3K71A

Structure of integrin alphax beta2 ectodomain
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
1081
structure length
880
Chain Sequence
FNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAANQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPELEMAQEGFSAVFTPDGPVLGAVGSFTWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQSLVLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGAPHYYEQTRGGQVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVVIGAPGEEENRGAVYLFHGVLGPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRVLGLKAHCENFNLLLPSCVEDSVTPITLRLNFTLVGKPLLAFRNLRPMLAADAQRYFTASLPFEKNCGADHICQDNLGISFSFPGLKSLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRYVAEGQKQGQLRSLHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANVSSENNTPRTSKTTFQLELPVKYAVYTVVSSHEQFTKYLNFSESEEKESHVAMHRYQVNNLGQRDLPVSINFWVPVELNQEAVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVLDCSIAGCLRFRCDVPSFSVQEELDFTLKGNLSFGWVRQILQKKVSVVSVAEITFDTSVYSQLPGQEAFMRAQTTTVLEKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of an integrin with an alphaI domain, complement receptor type 4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Integrin alpha-X
total genus 119
structure length 880
sequence length 1081
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2009-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
A PF01839 FG-GAP FG-GAP repeat
A PF08441 Integrin_alpha2 Integrin alpha
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1460 Mainly Beta Sandwich Immunoglobulin-like Integrin domains. Chain A, domain 2 3k71A02
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3k71A03
2.60.40.1530 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 4 3k71A04
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3k71A01
2VDKB 4MMZA 2VC2B 2VDQA 4WK2B 3IJEA 4UM9A 4Z7NB 4IRZA 5ES4B 3V4PA 3FCUA 5E6SA 2VDRB 3ZE2A 1M1XA 3NIFA 2VDNB 3FCSB 2VDPA 3VI4B 5E6RA 2VDLA 3ZDYA 1JV2B 1TYEA 3ZDXB 4Z7OA 2VDOA 5HDBA 3VI3B 4G1MA 3ZDZA 5E6UA 3ZE1A 1L5GB 3T3MB 3V4VA 4WJKA 4UM8B 4NEHB 4WK0B 4WK4A 3K72A 4G1EA 4MMYB 4WK2A 2VDMB 4Z7QA 3FCUB 3ZE2B 5E6SB 3K71A 3K6SB 4UM9D 4MMXA 2VDLB 4UM9B 3ZE0B 1U8CA 3NIFB 2VDPB 3VI4A 5E6RB 4O02A 4NENB 3NIDB 3NIGB 3ZE1B 3ZDYB 4MMZB 2VC2A 3ZDXA 2VDQB 4JX0A 3T3PA 4WJKB 3IJEB 4Z7NA 4UM8A 3VI3A 4G1MB 3ZDZB 2VDKA 4WK0A 3V4PB 3K71B 2VDRA 1TYEB 4WK4B 1M1XB 4MMYA 3K72B 4G1EB 3FCSA 4Z7OB 2VDNA 5HDBB 3T3MA 1U8CB 1JV2A 3K6SA 4O02B 2VDOB 4MMXB 5FFGA 3NIDA 5E6UB 3NIGA 3ZE0A 1L5GA 5FFOA 2P26A 3T3PB 3V4VB 2VDMA 4Z7QB 4NENA
chains in the Genus database with same CATH superfamily
1KTBA 4BQBA 3WJMA 1EV2E 5BXFA 1BZEA 3AG1B 4G9FA 4X5WB 3FTUA 4B97A 5C3LD 3WIIL 4IIZA 4GG6F 3ZDXF 4BCCA 4EXKA 2WBJA 1TVDA 2CKBB 1Q0YL 2APTA 2IAND 4N0FB 3HMXA 4ZX6A 2H0FA 4JNXA 1JZIA 5F2FA 2ITFA 2W81C 1O6SB 4GMTL 5LQBH 2RFXB 1W0YT 4NN6B 2P1YA 3E9TA 4AGLA 3GXNA 2Q86B 1GHFL 1LO4L 1IRAY 1WQVT 3BT2H 4XXWC 4JKPH 4YVNA 4R7DA 3D85B 5MHSD 1N8ZB 1F8TH 1JFQH 4KK6D 1M05B 1Q9LB 5EOTA 5JXEA 4EUPB 4P49A 4LQ1A 1BVOA 5MEOA 2NQDA 3C5ZC 3OKEA 1J5HA 2X7LB 3MNVA 4JG5A 1JGEA 4C54A 4NQED 4Y16B 1JGVL 5IK3A 1N3NA 1FPTH 5LBSL 1Q1PA 1DJHA 2A77L 2X89A 5FUZL 4UILH 3TN0A 3KBEA 4WENB 3VWKC 3ZPDA 5ITFB 5AB2A 4JW3A 3Q3GA 3VQ2C 1BPVA 2P8MA 2AZAA 2FGWL 3ZSTA 3HFFA 5T1DH 4LFHD 3PWNB 3HBGA 1G0YR 5EG6C 4FQIL 4WTQA 5I6NA 1J87A 2Y07L 1EPFA 4HCRH 4LIQE 1YEIH 4OGYH 1A5FH 3BZDA 3FOMB 1C5DB 4OUUB 3P0YL 3C5SB 3MRQB 1CFNA 3DURB 1NUDA 3HFML 4YXLH 1J1PL 1CXHA 3WDJA 2GJZA 3N1QC 1KTLB 1XF2A 1K32A 4PJEB 4PS3A 2H4EA 2PWDA 3HNVH 7PCYA 3FFCE 5I23A 2OX5A 2G5RA 3FULA 4RGOH 1A6WL 4G59C 1V7NH 2VAJA 1HZKA 2DIAA 5IV2B 1G0XA 2B4CC 4MQXD 4JBSA 1FYTB 4NWUH 4HJ0C 3CVBA 5HI3C 5AOJA 4X80H 3FU0A 3MOBH 5E0QA 5HJBA 3KPSB 5AQ0A 5KS9A 2Y5EA 1BXUA 1EO5A 3LS5L 4NIKB 4HLJA 2A77H 1USQA 4P2RE 5EH1A 3HMXL 1BREA 4ANKA 1GJIA 5I0VA 1A7OL 4BHUI 4JZJA 4LLDA 4S2SB 4PRAA 5E8PB 1ZVSA 4MCZA 1ILUA 3HJEA 2AJ3A 5A6MA 3CLFH 3H2WA 4FXKA 3OC8A 3OL2A 4FQXD 5F89A 1JTTA 2G60L 2QKIC 3W1ZA 5CJOL 2KDYA 5L6YH 2V2XA 1N6EA 3QAZC 3K6FA 3UAEA 2CGZA 3ARUA 2Z1PA 5IVOA 2W60A 1XGPA 4KUZH 4JPVL 1I1AC 5E08L 3KLHC 1AR1C 5FHBL 3UZVB 4XB7A 2F74A 2BVUA 3UJTL 5KSUB 1ERNA 2A6KA 4OUOA 4L8CB 1NCDL 3HC3L 2GJ6E 1S7VB 3RX5A 3KPNB 3VI4F 1KYOJ 2VSCA 3A4EA 4MZRA 2HKHH 3KPMB 4H8WL 2EIEA 1MPAH 1SEBB 3RL2A 3VD9A 2DQUH 4I5BB 1SXBA 4YDLB 1WS7A 3MRHA 2Y24A 5HDBA 4GW5B 2E7CA 4ZW8A 3MBXL 3BAEH 1OTUC 3UDWC 3EW3B 4LSQH 2NYYC 1F4WL 2WQRA 1DBJH 3FB5B 1ZAGA 2PCXA 4KTGA 2AJYL 4KI5C 1I8AA 1QQDA 2XZQL 5LCVA 4FYSA 3U9PH 3NVQA 1MY5A 2KDGA 1OLLA 4OFKA 1NLDH 3QFJA 3EMHA 4ZW6A 1HKLH 4ZO7A 4CJ0A 4QHLA 3R0MA 3CNKA 4Q0XL 1FNEA 3IXAB 4JLRB 1TTBA 1UZ6E 3ZUNC 5C9JA 5LAXB 5I1GH 1TYJA 4KMQA 3K71A 1ZHKA 5FOBA 2CDFA 5EUOA 2IOOA 5BZDA 5DCCA 5SWSB 4Z18A 2Q8AH 1KYOK 4XMZA 1D7BA 4HDIB 3QIUD 3PFQA 4F91B 4JM4H 4RFNB 2CD0A 2VXSL 3N04A 4YK4B 2XPYA 3RFHA 1KC5H 2ZX6A 4TUKH 1ERJA 4H5JA 4IMMA 3DGCR 3L5WB 4FG0A 1CLCA 4QUOA 3NIFF 4KROC 4WEEA 3U79A 5D7LE 1IBBA 2K6YA 3B9KA 5A7BA 1D9KD 1GJWA 3C08H 4A09B 2ZCLH 2VQ4A 1JMXA 3BVVA 5EU6A 5LNEA 1SOQA 1SGKA 1AR2A 2CLVA 4KJYB 3G04A 1E4JA 4LVOB 1ETZB 2P8LB 3M17B 2VDPL 4KKAD 4PCYA 4MX7A 3UMTA 4FA1D 2PCFA 3TYFB 2R1XA 1RPKA 2J1YA 1G0DA 3QH3A 