3K71A

Structure of integrin alphax beta2 ectodomain
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
1081
structure length
880
Chain Sequence
FNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAANQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPELEMAQEGFSAVFTPDGPVLGAVGSFTWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQSLVLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGAPHYYEQTRGGQVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVVIGAPGEEENRGAVYLFHGVLGPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRVLGLKAHCENFNLLLPSCVEDSVTPITLRLNFTLVGKPLLAFRNLRPMLAADAQRYFTASLPFEKNCGADHICQDNLGISFSFPGLKSLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRYVAEGQKQGQLRSLHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANVSSENNTPRTSKTTFQLELPVKYAVYTVVSSHEQFTKYLNFSESEEKESHVAMHRYQVNNLGQRDLPVSINFWVPVELNQEAVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVLDCSIAGCLRFRCDVPSFSVQEELDFTLKGNLSFGWVRQILQKKVSVVSVAEITFDTSVYSQLPGQEAFMRAQTTTVLEKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-X
publication title Structure of an integrin with an alphaI domain, complement receptor type 4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 119
structure length 880
sequence length 1081
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2009-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
A PF01839 FG-GAP FG-GAP repeat
A PF08441 Integrin_alpha2 Integrin alpha
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1460 Mainly Beta Sandwich Immunoglobulin-like Integrin domains. Chain A, domain 2 3k71A02
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3k71A03
2.60.40.1530 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 4 3k71A04
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3k71A01
4WK2A 1TYEB 2VDOA 2VDMA 2VDKA 3FCSB 3ZE2A 3NIFB 4MMYA 3K71B 2VDNA 4Z7OB 3ZE0B 5E6SA 5E6UB 2VDRB 4WK4A 4UM8B 3NIDA 4MMZA 4MMXA 5E6RB 3K72A 3K6SB 4IRZA 3V4PA 1JV2A 3ZE1A 4NEHB 5HDBA 4Z7QA 3VI3B 3T3MB 1M1XB 2VDMB 4G1EA 1U8CA 2VDPB 2VC2A 2VDQB 2VDLA 2P26A 4WK4B 4O02B 3ZDXB 3NIDB 3V4VA 3VI4A 3ZDZB 4UM9A 4MMZB 4Z7NA 3NIGA 3ZDYB 4MMXB 3IJEA 3FCUB 3K72B 4G1MA 4NENB 4WK0B 3T3PB 3ZE1B 3FCSA 4Z7QB 1L5GA 4WK2B 3K71A 2VDOB 4G1EB 4Z7OA 3ZE0A 2VDKB 3ZE2B 5E6UA 2VDNB 4MMYB 2VDRA 4WJKA 5E6SB 4UM8A 5FFGA 4JX0A 3VI4B 4UM9B 4Z7NB 3VI3A 3T3MA 1M1XA 5FFOA 1TYEA 1JV2B 3V4PB 5ES4B 2VDPA 5HDBB 1L5GB 2VDQA 3NIFA 1U8CB 2VC2B 4WJKB 4O02A 3ZDXA 4UM9D 3ZDZA 2VDLB 3ZDYA 3V4VB 3FCUA 5E6RA 3NIGB 4NENA 3IJEB 4WK0A 3T3PA 3K6SA 4G1MB
