRWE 2J8UF 3BZ4A 1HVXA 4NQEA 2JQAA 3OZKA 4WKZA 1WC7B 4Z76A 1QSEA 2AJ3B 3P11H 4FNUA 1WT5C 4WWPA 5DI8B 5HI3D 3R8BB 2UZIH 3FTYA 5DJ2A 5IJDC 1BF5A 2NPLX 2R9HD 4DKFL 1HZLA 1EFXA 3RVVD 1ZVHA 3PE7A 4NP9A 3TL5A 4CJ1A 4U6XB 2A9MH 3QZWA 5CSZB 4CMHB 2Q86B 1WQVT 2QDVA 2XC8A 3AMKA 4WENB 1JWSB 1R0AH 4JHNA 3QFJE 2Q7YB 2BVYA 4JFZL 2C3HA 2YAMA 3UOAB 1UA6H 1KENH 1RZJH 1L6PA 2C9PA 3MREB 3TC9A 4P9MH 1KTJA 2EC9U 5IEKB 4NJAH 4LSVH 4GGAA 1PNCA 4P57A 3IS0X 3JWDC 4AK2A 3K5RA 2AGWA 3IJ9A 2HG5A 4JMNA 1JNHB 3QBTB 1NC4A 3IDMA 3SHSA 3UCRA 5AG9A 3QXDA 1GCFA 1JGIA 4JREB 5CSGA 3SDDB 3DJRA 4AQ1A 5C0DB 2COQA 4TQEH 1AGEB 2BP0A 3FQNA 4G6KL 4IK6A 5TE6H 1O6TA 3VSVA 1NCBH 5HDRA 1F4WL 3WJJA 5IFJB 5KSAD 5EEZA 4LNRA 5EIIG 1AOZA 4OR1A 3LXUX 4NPJA 4PSWB 2WYHA 4AC4A 3KLAB 4IMKA 1ZGLA 2R1WA 1A02N 1A6UL 4G8GD 1ZHKA 2F53E 1M05A 2ZXAA 1ZTXE 3NA9H 4WW2A 3X1NA 3FH7A 4LEOA 3RP1A 4JMXA 4AW4A 3GSXB 4ENZA 4OZHA 1N2RA 4BINA 5JPNB 5DZ9A 1BMGA 4XCFH 1WT5A 4URKA 3V2AR 3EFOA 4HPYH 3AQDA 4EMZA 2SODB 2X4NB 2IBZX 8FABB 2X3CA 3MX0B 4HWBL 4MSWB 4UZGA 1AO7E 5EIVA 2FT8A 4OFQA 5DYFA 1RJLB 5LO7A 1Y1DA 2PM9A 4TLKA 5EZJA 2YD8A 5C2BH 2R0ZH 3V4PH 1PTZA 2ZXDA 1QEXA 2VDMH 3MRHB 5AL8A 3TBYA 4L9OA 3KHQA 4GXUN 3OJDB 3KPRD 5HYQA 3WNLA 1KTKE 2JJTC 2JI2A 3MNWA 3RWDB 2WINA 4X98B 4L1HA 4XRCA 2R4RH 3HJ0A 1XGUA 2F1AA 2OJ1A 1T0MB 4UMGA 1PZBA 4IDLA 3G9VA 3KH4A 3MV8E 3MC0A 4OZFB 3IE4A 2CLVB 3BJ91 2RH0A 5CUSL 2GBUA 3Q8CA 3IYLW 1P69B 4M6ML 2VW7A 4XI5D 4N6QA 3SBWA 4K3JH 4Y4FB 1RU9H 3LN5B 4NQSB 5HGHA 2C4FU 3ODTA 4BE6A 1C8QA 1A4BA 3G6JB 5ACLA 3VGHA 2PM6B 4NBZB 1I9IL 4KKZA 5IVXE 1UG9A 1OAUH 1QZNA 1WIPA 3AU0A 2Z0BA 3G5WA 3LS5L 3ARBA 3VWJD 3HG2A 3GXIA 3M88A 5KVEL 1XB6A 4XOCA 5M5SA 4OLEA 4PJHA 5DJCB 4FFYH 1R5VB 2QKIC 4FZ8L 1H5BC 3ABZA 4LLWA 3HEIB 1AO7A 1TDQA 1JK8B 1NWPA 4NO2B 4A7GF 2F53D 1ESOA 3PWVA 2QJDA 4ZT1A 4LSPL 4NNYA 2TAAA 1RUAH 3QS3A 3FYEB 2IAMC 3FCSA 1E4JA 2DIEA 2NQ3A 3Q5OA 2YK1L 3MLTA 3QRFM 1QA9A 2K70A 4OZIE 2BNQB 1KC5L 5CEZH 2H68A 3RVWD 1MFEH 3GFCA 3CHPA 1BJ8A 1RJYA 5E6IC 5CGTA 3UEZA 4XMTA 3UTQA 1YEGL 5CWSA 5LGJB 3PNWB 1NCAH 1N8ZA 3QIBC 5HPOA 2XQYG 4LHUB 5IR1A 3GJFA 2VITB 2Y36H 3DDUA 1KYFA 1SN5A 1M57B 5JPMA 2EKSA 1QOKA 3O2DH 2JQZA 3J27A 5FDWA 3TT1L 1R3LB 3O4LD 1JN6B 1T0PB 3S98A 4ZYKA 3EJQA 2OK0L 1KY6A 1RMFL 3OKYA 3HI5H 4GKSA 4NHCH 3CG8A 3IJSB 3SGJA 2J3SA 3LDBC 2NZIA 5FCUH 4A7SA 2VLJD 1P1ZB 3OQRA 1F4YH 5EALA 5E2TH 1F0LA 4YHLL 2EO9A 2PPEA 4G7RB 4KHXL 1LO4L 4NN5C 3OJ2C 1QR4A 2R23B 2CCLA 3AWFA 1XF2A 5KS9E 3FAXA 2X4QB 3Q2CA 4R9HA 1J5OL 3C99A 3QDME 1YMMB 3O8XA 3P30L 3PUUA 1ZSDA 4UIMB 4AUJA 1VFAB 3WLBA 2EDBA 3IJEB 4J3WA 3CHSA 4O02A 3VI3B 3P3UA 7FABH 4C83B 3BIBX 4ANXA 1OW0C 4WTXA 5CCKH 2EDYA 4ADJA 2XQYK 5AZ2H 4YEFA 5JIPA 3HNTH 4PREA 1JTDB 2C4FT 3KPLB 4PGZA 4WI0B 2XQBH 5IREA 3BP4A 1FJ1A 1Y0LB 2I0TA 2J44A 1JZHA 1XF3B 1BM7A 3FULA 3WHXB 4BZ2L 1MY7A 1RIHH 4PJ7A 1DL7L 4WEEA 4R7LA 3V0EA 4BH7B 2C7UB 4Z7WF 3DPBB 3PWLB 5TDOA 1T4KA 2DQMA 2MRYA 1IBFA 2O5XL 1KZQA 1F3DH 1UH3A 4XMZA 2W07A 4ODSH 4NLHA 2IWFA 2CDEA 2JCWA 4OGXL 5H8DA 1M7IB 3P77A 4Y2DB 2DZEA 2ZWKA 3QYCA 3RPBA 3UG4A 1B3IA 1IGMH 5A2LH 3HHSA 1IAKB 4PPTA 5I9QB 2ETWA 3RBGA 4P5TA 4FG6C 5EUKB 3NZ8B 2DYPD 1CWVA 4JM4L 3EYQC 4U3SB 4PGJA 3ZE1F 3TN0D 3LB6D 1ZHLB 2I0SA 2VLJE 3FOMB 2OVRB 3GB7B 5GRVK 2AXJA 1TYEB 3VFSA 2KKQA 1IFHH 2N59A 1E50A 1AACA 2VDOL 3DGGA 4U6VL 5DLML 5F7AA 4A37A 5F9AC 3VXTA 1RZ8A 4KZ0A 1R4XA 4ONFL 5CGYD 4PBVC 4TUJA 4PJ5E 3MOAL 3M17B 1AHWB 2H0FA 2YAEA 3ZL1A 2EXWD 4TF4A 1A65A 4NAQA 2CE8A 2CO7B 4IRJA 4NFBA 1FE8H 1Q9WA 2MCAA 1A3RH 2G75A 2YPVH 1LK2B 1KENL 2CKBB 3VRJA 2DWXA 4RGOH 3VA2C 3K2MC 3FT3B 3OHXB 1NC4D 2Z6FA 5D4QA 5A43C 1WJ3A 3EFDL 1NPNA 1BCIA 5FOBA 2YLKA 2WC7A 1Z9SA 3GF8A 4F58H 1I7UB 4L1TA 4DERA 2NY1B 4N2IA 3RA7L 1QPKA 1YQVL 1T80A 2IDCA 2NR6D 4FL4B 3WOVA 2GNQA 1TLKA 1RLWA 4M62L 3F7LA 1BHGA 2J8HA 4HEPG 5ESAA 4P2RE 5AVWB 4PB0H 1EFXD 1R5IB 2HLEB 4MZ3A 3FUFA 1DJWA 2IH3B 3HVDA 3SDAA 1PLCA 1N19A 1JFHA 3QJSB 4XP9L 5FKQA 3T8MA 2WVVB 3I89A 4DKAA 1W8OA 1K5NB 2J5LC 5TF1L 2WUBL 4WTZA 3V5HA 4P0DA 3GZOA 4TRPH 3C8DA 5EZIH 4TUOB 2A4EA 1J8SA 5FK9A 1PI6A 1V8HA 5CZVH 5KUMA 3PXTD 1EVTC 1GS7A 4KKLC 4DZ8B 5JHDB 1GC1H 1RXLA 5ISZB 2C3XA 3MV7B 4PJCE 3G5XB 4ZS7H 4OFYA 4G6AD 1ODUA 3N1MC 3CFIC 4I3SL 3IJEA 2N01B 3D09A 2V4LA 1G0XA 2V5RA 2XV3A 3B8YA 2G3XA 1Y7VA 1D7BA 1P9MA 2ZWNA 4HLJA 4PJ9C 3GSNA 4I48B 4DKEL 2PW1A 1T0NB 2PR9A 2JV6A 3TBSB 2DWDA 3CZGA 4AT6B 4L4VD 4RGNC 3WAKA 4LPXA 2DW5A 2JKJA 5J3HC 4PWGA 4HULB 3T3PA 3HNTL 1U91A 3NIDF 2A73B 3QQ4A 4IMMA 2KQMA 4YDLC 4L05A 3BHBA 2YAHA 3QUML 3CC5B 1RZ7H 1XTLA 4K5PA 4QXVA 3RWIB 5EAPA 3N1PC 