3KDPB 3RGVD 5EU3A 1IC7H 4LP4A 5C0FA 2GJRA 4Z7NE 2ZUQB 2IWKA 2NY1C 1BGXL 4IKJA 3QUZD 4ESGA 2X44D 4AQAB 4AIXA 2VAAA 2VDOB 2OW6A 4M8RA 1KENL 2DQEL 4R0LC 1B2YA 1L5GA 1NDGB 3VWJD 2WMPA 3F6LA 3WOVA 3QWOA 3QHZH 3WFDL 3HZKB 4UIKL 2WAQA 3D0VA 1XAKA 4NJAL 4XN7A 4BSJA 1DLHA 3VQ1C 1T22A 2PCYA 5GRZA 2C1PA 2JB5L 4I48B 2J8UE 3CZLA 4N4YB 4Z7NF 1IJ9A 1NDMB 2BZCA 1N6UA 1PQZA 2OXHA 3AREA 3O2WL 4QHPA 4XVOA 2VDML 3TURA 2CK0H 2IGFL 2M2DA 5JLZB 1J8SA 4H40A 2KHAA 2PW1B 3DLQR 3QXDA 5TDOB 1MG3C 5AZ2L 2MHAB 2FX7L 3KLDA 3F62A 4DSYA 3EFFB 3MYJA 2WOBA 1Z3RA 1UFUA 3PGFH 2GVYA 2H1XA 4MA8L 4PRBB 4XNMB 1FAIH 2DQCL 1KEGL 2D0GA 2TSAA 1LO5B 1NPNA 3MO1A 1IGIH 2DWEA 3FUFA 4OFQA 1OTTD 2R56H 4ZD3L 4D0KA 3NJXA 3VFUB 4WKZB 2OSLA 2NSMA 1OKEA 1BLIA 3HS8A 4PRHD 4LCVA 4XAWL 2NY7L 1ECYA 4ZDHB 1S9VA 2JQMA 3X11B 4LEXL 3MRFA 4L4TD 4FP8L 3C9NA 5FYLH 1TYQC 4MA1C 4QRTB 1DN0B 2F54B 3VA6A 3UGXA 2YEQA 2EP6A 3MLRL 5DK2B 4OJCA 1INEH 1OW0A 1F58H 4FLHA 4G8GB 4WCYH 4AGOA 1GIGH 1WCBB 4OLVL 3LZNA 1FZJB 1KGUA 5FB8A 1NOFA 5D4QA 2CO0A 2FT7A 3G5WA 4OY9A 4XN8A 1BM7A 3WBDA 4IRJB 3U7AA 3WHE1 3PHOB 3ECBA 5B38G 1FRGH 2IXQA 1YPZA 1Q47A 2H9PA 3MKGA 4A6YA 1U92A 1UD2A 1FAIL 1AP2A 3KS0H 4Y5RD 5D71L 2IALB 1YAIA 2AGYA 3LX9A 3RVXD 1G5AA 3U2JA 5IROD 1H6UA 5DJ8A 3AAZA 4YHLL 2B59B 4QIRA 3P4LA 4XVTH 2XXMB 3TN0C 2O93L 1RUAH 3H53A 4ELMF 4PP2A 1HHGA 1XIWB 4YDMA 3LKOB 5D7EA 4HGWA 2ED9A 1AHMA 5ISZA 5AALA 3LDBC 3O4JA 4M5YH 3NJKA 1LDSA 4WWNA 4P2RB 4JHNA 1XH2A 1TXKA 2IUPA 1FORH 5IROA 4DFIA 2W5PA 4HJGB 2NR6C 2FZ3A 3D09A 4H13C 5GGVH 1OWWA 4O02B 3TTYA 4QR7A 3JPXA 4WHDA 2QVKA 1R3LA 2N3JA 4KV5E 4Z3HA 3B34A 1U8HA 1LEIB 1OAQH 3KWVA 1T7XA 1IAOA 5I1LA 3IRZA 4PLNC 3KR3H 1UOPA 5EEYA 3EKCA 3MA7A 5DFAA 2NY2D 4LZKA 1HI6A 3THML 2EO9A 5E9DA 2PWHA 1U33A 4G7YL 4G5ZH 4IEFA 2NTFA 1FAKT 12E8L 5LBSA 2UYLA 5FYKL 4IOIB 3FCUA 4J3SA 5SWZE 3VG0H 5F7HA 5GGVY 1D5BA 4NP9A 1CLZL 4AOWA 2VLKA 4I4WB 3SE6A 3Q8EA 4NC1E 1I4FB 4UAOC 2ARWA 3DVGB 4OGAD 1A64A 1J1OL 2OV0A 3QEGL 1VYHC 3P11L 4ONFL 4E9QA 1HSBB 1ODAA 2NYZA 3DDUA 4IBTA 1ZS2A 4Z7UB 1XQ4A 3DWLC 5D1QB 2V33A 3CHXA 2XACC 1BBDH 2DRUA 4NHCH 1R3KB 4PYHA 1HL9A 3QUXC 3KXFA 3MYZA 4OF5A 3JBG7 5CN3A 4MQ7A 4YO0B 4FZEH 5ESAB 5HPMA 2VLJE 1NUFA 4MJIE 4UT9H 1F86A 1ACXA 4B5ZA 3QHFL 4L8BA 2E27H 4ONHB 1UC6A 3U0PB 3MUGB 1TZAA 2AABH 4OKVB 1JXJA 4HZAA 4UOQA 3C2SA 4NM8L 1W0VA 1YYML 4RAUB 4ZFGH 3MLPA 4G83A 1CU4H 3NIFE 3IJ1A 3EIFA 2X3CA 3RJOA 4DTGL 4JXMA 3CHSA 3ARWA 4IHOA 3O9WB 4GP4B 5EB9A 4Y4KD 3I84A 3UDWA 1JSYA 4WO4C 3MJ8A 1NBYB 1XF4A 3NIGB 1A7PL 4L9OA 5HE0B 4MBRA 5D96C 4R6UA 2DF3A 5KW9L 3EI4A 1M7IB 5F7DA 3I50L 2BVOA 3HIZA 2DI7A 4M1CC 4WHTB 1BD2D 5SV3A 3RFZA 4Y2DD 4AZ8A 4BELD 3OJDB 4HZLA 3V5HA 1E5UI 1CD9B 1WZKA 4NX0A 4ODXA 2Z34A 5DVPA 4DPCX 3EDFA 4Q74A 1YEHL 3AT8A 4AEIH 2I7OA 3V0WL 3S88H 3MXVL 1ACCA 1MFBH 1DJSA 1T1ZA 3W2DL 2X6BA 4M03A 4R4BB 2APSA 4IRSB 4X2UA 3GHPA 1GOTB 4MNGA 1FV1A 2CR6A 1T0NB 2Y5TA 4GSQA 2DPKA 3E7JA 3CSGA 4HT1H 2E76C 3OKMB 3QIBB 1BZ7A 3GXMA 2YAFA 5DGQA 3ZZ1A 2LTQB 3GSQA 4PJIA 3RTQD 2DQJH 5FF6B 2Z35A 3GXDA 2VLLB 4IU3A 1N7ML 3RNKB 1GGBH 5TPWH 3EYUL 3GBNL 2OMZB 2HFGH 3MLTA 4AVIA 3PQYB 5JXEC 3NFPA 3SJLD 5IJKC 2HB0A 3PIQA 2I5YH 5JO5B 1I9RL 5GS1A 3U36B 1QO3A 5EO1A 4N2MA 1S7RA 4YHNA 3K26A 2P9IC 4Y19E 2DQFA 3N1MC 4RZCA 5HHOA 1VSCA 3MKSB 3BRFA 3T8MA 3WYRA 1ILSA 3KNBB 4F37K 2H41A 1SBBA 4RLDA 1JPSH 4LOVA 1V54B 2HYMA 1QTSA 2PTVA 5IEHA 5EF3A 3RUGB 1DSFL 4FEMA 3VACA 2V5YA 4HEPA 4JUSA 2DM2A 5AB0A 5E6RA 2XWTA 2PPCA 5BVJB 1XHMA 2ZKYA 3FO9A 3FB6A 4ZYKB 5TTRA 4JFEB 4JFSA 2DWXA 4LCUB 4WJ5A 4HJEA 1JNLL 4JE4B 4PVBA 1I8LA 3MA9H 3KPRD 4JY5H 2WO3B 3KAAA 1KGCD 4J3OD 3NFNA 3RWJA 1N7MH 3TN0D 4BBWA 4BXVA 5GJTH 4QRPB 1D9KB 4P9HH 3QJHB 4U6YA 2I24N 3I6GB 3B37A 2LV4A 3OMZA 4P59H 1M42A 4NI6A 4NRXA 3ECQA 4XCNA 4APQC 4LHUD 3EYOA 3DV4A 1T1YB 4V1DB 2JJTC 5L4IA 3FCTB 2PP8A 4XMKH 1WWAX 5EMYA 1A6AA 4UINL 3BPCA 3H54A 2H3NA 1LEKB 2XG4A 5I16B 4XO8A 5HDBF 1FNHA 4YE4L 3IBOA 3SE3C 4G9FB 1PX4A 2VDLB 4X5WA 5F88B 1L0QA 2BIMA 4JVWA 4NP4H 4X4YB 3FBQA 2ED8A 4NFDA 1TITA 4ACTA 2YNPA 2AJVH 2GIYA 4FQHA 5C2WB 3ZKMD 1F4YL 3UTTA 2VDPB 4YXHH 3VI4A 5FW7A 5IVXF 3TZVC 2Z9TA 4UQBA 1ITBB 2HTKC 4U1NA 3BT2L 4IMLA 4M7KL 2UY7B 2DKSA 3TL5A 3GS0A 3FRUA 3H6AA 4KKCC 3GB7B 4AT6B 1ORQA 5A2CA 3WGUB 2GBUA 2CM5A 3DNKA 5DJZA 3T77A 3TPUA 1ET7A 2L0DA 5T1LA 3IGAA 4XPGL 4GB9A 2OMVB 4MCNA 1KLGA 3F6JA 4RRPA 4TVUA 2AJUL 3BE1L 4BSVB 4Y89A 4YFDB 3SDAB 1P84K 4U1MB 4UAHA 4NAAA 1TYEB 4KDTA 3QHTC 3NEXA 1UH2A 3CU1A 3TEZA 5DTFB 1C8PA 4YFLI 2YOAA 3PRZA 3NOIA 2BHUA 3MV8E 4P23D 2EBSA 3PY9A 4GMSL 3CHQA 5D6DA 3FFDA 3O3EB 4NZFA 1OCZB 4X6DA 4Y2LA 4Z7WA 4ZG1A 2F68X 4HK0A 4GS7B 1KFAH 1P7QD 1F56A 1YEIL 3QZWB 3V6BR 1NMCC 3QRGH 3L3IA 4N6RA 4ODUB 3EYFA 3HFMH 5D7JB 4J3OH 4PGCA 4Y5YC 3UAJD 4J0WA 3GRWL 2D3VA 3SIKA 5GRWA 5TDPA 1TENA 1WUZA 4RETB 4CSPA 5K39A 3MNWA 1XF2B 3FDWA 2G75B 2X1OA 3MRMB 4L4TB 3CXDH 5H94B 3G6JA 1CGTA 2J43A 1RUML 5ICYB 4ZMAT 1DO6A 2OX5B 3JROA 4AV4A 2BOCA 3UVKA 4W4NA 3FTVA 3C75H 4AKQA 1LK2B 1CGUA 3DHJA 2Z7YA 3ENEA 5G5DA 3D25A 1KCBA 1QD0A 3V6ZB 1BDYA 1NLBH 1L0YA 1SJXA 4ALAH 4YQXH 3BAXA 2RHEA 3HMXH 5E95B 3DSFL 4AGNA 3C75A 1LP9B 5HHME 5EO9A 3FHEA 1P1ZB 4OAWA 4ZX5A 1EZVX 2C4FU 4UQ2B 4XBEL 5SX4I 3NFSL 3FF8A 5FKAA 4YMPA 2CALA 3AQZA 3OLGA 1UZ8B 