chains in the Genus database with same CATH superfamily
3II3A 1F56A 5IF0B 4WK2A 1TYEB 1PMYA 2VQUA 3BAXA 3HG3A 1U4EA 4PBWD 5EU4A 2XU9A 3O4OB 1I1FA 2CNYA 3FCTB 4XZ4A 5D5ME 3QYNA 1XR8B 1SOQA 4BK8A 5HE0B 5C0ND 5INDB 2AZAA 2BP3A 1DN2A 4G43B 3MJ8A 5K9OA 4KZDH 3GFUA 4KUCD 4OZHF 1TETH 3RL2A 1OSZA 4HCRH 3VW3L 4H0HB 3QI9C 3O0RL 3MRJA 3S3SA 4U1EI 1DDHA 1UWEH 4X6BB 2FZ3A 3CZJA 2G9KA 5I9QB 3QORC 4N6RA 2R9HD 2XQYG 1NH6A 3JWOL 4Z7WA 1BVNT 1HE7A 4PRIB 1DANU 2HLAB 4N9OB 2HVBA 3B7UX 3N5AA 3LIZL 5JORB 1Z66A 5DK0B 1XF5B 2P5WA 2E76C 2XACC 3QCVH 4TVUA 2HXCA 1IKNC 1Z5LB 4JY6A 2W81C 5F88B 4OH2A 3ATAA 1T2XA 5DJ0A 1OGAA 1JFQH 1JK9A 3CFQA 3ECVA 1S3KL 3FOMB 3CN0A 3NN8B 1HQ4A 1YLBB 2VSKB 3SE4A 1U8LA 3BI9X 4MRCA 1P4BL 3B7TA 3NAAL 1OM9A 2Y0SA 4YHLH 3SGDI 4P05A 4M03A 1TJMA 1PNCA 3QNXB 1NDGA 2FRGP 3G7TA 1DVTA 3WIHH 4ONGL 2GSGA 3M1CA 4GW5B 5EU5B 1N3NB 4K3DH 4L29B 3T2LA 2FH8A 2CKBH 3D7PA 1NAKH 3STZB 2ZWSA 3TP4A 3ME0B 1Q9KB 1OAXL 1VCAA 3DI3B 3FU7B 5D1XA 4J79A 2ESVE 5DJ6B 1HEJC 3QEHA 2ZJSL 2VXUL 5CP3A 3QWOA 4QRUA 4R7AB 2ENSA 5FLVA 3L3DA 3ZQ9A 2DS4A 4XPTL 3HZMA 2AQQA 5I2IB 3P3UA 1JPST 2QPDB 4M7ZB 4XT1C 1U8CB 5EEUA 1R0AL 2DL2A 1WRFA 1K6QL 5FO9A 4R90L 4L0ZA 3C9NB 4YHPA 4LL9A 1AR1D 1SDDB 4QF1B 5IB2A 5EPMA 1TMCB 4IRSA 1KXQE 3JVGA 4XP6H 3V10A 3DURA 2J25A 3G3LA 1ADQH 1SJVA 1MVUB 2ZOKA 3MGTA 5IESH 3BPCA 4OF0A 2YXFA 3QPQC 5F7DB 5JUEH 5EIVA 3CZUB 3KD4A 1CD0A 1HI6A 1TKWA 2F5BH 4M48L 5MP6L 2ZUQB 4X6FB 2EACA 1NDMB 2X9XA 4Y2DA 5K39A 5DUMH 3RWHB 3U4YA 3C6EA 4N2IA 3CPUA 3RTQC 2ZXWB 3D2UD 1RUAH 3ZGHA 2A6IA 3ZZSA 1NAML 2NY6B 2AEPH 1MZYA 3CK0L 3V55A 2VLLB 3MNMA 3QBTB 2R56H 5KJ4A 1QRNA 3PQYA 3VH8G 4Y1SA 4HIEB 4UT6A 2C9PA 3ZR6A 4GOSA 4NKMB 3AXLB 4ESGA 1NFDF 1VFUA 2ZF8A 4N2CA 3N2JA 5EZLA 3QDGA 5GS2H 4R96A 4OGYL 4TTDD 2ESVD 3RY5A 3H9HA 3O6FD 4XC1H 4KVCL 4LGPB 4EDXB 1URZA 1ZEAL 4OU3A 4TSAL 4Z7VE 3LXAA 1NCIA 3ZTCC 4ZZKA 5TFSH 2B16A 3VA6A 1RKRA 1OXYA 3H2WA 1OHQA 3JVFC 2PR4H 2B20A 2WP3O 2XNAA 3LD8B 3VXUE 3NBNA 2WWMC 2ZKXA 4K9JA 3ECQA 4I1RA 4MRBA 2J88H 3U0PB 4Q97A 2GYSA 1YEHH 1I31A 1J5OH 5IEHA 3DPDA 4IBVA 2BNRA 1I1YA 4AM0A 2AF2A 5IVXA 3A67L 3LRGA 1UGNA 3QG7L 2D3LA 1RZKC 4MCYA 4H13C 3NCJH 2AJXL 2FQGA 4N6QA 4NAMA 2Q10A 3VI4A 5D96C 3P3RA 2F9BT 1OSZB 3I3DA 5AWNL 3FPXA 4YSCA 1D5BA 2H41A 4WHDA 4Z7VF 5MERA 3CDGB 1USZA 1FG2B 1JNNH 2XWTA 3MRJB 3CFJA 3CXDH 3NRPA 4KXZI 1DDHB 4TRPH 4U0QB 3IUNA 4JG0H 1M2VB 