2WXRA 3VXPB 1TPXB 1P7HL 4Q9CA 1LXMA 2X89A 4JKLA 4AOFA 3B9DA 1DVFA 1DDHA 2CR3A 3ELQA 5D5ME 5ANMB 1HZHH 1NLBL 4MA7L 4I79A 1PIFA 5CLZA 1MFDH 3BRGC 3QXAB 4XCNB 1FSKC 2QZQA 1XQ4A 3T3MF 2QGBA 3NCMA 5HGHB 3U7WH 1RLBA 1NIBA 1XF3A 1QFMA 1F02I 4F15B 1MFMA 3O9WB 5C9KA 5TF2A 2ICWJ 4NWUL 4ZPTA 3GKZA 1MEXH 3JWDL 1JOFA 1NC2A 1KBWA 1F45A 4DGWC 5LAXA 3ZIYA 3FQ2A 1B4TA 1IGJB 2OI9B 1ZWIB 1OQOA 3DRQA 4HPHA 4ZTOL 4MCYA 2EIBA 2NNXA 1SOXA 3IBEA 1DFBL 5F9DC 4KKQA 2O93L 4UOW0 4WUUD 3ZHFA 2X09A 1A6UH 2CUAA 3KWVA 4JX0A 3EO0A 3V4UL 3U6RA 1LDPH 1YPZF 4RMSA 3NESA 3WY2A 3U0WH 2CO2A 1S9YB 5IUSA 3E38A 1H8OA 5IVOA 2LR4A 4JW3A 3QUXB 4J3OG 1KXVC 5F44A 4N2EA 3CDGA 1Y1UA 1LVEA 3ZKQD 4N8CL 4O3UB 4N24A 1JRHH 1CFNB 1PIGA 1Q0XH 1U3HA 4RGMC 5ADOH 5IP4A 4M9PA 2PM7B 4WY7H 4E5ZB 4ODTH 3LNGA 4JGMA 1HKFA 4ZPVB 3HLKA 5IMMA 1E4KC 1TETH 4K7FA 5A2FA 1MHCA 3SE8H 5C08A 1SOKA 1DDHB 2AK1H 3KNBA 1YQVH 3U9WA 1SYSB 4WJ5B 4UI2A 3VRLE 3CU1A 1A66A 4GKZA 1A22B 3PGCB 4YVNA 1OCCB 3UAEA 5H4ZA 2QGDA 2VN6A 3TCXA 1VERA 3SGDI 2H9NA 4Y4HA 5AVUB 5I24A 5IQMA 4L9LC 1JUFB 3FGBA 2DQGL 1J0HA 3PPEA 4YBLC 4UT7H 1GGCL 5I0VA 5MENE 4KZEH 2IBBA 3MRJB 5T3ZD 3KLHC 2MH4A 5IWLA 1MDAH 4P4RA 1A6TB 4M93C 5MHSE 1FVDA 3D25A 5DHXB 1JPFB 1PZAA 1SRDA 3GI9H 4UT6A 1DBJH 3RPIA 3FTVA 2FUTA 3L5WA 2GTQA 1U8JA 1T1YB 3MV11 4PJDB 1V3LA 1PG7X 4HJSA 4AEHL 4WNSA 8CGTA 3WXVH 2LLLA 1CFSA 1JERA 4HUWA 1X4ZA 1CDHA 1T2XA 3PRZA 3RB7A 1XT5A 3SD2A 4AV5A 2Y6SD 5AAWA 1QSFE 2WQWA 1PBYB 1VADA 4XYHA 2MQ3A 1TZOA 2WBJB 3X1GA 2MPAH 3I8CA 5HYIA 2C1PB 4EXPX 1O5PA 5GZNC 2JKSA 1KMGA 4Z7OB 1FZMB 4YHIA 4MA8L 3DC0A 1OT4A 3RRMC 2VAAA 5DRWB 2WZPD 5HI4D 1FG9C 4GRWF 5ANHA 5HI4C 1EEZA 5DD3H 4Z0XA 1HINH 3AABA 3DWTA 1MRDL 5A2JH 5C1MB 4I0PB 5JOFB 3AL8B 3BWAB 3T04D 1JJUA 2XDWA 2E0PA 4EKJA 3K4AA 4P57B 3QG7L 4J79A 2E9WA 4HJGA 3KXFE 2C1OA 1BJMA 4GQZA 1MCSA 4DEUA 3QEHB 4BWUA 4JFQB 5HYQB 4OQTA 3ABMB 3II3A 4L37B 1FYHB 4HD9A 3MRHA 5BUPA 4LHUD 3H3KA 4EZLA 5I0XA 3OAZK 1IKNA 7PAZA 3QDMA 1TZIB 2EDQA 2HTKD 4FEIA 4BZ1L 4HKXB 4V2CB 1USQA 5JLZA 4J6RL 4JJ5B 4NWUH 1OF2A 1FZKA 4DTGH 5LAPA 4M43L 4DO5A 4EVNB 3DSNA 1X9LA 3T0EE 1AIZA 5C0CD 1C9SA 1KJ2A 5EA0H 1WISA 2WXKA 2BVOB 4R26H 4S1SH 5AKTA 2A6DA 5JW4R 4TNGA 1RZ8B 4PV8A 5AYQA 1UZ8A 2TSBA 4TTDD 5GGUA 3P2BA 5HHNB 1S5HB 2EIZA 4Y7MA 4BFNA 1OTSC 1G0DA 1A3ZA 4YHZH 1DBML 2IPUK 2NX5D 5KVEH 2NDGA 4GAGL 4HFWB 3GBDA 2ZXCA 3ZBMA 1J9RA 1ZS8A 2CD0A 2G9HB 3NJXA 5DC4B 1SPDA 2WQRA 1FDLH 4PD4K 5D7JC 1BQHG 4EXKA 5L88L 5M61A 5C0JB 3P0YH 5H4YA 4K5LA 3SCMC 1LK3L 3MJ8B 5I76B 2VWEE 2J21A 4U1IB 1N3NB 4XHQA 3I6LD 3VJ6B 1ZDQA 1SBSL 5B39B 2I60L 1OAZH 5FO8B 1WWBX 1QO3B 4P23B 1R3KB 3KBEA 1AGDA 1NUGA 2H13A 3BSZA 1HQ4A 1S3RA 4L8SC 4WO4A 3D0AA 2KZKA 3EZ8A 4GAYB 2DRUA 2YXVA 3G5VA 4GW1B 5DRZB 2DQHL 4DK6A 3QIWA 3FBKA 4WGVB 4R7NA 5HE2B 1NCAL 2AK1L 2R2HA 3HS0A 2FECI 4G59C 5DUBA 4Z3IA 1F8TL 4NZDA 1WUZA 1EXHA 3AS1A 3D4CA 2Q7QA 3X1BA 5L2JB 2WCSA 5GGSA 1AFVL 1I1YA 3RQ3A 2X1PA 4WLCA 1KG0A 2W5PA 4GAAA 3KJ6H 4L3AA 5DK2A 4KX7A 3Q1EA 1NC2D 3BISA 3T4AA 1MLBA 1TJGH 4NQXB 4FQCH 4AGOA 4KKBC 4YBQC 2WQXA 1CYWA 2FX9L 4P5TD 5SX5H 3TT3L 3B2MA 3OB8A 5C0GA 4K3ID 4BCXA 5ILTL 1BVKB 3KPPB 4WEUD 1SY6L 2VE6B 4QWWD 1I9RH 4WI7A 1AP2B 3SGKA 2XBDA 4FLHA 4KOCA 4LPCA 1W0WB 2ATAA 1G1CA 3KPOB 1XSIA 3RAJH 5FUZL 1KEML 1IAOA 2WNXA 2HU7A 4D0DB 5DURD 2LOEA 4WHYG 2R59A 3NRPA 2PPCA 3ZT5A 2OSLB 3C5SB 2ICEB 1QQDA 2HA1A 2K9UA 2M2DA 3DX8A 4X7SH 3QYNA 4PLKD 5I6XB 1XEUA 1NGPL 3MLPA 3NIFB 2ICWB 5GISH 3UZQA 2VH5L 4UTBA 1XR8A 2G2RA 5FUOL 3QHZL 2WXGA 5AYUL 2C4XA 1YYLH 2Y22A 1AE6L 2X12A 2YD7A 3KLHD 3VFWA 2GSIA 2DM3A 1GY2A 2DWSA 3D0LB 3MHZA 5D7LB 5E9NA 1IC0A 6PAZA 1IO4C 3ULVE 3ILEA 2HT3C 1XEDA 2EYSA 1YECL 5BQDA 3X11B 4X4XB 3QRLA 1WZ1L 4ONHB 3PP4L 2OR7A 2IFGA 1YEDA 3EI2B 2MCPH 4MQXC 5GS0D 3BH8B 4YHNB 5IMOA 3VGAC 3GM8A 1GXEA 3FB6A 3DPBA 1J9CT 2JJUA 1NCOA 2ORBH 3UP6A 3GJEA 3V6OC 3GZKA 3HLAA 4KROB 4YZFE 4L5FE 3ESVF 5E4EC 1JPGA 2V2WA 2EDLA 1WF5A 2BO0A 4HISA 3OXRA 4FFTA 4PR5A 3V95A 4EN3B 1VPOL 2PWDA 1A0QL 3EOTL 4K23H 2MNWA 3OR6B 2IG2L 4HIHB 4PJGE 4UILH 3D12B 3FT2A 1DLFH 5A16B 5J1AA 3ARXA 4UT9L 1EAPA 3GK8H 4ZFZA 3TYFB 4DN3L 1QFPA 3WFDL 5IIEA 3VW3L 1P2CA 2OAAA 3JYCA 3STZA 2H0PA 1A7OH 5IQ7L 1MQKH 2Z7UA 3PIQA 4BUQA 3D87B 3P02A 5DFWH 3POCA 3T6XA 3BQUC 4G6ML 4XAKE 3BQUD 1NCHA 2DWEA 3AQYA 4H8QA 2K4AA 4BK4A 3W39A 4RRPM 3WIHA 5IBTH 5DJ8A 3NSDA 3HMWH 2CRIA 2P24B 1EMTH 4HGKC 3UC0L 5IQ9A 1FFTB 4KJYA 2CNZA 4OJYA 4DN4H 1O75A 2NTFB 4KTEH 1VFBA 4PCSA 4KROD 3IPEA 3CPUA 2V5MA 3DOSB 1HSAA 3EOBA 4YL9A 1J11A 3AT0A 4E9RA 2WUCH 4QRQB 2E9IA 1E8MA 1IILE 3H9HA 4Y8DC 2NTFA 2H32A 2MNUA 3H9YA 