5L0QB 3QIWA 1F1AA 3RIKA 4NPYB 4L8SB 3WIAA 5HYJE 2COQA 1F13A 1VB9A 5CLZA 1RJYB 4NN7B 4EDWL 5I6XC 1VGEH 1F18A 2YIHA 3RRMC 1QLEH 3TESA 3BFWA 2EJ1A 5JXAL 2W60B 4POYA 3JZYA 3ZSSA 5EOCH 3GMMB 1HWGB 2VL5B 4NDMA 1CL7I 3AQDA 3SGDI 3BZEB 5GSVA 1P0SE 4L8CA 2WLIA 4JPIA 3R4RA 3KPNA 1EFXA 1G84A 2DLEA 4YHYC 5EZOL 4H8WH 1MF2L 5FO2A 4Z8FL 5HY9A 4QRPE 4PJXE 5BS0D 5E2VH 5DEFB 4GG6A 3HUJF 1O6FA 3ZHKA 4WJKB 5LN4A 1AI1L 2P5EB 2X0UA 3LQZA 4AX3A 4GQ2P 1NKRA 1JFQL 2VR8A 4XVUC 3RDJA 2JJSA 2NY2B 2YZ1A 1SF3A 5DUPH 3LNGA 4NC2B 3F7KA 4A66A 4WUUE 1UM6H 2EDXA 1B3IA 4LOUD 5J89A 1U3NA 3BP7A 3K6DA 5GRXG 5C9KA 1XGTA 3QUKA 3VAEA 1BF8A 3VWKB 4KKNA 5JYMA 3IUNA 2YMXH 2VN6A 4JN2A 1TEYA 1TQBC 3D12B 4L3FA 1DJIA 3MRCA 4CW1B 4BM7A 4GBXC 1IAMA 3TEYA 1X5YA 1U3HA 3QORD 4XNUH 2DWDB 4HDIA 1BSIA 2B5MA 1CBVH 3E0GA 4UI2A 2CUIA 1AS6A 1SN0A 2JKRM 4G6MH 4NRZA 5LAPA 4DNVA 2F7QA 3W11C 2HVJB 1FVDA 1Y0LB 4AUJA 2O72A 4PG9B 3VG9B 2CCVA 5TDNB 5D96B 4IM8A 1GYCA 3OR6B 4HISA 3HC4L 4M5SA 3MRJA 1QUPA 4L4JA 4N2OA 1ZLSH 4RQQA 4D9QD 2B1OA 5IVZB 1KEML 2FRGP 2ILLA 4AIZA 2D73A 2A83A 1AHWA 3MOBL 4YXKH 2BSED 4B0MB 3VM7A 4FGMA 2EYTA 4NFCA 4LHUB 2HJBA 3WJLA 2ITEA 4ZZKA 1OGAA 1Z5LB 3MLUL 4ES8A 5IQ9B 5L2KB 4GUPA 5GGRY 1JWSA 5HHXH 1LD9B 3TCXA 2X2JA 4KH2A 2WJ7A 3TASA 4FXTA 3MLSL 1R3HB 5DJ2B 1MIMH 1H3UA 3IETA 4LMQE 1TNNA 2HXAA 1J86A 2OI9B 1IGYA 3CE1A 1H6TA 3D06A 3NCJL 1JE6A 4B9KC 4JR9H 4EN3A 5CEZE 4IRZL 3QEHA 4ANUA 4PQXA 2CO6A 5ENWA 5E1IA 4J23A 1CD1A 1NAKL 3ARDD 3CFKB 4MSWB 4R7XA 4YHML 1OP5K 5I1KH 2VDQL 4Z7OE 4KQ0A 1FLTX 1HWHB 1TJMA 3GI8L 4OZFG 1ZS8A 3KRWB 1HILA 1MSPA 5IB1B 2A38A 3E8UH 1A7NH 5ICXA 3QR0A 1CFVL 5ADPL 4DP5X 1WHOA 2CHWA 4D7BA 1Q94B 5IFHH 2BSCA 3VMPA 2XKNB 1UWGL 4OD1L 1KEGH 4JHBA 3PHQB 5C0RL 5KZCB 3I9AA 5GGUB 4F7TB 4LSUL 3QIWD 3KRXB 3AU1B 3JTTA 4KZCA 5CJQL 3WUWA 1SDDA 4Z3IA 3W9DB 4KI5F 2EVHA 2C8NA 4OF6A 1IIIA 4E0RB 1AOHA 3QW9A 4U6TA 4WWOA 1O7VA 5CJXC 3RWIA 5CUSL 4GQ9H 2B1AH 2WKOA 3MX0A 1P2CB 3N06B 5J7CC 1I9EA 4JY4B 4A39A 3L5HA 1PFOA 3FN0L 2NLJB 3L9BA 5E1AB 2CIIA 1FFOA 2G3XA 4XCCH 1PEWA 1NEZG 2TRHA 1AKPA 4R26L 1CDBA 4HWZB 4UB0L 1OANA 4AKOA 3NRQA 2P7TB 1T04B 4BZ1H 4J1UB 1E3FA 2G99A 3VXQA 2P5WA 1A7NL 1MI5D 5E56A 1Q9WB 3P0VH 1YNTF 1NBZA 1TMCB 2PWGA 5BW7A 3EFDH 4J8BA 1OP3H 4FFYL 3V6OC 4OGAC 3LEYL 2BP0B 3G5YB 3ROOB 4XPTL 1QWHA 3O9WC 3N40P 3O45A 3B6SB 3ATEA 1NR0A 1NKGA 3ZUCA 3WKML 1NFIA 1GR7A 4K3HA 3P0GB 4P4RA 1FCGA 1MVFA 4LBEA 4S1SH 5GJSL 5BRPA 3S36L 4PP2B 1CFBA 3B2UD 2ZUVA 3E1F1 4NQCA 3PNWA 2FL5B 1P4IH 3MRKA 5AYTA 5GHWH 3RIAK 3SDAC 3ZHFA 3BPNC 4E9SA 2ZX5A 1MCNA 1BM3H 4ODHL 3EGSA 2FR4A 4E5ZA 1CGXA 5FHAL 4RGNE 3DMMC 4I8DA 2JWYA 3QG6A 4K9JA 2XX0A 4HHAB 4UM8B 3SCYA 4MJ6A 5DD3L 3RDTA 2H14A 1KJVA 2G30A 1IARB 3UR4A 5D70L 4GM3A 2D0FA 2ITCA 3BLPX 4YLCA 1QSEA 1ND0A 1MHPH 1JD7A 3OX8A 4FFYH 2N4IA 5HYJB 1TFPA 5AB9A 2IAMA 2NUTA 3MA7B 3UJIL 4BGLA 3CZFB 5FUCC 3T1WA 5K1CC 3T8XB 1SHSA 3ES6B 2YNNA 1VGKA 3IXTB 3QDJE 4KZEL 1KBWA 2AC0A 4ZFFA 3B2DC 3W5MA 4XNZC 1NMBL 3UYOD 1P7QB 1N6QH 3U1QA 1GS6X 3JWNG 3EG9A 2NY3C 3LKRA 4PP1C 3EI1B 1GZQB 3FQWB 3ZZQA 5LB1A 2WXHA 3GSXB 3ZRCC 4Z5RB 4OCXL 2VDQB 4MKMA 4KX8A 3UIZA 5D93B 5B3NA 5KDOB 1I3GH 4H1LH 5IBUB 3QJTB 4C56E 4P8QA 4GXUM 3GMQB 5T5FA 3DXMC 3I9PA 5FO8A 4LSVL 3HC3H 1P6FA 3PWPB 4IW4C 3V4UH 3ODTA 1ZJAA 3LY6A 4AJYV 2DH2A 1OHQA 3GBMH 1PZBA 4DKTA 4MS6A 1TZHB 3BDYL 3IDIA 1CBJA 3NJFA 2MCAA 3BP5B 3F85A 4XE5B 1DUYA 4AX4A 1HEZA 4KZDL 2CIKB 4DJMA 1A6ZB 3RN1D 1HH9B 4LU5L 2EO7A 2ZKHH 1EHXA 1I1RA 3D7PA 3U83A 2DL2A 3FO0L 3FUJA 2HPOA 3TBCA 4DTGH 5IMKB 3FTGB 2WOYA 4GW4B 3VB9A 4E36A 4OD3H 1JGLH 2ZP9A 4DERA 1J8RA 5H2BB 3L7EB 4GO6B 1VKXB 2GJ6D 1L9NA 2J8HA 2IGTA 4XPAL 5JDSB 4L0YA 3KG5A 3KPSD 3D4GA 1EHLL 3GKWH 5E4AA 2H1PL 1HU8A 1ZY9A 1A1MB 4EMZA 3P73A 4MDJB 3QEQE 1E27A 3C60B 4BQ6A 1DN2A 2YPKB 3MGAA 4X83A 1DJZA 1H3XA 4OB5L 2IPUK 4AV0A 2ALAA 2J71A 3D0LB 3H9SD 4RMVA 4GT7A 4LLAA 3LXBA 4PJCB 1VF5C 4HJJH 5HYNB 3O0LA 4POZD 4TQEL 4DIXA 4WI7A 1B0RA 4PTUA 5JPMA 2WLMA 1AQDA 2BNUB 2NSXA 4PJHA 2CR0A 5DMIH 5E8EA 1PAMA 5GSRA 1U8PA 1ZSDB 3FQNA 3NJMA 4JFYB 5E6UA 4LLDB 2Z7ZA 4KTDH 1S7XB 3GIZH 4N2HA 4HC1A 4OV5A 1U6AL 2X4RB 4D7PA 5A7EA 1J8HB 2FE0A 3VD5A 3T6ZA 2D2OA 2EO1A 2BSSA 1CXIA 3EGXB 3QQ3B 5KBMA 3K2IA 3BVXA 4OM0L 4G1EA 4K3EH 5BS0B 3GKWL 5IW6B 1LEGB 2MCPH 2X3BA 4WFFD 3UVLA 3VH8B 2FX8L 2WN2A 1ZXQA 3P9LB 4GAYA 5FECA 3BD4A 4HW6A 1YRKA 2EVGA 1R75A 3BG1A 3D51A 1GRWA 4D0CB 4IBYA 4X7TA 4LKCB 3E6HA 4XTRD 5JYLA 3REVB 1UM4L 3BPLC 4OFDA 4BUGA 4AQ1B 4S0SD 3N44F 3W0WE 1L9SA 3MUHL 3D8MA 5MEQA 3GDCA 3WL9A 2OMXA 3MLYH 1J1OH 3IJHA 3QEGH 2IEPA 2EXWC 2VM9A 1FBIH 3BJ91 1DQJA 3VFSB 1GC1L 1N70A 2JCCA 4KU1A 1I3VA 3AW5A 1RZKL 3HRZC 5FDWA 2OVPB 2R51A 2JKWA 2HRPL 3CZSA 4R8WH 4X6FA 2B5LA 1AZZC 2PR9A 5C0BD 4JFZL 4EZLA 1ZHNA 4PREA 5CWSA 3VNYA 4QOKA 1PDKA 5DMKA 1GCFA 3LEXB 4LLYB 1SQ9A 4NHUB 2AGJL 3O4LB 2H0JA 3ZKXC 4TSCL 4QHLB 2NY0C 3FZUC 4XMKL 1AS8A 5AW6B 4MB3A 2HFFB 3EOTH 3EI2A 2XWDA 4FA5D 2J56A 3UAAA 2CHDA 4PGJA 3LH2L 2ALWA 4BHUA 3RZCA 4KXDA 3WE6B 5CBAA 5KSVA 3L4YA 3KHQA 3KLQA 1UOWA 1OGTA 4MNQE 5DJ6B 5L8LB 1FNAA 5EU6D 2BCKA 1OZUA 4J86A 2FD6L 5DFVD 1N18A 1YNLL 1LE9B 4ORGB 3PAYA 4L3EB 4OF7A 2CDGA 1HE8A 3GIVA 1I7RB 1EO8H 4NO2B 6PCYA 3ZE2A 4TUJA 2VCOA 3CSPA 2BDNL 2HG0A 4R8WL 5T1LB 3ORVD 4AW4A 4A55A 