2Y36L 4PS7A 1FE8H 4XBEH 3H9ZA 1SXZA 4YR6B 1OM3L 2ARJA 4ENZA 2VDOB 3AL8A 4Z7WB 3KRXB 1T2QL 1RZJL 1CN4A 2X09A 1SQJA 4F15B 1Q1JH 3G5ZB 2AMUA 3P3YA 3BUBA 3B1UA 1E4XI 5LBSA 1WZLA 2DQUH 1MFCH 3N42B 2VISA 5DJ0B 3RHWK 2I85A 5KVFH 2EVIA 2ZD0A 4MVBC 1JK9B 4Z9KB 2H6NA 2GKIA 1BZ7A 2FL5B 2CN3A 2WXJA 4JAMA 4GM3A 1KIPB 3QHFH 3QJRB 1U8LB 2PP9A 4AEEA 1OP9A 5CBAA 2WWKT 3DJ9A 5L88H 5C6TH 4NQDE 4P57B 3QK0A 4FE9A 3V4VH 3MLYH 5D6DC 3G6AA 3BKYL 3RGHA 2ICWJ 1ZV2A 3UG3A 3AG2B 1S78C 1JNLL 2ZWLT 3JV6A 5FUCC 3S5ZA 3VXUD 3FQUB 4EXPX 5CEZE 4IRJA 1G7JA 4YXLH 3BPLC 4S1RH 4Y16B 2E47A 5FHBL 4ZTPH 1QPKA 4MZ2A 5SV4A 3VD4A 3S8GB 2W9EH 4F7EA 4CAGA 1KACB 2XWEA 1PZCA 1P5UC 3MSPA 2QPFA 2YARA 4H25A 1QI5A 4XCFH 4GQ2P 4JPIB 4JFVA 4ODVH 4RE5A 4L5FH 1IC4L 1GVIA 3VFGH 4ODHH 1WP6A 4M8UA 2CO7B 1BAFL 3EYVA 4JKLA 4HUNB 4JM4H 2YUZA 3M8OH 5C0GB 2VJXA 4PRHB 4X5PA 3RUGB 2FT8A 4I5BA 2HWZL 3LQAL 4HETA 3W9EB 2HJLB 5IB2B 1FAIH 3UG5A 4LKCA 2AC0A 4PR5A 3GGWB 1J9TA 5AKVA 1PG7W 1WT5C 2HB0A 1IC5H 3OF6A 4NAQA 1WA2X 5IREA 3CZGA 4J8RB 3PF2A 4TSCL 2XN9B 4JY5H 2EH7H 3BWSA 2C3VB 1DQLH 4XMLH 5JR1L 4JDVB 3ZOAA 4ZTOL 2W8CA 2LU5A 5DR5H 4NQDD 2MTAA 1ZT4A 1LO5A 4ACPA 4FA1D 2HLFC 1B90A 4BZ1A 4MD5B 1YC8A 4RFOH 3H2PA 5ALBL 5CEZD 2BFVL 3WV0A 2DM2A 1NCUA 2Y69B 3PQYB 4ZSOE 4U31A 4LQFH 4FTVA 5E08H 4QGYA 4HX1B 1T89A 3QDGB 3Q9PA 4AV0A 2YXVA 5E56A 4ETQA 5E2WL 3H9HB 2V2XB 3QEQB 4P5TD 3FB7A 1XF2B 3LZFL 4ZD3L 2H7WA 4AYID 4D9RE 4F7MA 1YEKL 4JZJA 4PM1A 5LCVA 1HH6A 1P7QA 1PY9A 2EIDA 4FEMA 4WY7H 4XNYL 5DRZA 4B97A 4JGNA 1QOKA 3PFQA 4U1NA 2RTTA 2Q76B 3O8XD 2BNRB 1I1YB 5ADPH 3WXWH 4YAQB 4GUOA 1M71A 4FNQA 3CIKB 3V5DA 1BVOA 2VXTH 4NCDA 4GXVH 1EAPA 2DB8A 3KXFA 3VI4B 3TURA 2FEJA 4EJ1C 1D5BB 1RZPA 2JKJA 1NJ9B 1JZFA 4PBYA 3CFJB 3TEYA 1XB8A 2D3VA 4WEMB 3W5MA 5FFOA 3S4SA 1G9NL 2N1KA 4DGIL 2ARJB 1A3RH 1UT9A 1OT1A 4W9CC 1MN4A 2F58H 5KOVC 4KRLB 4MKTA 5TPWH 1LP9F 4GG8A 2A3TA 4YVNA 4J82A 1OAKL 1CXLA 1I85C 5DQ9A 3RKPA 3SE9L 4J8GA 2QL1A 4A6YA 2R0KH 4KUZL 4P2YA 3PL6C 3RGBA 3RVXC 2GCYB 2Z1PA 3KGRA 4PCSA 3H3BC 4OTXH 4P04A 3QJZA 4N0YL 3QR1A 3HE6D 4ZW5A 4KVNH 2FNBA 2XG5A 4F8QA 1BFVL 4D9RD 3WD5L 4NN7B 1EEYA 4GYBA 3NZSA 4F7PA 5GGTL 1SPDA 2D2CC 5A1AA 3AMKA 3R1GH 2R4RL 4JDEB 5JPNC 4PJ5A 7PAZA 4DVBA 1G1YA 2MIZA 3CE1A 2JXMA 3IGUA 2B1HH 3THMH 1EDYA 4BZ2L 1F86A 1KUMA 3UJJH 2J5WA 4PJIB 4AITA 2QHRH 4BIKA 4YO0B 4RDBA 3UX9B 1BYPA 4F7EB 1SY6L 4JFEA 4DKEH 5IVOA 1JHKH 3I74A 4PRNA 3K72A 4CADA 5HHME 2GJ6B 2ADFL 4H25B 1N12A 1YEJH 2GBVA 3ZL1A 3EW3B 