3MMYA 4HG4J 5CU5A 3EW3B 3GIZL 4Z7WA 3FONB 1L4IA 4U6TA 1R3LA 4TSCH 5GSVA 4PY8J 4AM0B 4ODHL 1YAZA 1GIGL 1P5UB 5F2FA 1IX2A 3ABGA 1KCBA 2H4EA 4JZNA 3T8XA 3I02B 4S1DD 3QUMH 3SN6N 4AQAA 5HE3B 3A6CL 4EWRA 4YZWA 2VDRB 4PP1C 2NYZA 2BY3A 5BVJA 4NZFA 3A3YB 5AVTB 3OLDA 1FLTX 1W6LA 2AXWA 3WJLC 2PWGA 4PR5B 4J8RA 3F3GA 3U4EA 1VFMA 3EYOB 2N7AA 3Q0HA 3SCMB 1MNNA 2HT2C 3STLA 3RUGE 3SJVB 1XGYL 2IANB 4Z7QF 1YEHL 2DI8A 5A40E 3HRZC 4A09B 3LKQB 2ODIA 1IM9D 1XO8A 4TKWA 2YPLA 5E1HB 1U8QB 4ZAKB 3U0TB 3VTTA 4ZS7L 3AS0A 2BVQB 2BY2A 2CXKA 2ZCLL 3DK0A 4KK5D 3S8GB 1ZE3H 4KK5C 3ZSTA 1MLCB 3TIDA 3NRFA 2R29H 2AEIT 1H9VA 2XKSA 3N5AA 4YQXL 3RX8A 2ID5A 4P3CL 2X5PA 2J55A 2EC9T 2UV3A 3MLZL 2BOCB 4OUOA 5I82A 1IARB 5ALBL 4BK5A 5L4MA 5B7FA 4Z7UB 1CD9B 4PBXA 3FCUA 3MRLA 5L7XH 1Q72H 3MREA 4HCRL 4G83A 1BXAA 1UKQA 2KUTA 4B27A 3QG6B 4QJ3B 3U4BL 3ULSB 5GS1A 5BUAA 1WEJL 1GOFA 5EZLA 1CGXA 2EDFA 2FEEI 1H8LA 2VMFA 2P28B 2PO6A 3FMGL 3LQAL 1T0MA 3FQ1A 5EN2A 5EF2A 2O5XH 4MRCA 3VQMA 4Y4KC 3WNNA 3L7FA 2PPDA 4XNUH 2XT1B 3MNWB 2HT4D 4ZUTA 5T1MA 2CR6A 1QVOB 3N06B 2A6KA 3VGFA 1IM3B 5DI8A 3BZEA 1RQ5A 1J5CA 3OJDA 4JG5A 4FE9A 2VLJA 3IDGA 4ZSOE 5BVPL 3LN4B 4ZFFB 4AVKA 1JYVA 2X4PA 4M02A 4OW6A 2BSSA 3WDJA 1MWAA 2AEPH 4OFDA 4XBPB 3C5JA 4NC1E 1NGZB 3QH3B 4PJHF 5IVXB 2VMDA 3A6CH 5J3HD 1UHVA 1PJWA 1V7ML 1LWRA 4UYPA 3KRXB 2AJZA 2EIEA 4J6RH 4KKCD 4OZFG 5GRYA 4LEBA 3WSQL 4GQBB 3MRRB 3VD1A 4FQLL 2WO4A 3RHWF 5BRZB 2FT6A 3NIFE 1PQZA 4XTRD 5D9SB 4QHUB 1I1AB 4J86A 4TSAL 2J43A 3NMEA 1WPCA 2Q5BA 4LEOB 5DLMH 5C0CB 3VGDA 1T3FA 3S3SA 1AMXA 2OMXA 3ARQA 1CE6A 2ZZUT 3L48A 4MXVF 4TLTA 1FIGL 1OT2A 5TJWK 1XR8B 2VDKH 2B14A 3WFHA 2EH7H 2PP8A 3IJCA 2ADJB 3T2OA 1HU8A 2EIKB 2X44D 1AXTL 1YO4A 4AEIL 3FRUA 4IEFB 3UAFA 3D39A 4FQJL 3NJGA 4P2AA 4B0MM 4DESA 5JZ7D 1FHGA 1KELL 3Q6GH 5I6LA 3T4YB 5EU7C 2IV9A 3ZO0A 3TURA 3ATFA 4N20A 3ILQC 3KPQB 4B7IA 2VZSA 2A77L 1R47A 2Z93B 2QKIA 1NGQL 1S4IA 5FFLA 5EN2B 4AYSA 1KYDA 4HS8H 2GJ6A 4GZ8A 3ARBD 5G4OA 3VWJA 1QFWM 3QG6A 1JVLA 1P6AB 2AJSL 1EDYA 2W9LA 4GIOA 4NQDD 4RAUB 2E7DA 4OD2B 5D96C 5JHDD 3QQXA 1UXSA 2AGZA 1BQHA 5GSVB 3NJHA 1YEWA 4IIQA 2I9LB 4E9QA 2X4OA 1DVYA 4M6MH 4ATTA 2DEXX 2H45A 1FO0H 4NBMA 4MNHA 3MZGB 1QW8A 1R5VA 5KDOB 1MRFL 4FNLH 2ZPKL 1UQSB 4XVTH 5T3ZL 4S2SB 4JFZH 5CMAB 3VXRD 3UPRB 5DUPH 1AVAA 1KDJA 3QIUC 4XB8A 1GJIA 4HK0B 5HSFA 4UINL 5C0ND 2FQFA 2F74A 3BUYB 1RI8A 2FO1A 3GSRB 2W8CA 3GSVA 1GHFH 5LLIC 3LYRA 3H4HA 1AZBA 1JPEA 4M5YH 1OXYA 3GEWB 2OP4L 3O6ML 2B4CH 1QTSA 3ALXA 4TNWK 3QUKB 5CR1A 1WS8A 3BQUB 1KLUB 4M7LL 1BZEA 1FAIH 3N41B 4W9LC 2FIKA 3D3VD 1WBYB 1KY7A 1WFOA 2BFGA 3ZRSA 1J9TA 4Q74A 2BRRL 4BP9A 1CXKA 1ETB1 3MJWA 4N0YL 2R4SL 5IK3B 5DMYA 4PNKB 4E5XG 3RWDA 4OD1L 2WLIA 2B5LA 4FJYA 3CLEH 4P05A 3SE6A 3B9KC 4ONOA 1ZJAA 2Y0SA 4OF3A 3FBQA 4XX5A 4FWWA 2WYTA 7PCYA 4KI5C 1FHNA 2ENYA 1WFIA 2Y7LA 2F7OA 2ESVB 5EC1B 2X9YA 3SDDD 3QWRD 2VLRA 1X5GA 3B7FA 4JANB 3JV6B 3L2NA 2GJZB 1AXIB 4IKJA 3QO1A 1MJ7L 3EGXB 4Y0GA 1MVYA 3Q06A 4BRJA 3AY4A 5T1DH 1LE9B 1SM3H 3ZHNA 2VOTA 4ZZKA 2NNFA 3MRJA 2WLZA 1ND0A 2YEVB 3QDJB 4K3EH 1B0WA 2GC7C 1ZGLB 1HZKA 5IVZB 1Z9LA 4BDVB 1XMWA 3VDCA 1QSFD 4X8JB 3EOAA 4QHMB 1F8TH 2J88L 5F6IC 1RK0A 3CVBA 5GJTH 1LWHA 5AAMC 2B1HH 2Q8BL 2BXZA 3F3FA 2P1YA 3BLBA 4W70A 3PHQA 2Z0UA 1MFAL 2RFXB 3KL5A 2HN7B 2ZYHA 3ZTCC 1T7XA 2OSLA 3C5SA 2FVNA 1RK0B 2DKUA 3CU7A 3RLSA 2GBAA 1XL4A 2BHYA 5D1QA 2HVKA 1L9SA 1LD9A 1SFHA 4XC3H 4YHIB 4Z7NE 3OL2A 1PLAA 4C56E 3BUPA 4W1TA 3D85B 3K71A 1JXFA 1F13A 1MN4A 1UWEL 3L45A 3U2SB 4O02H 4D0CA 1Z5LA 3CHXA 4OZIA 1OGTB 1XIWC 1SEQH 4X6DB 2Z9TA 4PJBE 1CLOH 5EV7A 3MAWA 1LEIA 1D5ZA 3NCWA 3V52H 2V33A 2J2ZA 4P59H 4W9IC 4HUNB 4DUWA 3MZKA 3JWNH 3WIFB 5JUEH 3RVVC 4MVBD 5EWIH 2JCCA 1YEDB 1WC7A 4XZ4A 5D71L 4JEGB 3W15A 4BKSC 3O6KL 3MFFB 1ZMYA 3UYOD 1B0RA 2IURA 1KLFA 4FL4C 1HINL 1IGTB 3MSPA 5T1JA 2BIPA 2NY0B 3BPOB 2WB1A 1XF5B 2NY1C 4UAOC 3WTUA 4AVIA 4V33A 1I1FA 5HJGA 5T1DL 5J9PB 5C6TH 4B9FA 4M56A 4DPCX 4JCMA 3BPLB 5EO9B 1Q38A 1LO0L 1B6DA 4ELMA 4R84A 3PAYA 3OKNA 4ZFOB 1FV1A 4ETQB 2NY7H 4QAMB 5CIPH 4Z18A 3SBRA 2NW2A 2WXPA 5D7LE 1JNHA 4U1HA 5INDB 1ZVSB 1SXZA 4F7TB 2VN7A 5D1XD 4WSGA 3NIFF 32C2A 1TCRB 5CYKA 1RV6X 3GSRA 4ERSL 4QJ5B 4YE4H 3GMOB 4HMDA 4X80L 4WUUE 4F7MB 2RA1A 2Y7QA 4JO2H 4HIEA 2P49B 3BWUF 5K9OB 2F7PA 3ULUC 5IM7A 3DGCR 4W68A 2OTWA 4PRHB 1O6SB 1EFXB 1M53A 4UTBL 5CHNA 5E6IB 2CXGA 1XIWB 5C0BA 5HYJB 1UACH 3O6FA 2ZUQC 4F7PB 3I50L 5KVFL 1A3RL 1P7KB 2VLRB 4WQOA 4ABUA 3U4AA 1ZANH 3RIKA 3DVNA 4UM9B 4NQEB 4OV6F 1JF5A 5GS2H 1PY0A 3HMWL 5L2KD 1GZHC 4X7EC 2DQCH 5DZLA 1IE4A 4R7NB 3E1F1 4XAKD 2CLRA 2B9BA 2BOLA 4TQ8A 2FLBT 2WAQA 