3APDA 2ZNXA 2VOTA 4LRIA 3ZL2A 3HTLX 2GTZB 1ZT7A 1XF3A 3OHXA 3TBYA 5HYSA 1ZGLP 2LOEA 3IRPX 4X6BA 5D2NC 4N3UA 3VXRB 3K4DA 1DBML 3VRLE 4N68A 4ATTA 4Z3FA 4NUGH 5CR1A 1XXFC 2VIRB 4OWRA 1SXAA 3V6OA 5GZNA 4DKAA 4X4KA 1C12A 2G2RA 2ITDA 1EEUA 2ZYRA 3V0GA 3K1KC 4ZS6D 1DCEA 1A6UH 4DUWA 1KCSL 1NDGA 2AJSH 4AQ8C 3RZCD 5DJAA 2F9BT 2JJSC 3I85A 4FTDA 1NFDB 3SE8L 1UQSA 4ELDA 3CVHB 2BNRD 1YQVH 4G8IA 3UYRL 1H5BC 1F90H 5IFJB 2OSYA 3FU5A 5MI0C 3IAGC 5A2FA 1PBYA 4PJHF 4J8QA 4NQXA 1MJ7L 1NAMA 3NJHA 2DQEH 2JKXA 1Z9PA 1TQWA 2IPUG 2MRYA 3NSFA 4IGBA 4WTZG 3EZJB 4K7PL 5DJDB 4XC1L 3RURA 2MHAA 3GRWA 4DK5A 4UMSA 4DZ8B 1AXSA 4LOEA 4EI6B 1ZVYA 4ZUUB 3LIZH 1GHFH 1IAKB 1LO4H 4Q2ZB 3ZDYB 1OWRM 4RMTA 2OTWA 4RMRA 5JR1H 1KJ2H 3JWOH 2FQGA 2WP3O 1LP9A 1P9MC 1AVAA 4OGXH 2DWEB 1NGQL 1JHTB 4KO7A 2JKJA 2HLAB 4LESA 3TO4C 3VG0L 1JCKA 1M2OA 1BYPA 1NJ9B 1MI5B 4J12A 4XBEH 4KHTL 5DJ0B 4ZNEE 3AT0A 3K6OA 2IAMC 5F6HJ 3HPJA 1UZ8A 2AXJA 1QPPA 1EHKB 4TNVK 2RB8A 4A2MA 1AO7A 1JWUA 4TRPH 4PLKD 3FONA 4PJ7F 4B7IA 2PCPA 1Q90A 2ZD0A 4G6AC 4NKIL 1IGIL 1GGTA 3FOMA 5KJRH 2W65B 2J7LA 5C7XH 3QUZB 1U8OA 5T1KD 4D0BA 4FAVD 1R46A 5C09B 1DQQB 4HCRL 5I1DA 1XGUB 4XX1G 3VSQA 2D3LA 2GFBA 4YC2C 1DL7H 4ZT1A 4PS4L 1IEBA 1ZLWH 3KPOA 4KK6C 2FO4B 3FK3A 2P46B 4ZMOA 2CCLA 4XC1H 2YBGA 2EEAA 1KXVC 1YUKB 3MDJA 3NTCH 4R9HA 4U05A 2Y6SC 2WVSA 5L4MA 1DBAL 4PJFB 1J48A 1U92B 5E2VL 1P7KA 3MLRH 5FIEA 1D5XA 1YEKL 1CU4L 2NY5H 5CILH 4E41E 4BKLB 4PXWA 5D5MA 5CLTA 4Y9FA 2BMKA 4NWUL 3NIFA 2FYVA 4KHTH 4OLYH 5D93C 4KDWA 5C2UB 2FLRT 1KLUB 2FO8A 4EIZC 3JZHA 1HWWA 2Z7WA 3HB3D 4PH8A 4BL0A 1FVCA 5BV7L 4JQVC 4LPYA 3ARBA 1F97A 3GUTB 5AVVB 2YEVB 4W9DC 1VRSA 5D71H 3VE0B 1DE4A 1I9IL 3QQ4A 1E28A 3EDEA 3E6FB 3VI3B 2J56H 1JRHH 3ZE1A 2AQ3A 3WTSA 1XFPA 3HC0A 1XBDA 4HMEA 4P46C 4DF9A 2YXWA 4X60B 3VTMA 1OTUD 2WUCL 2ZIDA 4WI8A 3MRPB 4WUKH 1T5XA 1ZD6A 1DUZA 1WBYA 5C08D 3IPBA 5KYUB 2IWFA 5EZPA 1RZJC 4JPSA 1PY0A 5F7WC 5AAMC 4PRPD 2MTPA 2R0WH 1Z9MA 3CHPA 3F12B 4K23L 3U4EA 4FYQA 5TQ2L 2W07B 2ZF8A 5I6MA 1F3JA 5IVXB 5BOJA 4WW2F 2A9NL 1QBLL 4MMXA 5I17A 1KB9J 4X9HA 2XXGA 1O9WA 1IX2A 5J3HD 1CDIA 4NZRL 4PLJD 1C5BL 1Z32X 3W0WB 3IWUA 5ILTL 3FCBA 4JFFD 8FABA 3FB5A 4HEME 1MZZA 4U1SB 3QUML 1GGCL 3MNZB 2PR4H 3EOBB 5B38B 12E8H 4X7EC 4XPBH 3VDCA 2XTJB 3O2DA 1F4WH 3V10A 4GUCA 4GG6E 4YHYB 4XN2A 1YNTA 3US9A 2FWSA 2GW5A 3E3QE 1QFSA 3AY2A 3FT9A 4TYUA 4GQBB 1CFMA 3EJTA 1DR9A 4G2AA 4XZUA 1Y1UA 5C0EA 4PRIA 4RWYL 4IKLA 5H35B 1VZHA 2VJ0A 2BVPB 2AJXH 2MQ0A 3IKCA 3TT3H 3O4LE 3VGAC 5CN1A 2YS4A 2VC2H 1GKEA 4PGBB 2G9HA 3CFDB 1OO2A 1Z9SB 2O4EA 4NCDA 3B9DA 2OTUB 1KF9B 4GRLB 5CU5A 4FYTA 3FXIC 1KOAA 2F61A 2CLZB 2YAMA 4NZRH 1K8DB 3JWDC 3MR9A 2JB6B 4LK4A 1HN1A 4O1QD 2GBAA 1R47A 3UTSE 4Z7QB 3VX0A 3Q8BA 5EZOH 2CNZA 3JSSA 2YK1H 4HCGA 2BSTB 3TJEL 2XKNA 4B3VA 4D8OA 2YD9A 1OL0A 4X99B 3QEUB 3IDJA 1UB6A 5F8RC 4J4PC 4EZJA 1P4UA 2PP9A 3V0FA 4D9RE 1P5UC 1YAZA 1J0KA 2AJVL 2JKLA 4J3UA 5D9SB 4ELKA 1UM5L 5FM4A 4Y2DC 4KDVA 1FN4A 3GHBH 4DGVH 1RP9A 1E8YA 2EH8H 2Z2NA 3A6OA 1CI3M 4G9DA 2EKSB 5BJTB 2F54D 4E9YA 4YHZL 5LWYL 2HU5A 3HS0C 4JSVC 4A0BB 5FGRA 2QADB 1TQVA 4KKAC 4IYKA 4JRFA 7TAAA 1B9ZA 2D7QA 1L5GB 2AXFA 5CJ5A 5FF6A 4MD5B 2XETA 4NCC1 4XPGH 5AAMA 3RB7A 4YNYB 5JIPA 4IRJD 5FW6A 1A8JH 5DQ9B 4X5XB 4GEJA 1LYQA 4P57B 1C7TA 2YGOA 1SLWA 2DD8L 5T5FL 3L9YA 2P80A 4YEEA 2EXTA 3SOBL 3STLA 4AYFA 1JTDB 3MPCA 5FA3A 1PKQB 2ZQKA 1UOOA 2BIPA 2X1WL 4L1TA 4XH2B 3DYPA 3ROOA 2YPLA 1OF2A 2ODHA 3AY4A 1IM3B 3U0TA 1NC2D 5D1XD 2DI9A 2OP4L 2NXZB 15C8H 2EE6A 3BLBA 3ZZSA 1GY2A 3L2LA 1ZLWK 3LRSA 3RUGA 3K2KA 1PFCA 1T3FA 2VZSA 3PWLA 1A1NA 2XZCH 3IURA 3IDNB 3KL3A 4UYQA 4UZGA 3TPKA 4LSSL 5A2BA 1C9IA 1G9NC 3CXDL 4XHJD 4O4YH 1ZDQA 3S3DB 4WJ5B 5DA4A 3EGSB 1NIDA 2YBRB 4I18B 5IGXL 5GXIA 1AKJB 1JPSL 2YD3A 4OLXH 4PU2A 2B8OT 4KOCA 5FK9B 4M6OH 4WO4B 5G4OA 4RVBA 5JHDE 5ACMA 1J9SA 3CFIC 3PJSA 3QG6B 4DN3H 1L9PA 1EJOH 3BW9B 1CFQB 4YUEL 3F7VA 4P04A 2H6NA 2F53B 4FULA 4ABWA 3L17A 5HHPB 2IQAA 1J5CA 1WTGT 5HGHA 3AGWA 3L6FA 3DXAA 2APBA 3L3JA 2CO3A 1JF1A 4H4NA 4KPHL 2JJVA 2MQ3A 3DSNA 4Z0XA 4GGDA 4MAUL 4TVPD 5AJAA 4Z76A 2ZOOA 4B9GA 1SXZA 1G1CA 3QQ9C 1UJ3A 2DLFH 3BYYA 3S4SA 2W18A 2HCZX 1K2DB 4BK5A 2V9RA 4OR1A 1DVFC 4G3YL 3FOLB 4PV8B 3I9GH 4F57H 2H7WA 1JGVH 1RZKC 1R19A 2VLKE 4JFEE 5B4MC 1HXYA 2Q1EA 4PW9A 1ANUA 3AMLA 1FRGL 4WV1C 5EF2A 2VR5A 2QTVA 4OZFH 2YAPA 4Y2OB 3EJSA 3GM8A 3RI5K 3ROLA 2X6MA 3BGMA 5F1NB 5GGSB 2EEXA 4AE0A 3CDZA 4QHUA 3C99A 2NPLX 5JOPE 4OGYL 4ZXBD 5ES4B 4PN6A 4HDJA 3MRDA 4URTB 4Y4FD 1Z3GH 1OD9A 3GSOA 3CQQA 4DPAX 5HHQB 2YAQA 3NABH 3TIEA 3VQLA 4DVRL 4KJQC 4LLMA 3MRQA 4Z1PA 4AY0A 2K9UA 1NEZB 3HLKA 2WSDA 4JZNB 5DTFA 1MRFH 3MZLA 4H8QA 2TRCB 4BJLA 2Y6TE 1YR2A 3CMOH 1A6ZA 4XO9A 4O9HH 5CZXC 5D2LB 2DLFL 2IUQA 4HF5L 2APFA 1EZLA 2L4OA 5EOQL 5AD0B 4N9GA 3MJ7B 3EGDA 1BIHA 3H6JA 5EDXA 2RCSL 2Z1KA 4W9FC 4HJSA 4F80A 4M5ZH 5E2UL 2CQVA 1F02I 1UM6L 2W91A 2Q3ZA 2GK0B 5JDSA 1PZSA 1P1VA 2CRIA 2H1PH 2HJKA 3B43A 4QTHA 3SKNA 4G8GE 3K8MA 1EXHA 5I6PA 1KGJA 4O2FB 3P73B 3FFCA 1UEYA 4G8FA 3CFJA 4K9EH 4LO9A 4GRMA 4XNXL 4Q9CA 2Y3NA 1QSED 1BPOA 1R3JB 3DVGA 4Q89A 1HCYA 4XOEA 2Q86A 2CGYA 2AVGA 5DQJB 2L7EA 3RVVD 4A7GF 2ENJA 2BO0A 4ANVA 4EI5A 2FNWA 5I66B 3O3DB 2OMUA 4P4KD 3P11H 1QFOA 4FG6C 5D7KD 2WYTA 4OIAA 3KS0J 3GJEB 3GM0A 