4WU5B 3MJ6A 3SOBH 3ZHKA 1BBJA 2QZPA 4H40A 4DGVL 4MJ4A 4ZOVA 3TFKC 2B14A 3IDYB 5ICZA 2BSSA 1U33A 5KYUB 2NY3D 3ORVD 5HGAA 3RJOA 5HPOA 4I5BB 4OM0L 3EOYG 2NW2A 1P1ZA 3WE6A 1CFMA 3QW9A 3I75A 5CUSH 5BMFH 3ILEA 5HYSA 2AI0L 4NNYB 2VM9A 2FJFA 2NXYD 3DROA 4N2MA 4X4KA 5HHVL 3R06A 3VQ1C 2WSDA 3JSSA 2UXGA 3OQRA 2BNQE 3LH2H 3GIVA 4K5PA 4JCMA 1JPGA 1NFIB 2R1WA 2OK4A 3JWNH 4C4BA 5DU7A 4CA4A 3QUYD 3SKNA 4PWGA 4YHIA 1ZT4B 5IJKA 4QTHB 3OWRA 4RX4D 1LO5B 3BKJL 1NCGA 4X4YA 3OR7A 3WLWD 3LKOB 3EKCA 4HS8L 5LAXA 3ZTNL 3SCMA 3DPBB 1FNSH 1F4HA 2PPAA 1KJ2L 2CAKA 1JPFB 3BUTA 1XGZA 3L2MA 5BUGA 1R5WA 1KELL 2LAGB 1KC5H 4X8XA 4FKKA 4Y19A 4ETQB 4HHGA 4LT7A 3KM2A 2A9NH 5DHVB 3RU8H 4Y2NA 3O9WD 5MENA 3APMA 1HX0A 4U2YA 2APFA 1FGVL 4TMPA 4TSBL 2GUOA 5HHMD 4DTGH 5LXVA 4GSDL 4GKSA 4XX1G 2JKWA 4BFKA 1IZJA 1VFOA 3VYOA 4MLSA 3S36L 3CSYA 4PLKD 4JFSA 2X44D 3MLXL 4RMBA 3CVIL 2VDLL 4KNTA 5MEOB 4W9JC 3Q8BA 3U6RB 5F70A 3MBED 3ULVF 1Z2KA 1XZWA 5JZ7D 4LPWA 1QYGL 3B2DC 1EA9C 4PSRA 4WFHE 4J3VA 3DTXA 3FHEA 1ZGLB 1ETA1 3FO0L 2AQNA 2BNQD 4GRLA 1BMZA 1KGYE 1X3DA 2H3XC 3CHPA 4KDWA 2JJUA 3ZYZA 4A7VA 2ZKHL 4UZGA 4WI2A 4TS6A 1CICC 3D18A 2ZYIA 4G6JH 4U49A 2CALA 4XP1L 3S4SB 4B50A 3CUPB 5CEXA 4ZMXA 5GS0L 4FABH 3RNQB 5TQ0L 4JDTH 3SYQA 3ZDXE 1BX2A 3GHPA 3F7QA 1RQ5A 2IAAC 2NXZD 1MG2C 2NTSP 1K9TA 5DQ9B 1ZLSL 1BLIA 4A6YB 1JMXA 5KSUA 4B9PA 1CQYA 1FVEA 3L5WA 3JRPA 2DWTA 1Q9LA 2ZX7A 4LEEA 3CFKB 4MCZA 3TCTA 2GHZA 5KN5B 2BC4B 4G6AD 4L3EE 3SDDA 2V17L 1L0XA 3VFWA 4CL7A 2HFGL 1I7RB 3KPMA 4OFDA 4WTXA 1S8DA 2HUEA 3GNMH 4AQ1A 1DYZA 4P2RA 2HX8A 1OL0A 3O41A 4M8QA 1EEYB 1UA6L 4J12A 1U2YA 2K70A 2MPAH 2RACA 2Z7ZA 1U8QB 3MBWB 4M3KB 5H2BB 4A7GA 4GAFB 1G7QA 1J0KA 3QFJB 4ZQKB 3CZEA 3WN5A 1CLOH 5GGSB 1AO7B 2CJ3A 1XGQB 3ALXA 5HJ3A 1E6JH 3EYUL 3QQDA 4DP2X 3U9PH 3S35L 4MXVF 2BNUA 4MD0A 4WFHD 4P9HC 2XZAH 3K72B 3QZMA 2N56A 5IIEA 4X6CE 1NCBL 1ID5I 2IPTH 3GSWB 2XC8A 1YPZA 4WNQA 2N01B 1ETZB 2H6QA 5F9JB 3RFZB 4WO4C 3OG4B 3U2IA 2TRYA 3UIYA 3PAVA 4XODA 4YIQA 1OE3A 1KV7A 1UB6A 2CNZA 2OXGA 3DYPA 5L0QB 5DFWH 1JZ6A 2ATKB 4Y1AB 3KCWA 2X4UA 4I9XA 5HGAB 1LDPL 2MCPL 3WFEL 2NW2B 1P1ZB 4GJTB 3GIZH 2A4EA 3CN3A 3NIGE 1XZ0B 1AHKA 3VNZA 1DANT 3BZFA 3DUHA 1VZHA 4MNHA 4NWTH 1GGBH 1NMBL 3L8QA 2IPUG 3R06B 3Q3GA 7CGTA 5F6IB 3VXTB 3B9VA 4X6CF 4WEUD 1CDBA 4JFWA 1CU4H 2VM4A 1IGML 1J1OH 3UC0H 2IFFH 4JKWA 4L3ED 3OKYB 2YK1L 1DZBA 1X5AA 3PJSA 1DJXA 5I6PA 4L3GD 1KTKE 3FSVA 2F54B 1NBZB 3NJMA 2B9BA 3HI5H 1ROCA 1IAIL 4IKKA 3LS5L 4XPAH 3UTSE 2EO9A 4JUTA 