1JZDC 2X7LA 3G5VB 5DRZA 1DVFD 3CZKA 5I17B 2G99A 3LXBA 2ZTBA 4Y16D 5FFOA 3C2SA 5MEPA 2QKIB 4GFTB 1RUQH 5A6IA 1NFIB 1UOKA 2F5AL 4JK0D 1MHPL 2FLMA 5CFHA 5HHOD 3VXSB 4JFDB 4L0PB 3IT8D 3O3DB 4YHOL 5I1IL 2J6EA 1UA7A 3QXDB 4I9WD 2DQUL 1BVLA 4KV5F 3ET9F 4BFIB 1B2YA 2MOQA 5J6HA 5JHBA 1WUNT 3LRKA 2YQGA 4Z7VA 3HCVB 2QGCA 5DMJB 2YARA 1OP5K 2HX9A 5H94B 4IKNA 3MRCA 4HMEA 1LMIA 2F74B 4QRTB 2WSKA 2CO6B 3C9NA 3WMQA 3OF7A 4W9GC 5I6MA 4AGLA 4CVZA 3WIHL 4UM8B 1A1NB 1MG3C 4WTZG 4OGYL 2BM3A 1KNOB 1AG6A 3B7RL 2J4WH 3FUJA 4FFZH 2ZX6A 1E28A 3RX9A 4HF5L 3RRQA 4EUPH 4M93B 1EJOL 1KXTA 4G7VH 4PI0A 1QPPA 4HVBA 1J8HD 1N0XL 4QCIB 5D8JH 1JVOA 5DZAA 5FYLD 2VDKL 2VDLB 5LWYH 4HIEB 2X6BA 1INQA 1KGCD 4KVCL 3GHBH 4G7YL 3NT0A 3H4FA 1I82A 3L3GA 3MUZ1 4X9YA 3RDTB 5F0MB 3MRNB 1FFQA 2BDNL 4HWZB 3ZDXE 1YEFH 5DVMA 1U95B 1WRFA 4O2FA 4CZVA 2YN3A 4DK3A 4HJ0C 3H1ZA 1KPRA 1A7NL 3GXMA 4MAUL 3V5WB 4N3TA 5BOZG 3H7BB 4MB3A 3UYRH 1QP1A 1U0QA 1MXDA 2EO7A 3ZDZB 3OKNB 2FL5B 4U1GC 4QXGH 3VB9A 4ELMF 5L8JB 3D50A 2CA4A 5C08B 5T5FL 2VLKE 4FQCL 5I5JA 2YA0A 3E7JA 4MXQC 1DUZA 4UDTA 3ZIMA 1MVUB 1A6AB 2FO4B 1XCWA 1I1FB 5KG9A 5B8CB 1FN4A 4KJPC 2D8KA 4ISVA 4ZOXA 1ZSHA 2HFGH 3X2QB 2WLLB 5AKVA 1MIEH 1WBZB 4FX5A 1E2ZA 3NZUA 2W95A 3I2NA 3C60C 5E8EA 3IE9A 1QABA 3FRXA 2UZXA 2I85A 4NZTL 3SGKC 3F5WB 1DQJB 3U30C 3HZVB 4CDGC 3VFPB 2C34A 3VFGH 5JXAL 2DD8L 3P54A 3Q5YA 3LKQA 1SHYB 2OX5B 4S1RL 3K4DA 1BV8A 5KSUA 4LCVA 5FECA 4MJIE 2NY4D 1U21A 4G11A 4P4KB 2KPWA 3CFMA 3V4VB 5A2IH 3PVWB 4AEIH 4I9WE 4QKTA 2MEJB 3VXSD 5AW3B 1WIOA 2CJSA 5KBKA 3U6RB 3MV9D 1TXKA 4UQIM 2OI9C 2WZ5A 5DVLA 1SDDA 3TV3L 4YIQB 3T3PE 1FDLL 5CILH 2BSRA 2ADGA 2EDDA 1OLLA 4XMLH 1SHXA 5KOVC 4PY8I 4RBPK 1KTDB 3VFVB 3P9MB 5BO0D 2IH1B 3MVSA 1CT8B 4ZX3A 5K1CC 2CIIA 2Q7AA 4WJ5A 4U1JB 4YC2B 3M07A 2AGJH 2NUTB 4IDJL 1ZHBB 3L3IA 3LV3B 4LAQL 2X1QA 4K7FB 4PJAE 3HS9A 2XBTA 5IQNA 5BO1L 1I1AC 1I9JH 4AYDC 1AY1L 2L4OA 1OE1A 4G8AC 1CYXA 2DMBA 3F6JA 1TQSA 1ZV5A 4XPHL 2FUQA 1ODAA 3NIDA 3I6GA 2RD0A 1P1ZA 4IHOA 2WP3T 2XZZA 3MO1B 3KS0H 4CW1B 4JFPB 5FUCC 3UPAA 1F97A 2LU4A 1OSPH 4WZ9A 3TJEL 1UXMA 5DD5L 5DR5H 4GOSA 3JT2A 4PMEA 1MWOA 3EH5B 4LMQE 2JJWA 4YXLH 5KTEH 3O4IA 3G9AB 2WV3A 4R4FH 4YDJB 4ICWA 2YSTA 3OLEA 3EYOA 4JZJB 4DP7X 4HLZG 5D7LD 5F8QC 5JIMA 3BPLC 1KYOK 1EHKB 1OOAA 1U58B 2EYTA 1QLEL 2X38A 1XB8A 3M1OA 4LSSL 5F7YC 4ENEC 4P2RD 4MA3B 3TONA 2YQBA 2GI7A 2EABA 4OD3H 1F4XH 1OTTC 3W2DL 3BP7A 5I6XC 4DOHB 3S37L 5CKAA 1PL3A 2BNQA 2XTLA 3O4OB 3ESNA 3TEXA 3JUZA 3WLBB 1D5IH 1WZKA 2ITDB 2VDNL 1KLUA 4LPWA 1PVHA 4NQCA 2XN9B 4PVNA 2OVQB 5C2VB 1IBYA 3TN0C 3VG0H 3X3FL 4GQ9L 4L1BA 2UZYB 2Z4TA 3IMTA 1S7TB 2XXMB 3JB9L 5JPMC 1U8IA 3PNRB 3WYRA 4P49A 3BWUC 3RFZB 2Y7OA 3BKMH 5J6GB 3QR2A 3RIAK 5CD5D 1PY4A 4MCZB 4O5LH 2A5UA 3E6HB 4V1DD 4AKQA 1DBAH 1EEUA 3D85D 4PYGA 3C8KA 3ZL4L 5MEND 2WLLA 2EEBA 1M2OA 4MNHB 1E3FA 3MFGB 5CXBB 2C9XA 3K6DA 1DP0A 2P3YA 2XZGA 1OARH 4WI8A 3LRGA 5EAMA 1NMAL 4OD2A 2XN9E 2ZUYA 4PRIE 5JQ6H 3WEXB 3DURA 1X5JA 3C2AL 4PJXB 4QHNB 1DLHB 3W56A 2W92A 3MRFA 4F1ZA 2DQ6A 3SO3C 1FNAA 3NVQA 1H6UA 5E0QA 4PJBA 4LVHC 3Q1SH 2YBAA 4P5MA 3G5XA 3IIYA 5D7IA 2XKUA 4R4FL 2TRCB 5ETUA 2ENQA 4O2CA 5FM5M 3DX9B 4ZMVA 1CXFA 1RL1A 3S36X 1KXQE 4HCFA 3MLTB 43C9B 4Z0BL 1KCUL 3G5ZA 3RGVA 3GZPA 4M7LT 4ZMAT 2X6VA 4HIIA 1CGUA 3U2IA 3GYRA 1BECA 4XXWC 1ACXA 2ZD0A 4YE4L 1SZNA 1RY7B 1BP3B 5EFIA 3WFHB 4LIQE 3WTSA 3PXLA 2B2XL 3FUDA 4GRWH 1YN7B 3LB6C 3AGWA 1MRCL 1KN2H 4AGPA 4YDVB 1YEIL 5EBWB 1NGWA 1UB6B 5L2JA 3BESR 1H9DA 3CXHJ 4JFTA 3QEQE 1L3WA 4Y2NA 1MFDL 2JWYA 4X8GA 4GM3A 1OTUC 4JFWA 3GMPA 2F6AA 1F6LL 2JI1A 2V8LA 1M6OB 2WKOF 3C5ZD 4FRWA 4W9HC 1AS8A 5HGAA 3T8VA 3AXLB 3ZDXF 1CG9A 2E75C 2EEXA 2NX5E 3ASNB 3TFBA 1OF0A 4UV4L 1FN4B 1KELH 2RACA 4WO4B 4NCC2 3NCEB 4Y5VA 1JZIA 1ZT4A 2CLZA 5C0CE 2XUWA 4A67A 5EU3B 5JXEC 1IKFL 3VWKA 3F6IA 5C7ZA 1JFQH 2I9LA 4FFZL 2G5UA 4GAGH 2F8IA 3I7HA 4GW4A 3NCCB 1SN2A 3CVIL 1NJ9B 3EBIA 4D8PB 1BQSA 1S8DB 3IIWA 3O6LH 5IB1A 4BELD 1AP2A 2UXVA 1NCWL 4K8RC 3JTSB 2GJ6E 2YSSB 4H26B 2R0WH 3TO2A 4LCUA 4OJCA 5T3ZH 5C3LD 5KSAA 4PSXB 2A83B 3QORC 1M6UA 4QEGA 2CKNA 4XN2A 4ZUSA 1S7RA 2Y07L 3T4YA 4HEMA 3ULUL 4MAYD 3SPCA 3FSOA 1UWFA 4P2OB 4PJ7F 3W9EB 3BDYH 1AANA 12E8H 4PW4A 2QDWA 3LQZA 3NPZB 2FD6L 1AXSA 1GW6A 1T1ZA 4PRIB 5LHDA 4H13C 2HJKB 2W07B 4GW1A 5DK3A 2O61B 5LNDA 3C6SB 3QIBA 3PDOA 5F7FA 4N8VB 3ZE2F 3R06A 2XA8H 4IU2B 3LKNA 3RA7H 1F4YL 4HCRH 3OMAB 3QFJB 4UANA 1A3LL 4N1HB 4KKPA 5KW9L 4ZX5A 1E6JL 4X7FC 3EAKA 5IR1B 5A3ID 5BVJB 1SHMA 3C09C 1QRND 4OLXL 4KK6C 4HJ1A 2OTUA 4NQED 15C8L 4NRXA 3KBHE 4EIUA 1G1KA 2HPTA 1CLYL 3CSPA 4FTVD 3V9CA 4ANVA 3ECQA 