1CI5A 1IE5A 4XPHH 2CJ3A 1FYHB 4OBRA 4R7NA 3OKNA 1JV5B 3K3QA 1RV6X 4L2YA 2W0LA 3W3BA 4YXKL 5FKAB 4P5TC 4PBYA 4XMLL 5CLWA 2JXMB 4ZO8A 1FL5A 5D70H 3DX8B 2B08A 3V4PB 2P8MB 3W82A 4F8NA 1J8KA 3EI3A 4RRPG 4HA1A 2OK0H 1ZTXE 5ESQA 2VDNA 1AHKA 1Y07A 3WMQA 1THAA 2CKBL 1OV8A 2WN3A 4K94L 1EERB 3Q8CA 2OJEA 3H42L 5M61A 2XVGA 5EORH 1NBCA 2HMID 5JPNB 5IT9g 2E4TA 3QRLA 2VUKA 3D4YA 1AH1A 3FT3A 1EA9C 3BGFC 3MLSH 2OL3L 5KYWA 1NBYA 2MCMA 1C5DA 1RQ5A 3NIGA 3NCCB 3JV6B 1HHIA 2NY1D 1A1OA 3APFA 1OAKL 4H8PA 4JJHA 2FLMA 1ZA6A 1A7RH 2ARJB 3IJYA 4PLJC 5JOEA 4GLRH 4PRHE 4BQ9A 4KJQD 4CDGC 1PW3A 4HH9A 3KYAA 2P5EA 3LQZB 3KPSA 2AK4B 4UNTA 5DLLA 2RH0A 4TQPA 2XN9A 5J6HB 3KEHA 1OAXL 3BVTA 5DF0A 1ZK5A 3P4FA 4AMKL 3VXSD 1YEHH 3GTVA 4FLRA 4FFZA 1NUNB 4XMLH 4AEIL 2VMFA 5E8PA 5M5TA 3GSQB 5EIIG 3D0AA 3Q48A 4YFEA 3PV7A 1S9XA 4PRHA 4JS7A 4NNXB 5C0AD 4N8VG 1L4IA 2VM3A 5CEZD 5EORL 1RVFH 5B21A 2DQIH 2ZWSA 1O9VA 4P46D 2CUHA 1QHOA 1DVFD 3DYMA 1ZOXA 3KDMB 4AM0Q 1JAEA 3BMVA 1S4UX 1OB0A 4Z23A 1MVYA 3WE6A 2ZZUT 3WY3A 4N0YH 1URLA 3IUMA 5I0ZA 3F7LA 3T2NH 3N85H 3PWVA 3Q05A 4O2WA 3SDXB 3G5XA 4MNGE 5JNYA 1YNLH 3ZE1F 4ABQA 2R2EB 5CEYA 4Z78B 5BV7C 2ZTBA 3FFCD 1BEXA 4MS8C 1ZHLB 5BVJA 5HDWA 4NZJA 3EYQD 1G6RL 4RGMB 2PO6B 4H25A 3COOA 4P05A 1N19A 5IBUG 1SUHA 4OCWH 5EEWA 1W2KT 2VR9A 5GPRA 1EBPA 1MJJB 4J5VA 1WIUA 4FQ2L 1IC0A 1KB5L 1QFHA 4PRDB 3NH7L 3NFNB 1SEBA 4LSTL 5L2JA 1GXRA 1YFQA 4JRXD 4JFOB 4AYID 2GT9A 1BFSA 1S8DA 2EDEA 4OI9A 4UV4H 4I3GA 1DLHB 4IA9A 4DP7X 1T80A 4LNVA 4NLHA 4HCIA 4XP6L 4P2QE 1R0AH 1SYVB 5DJ2A 1PLBA 2ZNWA 4PY7A 1IGFH 2YC1B 2F7OA 1A4KA 3QFJB 1X6LA 4P07A 4V2CB 3QXDB 1MHHB 2DQCH 2XIBA 4MXWL 1ZPLA 4FABH 5JA8B 4QOKE 4LP8A 2UZYB 2D9QB 5F7FA 5B39B 1RZ7H 5JW4Q 2F5AL 2I9LB 5B3JE 4YE4H 3UTTB 4DP4X 1TVBA 1AD9A 2BNQA 4P5KB 1JMZA 1RK1A 4FZ8L 5C2BL 3BVNA 3ZKNC 5EIVA 5C08A 5JMOC 3L3OA 3LEVL 3QS3A 5FYLL 2QTEA 3PDDA 3WFZA 4JR9L 4ZDHA 2D0HA 4DZ8A 5EAPA 3UAJC 1RSYA 4JQXA 1Q72H 1GZHA 2ZUTA 3FSZA 2CLVB 4MJIB 1RZ8B 3FSAA 1D6EA 4P0DA 2PWEA 3PWJB 2ZOLA 1XZWA 4F9PC 3BKJL 3UPAA 3ZR6A 3MCKB 2WD0A 4PJ5D 2R4RH 5B3JF 2FYYB 1AGDA 4LDOB 4PJXB 4ZUTB 1MI5A 1PNCA 2FBOJ 2YD4A 5C08E 4HJIA 5C09E 1G1OA 4OZHE 1X5AA 1ETZA 2P8LA 1TKWB 4JFZH 5ESVB 3CSTA 3KGSA 1ZT1B 3UO1H 1P2CA 5FA4A 5G4MA 5HHNA 5HYQB 1DVFA 1AAJA 3U46B 5CD5D 2XDWA 5DJCA 1DEEB 4F15B 4KTEL 2PCPB 5L88H 1CD0A 4XRCB 2P9SC 1NMAL 2GY7B 2CPCA 2CUAA 5D7IA 4JDTH 4HWZA 5A2LH 3JV5A 3K0WA 1BJ1H 5I75B 1IJNA 1YEDB 4P2OB 4D8PB 1S3RA 3O6FB 4NZTL 4NQSA 5JW3L 1PLGL 2JKNA 3BRDA 3JTBA 3K91A 2X9ZA 4HKXA 2C5DC 2E74C 3ZXAC 3NTCL 4ODTL 3TZVD 4KK5D 1PQZB 2OXHB 3AREB 3N43F 4YL4A 4ZUSA 1G7IB 3VXSB 1JGDB 1UWEH 1VZIA 1DBAH 1YY9C 4KHXL 5CBEA 4GSXA 2H2SD 1INDH 1V8HA 4GRLC 3MV9D 3K6SB 5I6KA 5ISZB 1AXTH 1QX1A 1IBHA 1XH3B 4BFIA 3OR7B 2DAVA 2HA1A 4YZFE 3ARDB 4ZAKD 1JRHI 4PVLA 4EE2A 5IUCA 3CN2A 3VGBA 3WHXB 2YA2A 3H0TB 2CBMA 3FQTB 4WNJA 1ZKAA 4LCWB 5EFIA 3O3BB 3UO1L 3VXUB 5C6WH 4KX7A 5HQGA 2NY3D 4PP1D 1KWGA 4J0XA 4OFVA 5CM1A 2GBTA 4Z7VA 1UVQB 3VE0A 3VI3A 5DRXB 2BY0A 4RFOL 1QRNA 4Y4FC 4A11B 2ZYSA 1SLUA 5K1NA 3X13B 4E42A 5EBLA 3I3DA 1NCOA 4LKXA 4F33A 4OLWL 4NZTH 3ZRSA 3X1NA 1AJ7H 1ZMYA 1WIPA 2VXTL 3MRPA 3GEFA 2KLRA 1KCSH 2AJSL 3VTAA 4ZOYA 3GO1L 4G80A 4KMTH 3OZ9L 1NGXA 3QJSB 4K23H 4H1LA 2XN9E 4KVNH 2YAHA 4UV7L 1U8CB 1LO2L 2H32H 4JANA 2HLFC 3NT0A 5M5UA 3MRRB 5FKRA 3X3GL 2EECA 3E2HB 1EFXB 3PP4L 1YEGH 1ZV2A 5SWQB 1N8ZA 3S96B 3OKDA 2ERJB 3C09B 2XTJE 1CTMA 2W88A 3NGBB 4UT9L 5HY9B 1RJZA 1KB3A 2AV7A 4GAGL 1V55B 3N50A 1XR8A 4FTVD 4QPEA 1WITA 4PGEA 3N43B 1VERA 4ELMA 1P7QA 5MEOB 2VDMA 1YUHA 2AZUA 3BH9B 4LXFA 3NRFA 4PJ5A 3RGVB 3RWCA 4HHGA 5FGCB 5JR1L 2RBLA 1OMWB 4UI9R 2JH2A 1BLNA 2JCCF 1TJGH 3MNZA 4CMHC 3IJEA 4XX5A 1O5DT 1YYLL 3VXME 1KIPB 3LKOA 4OJFL 4WO0A 3Q6GH 1B90A 5AW4B 3QFJE 4L1HA 1QPXA 4FHBD 3ABMB 1BVKB 5AVXB 1QHPA 4GRWH 2QQNL 1WH0A 1BECA 4OUUA 2QSVA 4TULL 4AGQA 2XQYG 3MRCB 2I60H 4QWWC 5IJBC 1XIWD 1B4LA 1QZ1A 3BP5A 1R6VA 5KW9H 4J82A 2O5YH 2CDEB 4Y5XB 1KBGH 4J6RH 1N6FA 3S0PA 1TQCC 4NPKA 1E5BA 4GY4A 4ZUWB 1PX3A 1HEJC 3TVMA 3KJ4C 3QUYB 4GP5B 4HXBH 1M7IA 5IMKA 4P9MH 1FG2A 4AZ8B 4GRLA 2IWGA 1BPLB 5E4IA 3BWZA 4B9CA 2H47A 3C5JB 1A6TA 1WK0A 3MR9B 1TO5A 1IEAB 1UKTA 4OJDH 1IAOB 5I1LB 5FKTA 2OQJB 1CZ8L 1TPXC 1QW9A 1JJUA 1TU2B 4R4BA 2FCBA 4H8UA 1YVLA 5CILL 5HDOA 3UROR 4CVWA 1TJHL 5DT1L 4FKKA 2VLRB 5IT2L 5I0WA 3MV7A 3ZE0B 4NJ9H 4G6KL 5JIMA 4F7CB 2Y25A 2QGCA 4UU9A 1H3GA 2CHXA 2MOQA 2DMGA 4N3TA 4X0KA 2OMZA 2RFXA 4GUPB 1A6PA 2EH8L 4NQDD 2D8KA 4XP1H 1DZ0A 4GUOA 4PJHB 2Y0SA 2XIDA 3EBIA 3PXHA 3S5LB 1M05A 1Q9LA 5F93C 2DQFB 3NN8B 1CDHA 1V05A 3M07A 3ZU8A 2DEWX 3OJ2C 3UTSA 3MKQA 2D7PA 3ZE2E 5KSAA 5C0CB 1ASOA 5IKCA 1R5VB 4DEWA 3C6SA 2WQUA 3ALXA 1ZGLA 5SX5H 3CFKA 3IWVA 4G1EB 1A22B 2R2HB 3FO1A 1C5CH 3IK2A 4AN0A 5DD6A 5C8JB 2KLTA 3LHAA 1RJCA 3ZKXB 4MVBD 2CBOA 1UD4A 3CLEL 5C0GA 1I3UA 1PKQA 3FB6B 3PGDA 2J5WA 4P3CL 3W5NA 4Y7RA 1OP9A 43CAA 1Q0XL 1FGVH 1U2CA 2UX6A 2VDQH 4PRIE 4LSDA 1KPVB 3OB0H 4GKZB 3NIDA 1A9BB 4NNYA 4P59L 5BV7B 1CWVA 5IREA 4JSNC 3SBWC 3DURA 3JV4A 4RGMC 2VO8A 1MCBA 3IEAA 3UIYA 4D94A 1WHPA 2GJJA 2VH5L 3CG8A 4GT0A 4K3EL 4QRPA 4J3XA 5D1ZB 5FO9B 5EAMA 3LPFA 4XCNB 4YGAB 5HVHB 1ZVHA 5GIRA 1DVSA 2QQLH 3MBED 5F3HA 3TXAA 4N14A 4M6NH 5J3HC 3FCTA 3FCGA 4JRWA 1CURA 2GNQA 