5IQ7H 5AAPA 4AGQA 1A7BA 3C60C 3V4LA 3TJEH 1BIIA 4UM9D 5E7FA 4CZVA 4YL9A 5C2BH 2WZ5A 4MNQE 2IMMA 5SX5H 4L1HA 4Q9RL 4OLVL 4Y19B 3OHXA 1XHMA 3H8NA 2N0KA 1QPXA 3ALWA 2VLJA 4LOUC 4AUJA 1QFPA 3IMRA 1J0HA 4JJ5A 5C2VB 1UEYA 4ODTL 1FIEA 2H26A 1ZRUA 3G5VA 3CSYB 3VX0A 4YBLC 5EEZA 2JCCE 4YUEL 2DQIH 4DERA 2P5EB 3U1SH 4WJ5B 3TNMA 1B3IA 3WO4C 5BNXD 4XMXA 2VDPH 2GSMB 1YEIL 3A4DA 4N8VG 4H26A 1V54B 1G7PA 4JMXA 1VJSA 1BQRA 5E4EC 1OTUC 3ZE1E 4EUPA 5CFAA 3H4HA 3TYGH 2DQEL 3AW5A 3DHUA 5AAWA 3AM8C 2DAVA 4GRLB 5FO2A 3BO8B 3O2DH 4NQTA 4N28A 4UMGA 4NRXB 2FSEA 4JS7A 1XAKA 1T5KA 3ZZ1A 1YYML 4HZ1A 1ZVSA 4YWGL 4XHJC 5ID1B 3LDBC 1DBMH 5FYJH 4OFVA 1JTDB 1WTGT 2Z31C 4I18B 1C8QA 3UTSD 4CUCA 4B3EA 5F1SA 3FAWA 4KX9A 5IQNA 1S5IH 2B2XL 3EHBC 4OGAC 3US1A 3BP4A 2IAMD 1OD9A 3ZE1F 1YY8A 1OAZL 4MNQD 2DOCA 3DA0A 2LHAA 4HJGA 5L2JA 3N9GH 5CYKA 1XR9A 4K3JL 4NNPH 5F44A 3KR3H 2YUVA 1VE7A 1WBYB 4M1DL 4HUVB 2ITEA 3CHQA 3DXAA 3O41B 3SPHA 1ORQA 4IBWA 2Y22A 3QG6A 3DI2B 4G56B 2WYIA 3EMHA 1EAQA 3FRXA 3KJ6H 3VFPB 5AZUA 2FX8H 3BRFA 3BUPA 2QTVA 4AL8H 4N8CH 3B3IB 4BSVB 1SF5A 4A68A 2QADD 1YEGH 1NR0A 4MYPA 3GYRA 1LE9B 3DOHA 3MV9B 3QQDB 4Q0XH 3EDDA 2BNUB 2JJWA 1ND0A 2WTRB 3T8VA 5AQ0A 3V0EA 3GC3A 5BW7C 4KO6A 5DUPH 2JVUA 2FQFA 1E9PA 3KYKH 3MPCA 3O6MH 2YEVB 3MZKA 2XBZA 2CBOA 2XDHA 3LN9A 5IROA 2ZXEB 5C09E 4FQIH 3IXTA 3F7LA 2LV4A 4B7LA 4FNPA 1QLRA 2RA1A 3H3PH 4PJEA 1EEQA 4OLXL 1KCKA 4H0LC 2IUQA 2R2CA 2X2JA 1XSKA 3EI3B 3DDFA 3B6SA 5KJRL 3TIDA 1W0VA 2GC7A 2BK8A 1FUNA 3ZHFA 4LP5A 3NTCL 4XBGA 2ZKMX 4QGTA 2PPFA 1CGVA 3CQQA 2PM9A 2WB7A 4M6AA 3HG1E 2HH0H 1FVDB 5LG6A 5IHWA 4X42A 4KY1H 3QHZH 3DK2A 5I17A 3ARGD 2ADJB 5T1KA 4N5EC 4PLJD 1MRFL 2XKNA 2AJSH 4UTCA 5C0IA 1Z5YD 1PG7X 1TJHH 3W39B 3HUJE 5BV7L 4F7CB 5HI4C 3DTUB 1MHEA 2KH2B 1OV8A 1LILA 2CR3A 3IN0A 2FBJH 1HL5A 4XPFH 1QFHA 2X10A 2QGCA 5A3ID 3AITA 3UIZA 1QFUH 4JJ5B 4TZ4A 4N2OA 2FO4B 4PJ9C 4C54A 2H0PA 5C09D 3HJEA 1ZY9A 4B5EA 2X3BA 3O45B 1CCZA 1G1KA 1MCWM 4E5XG 1J5IA 3SDYH 5AVWB 2W18A 4YDKH 3PVUB 5CIPB 1FH5L 3U83A 4HKXB 1S7WA 4ZPVB 2PETA 4UOW0 3HUJF 4A0BB 1J7VR 5CGYC 2A1WH 2MRYA 2WXOA 3GO1L 4H26B 3ECUA 1XF4B 3GXPA 4ZFQA 5BO0D 3QJFB 4G6KH 4KK9C 5J56B 5EZIH 3VFTB 1KJ3H 1OAQH 1KTRL 2O26U 4TUOB 2QXVA 4Y9CA 3HG1D 4YHML 5I74C 1T5XA 3OKOB 4WWKB 2APBA 4ABUA 4BP9A 4O5LH 1WBXB 4W9HC 4W93A 2X3CA 2G3ZA 4QY8B 4JKKA 3ULUL 2VDNB 4GRMA 3PY9A 2JTYA 3NVQA 2AQ1A 1G0YR 3T0AA 1R3HA 4JRYE 3GSXB 4X99B 3HLAA 5I18H 3CFBA 4KMLB 4JKMA 1A7PH 4HJGB 4UU9A 1XR9B 2OMZB 5K9KB 3ZE0E 