3K7UA 4UUJB 3SOBL 1DE4A 4G3YH 4AE1A 2YUWA 2H8PA 4PG9A 3US9A 4BK8A 4N68A 4FNQA 2ZKXA 4HJJL 4IBYA 4BSVA 4LB8A 1U8MA 5E2JA 3NAAL 3RWEA 1C5CH 5MP6L 4Y5XA 3PVUB 4GW4B 1S6NA 5EPMB 5GZOA 4XPGH 1LDPL 4UDUA 1OALA 1EXUB 3K81A 3WTTA 3RVXC 3LVEA 3NFPB 4TUKL 4JUSA 4YN3A 4JUTA 3ESOA 5EN3A 3UJJL 3FZUC 1IM3D 1Z5LB 4MD4A 2DYSB 4J3OC 5JYMA 4H8WC 3D2UB 3KWWA 2DWTA 1UGKA 2GJ6D 1L5GA 3H3BC 3TZVB 1UTCA 4PSPA 2B7DT 2QR5A 5F71A 3BLPX 3K46A 1UFUA 2Q8AH 3V4VL 4IKKA 1P4LB 1QTPA 5CINL 1QNZH 5DQJB 5I1JH 1NGWB 2NW3A 4RWHA 1BZ9B 1VGKA 1WK0A 1DQMH 3MODL 5DURB 3W0WE 5I18L 4GBXB 4BZ2H 4Q58C 1CL7H 1RJYB 1Q0EA 2DYPA 4JPSA 5ICUA 3V52L 4TULH 3ZW3A 3OKMB 3SQOL 4IKIA 4QTFA 2YJQA 3SDXE 1JDCA 4P48A 4QYOB 4TQHA 5TFSH 1XAUA 3O9WD 3QAQA 2NY2D 2ZKWA 4X7CC 3T1WA 2NY2C 4Z8FL 4B9JA 1MW3A 3E3QE 2K3TA 1RZKH 2N1KA 2O5ZL 4J6IA 1K8DB 5IQOA 3BPCA 3BVNB 3WFCL 2NOYA 3SPHA 4BYHA 3D4ZA 4V11A 3U82B 3L5WB 2EVGA 4Z7NA 2FZ3B 1GOTB 4IMKC 1AZNA 3N0EA 4MMXB 3WN6A 1ZIBA 1TYQC 1KYAA 3QR0A 2HFEB 4YX2L 4ZW6A 6FABL 3GHEH 2HX7A 1HWHB 4N5ED 4H8UA 4P4RB 4GQ9H 4PRPB 5IW1A 3O0RH 3C08H 4OZHB 3LH8A 3HR5B 4E41A 3VXMD 3KM2A 4R97B 1R17A 1SDAB 3DJSA 1ACYH 4PLKC 2ZUSA 2E6PA 4HKBA 5EBLA 4B41A 5BS0D 4I0KA 3VFWB 1KJVA 4YJZL 1M42A 3FOLA 2ZOKA 4XH2B 3BSGA 4OF0A 1G5AA 4G1EA 4QRQA 3SDYH 3TNMB 2XETA 5D55A 1TTRA 3CXDL 2IPKA 1UM6L 1JPTH 4QPEA 3U30B 4F20A 5GSAA 1BIHA 5E9DE 4MX7A 3OR7B 3KYKL 4M5SA 3SPVB 1JPST 1KPUA 2A74A 4Z7WE 1T5WB 5E1IA 2H47A 3UZEC 2EO1A 3EJYD 1CBJA 2B3IA 2E3VA 3LX9A 4RAHA 5CSBA 5D1XC 3FT4B 1KGJA 1H3VA 3WKNA 1PCXA 4YHPB 3NJFA 3RL2B 1PG7H 3TEZA 3X1FA 5B1CA 4PWJA 1H3UA 2H6OA 5K33A 3MRGA 1UKTA 4G42A 4I1NB 3FSAA 3SDCD 2FHBA 4KRMB 3OZ9H 1X5LA 3IU3A 4U1GB 3S6CA 1IGYA 1P2CB 2L0DA 3O3BA 2OCCB 1Q9LA 3PU7A 3OZLA 4U4BA 5F8RC 3T4AB 3ZOAA 4QT8A 2A1WL 4M8RA 4M4RA 4H88H 3GC3B 2JIXD 3DUHA 1T21A 3D8MA 4LG9A 1HHKA 1KIPA 3Q9QA 1YYMH 2W0PA 3NPSC 4MMYB 5FKTA 2NY6D 4XWOC 3P4MB 5JQ6L 1RIVL 2XZCH 2EEFA 3UCQA 1CN4A 3HZVA 4BKTC 2FX8H 1BD2B 4E9LA 3M7OA 1T20B 4QHPA 4HOZA 1KC5H 4L5FL 5CEZL 4J8BA 3CDZA 2OL3H 4PRAA 4EN2A 1Q72L 2Y6TE 3BGFC 3KDMA 3VXOB 4HPYL 1LP9E 4FQXC 2LTQB 4RRPG 5FWRA 5B4WA 1FIGH 1MI5D 3D08A 4IEFA 4WI2A 4AEEA 1QYGH 4BSWA 4N2MA 4DNLA 4Z7VE 3S0PA 1EDHA 4G8EA 3L4MD 3MOBH 1OZUA 1AO7D 2OMZB 2HVBA 1PX8A 1I75A 4DUVA 5F9JB 5E1GA 2P43B 2DLGA 1DR9A 2F54D 3R0MA 2AV1B 2WBJD 3PWNA 1MRDH 3QUXC 5FW7A 4PRIA 1SF3A 4HWUA 2GIYA 2QZ5A 3N40P 4XNQB 4G6FD 2HRPL 4ZUWA 1MW2A 1MG2A 4F24A 2MJWA 2WSDA 5ABDE 4B97A 1BVZA 4H0IA 3EYFB 3WLWC 4CY2A 2L7JA 1BQUA 1BFOA 1U93A 1YSOA 3MV7E 4FXGB 4QY8A 4KXBA 4Y19D 2IDUA 3NFSL 1PLBA 1DQIA 1ID2A 2JELH 1OIOA 3O4JA 3B9KB 4DN3H 2AAAA 3IDJA 4K3JL 3VW3H 2XX1A 3FB5A 1L3NA 3QH3A 1P5VA 4FHLA 3QJTB 3NTCL 5PCYA 1XTMA 5DEJA 2DH2A 2J1ZA 2WLJA 3SBPA 3MRBB 2YGNA 4ACTA 3S9DB 4IRSC 1I1YB 1AQDB 1V10A 3U0PB 1KNOA 4XB3A 3ZZLA 4CDHA 4WI3A 1GOGA 4HGMA 1D5MA 5TD4A 5CJXA 1DBBL 4IYKA 3UBXG 1CJYA 1ACZA 2B5NA 5FKAB 3LPWA 3NSFA 1E9OA 3V0HA 2V5YA 3PAZA 3V4PL 1NCBL 3MCKA 4F5CE 5E9AA 1XX9C 3FO9A 4I88A 3BSZL 1P4BL 1I3RA 1I7RB 2HUEA 4YQXH 5D1ZB 5GGTH 3VSQA 2CE9A 5EEVA 2R39A 3QUZD 3ULVC 1KCWA 4N0FB 4JO1L 4BSWB 2H6QA 4QL1A 5D2LB 3N2JA 4HD5A 1NANI 2KDYA 4QO1A 1LMKA 4NFCA 1S78D 4JCLA 1OOWA 3QZOA 1EO8L 3QHFH 5F7BA 4U1NA 4B0MB 3QJOA 1CICB 4UOW1 3D05A 1KGXA 4KO6A 2YFNA 4RMRA 3D2UD 1D7DA 1WITA 5SX5K 3U36A 4A6YB 1OGAA 1E4XH 3FQWB 3OAYH 2V17L 3S4SG 1DQLH 3LXAA 1E2WA 5IT2L 2JLLA 2WLMA 4KKAC 4MJIA 3ZUCA 1IIKA 4X99A 5MEOA 3O3AB 4OIIH 1C16A 3CWGA 4UAOB 3SO3B 1CZ8H 4TNWF 3TVMD 3BPOC 3MXWH 1G6RH 1NDGA 3H9SE 3DXMC 3GC3A 4M4RB 4NM8L 4EOWL 3KLSA 4FEMA 2BWDA 4L2YA 1Q9LB 2AXGA 1A0QH 4H2AA 2WWOA 3QDHA 3L5XH 1OGPA 4R90H 4TOYH 4PJBB 3AW5A 3GWJA 3J2PA 3V0VA 2NLJA 1CLVA 4HSAC 4KQ4L 3HHRB 4N0CD 4JKPH 4Q14A 4OQTL 4XCYB 2VL5B 3WXWH 1OTSD 3US0A 1TITA 4JHWL 4JDTL 1NJ9A 2XVKA 1T7VA 4G8EB 3B2DC 1G7IB 3ZN6A 3RFZC 2UWEE 4LSUH 2AQ2A 1F42A 5EU6A 3EFDH 3V5DB 3HN3A 4L0YA 2ICES 3PHSA 2WANA 1GJUA 2IANE 4LFHG 5IGXL 4O9HH 5H37G 5A6LA 4A7JA 3RWJB 1ACCA 4G43B 2VDQA 2BNRD 2ZYRA 3TJHD 3UYRL 3EI4A 2BY0A 3ATAA 3U1SH 5FUOH 8PAZA 2ZOKB 3ASWA 2QQQA 4XH2A 4XPBL 3WIAA 3TEUA 3WTVA 3NVNA 1NM4A 1R34A 2A38A 5I73C 3BEVB 5I75B 2QHRL 1A4KA 2XU9A 3LEVH 3MLUH 2NNCA 3BW9B 4GPVA 3UTTE 2XNAA 5GRXG 4PJAF 4F7KA 1ASQA 2XWTB 1J1XH 3IGAB 3KEDA 1BFSA 2VITA 4QOKD 1J10A 5HGGS 1J0JA 3SPJA 2CK2A 2W59A 4YHLH 5EZOL 2FJGA 4AZ8A 1NFKA 5CWSB 1QBML 1TMCB 2AC0A 4MCYB 3ECWA 4L48A 2NYYC 1RZIB 1U6AL 4FQ1H 4KDVA 4RX4A 1UXLA 1KN4L 4DGUA 5E08H 4B53A 4MCMA 1J7VR 1CD1A 3MA9L 2AKRA 4HCGA 5AALA 3EUUA 4QLWA 1G7QB 2Y23A 3TT1H 4B9PA 1ORSB 3DROA 4ODUB 4ODXB 2F9BT 1L7TL 