2LU4A 4OLXL 4WI2A 1MWAL 4S11A 1NINA 4A08B 4XMXA 2DWSA 2X2UA 1F4YH 1HNFA 2A6JA 2B1AL 4U1LB 1FC2D 2FWUA 2E56A 1W72A 1JV2B 4NQTA 4NHUA 1WPCA 3QJXA 4LDCA 4IU3B 4JFQA 4PI0A 3V7AE 5T5NF 1T0NA 4WW1A 4Y4KB 4Y19D 2VISB 3RX8A 1I1CA 3M8OL 4XBPB 3HR5A 3AB0C 5I5JA 1NIFA 5DZNA 5GGQL 4JDZA 3HHRB 5EALA 2D3NA 4R7AB 5FKQA 3I9GL 5T3XE 3HS0B 4HS3B 4WJG3 5HYSG 1GL4B 2WXGA 5C0IA 3VI4E 1CXKA 4L8DA 4U7MA 3IVKA 1SY6H 5E6SB 3EJJX 2WGNB 3LKPB 4NQDE 4BINA 4JKKA 3MJ9H 3OXRB 1IBGL 1LE9A 1M57B 2XZAL 1Y7VA 3KMDA 1RHHA 4CZYA 1R4XA 4G56B 4P48A 2PTTB 3SQBB 5D2LE 4I0PB 1AR1D 4I9WD 3U1SL 3H3PH 3L3HB 4IBLT 5KVMC 4LG9A 5CIPA 2AGLA 4PWGA 4U33A 3VD7A 2F7IA 2N1KA 4DVRH 1P4IL 4ZK8A 4KQ3L 3WTWA 1IQWL 1G9MC 5D7SH 2BM3A 4HD9A 3RL2B 4PJDA 4GQRA 2G5BA 3TA3C 1D9KA 3PXTD 5C70A 2RACA 4B9ZA 1IM9D 3S2CA 3MNWB 4HJTA 4NBMA 4HF5H 1USZA 3VH0A 3KLSA 5EEZA 1F1GA 2DIEA 3M7FB 4QTIH 2K8MA 5I15L 2E4FA 1LK2A 3MBEC 1AY1L 2WKGA 3NACH 3HZMB 3NIGF 3QPXL 2VLRE 5FAAA 1J8HE 3SY0A 4BH7B 2XZZA 4NXKA 1VEMA 2A3TA 1IBGH 3SBWA 4N2KA 5JXED 1MH5A 4F7EA 4G8EA 4J84A 3FFCB 1G9NL 4AXWA 5IFJA 5AL8A 5I30H 5BZDB 1A5FL 3FB7A 1XGYL 3ILPB 3O2DL 3WI9A 5HHVL 1SDYA 1N3NB 1EUTA 4N24A 1A3ZA 1WZ1H 1TR7A 3HZYB 4IMKC 3S3PA 1NAMB 1A4AA 4NRYA 5CNHA 2VN5A 3T3PB 3Q2CA 2ICEA 1XR9B 4AT6A 1MCKA 4KRMB 4IKIA 2OS7A 4RFEA 1M6OB 3PUUA 4OTXL 5CINH 5DQDH 3MRNB 2FGZA 4IMLB 2X4TB 3KVDD 3P69A 3T0VA 4U3XA 4TNGA 5FLXg 5IGQA 1U8IB 2YZ8A 1V7NL 3QA3B 2LGNA 4U1MA 4X61B 3FB8B 4DK3A 1B0GA 4JQVA 3KD4A 1JV5A 5HJGA 4U2YA 5EC1A 4GGAA 2ZF9A 2I3TA 3ZT7A 5DC4B 2YWYA 2Z4QA 3KLLA 4ODWA 4CMHB 1VADA 3QH3B 5EZJA 5ILTH 1AQKL 1CGVA 3BKMH 1V3JA 5ERWA 2WO2B 1FHNA 4JHWH 3OMIB 3WXWL 4YDKL 3DX9B 4BSWA 3DTDA 4LCCB 3C6LC 1BVZA 1Y18A 1N64L 2GC7C 4OZHA 3L3IB 5CJOH 3CDCA 3ASNB 1O5PA 3MODH 3MUJA 1PJWA 1T89C 4O58H 3RG1C 5BMFH 1I75A 3H3BC 4WV1B 4A7SA 1SDAB 5DYOA 1T22B 3QPQC 1W8EA 1DQDL 1MCPL 5AVTB 1XMEB 1KJMB 4ZS6C 1BMGA 3G6JB 1FYTD 5ICYA 2Y22A 2ZWKA 3BI9X 3UJTH 3VWKA 5ICZA 4PTUB 4PWIA 2CMRH 1FLRL 2YJLA 5HBBA 3ARGA 3BSHA 3NIFB 3RAJH 3CLWA 3BKYL 1EFXD 4FFWC 3R8BB 4O02A 2FBJH 2EYRA 3MYJB 4HIXL 3D34A 3BPOC 4NQEB 4Y16D 2OZ4A 3BKML 3UX9B 3FYIB 32C2B 3US1A 4Y2DB 4O9HL 5I76A 3U9UA 2BS9A 2EDWA 1RLWA 4AYEC 2FB4L 2WZPD 1NOLA 1RIUL 4N2GA 5DVLA 1K72A 4CI1A 1QNIA 3VH8A 4ZXBC 5BCAA 1YC7A 2Y4SA 4ES9A 4PJFE 1D7DA 4L8SA 3FZUD 1HKLL 2HKFL 2WV3A 4A04A 4D0CA 1WBXB 3UTSD 3CH8A 4Q0XH 5IP4A 3REVA 1DQDH 2BSEA 4PJGA 4AQ1A 2R0ZH 3F05A 1HYSD 3MV9B 4K3JB 5HHXL 3BUYB 3F04A 2XWCA 4FQIH 4JFHE 4TVPL 4XXDB 5FYJU 1QAWA 3HG1E 1OGPA 4XOAA 4LPVA 1UM4H 4V11A 3QJUB 3KLHD 4XVUD 3NSDA 2V17H 3IF1B 1QRKA 3F7YA 2BP5M 2QHRH 1IKFL 3AVEA 1AGBA 4XMPH 4R97B 3IM1A 3RILA 3WTYA 2H9GA 3PHOA 1WF5A 2WSPA 3OSKA 3T0AA 2R7EA 2BP8A 1IILE 3IXAA 4XHQA 5IV2A 5KBKA 3MV7D 1YMMB 1ZHKB 3DO3A 1MY7A 4HKZA 3AITA 1QFWI 1NCWL 4HFWA 3S5ZA 4PJCE 1F4XL 2A73B 3EOBA 2OVQB 2HWZH 2AERT 5KVFE 1TG8A 4RWHA 5DUBA 5DRNB 4LP5A 1V3KA 3L4CA 1JPST 2EDLA 5HI5C 1ZSHA 4RESB 5AAPA 4DK6A 1JHKH 4NOFA 2WPGA 4HGWB 5JQIB 1IGMH 2ZOKB 2Y7LA 5I8OL 3SCMD 1U95B 3T3ME 2VR3A 3UVNA 2O5XL 2VN7A 3TNMB 3OXSA 1NQBA 2D4FA 4LGSB 3BZ4A 3K7UA 4PTTB 1KUMA 2JCCE 5EMLB 4CW1A 3VW3H 1OGTB 2OR7A 1NCJA 4IBUA 5AL0A 1CTNA 3SMRA 1ES0B 1MCQA 2IFFL 4EN3D 1ZHBA 2EC9U 2Q7AA 4OBSA 1RERA 1OTTC 4OM1L 5C07D 5L6YL 3B2MA 4N5EC 4QT8A 4GXVL 5C08B 1OAUL 4AYBA 1H3WM 1RZFL 1XSJA 3PWPE 4XCCL 2YQ3A 2BJML 4TUJB 4Y1TA 1FZKB 3AQXA 4M9OA 5T1JA 25C8H 2G9KA 1ZA3A 2IDQA 2ENYA 1PIGA 1NCWH 1CB4A 1FV1B 3G7TA 4AQAA 2WNXA 2ZUWA 5E9DB 3ARXA 2GTZA 3RN0D 3PL6A 3QORB 1S5IL 5F3BB 1BOGB 4OZ4B 4CVXB 3L45A 1D5BB 2FBRA 1WTLA 1K3ZA 3KXFE 4Z7VE 4CNIA 4HC1H 4JRLA 4A2HA 3BRGC 3VSUA 1Z9OA 3IS0X 5I8OH 1LD9A 2PTUA 4WO4D 3LZPA 1A0QH 4Y7MA 2E6QA 1VESA 4JFXB 4ZD3H 5EO1B 4X7SL 5TQ0H 3QI9A 1JGIA 3D3VD 2V7NB 4FXKC 3MVDK 1F6AA 4ZFQA 3IULA 4X5XA 1IBYA 4ABUA 5DJYA 2YARA 2VABB 1TQCB 1IGYB 5JQHC 4F92B 4JKPL 5FV2A 2XQBH 3VFPA 1PBYB 5TE7L 3GD1C 5I1GL 1JNNH 1NKOA 1YJDL 3CK0L 5KG9B 1INDL 1NCGA 4EXPX 4JFEA 3K6SA 2FWOB 3IPFA 3ZYIA 1QZNA 1ESOA 2GI0A 3S3BB 4Z7UF 4QHMB 3ARZA 5I8EA 4WWKC 1NAMH 3RWJB 3SDXF 4Y7OC 3L54A 1N68A 4ILDA 4TUKL 5EU4A 5IGOA 4AKPA 3H4HA 1SOSA 1BXVA 3I6GA 1L6ZA 4MJ6B 4NENA 5TK2A 4MB4A 1XX9C 4J2QA 3VFOA 1MFEH 1FUNA 4G8GA 5GGUA 1CS6A 4UM9A 3QJFA 5TQ0L 4I18A 4L4TE 3CVCA 4JHAL 1N5YL 6TAAA 1ADQL 3RSEC 5EO0A 4LKXB 1AJ7L 3RWIB 4X4YA 5EN3A 2VDLA 3QUZA 3N2JA 3K4ZA 4TRPL 2GC4C 4WHYH 5HGHB 5LXVA 2NNRA 2O5ZL 2IALA 2WM0A 3BQUC 2VDOA 4OD2B 3X1FA 2X4OA 1LM8V 3N9GH 1E5CA 4UV7H 3AAZB 3ZQ9A 2E6PA 2AITA 4R96B 5DZLA 2YD6A 4Q14A 3FQWA 1CICB 5FGCE 3ZQWA 2UY7A 4RMUA 1GKOA 5IVNA 4L05A 5DZ9A 3QUXB 1U91B 4X80L 1NGYA 4PS4H 3VXQB 1NFDE 3HNTL 2L7UA 3ME0A 3MVSA 4RSYA 4XWGL 3TX4A 2WBXA 3SKJH 3U4BH 2BSDA 2IPKA 2X4QA 2VDMB 2GABA 1JZJA 2Y7OA 1EMTH 4P2RA 1MRDH 3O4IA 4O2EA 1CDJA 2PPAA 1BD2A 1BLNB 4AEHH 2Y1AA 1U41A 4ONGH 2MSPA 3VXPA 2X6AA 1LMIA 5E6RB 1QTYT 3EHBC 3U2SA 3QI0A 4WSGA 5ADOH 4BWUA 3UMNA 1AACA 4PSRA 1M7UA 5FYLD 4ALAC 4WKZA 5HSFA 1HI6B 3INOA 1XH1A 5CP7B 3QDMD 2X9YA 5L88L 5E08H 1R5MA 1NCNA 4BZ1A 4PWFA 2WBJB 1Q9OA 4B95C 3L2MA 4XTRC 1JXKA 1O6SA 3ARYA 1RXLA 3P77A 4CN6A 1PLGH 3RDTB 1XEUA 5D4JA 1BZ9B 4JFDB 3DUHA 1KBPA 3VH8G 4FP8H 3EYOB 4R7DB 5C3TA 1XWVA 2LTQC 3EJYD 1Q0EA 1LTXA 2AQRA 3GMPB 2H6UA 3L7FB 4JPKL 5EOTB 