3NGBB 5JHAA 3OR6B 2CRZA 3VE0B 3DXAB 3O4LE 4XMTA 5HVGB 4E42A 3G04A 2WYZA 4UINL 4OJDH 4F2MA 2GI7A 3E0GA 1YYLL 5DF0A 1CTMA 2EKSA 2Y7MA 4M4PA 2OK6A 4E9SA 4B96A 2QGEA 2ZYRA 3MV7A 1WAPA 4IQHA 3IRPX 4BFBD 1ND0B 4OB5L 5EO0B 4NENA 1IJNA 5AALA 5FKSA 1KYAA 3ZE0F 4ALAC 1UKSA 1ROWA 2UZIL 1WFOA 3HPJA 4FTDA 1GY2A 3TVMC 4KJQC 5DMKB 4Z5RA 4JSXC 2PW2A 3CMOL 1GL4B 2Z92A 5E1AB 3VW3H 4MMYA 4PJEB 2MPVA 2Y25A 4LG8A 1CGTA 3O0RH 3B6SB 4KROD 2YAPA 1F6AA 1TTUA 3GMMA 1R9FA 4FG4A 4HIPA 3FDWA 3MLSL 3P0GB 4EKJA 3JWOH 4JRYD 2BVOA 2UWEE 4K2UH 3V6OC 5AMSA 2FK9A 3ARBA 3VFOB 3LIZH 3Q6GL 3X13B 4LLUA 4ZO9A 3EI2A 3LN5A 3HMXL 2YPLB 5I5JA 1QQDA 2R2BB 2VLKA 3U82B 3HPLB 3O4LD 1DVYA 2VMEA 1S3KH 2XXFA 3V0HA 1CDCA 3LQZB 3UTPE 3IJYB 5D2LA 1IBBA 2PPDA 1P4BH 5I1AA 1BLNA 2AKRB 4S1DD 1BVZA 2WWOA 2XV6B 4A39A 3NAAH 2A9AA 4EI5D 3ZDZB 2BH0A 1HVXA 5C07E 4AKOA 3ILPA 3DKHA 2PF6A 3NFPA 4GI6A 2EEFA 2XTSA 4D9LL 1T21A 2B7DT 4X7EC 3S3PA 3DO3A 4R8WL 3AS2A 3EQ8A 1UWXK 3T8XA 3ECBA 4BSWB 1T0PB 4NQSB 5TDHB 4Q6IC 5L8KB 3ULEC 5KVFE 1F8TL 1I4FA 4HWZB 3SHFA 3GSVA 5GS2D 4Z7OA 4GMTL 2FBOJ 2VXUH 3KPPB 5IB3B 3E8UL 2X38A 3EADA 4PD4K 3WENA 4BKLA 1ILSA 1E8ZA 5F8RC 4XPTH 1G5GA 2XXMB 3CZNA 1OHZA 3FB8B 5DUJA 4CILA 3BZ4A 5AVQB 3I9GL 3Q5OA 1R0AH 2YLHA 5CJ5A 1K6QH 1O6VA 4YHZL 4R90H 4HU2A 3FSZA 5EMKB 3UTQB 4N2KA 4PJAE 1MHCA 1T5XB 2GSIB 3GT6A 4EN3D 2XKUA 3MRPB 2CXKA 1T1YB 5KYWB 3FT4A 4ZFOA 5BXFA 2P9IC 3ARSA 1FL6A 3P54A 1N6QL 4M48H 5MP6H 3UTPD 2XYIA 1T6VN 4L5FE 1BQHB 1SJXA 3GTNA 2MQCA 1B0RB 2VITA 1R3HB 4Z76A 2NZ1A 4Z18A 4ZODA 1NAMH 5AB1A 2VUOA 3CK0H 5C07D 4PBVC 1T83A 2BRRL 1M2OA 3EG6A 3FB5A 4NUJB 5KBLA 4PJAF 4XNZB 1RZ7H 3DV4B 4G5ZL 4HGKC 2ZTBA 4OQ1A 1D7FA 1KGWA 3QC5X 1MCPL 4OCSL 5H1MA 1DJHA 2P80D 4QI3A 2X6MA 4E42B 4OGYH 2QC5A 3TA4D 3TBVA 4KVCH 3GZQA 4J3OG 2KS0A 4JRXE 3O3DA 1ZEAH 4NO0A 4TSAH 1JYWA 4FG0A 1MJJA 3MRBA 2EKSB 1SN5A 4N2FA 5BZWB 5FM8A 1J1XL 4MNGE 3DLQR 3MV7B 3X1NA 1QSEB 3FONA 2C9XA 4OZGE 5MEPB 4MMXA 3ARPA 3OBAA 1E5TA 1N64L 1YC7A 1NCOA 3VG0L 5EMLB 3TBTA 1LHZA 3A67H 4H5JA 5EO1A 2BIMA 3BAIA 1MWAA 1EV2E 2LLLA 2AJXH 5GGSY 1JV5B 5BRQA 3W5NA 1LDSA 4ATWA 4UIKL 3TO4B 2KI6A 4R4FL 4Y5XC 4KOCA 2QR0A 5AWNH 5EZOL 4OAWA 4UTBA 3BPNB 1ODUA 3BFOA 5DZOA 3U2SB 3FQRA 3IMVA 2Y36H 5FQDA 1F41A 3KNBB 4OZGF 5GSRA 1JRHI 1OM3H 3TT3L 1QWUA 4F33A 3F6LA 1T2QH 1RZJH 4DNWA 3QQ3A 3ARBB 5HI3D 4G1MA 1C1EL 1UM4L 3RGVB 3WELA 1YUHA 1SUJA 3LN5B 3AJ7A 3MOBL 1JWSB 2EEAA 5K19A 2V5RA 4G8EA 4PV8A 4DKTA 1QQDB 5EWIL 4ENED 4LSSL 3D2UA 5FX3A 5J11B 