3QPXH 2UYLB 3F7QA 2Y25A 2AAVA 2I3TA 1C12B 1ZGLM 2WLHA 4BWWA 3LKPA 4XTRC 2ERJB 5DMGD 4CGTA 5DMGC 4JKPL 3S35X 1NAMB 5E5MB 1FVEA 3SKOA 4ELMB 5TQ2L 3TNMA 1CD8A 1SEQL 3AU1A 2H1PL 3SKNA 5I1EL 4GY4A 3NPSB 2EXWC 4BQ8A 2YK1H 4QIRA 4D9RD 3KLDA 3RWGA 5F7UA 4M6NH 5DHVH 3ARFD 1S7QB 3OB0K 4MGXA 3PG2A 5D5MB 2B9AA 3B43A 1SN0A 5EU7E 4LF3B 1ZEAL 1UADC 3SKMB 2Y1AA 2XN1A 3L1OL 4LLQA 3X13B 3LNEA 3VCLA 4MJID 4CVXB 1KCUH 3VXNB 1DN0A 1ID5I 3FTXA 2YAQA 1UWYA 3OAUH 4JANA 4XPFL 2D0FA 3V0GA 1T4WA 2VO8A 4KK8C 4RNRB 2EKJA 4TSCL 5EO0A 4CUCA 2X10A 3KWUA 3HAEH 4BKLB 4XNXL 1FBIL 2CR0A 1A2YA 3SQBB 2PCFA 3GPSA 5EIQA 4KZCA 3UG3A 2F8VA 1SLUA 4PJFA 5TQ0H 4MNQD 1THAA 5AENA 1CE1H 2X2HA 2B59A 4KMLB 2V2XA 2V37A 3B6SB 3IFPA 2H6PB 1CD0A 2DYPB 4JRFA 3CDFA 2WK2A 3ZE1E 4GO6B 5ISZE 1KGUA 3I6LE 2IH3A 4XO8A 4OCXL 5C7XH 4XNBA 2G0LA 5J11B 5JIQA 1I7ZB 1SVBA 1Z0NA 3RTQD 2VDPA 1TQCC 3TA3A 2FQEA 4LCCA 1SLVA 3T0XA 3CX5J 3V0FA 3AG4B 1PNDA 4DQAA 4M6OH 4GJTB 1I8KB 2F7QA 4PJ5D 4QXTA 2VISA 2NX5A 1I4FB 3OKKA 4JM4H 4R4BA 4R96A 3WDIA 5E2WH 1E6OH 4LCWA 4AYEC 3UTSD 1DCEA 1X5HA 5B3NA 4ALAL 1U8PA 3D3VB 5DDHA 3SKNB 1F86A 3BVXA 3UR4A 3UADA 5T5FA 2HESX 5FO8A 1IEBB 2Z8VC 4WGWB 5JWZA 4MMZB 3CH1A 1XIPA 4ZK8A 5DC0A 2EE6A 4U1MA 4DT2A 2EILB 2O6PA 1AHWA 4JM2B 1CCZA 5HE0B 3RVUC 3GLDA 1XHMA 4M4PA 4QTHA 3NEXA 1R6VA 3CVHB 5EF1A 4F33A 3T2PA 3DRTA 1EJFA 1IGFL 4I4WA 4RZCB 3WGUB 2EECA 3QIBD 1HL9A 4OZ4A 4PC0A 3F85A 5E4EB 4L4TD 2BZ7A 4JG1H 2ARJB 2VM9A 4GBXC 4YE0A 2YOAA 4PRNB 3VD5A 2Y2YA 4YNYA 1E4KA 2E4FA 5KVFH 4KXZI 4OZ4B 3GLEA 2XFXB 2AXGB 3OKLB 5E7FA 3K5SA 1AD0A 4G9FB 2P80A 5B3JE 4TVPL 3Q2NA 2V5SA 3TZVD 1JK9B 1JWUB 2Y1VA 3CX2A 2CIKA 3M86A 1K5NA 1P7QD 3MRMA 2VDRL 1MUJA 2PCPA 4U31A 4CMMB 4U7SA 3QNYB 1BXVA 5GGTL 4ZO7A 4KJQC 3QDGD 2VAJA 2CUIA 5EM2A 3DOIA 1L0PA 1NCWH 2CPCA 3MCLH 2K7PA 1G94A 2A0LD 3ZQWA 3VFMA 2FCBA 1OM3H 2OMXB 4S0HA 5E8EB 5IW6A 2ICEC 5ABZA 2HLAA 1WLHA 3T65B 3BXNA 5AVZB 2B5MA 4QHUA 2H47C 5E99L 5HDLA 1F90H 3C5XA 4LCYB 3S4SA 3EYUH 3UO8B 4H88L 4AJYV 3A4AA 4OUUB 5D7IF 2R1XB 4ZXBC 2D73A 5FA4B 4Z5RA 1HIML 3ZDXB 4AMZA 2YRPA 4IOSA 4YBHA 4IQHA 1G87A 5HHVL 4O2EB 4EI6B 3MR9A 3RZCD 2Q2LA 2YAOA 4JDZB 2W0KA 2VABB 2VXQA 5BRZE 2R69L 5EWIL 4JM2F 5B1BB 5TDPB 5K9KB 4S0SD 3S8FB 2CDFB 3RU8L 4CKVX 2OR8A 3VGZA 2DBJA 2YNPA 1DL7H 4L3FA 35C8H 2FK9A 4MJ6B 4XP5H 5AUMB 4YZFF 1LEKA 2FHFA 1IRAY 3WJMA 2HFFA 5C09E 1TTFA 3VXNA 3QE5A 2Z91A 4Q2ZB 1RSFA 2DOCA 2OYLA 2YRZA 2HFGL 1ORQA 5JLZB 2NY4B 2IQAB 3KD4A 4DO6A 1J8KA 3IPBA 3I3EA 3SDXF 3GTVA 1RI6A 3HW7A 1X5IA 1U3HD 1CE1L 2WQUA 4RH4A 4ZMWA 4H20L 2CK0H 1NCDL 3DDFA 4R4BB 5FUCE 1MHHA 3VQLA 3HG1B 1MFNA 1UZ6E 5TGBA 3V55A 3O2VH 4YDKL 1JSYA 4MAYB 5SXMA 5I8KL 1A1NA 5DJXA 2HH0L 3VXME 1UWGL 3AU1B 3CLWA 1H0DB 3JV5A 4XEIC 4OI9A 3LKSB 4BJLA 2NY0C 4HH8A 5IV2A 2QMKA 4E54A 3O3EA 4TOYL 1UEMA 3V6FB 3MRCB 3D39D 2DEYX 3QDAA 3QIWC 2H3NB 4YDMA 5HJBA 4CC1A 4QYAA 4PJCA 2QELA 4ZXBB 1ECYA 1RUPL 5TPWH 4U1EI 4M7KL 1Y0LA 4R83A 1F6AA 2D7TH 4A7VA 1N0XH 5D8JL 5CGMA 3ULVL 3SYCA 4P46A 3VD2A 3MFFA 2PCYA 1T20A 4LLVB 2J8UE 3EBHA 1CDIA 3OG6B 2W1NA 4ZUVA 4ERZA 2YRLA 1WAAA 4JNXA 4XMXA 2F7IA 3CSGA 4YFDB 2IAND 4B9YA 1TUPA 2IALA 2Y7SA 4GRMA 3H54A 3BD5A 4JFEA 1X7SA 4OWRA 4PJGB 3DYMA 5CJBA 5HDQL 3LEXB 5ECJE 4HS8L 3MRLB 2W60B 1MIML 2FIRT 4PJAA 4X6DA 2WXOA 2YFOA 1VEMA 1JTOA 4QRPE 4X6BA 4QAWA 1U8OB 3ULUD 1QI3A 4JHUA 5ACZA 3Q7JA 1GH7A 2AQ3A 3MBEB 3RZWA 1SJVA 1PGRB 4XBEL 4CW1A 2XOTA 3G5YA 5GGVL 5I1DB 1AOHA 3IJSA 5C2UB 4LKXB 2HN7A 2MWCA 5CAYB 2H2SD 4HIXH 1QLEH 4UBDD 4JFHE 3T6QC 2ZUVA 4MNQB 4UAHA 5EHFA 1IC7H 2P45B 1IKNC 1K9TA 4FFYL 5GXBB 2VCOA 1NOFA 4RAVB 3SVWD 2ZKHH 4BDVA 3QUXD 5INDA 4J81A 5FYJH 1TEGA 3R7QA 4JDEA 3V7DB 2HB0A 1U3HB 4ETQA 4ZFOA 3DWLC 5JA8B 5TTRA 3VSUA 2XJLA 1KIUB 4FXLA 3WE6A 3U1SL 5F9OL 5IUCA 5GGRY 4EAEA 4G72B 4OCSH 2BIOA 2Y24A 5DT1H 4IBTA 3A23A 1NEUA 3QAZB 4PSRA 3X12A 3ZMRA 5H17A 5EMLB 2XKNA 5BJTA 5TFSL 2X0UA 3ARFB 2VC2A 4L4JA 2HVJB 3SDAD 3ZJAA 4BHUI 5H37A 4G9DB 4GO8A 1S7SA 5MENB 4HJIA 1IBZA 4QRPA 3GPEA 2IBGA 3D69B 2AGJL 3LZQA 5IMOB 2ZKYA 1LNUB 3MYZA 1PKQA 3JBG7 2EDTA 2XWBB 3O3BB 4Z7IA 4PGCA 4L1MA 4PRBB 2X4TA 2WUBH 4DPRA 5CINH 4CGUB 3NJLA 3IGKA 3DECA 4NM4H 1AR1C 1GGBL 4PJIE 3OKDA 4ZPTB 1UD4A 3TVMA 7CGTA 3WTYA 5IOPA 2YO3A 5B1JC 1AQMA 2FEDC 4F2FA 4HETA 4MKMA 4NNPL 4XBEH 1OQXA 1V7NL 3CXHK 1N6EA 2DQFA 4YAQB 4Y4FA 5E6RB 3J80g 2ZXGA 3JVFC 4YSAA 2ORBL 2LLNA 3WIIL 1ROWA 4GS7C 3FCTB 4MJ4A 4ZMPA 3O3EB 3WY3A 3AVEA 2R2EB 4P23C 4X9GA 5D2LE 2X4RA 1ES0A 1H0DA 2D3LA 4ODWA 2OMTB 4I18A 3UPRA 3ILPB 2ADFH 4DCQA 1H2XA 1SQJA 3L4VA 7TAAA 1J0IA 3HAEA 5JDSB 1BXUA 5FQDA 2CUHA 4YSTA 4Y4FC 