3SKNB 3EJQA 1A3LH 4DNWA 4PG2C 5TK4A 4K8RH 3CJJA 4GRMB 5CGTA 5AOIA 1GIGL 4AEHL 1NEPA 2Z65C 4MQXC 1ZCRA 2XYCA 1QFWL 4N1CA 1Y1DA 2IDCA 3SDCD 4D9LL 5L8KB 5T33H 2BVQB 3PGCB 4HH8A 1OAZH 2QBWA 1UACH 2GUOB 4HK3J 5D4HA 2AGXA 3LN4B 2BSSB 2EDDA 3MJ6A 5B1JC 1CK0H 2AJZB 2DJ4A 3KYMB 2VDQA 1VAHA 1A14L 3QDHA 3TT1H 1LP9F 2AF2A 1KWKA 2P8PB 3I2NA 1UWXK 3ETTA 2E7DA 1N67A 3O8XB 4YHLH 5F7KC 3S5LA 1CIDA 2ENSA 4NOBA 3KWWA 2P3YA 4J4PD 4PRIB 3SSGA 4X5RA 3KWUA 3TO4D 3I75B 1MFBL 2GUYA 1J0IA 4NERA 1HDMB 3GGWB 3F01A 5KOVC 3NJNA 3P1VA 4DO6A 3HHSB 4XNYH 1TYEA 3DRTB 3R7QA 4CU7A 2XN1A 3CFDA 2X4UB 5E8DH 1GS8A 3CPUA 5IB3A 5KJ4A 4Z7OA 1GSKA 3FQRA 5TH2A 5DD5H 5I5RA 4LGPB 3FO2B 4MXVE 2UX7A 4RAHA 4Y1AD 4DWHA 1KGYE 2A9DA 3D9AH 2CJTA 4XVSL 5C0BB 4CKVX 2P5WE 4Z7WB 5GGVL 4G42A 5KVFH 4DEPC 4LGNA 2OJ1A 3WIFB 1CXLA 2N7BA 3K27A 2WSKA 4A1RA 1BF2A 4ANXA 4GSRA 4S1RH 4R84A 1I9RH 1SJEB 5CZKA 5GRUH 1MFDH 2AHIA 5FO9A 1E90A 1ZA6B 5F97E 3GBLA 3QXUA 3FCUB 5JHBA 1ZVSB 4MCZB 3EOTL 4TLUA 3HZ3A 4BCZA 4X7DC 3MRMA 4F20A 2VLKB 4K5PA 2XWJB 4P9HC 5FYKE 1PX8A 3C60A 4F1ZA 2HX7A 4AENB 1I4FA 4OJFH 4AH2A 4LVNB 2NY6B 1U3JA 1FN4B 2R27A 4ZTOH 4QRSA 1CUOA 3RQ3A 3PP3H 1MCWM 2SEBA 1DSFH 4KOBA 1GOGA 4ZMVA 4NQCE 4LEEA 1XB3A 4XN4A 5AOLA 5IC7A 1OSPL 2DLGA 3UO8B 5MEPA 5FYJH 1BXAA 4KROD 3IJ8A 2FECI 1BFVH 4DEUA 2HTKD 4ZX3A 3KXFB 2LAGB 3OQRA 1BQLH 3PAZA 5FHBH 1TMQA 4F5CA 3L8QA 4HU2A 3B8YA 4QOKD 4BDVA 2N56A 1EO8L 2GITA 2VDKA 4B0MM 3L95B 1T20A 3APMA 3U0PA 4I2XB 5DVOA 4WWID 3Q3GB 2FX7H 1JDDA 3DXKC 4ZMTA 2HRGA 5I19H 1F11A 2J8OA 1BMZA 2A6KB 4H0HB 1OAJA 1X5MA 4E41D 4TN9A 2AEPH 2CO1A 3BVWA 4WFGD 1S7VA 4MJ4A 1AHWB 1JDCA 2BNQE 2NCMA 3IJSB 1U42A 1IC4H 3CVIL 3E6HB 1SLXA 3P4OB 4JO2L 4KTEH 4M7ZB 4OZUA 1J0JA 3EHBD 2XZAH 3LVEA 2I9TA 4XB8A 1FFRA 3KL5A 1ZGLM 4BKSC 1Z5LA 1ZHLA 2CGRL 5D7JC 2HX9A 3IDYB 5D7JD 5F9AC 3DMMD 1CG9A 5JW3H 4QCIA 4HSQA 4C4BA 3C60D 2APVA 4N87A 4HPHA 5F7DB 1F6FB 3ML9A 3RWFA 2X4PA 2OL3B 4QGYA 2XA3A 5FDWB 1BQHG 1F2QA 4HIIB 1ADQA 4P3WA 2DKUA 3LS4H 5TE6H 3VI3F 4UYPA 1DQJB 4XMWA 3OHMB 4YIQB 5CWSB 1PD1A 3TFBA 1FNEB 2IQAB 5CZRA 3TONA 4PJ8C 4JO1H 1E4XH 3HI1B 2VXSH 3DSNB 2VDPA 4XWOD 1I1FA 2CRMA 4UQEA 3QIBA 1UXSB 3JAMg 3GRGA 3LQAC 5EV7A 3QPQD 2F7PA 3VRIB 4CSSA 5AKRA 3T04D 2A9CA 3O11B 5IIEA 3AXLA 3IYLW 3PPSA 4KPHH 2A5UA 4IGBB 3IUQA 3IJ0A 4L37A 2WTPA 5EARA 3K74B 3UTQA 5FLVA 2J6EA 3RWDA 4ICXA 2P9KC 4GMSH 1MH5B 2WQWA 4B9YA 2QLVB 2J4WL 4NN5B 5AB1A 2RIKA 5I30L 1UZGA 2FT8A 4W9HC 4XP6H 4HS6A 1RIHH 4IDJL 2DWDA 4AK1A 1E4XI 2FUTA 2OMWA 2VDNL 3BGMB 3GRWH 2JFCA 4QXTA 2X4NB 4KRLB 4UTAL 1DJGA 3O0RH 1A9EA 4NKIH 4HX1A 1NWOA 4N2NA 5IEHB 5KYNA 2D31A 3KPTA 1YQ2A 5AAWA 4HJ0D 3IJCA 5HI3D 1REIA 4L3CA 4PGCB 4JN1H 1YN7B 4F7PA 3WD5L 4AQ1C 2VE6B 5TDPB 3VGFA 4D2NA 1VACA 1XGUA 3N5AA 1TDQA 4WNQA 1ZT7B 3GLDA 5D2LA 2P5WB 4Z7WE 4JRXB 2VIRA 4NZDA 4WFGE 2WMPB 4JHWL 4N2IA 3WXWH 3KCIA 4E9XA 1YYLH 5C92A 2KYIA 2YAEA 4GI8A 4M1GH 2KT6A 4POZC 4HFUL 4JFFB 4PIBA 4S1QL 4R4FH 4ZOZA 1D5XB 3AXHA 2D7MA 2J5LB 3CN0A 2ZWZA 1N6VA 2FECL 4UZSA 1C12B 3F3PA 3BX7C 2BMKB 4O58L 5FOBB 1ZTXH 1J12A 4X42A 3OZLA 4FTVE 2WBJC 3UPCA 5CEZH 4N8VB 3VXUD 3VU1A 4X50A 3HBQA 1G4RA 3QFDB 3Q8AA 5JIDA 4NQCB 4JKWA 5ABZA 1KJMA 1CD1B 1OALA 1TQBB 5IHZB 1XH3A 1HINL 4BUQA 3OR7A 3RY6A 3ULSB 4WEMB 1QASA 2OMUB 4IOFD 4WVRA 1IAKA 2OTWB 3A21A 4Y9EA 2DS4A 3S6CA 4H2CA 2G5UA 1E4KC 5DJDA 3HE7D 2EIKB 2GTWA 2OJZH 1NH6A 1JHTA 2R0WL 5EBMA 1RK0A 5FM5M 4M7KH 3MACL 5EHFA 4MMZA 5IMOB 5CR8A 1NCIA 1FO0B 5DJ0A 2P24A 3OGOE 4GBXA 3BO8B 5DDHA 4NDMB 1AXTL 1WFIA 1AE6H 3MNMA 3H9SB 1OPGL 4A2DA 3N41B 4PPTA 4M1GL 4XPHL 4DVBB 3QPKA 3W9DA 1BZDA 4H0GA 5F1OB 3ECBB 4F33B 1MCOH 1JN6A 8PAZA 3HW7A 2Q2EB 4JDVA 4PB0L 4M3JA 4PCKA 1ZTXL 3MBEB 4Q6YA 2ZXQA 4IRJA 5D1XE 3TVMC 3TBWA 1L7IH 2MJWA 3QUMH 4N90E 1K3IA 4M8QA 5I0XA 4N6RB 3QYMA 3EG9B 4H1LB 3ZKMC 4M7LT 1MFCL 1NCAH 4NKQB 3BUYA 4LHJB 5GRVL 4LVOC 4XXDA 1J88A 3L9EA 2DL9A 2OMNA 2C1PB 4I48A 2XQYA 3G08B 4GEIA 2WZAA 2ZICA 4R90L 4G82A 2E7BA 5E99H 1C5CL 1YNTB 2H9GB 1TZIB 4O2CB 3HB3C 3AM8A 4HCFA 5T1KB 5AFU3 3EH4B 2BP0A 3G5YA 1P6WA 3VXRD 3WEBA 3CD4A 5L2KE 2C3VA 4D6VA 3EJUA 3ULUE 1ZRUA 1Z1WA 1U8HB 4J3OC 1LEIA 2AGWA 4AN1A 3EF4A 4IKNA 4JM2C 3HI5L 3UPRA 3DHUA 2XJKA 3NBNA 1D6VH 1IMHC 1P1ZA 2XVLA 4OAWB 3ZE1B 2V2TB 1UOLA 2N0MA 5K1VA 4E9RA 4J87A 4EVNB 4F27A 2EDRA 2FK9A 4MA7L 5IUSA 4LBAA 3QYNA 4A6YL 1UOQA 2DEXX 1IU1A 4AJ0A 1KYFA 4FQXC 4TTDC 1CYXA 3F65A 5KYUA 3IVMA 2OZ4H 2DLTA 4LCYB 2HKAA 5F7UA 1CLZH 4HUCA 4PRID 3TO4B 4DNUA 3WN5B 1KTJA 1M71A 4QRTA 3W0WD 1WWBX 3SDXA 1TZOA 2QQNH 4E2OA 4EOWH 1K8KC 3NDYE 1WFOA 4BUJC 4QMEA 4DGUA 3DIVA 5D9SA 1ACZA 1K5WA 3N85L 1E7UA 4LL9A 2XXCB 1MAJA 2MTAH 2P4AB 4FQLH 5DD0L 3K46A 2FX9H 1UOKA 3WAJA 4PM1A 1UD3A 4AMZA 2ORBH 3QO1A 1NCBH 1LO0H 1VPOH 3HAEA 4JVUA 2Z8WC 2IXQB 3J2PA 3NZUA 3UYPB 4AYMC 5ACZB 2BNRA 1MN4A 5KSAD 4TMPA 3ERXA 3RIAF 4C56A 4LPCA 3BN9D 4ZW5A 4NWTH 3X3FL 2GK2A 1IUZA 4G6FD 4MQ7B 4YO0A 4U1KB 5IFHL 4CNIB 2X7LA 4HUUB 3L48A 4KUCD 1KCRL 4TQIA 3BQVA 4OD1H 1X5XA 3F8UB 4MNQB 4AQEA 2WQVA 4L3ED 4NO0A 5ALCH 4MA7H 4Y9BA 2WLKA 4LLUA 4JT5C 4G9FD 1OOWA 2FATH 4JO8A 1XB8A 3A24A 4P5TD 2H45A 4PY7B 3S8WA 1RU9H 3ATFA 4I77H 5HVFB 5I1IL 4JPWL 2FB4H 2CHZA 3OAZH 1FE8L 4U6XA 3U1SH 5C0EB 2DWYA 4HG4K 3PWPA 2K6ZA 4M1CD 3NJGA 1BQHB 3IU3A 3QIWC 