4OD3L 3RE0A 3TN0B 1U8PB 3L4XA 1ZIBA 2LTQB 4JRXD 2VGLM 4JM2F 1XL6A 4QAWA 4PIBA 4P4KA 4AK2A 3BKYH 1KXTB 3T1FA 3VWKD 2YQBA 1JNLH 3NFPB 3UJIL 2ESVA 3AH8B 2ITFA 3O6FA 1WTLA 4APXB 4AOFA 2ENJA 3AY4A 5FHBH 3MA9L 3T8XB 3UVLA 3ECBB 2W92A 1HWGB 5IQOA 3SLED 1F42A 2X5PA 4OLZL 2UX6A 4P46C 4M1CC 4J3OC 3K5SA 1JHLL 1S9XA 2CIKA 2N0MA 1TCRA 4TL4A 3TBBA 4BKLB 1J8HE 1IC4H 5DTFB 3TBWA 1KLGB 5JW3L 1BAFH 1HS6A 2NX5A 4WAFA 1BM3L 1PU0A 3OXSA 3WG7B 1IEAA 2FX9L 2R1XA 4WQOA 4K3EL 2HWZH 3WS3B 4AJVA 1NFDA 3LQAH 2I9TA 3O4IA 4IIQC 2WN3A 1A9EA 1E6OL 2DDQL 1NINA 2PPEA 3IAPA 1U3NA 4U7KA 5B38B 3WU1A 3HFFA 4UNTA 1U3JA 2HVKB 1YZZA 2VKXA 1IBZA 1BQ5A 1FL6B 1VFAA 1SLVA 4TSCH 1OSYA 1AGCB 5DURD 5JR1H 1UM6H 2MNJB 4LEBA 4ZTOH 3V9FA 4A7QA 2EICA 2WVVB 5F8QC 4TQ8A 3EO9L 4ABQA 1XIWC 3HI1A 3S8FB 3AREC 4PGCA 1H8SA 3SJVA 3WY1A 1WVZA 2Q0ZX 5ALBH 2BFVH 2XFGB 4PN6A 4OZHB 2Y5QA 4KZCA 3MYJA 5K93A 3VGFA 1GC1C 3G5XB 3N04A 4V1DE 3ESVF 1NBCA 4H1LA 4F1ZA 3LRHA 2NY6C 4W9DC 3QXAA 4DOHE 3K1KC 3MRDA 4KMTL 4JE4B 5E2WH 4X6DF 2HYMA 3P02A 3LZFH 3MV8E 2JLPA 3O3DB 4GMSL 4PW9A 3REWB 4DKFL 4ZD3H 3JWNE 3QWNA 1R46A 1QPPA 1EXGA 1MLCA 3QQ9D 4A2HA 1YEKH 5ISZA 4NO2B 5D5MB 8CGTA 3Q9QA 4N90E 1J8HD 4TNFA 3T65B 4LFHG 3RZCC 4FOMA 3FONB 3ZIMA 1XSJA 4LDCA 1T4KB 2H3NA 4XNYH 5DJ8B 5E9AA 5L4IA 4MMXB 1H8OA 4K07A 1MNNA 4UUJB 4HF5H 2AS5M 2NYYC 4RZCA 1DO6A 3HR5B 2PMZA 5EO1B 1KSRA 1MWAB 3LD8C 1I82A 4U6XB 1K2DB 2H32H 3TA3D 5D2NE 4JVUA 4X5WB 3A6OA 4ZPTB 1BA9A 3HZVA 3WFZA 3KVPA 2E6JA 5I1EL 2GK0B 3K81A 4O51B 1XIPA 2DPKA 3EGDB 4IIZA 5EBLA 1AR1B 1G9NH 1UFGA 4S0TD 4DGIH 4IGBD 2CGYA 3MLRH 1CF8L 2HRLA 3VI3E 5EUOE 1NGZA 3QQ3B 3U4EA 4GUQA 3BSZA 2H9GB 1VERA 4HS3A 1KFGA 1OAKH 1UUSA 3P4OB 3C8HA 3SDAD 3BRGC 1V05A 3SE9H 4JEGB 4PV8B 2O1AA 1FNGA 4V1DD 4KUZH 3FTXA 3I3EA 4AK1A 4PC0A 4MJHA 4NQDA 4A2EA 1FLTX 2FB4L 5E8EB 1AYRA 2W9LA 3KM1A 3RL1B 4N0YH 4AQEA 4EBQL 1E5AA 3ZDYE 5L2KD 3MV8D 2XSKA 4OSUL 3WD5H 1RK1A 3HFQA 5GGTH 4NQVA 3VI3F 2CHZA 2XHNA 4N90D 4PS8A 4D0BB 5KDOB 1A4KA 2VH5L 2R4RH 3S96A 3SE4C 5EU7E 3IS0X 4ZUUB 1S9YB 5LAPA 4HZAA 2ESVB 1CFNB 3BH9A 3FBKA 4AYEC 1A1MA 1BZ9A 3AQYA 5CAYB 2OA9A 4PGZA 2EXWD 4BZ2H 3F7RA 3JAMg 2IF7A 2IEPA 4LF3A 1IC7L 4R5XA 4BELD 2AQRA 4CVZB 4U1SA 1SY6H 3D87B 2R51A 2BVQB 3ZDYF 4ICXA 3NIDE 4Y16C 2ADFH 4YDVA 1ZKAA 3RKDD 4UAHA 3R0NA 2J56A 1EVUA 3TLRA 1QLFB 1NCAL 1Z9PA 3IMSA 4N8UA 5D1XC 5SWZE 4F24A 3IBEA 5J06A 4HJEA 4DGVH 4UV4L 1PLGL 1CTNA 3QUKB 4WW2B 2WMPB 3BOVA 4PG9B 4BH7A 4PJDE 3L1EA 5AOKA 1EMTL 1ACXA 1HN1A 1G5AA 