5AB9A 3FDWA 4BCBA 2IIJA 5E1AA 4Y4FD 3VG9C 4RBPH 3L3GB 4OCYL 1HCZA 5I2IA 4CADA 4LRIA 1D5BB 2CNYA 4P5SA 4CZXA 4J7RA 3ZE0E 4JO4L 2DIAA 4ADIA 5EUOF 4WEBL 4IBVA 2EP6A 4A0BA 4LBEB 4XXWA 1FGVL 4KNSA 1OGAB 3BCFA 2AABH 3HPLB 4PUBL 5F7WC 3DVIA 5EUOA 1LEKB 4MMXC 1B9XA 5IHHA 3LKRA 4X60B 5FHAH 5CR8A 3UTSA 3NIGE 3GS4A 4HALA 4F15C 3MLUL 2R8SL 4KWUA 1JV5A 5JHLA 4WK4B 4ERYA 2YZ8A 5K9KA 2LGNA 3MACL 3IJYA 1XH1A 5LGYA 5BPPA 1SY6H 5MERB 2DI7A 3BP6A 1JFQL 2C26A 5B21A 1C08A 4D94A 3VI4A 5FF6A 5EMKB 1DUZB 4R0LC 5ESQB 3GNML 4NRXB 3I3BA 2BIIA 5ANME 3WFEL 3SDAB 2JB6B 2C7FA 1U2VC 4L3CB 2UY6B 4RETB 5ICXA 3ILDA 4XMPH 2WBWB 1ZLSL 2WCGA 2HMIC 3DM0A 4NUGH 1N6FA 2XDHA 1KOAA 3VFNA 3F01A 2W9DH 4NQQA 3QW9A 3QC6X 3MV9B 5DJXB 3SE3C 4F57H 4C58B 5D9SA 4JDVA 4LFHD 3C6EA 5DRXA 4DFHA 5CD3B 1IEAA 5J11C 1XSKA 1JGDB 4HHAB 4HS6B 2ZF8A 3GMMB 3Q1SL 2OMNA 5I74B 1LL1A 2AF2A 2BNRE 2ZG2A 3BOVA 2V7HB 3KPSD 1OCOB 3RILA 4WKXA 2JCCF 2Y6SC 4GKNA 4PGBA 1M7XA 4QCIA 4ZDHB 3QZNA 2PNDA 2PW2A 2D9CA 3S37H 2MHAB 4U3XA 1X5YA 3RKDD 4ALAC 1CICD 3Q5TA 5CCKL 1UOQA 4JPWH 4HUXA 1EXUA 3AACA 2GHWB 3DVNB 1O5DT 4G5ZL 3JPXA 5EF3A 5I6PA 3WL9B 2A9CA 4Y88A 5E99H 5I1GL 4A66A 4LU5L 3PDGA 2CDFA 3HC0B 5HYNB 2BOBA 1A4CA 3P0VL 3PLYA 1KTRL 3FQUA 5D72L 5DZOA 5AOZA 3L7FB 3VB8A 2Y69B 5IHLB 4ABWA 1G84A 2ZCLH 1P84K 2OMUB 4RRPA 5D1ZD 1E6JH 1V5JA 2X2UA 4XCCL 3W3BA 5BOJA 3TFKC 4M62H 2PCXA 4ZX6A 1XH3B 3CUPB 4JFQA 4HIJB 2AQ5A 2QSQA 4QTHB 2VJXA 3GLAA 4L4VE 4N86A 4GW5A 1OB0A 2XZAH 3G08A 4XN4A 1KPUB 3ARGD 1BIIB 1ZVYA 4JY5H 2VIRB 5D7EA 3CSTA 2B77A 3KPSE 4OJFH 2J1KA 2P5EB 3KPMA 5FA3A 4PGEA 4WIQA 4BZ1H 1C08B 2IGTA 1A64A 3CCHA 2N4IA 1E42A 2VXQH 4DP1X 5I1LA 3KCPA 5EC2A 1CFVL 3N42B 1NMCC 4ZS6C 2JTDA 2PXYA 5D1ZI 4QXTB 4O9DA 3WELA 5D1XA 1A6WL 1KV3A 4FKKA 2XXGA 1I1AA 1HHIA 3GIVA 4PRPA 1QI5A 5C07A 4OGAC 3NABH 4RE5A 5IT9g 3ARDC 1FZJB 1AD9A 5DHMC 1BM3L 1YMHA 5IB4A 5I16B 5F9WC 1O7DE 2Z92B 3VD4A 4I2XB 2P42B 4ZMLA 1BFVH 4HEPA 3EI3A 1VIWA 2X70B 3PY9A 5I0DA 3TO2B 5DEGB 5F7MC 4O58H 2WMPB 5MI0B 1D7FA 1J88A 1KIUA 3HG1D 3KG5A 4WFGE 5LCVA 3IUMA 1K4CA 4WU7B 3RSEC 43C9A 3FFCA 1NCTA 4RZCA 5E1AB 4ZQKA 1VF5C 3KWXA 2C1OB 3WXVL 4AYMC 4QRPD 4RGNE 5JMOC 2ZXEB 3QWOB 3TU6A 5I73B 5F3HA 3LS4H 4LL4A 1A5FL 3IFLH 4XXDB 3IB4A 3LPOA 3Q8BA 4JGUA 3RWCA 3V5KA 2YXWA 2VDNB 3CDCA 3S35H 2DQHH 4KRPB 2PXYC 4LEXH 4P99A 3EDJA 1AIFB 1G9EA 1GW0A 2HYMA 2JXMB 4D9LL 3WNJA 5I5IA 4L8DB 5AKRA 4Y9EA 4AQEA 4FXGC 1DLFL 3ARGB 3COOA 4XX1G 3LKOA 1DJSA 2GCYA 4JY5L 4J8GA 4ZNCD 1I8LC 5FDWB 2HXCA 3OKDB 1RUQL 4LL9A 1WAAF 1CR9H 1KLFB 2GJJA 3CX5K 5CEYB 2NXZB 3VVWA 2CIKB 3E6HA 1Q0YL 1G0YR 2CBMA 4LCCB 5FYKL 4GQPH 3EDKA 4IKLA 4QR7A 3UMNA 3MNVA 1W0YT 1P53A 2HSIA 3JTTB 3KEHA 3PQYA 2VSKB 5I1HL 4N2BA 2VB5A 4YDLB 1I9RL 4I3RL 2QVMA 3MCLL 5LVEA 4MA1C 3TYFA 4JRWA 3AXIA 3AY2A 1E8XA 4JFXA 3T2QA 4I77H 4CAGA 2ITDA 1I3GH 3FRPA 3F05A 3CVHA 3PWVB 4MAYC 5J57B 1WE5A 1O7SA 1UJ3C 3EZJB 5EZJB 4QHLB 3UTTB 5HHXL 2WXFA 3K26A 1LJMA 3ZDYB 4AWJC 5GISL 1NGPH 4I2XA 5E2WL 3RG1C 3LDBB 4P3DA 1JZEA 4AYFB 4Q6IB 4PV9B 3BH8A 4QXGL 2YXFA 4XBMA 2OMWB 2WY3B 5CIPA 3IJ1A 1I53A 4DEPB 5BZDA 5DO2D 2XFGB 2FJSA 1Z6JT 4O51B 1BZOA 3K6IA 1I31A 4IMLB 2NY0D 2BJMH 1U8CB 2BS71 2PR4L 3BMVA 3IDNB 5FKPA 1CGSL 3LJ3A 2CNXA 2W91A 1A5FH 3B7UX 4Y9CA 1JZFA 1PGUA 1YNLL 2IO5A 1PX3A 4UT6H 2QT6A 3QDJA 3PFUA 1VZ2A 3NCJH 1JV2A 1YEKL 5EBMA 3AC0A 3RL1B 2H9GB 3QORD 5FM8A 3EH2A 2BP0B 3FQNB 3EBAA 4ELME 2MIZA 4HAGA 3V5KB 3CHQA 4ZODA 3V0DA 5EIIB 2CO1A 2FWUA 1I3VA 2GFBB 4M6AA 4AJ0A 4YK4C 1MG2C 1HOCA 3GS0A 3OGCA 4NM4L 3EGDB 2WWKT 4OLVH 3T77A 2ED9A 5DJZB 2UUDH 2P24A 3EBGA 1WA2X 4P2QB 1KXHA 3I3DA 1CUOA 1T7YA 1VGEH 1AH1A 1CVRA 2DV6A 3WDHA 4GBXD 3D1MC 4ZD3H 4LZKA 1N8OE 2I7OA 4DVBA 1H3PH 4ENED 1B2WL 1N9PA 1Z9OA 2ZAGA 5F6IB 4FKEA 3UGXA 4D8PA 1JF6A 4FLOA 3MGOB 4NO3B 3MROA 1G7PA 4UU9B 5L9DH 2HCZX 2A9DA 2QPSA 3BEWA 3EO9L 4DF9A 1ADWA 3AUVA 3VXUE 2WKOA 1LP9A 3PL6D 3RIFF 3X3GL 2XQYA 1PD6A 4G8FB 1T03L 1HAWA 3RDJA 2R2BB 2BRRH 2OZ4A 2M8XA 4NOBA 4PJCB 2AJSH 2ZUXA 3K3QA 4NCDA 4FHJA 3WFEH 2DJUA 2PUQT 2AERT 1FNFA 4F27A 2YC1B 5F88A 5AVSB 3L16A 4WUUA 5C0IA 4LARH 2IFFH 1LTXA 2YHGA 2GKIA 1CG9B 1GG2B 3PE9A 4P23A 3HI6L 5A2CA 5GGTA 2EYSB 3ZU8A 1B0GB 5CD5C 1MHHB 3H53A 5CCHE 4BP8A 4KFMB 2A9AA 3D3VE 3TNNB 3E0GA 4NRZA 5IQ7H 4Y9GA 4M43H 4UIKH 1X7TA 3DROB 2FSDA 2R0LH 3IDIB 5B38A 4AIEA 3EI1A 3SE9H 1G7QA 3DJZA 3TPUA 1FL6A 4MHHI 4PJFF 2CQVA 1I85A 5GRVL 2HT2D 5FDYA 3EIFA 5IB1B 3UZEA 4JKKA 4FNPA 4WWKC 5HPMA 2A6DB 5FIEA 4WHTB 5KBMA 4S1RH 4ODVH 4ZOBA 1CPUA 5I16A 2ZONA 2JJTA 3VFSB 1NCUA 4RMQA 1MAKA 4ZQTA 2C9RA 2LU5A 3E9TA 1XAKA 1N64L 5C07B 2VDLA 3AMLA 