3S34H 1TZHA 3IKKA 3OAUH 1A6VH 3I7LA 1HZHL 3T4YA 5MEQB 4FQJL 1HAWA 4PGDA 3RY5A 1CIUA 3AU1A 3JTTB 3WUWB 1YJDH 5ANMA 4BE5A 1V7MH 2CIKA 2ZP0T 4Z9KB 3OJDA 5TJWK 2XNAA 5KG9A 5LGKA 3PSCB 1OF0A 1HCFX 1PAZA 1C8QA 3KYKL 4I9XA 2ZSWB 5AVRB 5HXMA 1Z9SA 3BOVA 3GINA 4D9RD 2V3EA 4U6HA 3TGXA 1E3XA 3NVNA 2FLBT 5H4ZA 1NAML 2BSTA 4MNGB 3GMLA 5E1AA 4N2BA 3RP1A 3IDYC 5B1AB 1BJ8A 4GAJH 4RQQB 1GYWA 3MCKA 3DMMA 1IGJA 4BK5C 3UEZA 2WWOA 4Y8AA 1J5OH 1LJMA 2Y5TB 2AEQH 4J1UA 2PN5A 4PBDA 1KFAL 2YN3A 3B2PA 3DVIA 4FDWA 4JHAH 2YRZA 1RU9L 2R9HC 4I77L 1UJ3B 4M3KB 3TBSB 3BHBA 5I1IH 3KZ8A 2UZXA 5T3XL 1OGAB 3POHA 5GS1B 3U7YH 5CZXD 4U1LA 1NSNH 3IMSA 3L5IA 3CV5A 4PV8A 5CINL 1T7YA 3M45A 5F8QC 4HAFA 3KW7A 4M93B 1HXYB 1AOZA 2QQLL 2I3SA 5ESAA 3NVXA 1RPQA 2FNBA 2B5NA 4G1MB 3DUSB 1S7RB 4HIPA 4YHNB 2DJSA 4PYGA 2AXFB 3KYKH 3IPEA 3CDZB 3WMSA 2HLFD 2WW8A 3MUGA 1JZ4A 5DZAA 4BK4A 2B3RA 5CIPH 5CU9A 3PNWB 2A0LD 3W56A 3RJQB 3JYCA 2PYEB 2R1WB 2X4QB 1GYVA 3P30H 4J3OG 3SYOA 2XXFA 5IB1A 4GG8B 1YJDC 3FN9A 3FU6A 4HJUA 2AH0A 3O2VH 2GAZA 4OZFB 4LNRB 1OF2B 2AVFA 6CGTA 4ONGL 5JW5A 1SHYB 2YKKA 1SN2A 5AW0B 3DV4B 5ADPH 5FUZH 4KJWC 3PWLB 4UT6H 3BPCB 1IIKA 2JI1A 2HKRA 3TV8A 3V5HB 2PXYA 1EXGA 3CZFA 5C2VB 3NZHL 4E0RA 1F45A 1I3GL 1ZLVH 5I16A 3ES6A 4YHOH 4K94C 1VGKB 5EUKA 4J39A 1T1ZB 4JGMA 4JY4A 4AUUA 4UTBA 3QC5X 4FQHB 1U58A 3DPBB 3NJLA 4OLWH 1FFOB 5EZLA 3VI4B 4X6FB 1XCTA 1W9XA 3MLVL 4NC4A 4GRLD 1DZBA 3RUGF 4QNPE 1FJ1A 2PUQT 1GZQA 4Z5RA 1EK3A 1PEZA 1IAIM 4DW2H 1G4MA 3HJ0A 4KK5C 1NBQA 3IU4L 2YUZA 4LASL 2DMBA 4KTYA 4ZFOB 4HPOH 1AD0B 1CFTB 1RL1A 2IDSA 4R3SA 3SPJA 1MFMA 4BH8B 3BAIA 1HVXA 1VZ3A 5AW1B 4XOCA 3BH8A 4A0AB 2ZXDA 5KSVB 2Z64C 3ROLB 3S8GB 2EIMB 1Q9KB 5CXBA 2EACA 2Z2OA 4OIIL 1U8MA 1NGPH 4D0DB 3SZ6A 1W8OA 5IESH 5GZOA 1E65A 1E8MA 2PW2B 4P4RB 4RX4D 4ORZC 2AV1B 1BF5A 3DSMA 1OE2A 4YZFF 5HHVH 2FL5A 3MRKB 4XNUL 1EJ8A 1N5YH 1UTDA 1JF6A 4MAYD 5BZWB 4LCUA 1V5JA 2VAAB 4BFBD 2DYPB 3TIEB 4ODUA 2C26A 2GFBB 3JT2A 2OKMA 4ONFH 5JHMA 4NS0A 1AZBA 4N9GB 4HPOL 5FHAH 4ICWA 3DHPA 2DY2A 2QVMA 1O7DC 4EIGB 1A6TB 4NUPA 1Z5YD 3O41A 3OX8B 5C0AB 3N42F 1AGFA 1AQDB 1RMFL 1PEVA 2XN9B 5J6HA 1WD8A 2H3NB 1T66D 3MTXA 4TSAL 3T8XA 1NGPL 1MHPL 3SGJC 4L1LA 5DJAB 3HG1A 3CWGA 5A2KH 1MLCB 3N3EA 3QUHA 2WKLA 1MW0A 1SPDA 4X6DF 4Z7WF 5J06A 1OGAE 4JJOA 5F9OH 4F7CA 4L29B 4XNMA 1MCCA 5EZIH 2XDHA 2X6VA 2DDQL 2HH0H 4TNWK 1LO5A 3MO1B 4EI5B 4KZEH 1IVLA 2J6EL 2O9KA 1OW0C 3QQ3A 3QDGD 1A25A 4NPYA 3T0BA 2B5IB 1BWMA 1E6OH 3BESR 3CN4A 5F96L 1U2HA 1OSPH 4MJJA 2OXGA 9CGTA 5DHYB 4P2CG 4FNTA 5HHMB 2NXYB 3TPUB 1J8HD 3JZGA 3RGVC 2EVJA 3UTSB 1EDHA 2NR6A 2ED7A 3PE7A 3H56A 2UY6B 3D07A 3NAAH 4UQCA 3OG6B 4BSVA 3V52L 3F12A 4PB9H 3SVWD 2CMRL 4PBVC 2F54A 3LIUA 2XSKA 1XGRB 3FTSA 3FCSB 5IVXA 3W38A 4U49A 2Z93A 4TTDD 4ODVH 4OCWL 5ISZE 1KTLA 3H8NA 3TZVB 1YEFH 3L5XL 3ZMEA 2WCPA 4FQ2H 1JZ2A 3W11D 1D5IL 4M48H 2WYIA 2WLIB 3KWTA 3VFSA 1GJUA 4WW2A 1TCRA 4DPBX 4WUUB 5EA0L 5JPMC 4ZOAA 3TNNA 4P3CH 3WAKA 4H2AA 2VTFA 4JCWA 3O6KL 4PWJA 4WJKA 1RIUH 1M2VB 2VDPH 4PMEA 4XMTA 1HHHB 5IW3A 5BO0D 3PQYD 3I3EA 3ULVH 1HHIB 4LGRB 2EYSA 1EHLH 2JK5B 4F5CE 3PL6C 4JQIA 5I6LA 1OARL 1XAUA 3SDAD 5F7EL 3IS1X 4JFUA 4DEPB 1HYRC 3WGVB 2IVFC 1DQLH 1ASPA 1D5MA 1PKQE 4HOXA 5GZOD 2OW7A 2VDKH 3CZEA 2AQPA 2N7SA 2EIZB 5C2BH 3TWYA 3KCWA 4KWUA 4AYDC 2B9BA 2Q3XA 3ZYJA 4WW1B 3M88A 4Y4KA 1I1FB 2VQ1B 5I28A 5TFSL 1KXQA 2QELA 1J8HA 3OR6A 3JUZA 3UTQB 2WK2A 3MA9L 3NCBB 2HWZL 2HVJA 1EXUA 2CKNA 1U4FA 3C6LB 1S5HA 1SEQH 2J4WH 3DX3A 1WA0X 2MPAL 5J9PB 1DANU 5I1HL 5I75C 3IVKB 5AZ2H 5CLXA 3EQ7A 2ZXGA 4M93C 4K5MA 1T5XB 1MCDA 4KQ4H 2YGQA 1D2OA 2YMOA 5IVZA 1RJLB 4YDNA 3NIDF 4WHCA 4V1DD 4MAYB 4TS6A 4YDVA 1QMUA 2OCJA 1ECZA 4F37F 3U30C 3VCLB 2P28B 2R56L 2PYEE 4QYOA 3QWRD 1F00I 1F42A 2R0KH 1RZJL 1ROWA 4AG4L 1QSFE 1OP3K 4YSUA 5IBLC 2XLLA 3MRGB 1G7MB 1JPTH 3M1OA 4MMXB 3CFCL 2LU7A 4UT7H 5D1QE 4XAWH 2QGDA 5D7IB 5EULV 4MJ2A 4U0QB 2F6AA 2RJMA 2YN5A 2AH1A 1N59A 1FFQA 2Y7SA 3MZKA 4U1IB 2ZX8A 4YR6A 1C1EL 1NA8A 1WDAA 4WNQB 3A0FA 4FG2A 4BCYA 2FEDC 4PR5B 4KFMB 1QA9B 3BP4A 3N41F 5AFAA 1G43A 1QKZL 5FGBC 3LRGA 5ANHA 3N40F 1CLYH 2H8PB 1RZKH 2WBWB 1NCCH 2EAEA 5T3ZE 4Y4FB 3OF6D 2CO6B 5ENWB 3O4LA 5D2LF 1QABA 2MPAH 3W9EB 2HRPH 4JFFA 1W0VB 4BH7A 3TV3L 2VLJD 1DVTA 4Y88A 4GKNA 3L5WA 4J77A 4ZUUA 3LOWA 3WNLA 4ZAKA 3KYOA 4WTWA 3Q2VA 3H0TA 1WGVA 5CEZL 4FA4D 3VMOA 1A0QL 1JNHB 3I2CH 3TBBA 4OCMC 2XV6B 3IKCB 5EU6B 4QRJA 3VFMA 3HZYA 2HG5A 2H6OA 3I9IA 4PLOB 4NRZB 3SQOL 4L3AA 1TVBB 1KB5B 4P5KA 3H9SE 4Z7VB 1CC3A 4XB3A 3DV6B 3RTQB 5LGYA 3QDJD 4GQ9L 5I8KH 1FVDB 1Y0LA 5I1CH 2J73A 1W72L 5DVNA 1AO7B 1JWUB 4CZVA 3HFQA 3ET9F 4MRCA 3LDBB 3FONB 1G1KA 1BD2E 5C0FB 4PVMA 3BW9A 5DJXA 1GC1C 2XQBL 1I7RA 3ZE2B 5IJKA 2GBVA 1U8OB 3OM3B 3RZCC 1ED3B 2WUBH 3L3JB 1DQQA 3FU9A 3PVUB 3K6NA 3IDJB 3NK4A 4PD4J 5F6IC 2YLKA 1TLKA 2XTSA 3QJFB 1MEXH 2MNJB 3LQMA 4Z0BH 3TBVA 1A2YA 2ZUSA 3QUXD 3ZBMA 1PGUA 4C83B 5I1JL 4ENZA 2IMNA 2VXVH 2X3AA 5HJ3A 5JIHA 1HJCA 1WZMA 2W9DL 3GHEL 2W95A 4FEIA 1AGEB 4J7RA 1C08A 4JK0D 1L7TL 1NDMA 4PJEE 3PXSD 3FU8A 4HBCL 3TA3B 3KCPB 2ZCZA 1FP5A 3FQXB 3RWHB 4GI6A 3NCWA 3UC0H 5HYFA 4Q6KA 4JG1L 4ZMWA 4HJJL 4MD5A 3MFGB 1KLUA 2XCMC 3ULUL 3QIBD 4HGMA 4IU2B 1EAOA 4RGNB 4KO9A 3MREA 3HN3A 1FVCB 4TULH 3KYNB 1GPOH 2Y2YA 3QR1A 2IANE 4P2OD 4KXZI