3FOMA 3V0WH 5LDUA 1LO5B 5BZXA 4FQXD 4J77A 5GPRA 3VFTA 3UO1L 5AZ2L 4Z5RB 4LLMA 1OAQH 5HHQB 3QJXA 3ZUNC 4ZN4A 5IG7A 2ZCHH 2ZOLB 1T03H 5I30H 3VTAA 3QEHA 1F4XL 3RX7A 2VXTL 5DS8A 5SX4I 1AQKL 5HGAB 5DJ0B 1GIGH 1S7UA 3DXAD 5I0WA 1MHPH 3SY6A 3H3PH 4I13B 4Z7UF 1RERA 1G43A 3CK0H 1E3ZA 3FMGH 3FN3A 3VXSE 2VKXA 3N44F 4FG4A 1BOGB 1YYCA 2B15A 4BH7A 1BD2E 4OLWL 4BGDA 2R1YB 2XRAH 3FN9A 1MCNA 3MQIA 2B59B 1R46A 3HCVA 3IF1A 1CDBA 1HILB 4LASL 1VACA 2JELL 2GIMA 5T3ZE 2VUOA 1D6EA 1BBJA 3QNXB 4GAJL 1AI1L 4BKLA 4KRLB 4EEEA 1Z9NA 4UQAA 1OWWA 5D4IA 1U8JB 3E9UA 3LNHA 4LSUL 3VD0A 1Q4NX 2FT7A 4MDJB 2H9MA 1ITBB 3IVKB 3KLQA 1E9PA 4GRWB 3MRFB 3FU6A 1K32A 2H1XA 2YEZB 1S4UX 5B38B 1KIQB 3EI1B 2OJEA 2AEWA 3NJJA 1AZUA 3FHAA 4MQXD 4U6VH 4AJVA 4HOXA 3GD1C 4R4ND 1ZLUH 3B2VH 4ACPA 1JZ6A 1EDQA 4WF7A 4G8IA 5J4MA 2X1XR 3K27A 3FO2B 4P2OC 5KJRH 5JW4Q 4B9ZA 3DX6A 1E9QB 5DJYB 3OGOE 3QORB 1Y6MR 4LU5H 3PF2A 5GZND 4POYA 4DCQB 1OAZL 1I3UA 5GHWH 2G5RA 2IVFC 1KLGA 2EDOA 4P2RA 3L3OB 4BWTA 2F61A 4XBGA 5F88B 1T89C 2QSCL 1S78C 2WP3O 3OAYK 2CDGA 1X3DA 1NIFA 2QPEB 4Y1AE 4X6EB 5F9JA 5AWNL 2WGNB 2XE4A 2CM5A 2HP4A 4RSYA 4PY7A 1S7TA 2CHZA 1D3CA 4IBZA 1MIMH 3TWYA 1MCRA 2B2XH 2QPDB 4LSDA 4L8CA 2XPYA 4Y4KB 4YDKH 4EDWH 1WCQA 3T0BA 3IXAB 4RMVA 2G2NA 3PAUA 4M3KB 4OZGB 4P59L 1KJ2L 2QQKH 1JGUH 4PJDE 1NKRA 4PAZA 1KCSH 3O4LB 4B9CA 3F62A 3IJHB 1HHJA 3JWDH 4BQ6A 4Z3TA 5CLYA 4NUMA 3VQ1C 3Q6FA 5M5VA 4XNUL 4PBWD 3VH0A 2XLLA 2VQUA 4RA0C 2C3GA 5DZJA 4PMFA 2V2WB 3AWGA 4ZS6D 2R51A 2BKLA 3CBRA 1R3JB 2FJHB 1MQ8A 1BVNP 3EGDA 5FUZH 1O9VA 5T1LD 4CKQA 2I25N 4MS6A 2MKWA 1NIDA 1REIA 2IOOA 4KO7A 4Z7NB 4ZAKC 4UINH 2FX7L 3VO0A 2NR6A 5DSCB 4WAFA 4M8QB 1ES0B 4N6RB 1AXTH 1L7IH 5DC9B 2XACC 3E6FB 5D7SH 1MY5A 4QD2E 1VKXA 4KVPA 2VDQL 5FO9B 1XWVA 1PSKL 2NXYC 2F53B 1TCRA 5CYKB 5E00B 4Y1AA 4F9PA 1EJOH 2AK4D 1TVBA 3L3JA 2M1KA 4ZXBA 3GT6A 3VRIB 1ZDSA 1T2QL 4ZUUA 1ZHBA 3L3IB 3LV3A 3SOTA 3B9KD 3BIKB 3BFOA 1ZXQA 2YUVA 2X88A 3GJFB 4LIQH 4OZUA 4HV8B 4M1CD 1SYSA 2CIIB 3DV6A 2ZNXA 3N43F 2HXAA 5C86A 3PWPD 4CRPA 5F3HB 3WG7B 4EIZC 4U7AA 5AOKA 1P5UC 4FXKC 1MKFA 5J9PA 1WV7T 2XTJE 3HZYA 2FR4B 4ESKA 3P69A 4ZFZB 5J1AB 4XN7A 4I8DA 2C3WA 4OCXH 4NWTL 1UJ3B 2ZCKL 3P3SA 2BSBA 4YSDA 4I3GA 2VMJA 1JGEA 3TN0A 2IOMA 4Q97A 3DO3A 4ZO6A 4GP4B 4BH8A 5D7JB 4L8BB 4NXSA 2EE9A 2IQAA 2GI0A 1CXHA 1P0SE 2DQEL 5E8PB 1U8HB 1T5XA 2PF6A 4M5ZH 3T0EC 4PEEA 3ZZ1A 4KZEL 5ITBL 3BPNC 4GQ2P 2HFFB 4OJFL 4XMKL 3MJ7A 2P9IC 3AREB 1PD0A 3FO0H 5FO7B 3CZFB 1VRSA 4LMQI 4TMPA 4MDIA 5K1VA 1WDAA 2I5YL 2OMYA 1CO1A 2X4UB 3C60D 4K8RH 2AK4E 4HIPA 4WWKA 3FN0L 4KXDA 4Z7AA 2ITEA 4N0CC 5DMIH 1KXQA 4MVBC 2NY5H 1M05B 3NGBC 4ANKA 5BCAA 2HKAA 3WENA 1XGPA 4A2GA 3ENEA 1MAMH 4N5EC 5HJDA 1J5OH 2B1HL 2Q8BH 2V2TB 1JS4A 5KVDL 1R3IL 2D31A 4JDZA 4JKNA 4AIXA 1LD9B 2F19H 5IK3A 4JHZA 3ARGC 2YPVA 3OPZH 2OXHA 4CSZA 4N90E 2AVGA 3UDWA 2FD6H 1NEZB 1ULVA 1UM5L 3MYJA 1D6VH 3QCUL 4KTDH 3RIAF 3QRGH 1F11A 2BP8A 2BXYA 2JK5A 5HY9B 2HKMA 3I9IA 4A04A 1A8JH 3FQ4A 4RZKA 5FA5B 4N26A 4K5MA 1XH3A 4QRAA 2CDGB 3EH3B 3BH9A 1S7VB 4JRXE 1KLGB 3T6WA 1INQB 3VGAB 4YXKL 3BZ5A 2CLRB 1ZLWK 2PPAA 1JXGA 3APMA 5I0YA 4NOFA 4GP5B 4ZW5A 5JIKA 3I6KB 4D2NA 5EEXA 3RKDC 5EZIL 5F7DB 2AJYL 3FNKA 4TRPL 1YY9D 3ATBA 3CHOA 4R0LA 1U4FA 1RPQA 3SQRA 2PN5A 1ZD6A 5FLUA 2BNRA 1JNNH 1OF2B 5KBLA 1HC1A 4DGIH 1GGBH 3P3TA 3RNQB 1MFAH 1QSZA 1W16A 1DQVA 4Y9BA 4XYIA 1TO5A 4UUJA 1YPZE 5TEFA 2HU8A 4Y2DD 3W11C 2BRQA 2BCJB 2HH0H 4X61B 1QSEE 4WJG3 5C8JB 1LO3L 5IFJA 3N0AA 5HYJE 5FA4A 3U6XS 4GUPB 3FSWA 2DBLL 2H3KA 2XZQH 2UVEA 3GSOA 3MDJA 3ZY7A 2WOBA 3M1BB 1QD0A 3W9DA 5DK0A 5C0BD 3DIDA 4URTB 1UXWB 1W2KT 4GUPA 4O1QD 5C0JA 4DP0X 4AENB 3KMDA 1QLFB 3NN8B 5F1KC 4IIZA 4PXWA 4FADA 4A2EA 3K2IA 5DDHB 5AOJA 3KYAA 2C9SA 1N12A 3WFBL 3CZLA 1AY1H 2X7LB 3I7KA 2QLVB 3BKCH 3ZQ9A 1IL1B 3VU2A 3ZMEA 4OV5A 5DRNA 5GRWA 4AGMA 2N7SA 3MLRL 3WHXA 3PFQA 1IEHA 1OGAD 2RBLA 3FQXA 3MLWH 5GRUL 2XL3A 4EIBA 1EZSA 4U49A 4CBPA 3L6FB 1UXSB 5A2AA 3DVGA 4FYQA 2R0LL 4FHKA 3EQ8A 3QHTC 3EXJA 4Y7RA 2UUDK 4KPHL 5E8PA 4GG6F 4QXUH 3TH4T 1ZTXH 4KMTH 4R2GD 1YEKH 3BMWA 3QJHB 3PJSB 2GJ6B 4GXUM 1FNSH 3FUIA 5DS1A 1KN4H 1U3NA 2VLJB 3QUZA 5DZPA 4E36A 3D2TA 4POUB 1SJHA 3B3IA 4PJ8A 2E7BA 2DTSA 3HG3A 5GZOC 3U0WL 5H14A 3T77B 4Y5XC 4KXCA 3VFGL 5F7KC 3QXWA 1B0IA 4K8RL 2Q3XA 1DFXA 4ZOVA 4HLEA 3ZMNA 2EDMA 3KVPA 4OVVA 5A1AA 4GG6B 3MGTA 2LQRA 2NSQA 3KPNA 4PHZA 2X6MA 4CC0A 2AXFA 4C56B 1HL8A 1BVOA 4KJWD 4AUUA 3BD3A 4X0NA 2A6IB 4X0KB 4HW6A 5E00A 3IKCB 4YSOA 2J8OA 1N6UA 3MV8A 1XGZA 3GKWH 2FWOA 2OL3B 5BNXD 4LKCA 1NBYA 1QFOA 1T04B 1DYZA 2P8LB 4OCSL 4NN6C 1YC7A 3QPKA 5FEBA 3HC4H 4JG1L