3CFCL 3FF8A 3VXQB 4OM0H 2DD8L 5CN2A 1T5WB 2IG2L 1Q9OB 4JFOB 3V4PA 1KCRL 3VFNA 3TV3L 1TZIB 2DMHA 4QCIA 2AI0H 3MKSB 1OEZW 5HHVH 4L9LB 1TQWA 3NIDF 2V3EA 1QFWM 2ZPKH 4D9QE 2YN3A 2JB5L 3IK2A 4UQ2A 1Y18A 2NOYA 2CO6A 4IRSC 3JVGC 2BCJB 4XNAA 6PAZA 4LLMA 5EB9A 3VXPA 4FA7B 2JJVA 4WUKL 2Q87A 5E4OA 4J87A 4PJDF 3BKJH 5HDBF 1XVSA 4DPBX 3GMPB 4KK6D 4MAYD 2H3KA 1MFVA 2WUCL 4Y2DC 3JZGA 4P4RA 4HS8H 5D7LE 3ATBA 3ZTNH 1PAZA 3KS0J 4Y89A 2JIXA 3WJLA 1AGFB 2TSBA 3OAZH 1KJ2H 4FGMA 4RETB 2E7BA 3GMLA 4Z7VB 5EBGA 1KELH 2IURA 3NJIA 4I87A 1JWUA 2MNUA 5LNGA 2ATPA 3ARFA 3VXUB 5B39A 1FGVH 4OM1L 4TSBH 1PPIA 4GSDH 4O2EA 5DRNA 4DCQA 3HA0A 4KHTL 1E5BA 2N1TE 2Q9OA 5SWZD 1LP9A 3S36H 2ATAA 5I1LA 2AV1A 3QR2A 5MI0B 3MLXH 1K4DA 3CVIH 2VDLH 5DO2C 2PM6B 4XCEA 3PWJB 2P28B 1F0LA 4Z3TA 3QUZA 3LH9A 4KDTA 5EOQL 4EI6A 1QYGH 3DRTB 4EDWL 5I24A 4KVPA 2IC2A 1HAUA 3ROOA 4UF7C 3FO0H 5HTSA 4D9QD 2X7LA 3HZVB 3CZKA 1TYJA 3SZKC 1BZEA 4G42B 2ZKHH 4WCYL 4K7PX 1I3UA 3QYCA 4XP1H 5EBLB 2EP6A 1O6SA 5GS0H 3DM0A 3R7RA 5JW4Q 2HN7A 1RJZA 5TQ0H 2Q3AA 1A1OB 3U4EB 1J9SA 1AGDA 2BJML 1EERB 2VR5A 5D7LD 3RURA 2BLFA 3ZJAA 5E5MB 1ZLSH 3O3UN 1OP5H 1TO4A 4L1QD 3EBIA 1FNGB 3PWVB 2GW5A 1DJYA 2EZ0D 1PJWA 4NQDB 3AG3B 3X17A 2V17H 2WTPA 2VDRB 2HFGH 3P2BA 15C8H 3LEVL 1IQDA 2PBIB 5T5FL 5TF2A 2Y2TA 4JL2A 1HSAB 1CDJA 3T3PF 4LESA 5BS0E 3JZNA 3L95B 1UA6H 5FYJE 3UZEC 2QTEA 1WQVT 3BP7A 3C5JA 1KCSL 3B9KD 3QIWA 4MGXA 3S96B 1H2YA 1KYOJ 1CDGA 1CT8A 3A47A 3MJ7B 2OZ4A 4NRYA 4Q6YA 4P5TB 1E8YA 4HJUA 4NN7C 3O9WA 2VDNL 2LOEA 3EYUH 1OQXA 4EZLA 1A2YA 4U6VL 2CE9A 3S35H 1Q0XL 1V3KA 4DUVA 1Z32X 4IRJC 5CKGA 4B9ZA 1AXTL 3K74B 2WLJA 4YDVB 4M7JL 3WEAA 1NCBH 1TFPA 4MB5A 3O8XB 1EO5A 2FX7H 4P9HL 2BZ7A 4P3CL 1OF2B 2XIBA 2DIEA 5F1OB 1AY1L 3QS2A 2RMNA 2HVJB 2VLME 4YBHA 4G71B 2MCPH 5KYXA 3N0EA 4I79A 1KXHA 3A6BL 3WFEH 4YXKH 4CVXA 1LK3L 1GS8A 2WOBA 5ETUB 3NA4A 4QCIB 4Q9CA 1NMBH 4FZ8H 1BZDA 3FQ4A 4OCLC 5IW3A 3U4BL 3IWUA 4RIRA 2V8LA 1T7VA 5DJDB 2HT2D 1IGMH 2G75B 1Y18B 2CO6B 2YK1H 1EPFA 3BMWA 2WW8A 1N2RA 4NFDA 4FQCL 1IAIH 5BS0D 3LS5H 3BP6A 4ZSOB 43CAB 1UWFA 5FYJD 3RX7A 1P69B 2L3BA 4XMZA 4P4RB 4MZ3A 4CMHB 5AB2A 1TLKA 2EINB 4HH8A 2WVSA 5IZ7A 1J8SA 3HE6B 1G7IA 5K33A 3L7FA 4Q9RH 4QJ5B 3TJHD 2CDEA 4OLVH 2VC2B 1KGUA 4QT8A 4FQLL 3UEZA 4HUUB 4AIEA 3O11A 2WVUA 4OUOA 4Z3EA 1J0ZA 4XGZA 1ZJBA 4ODTH 2WBKA 4AEFA 2FD6H 3GSQA 5DRNB 3EJZC 4KV5E 1T89C 4YDIL 1SJHA 2GABA 2W60A 5LGJB 3MGAA 4L37B 3HE7A 2AV1B 1HJBC 4YUEH 1BGXL 1MFUA 4PEEA 1SJMA 2VLMD 3OAWA 4UAOC 4JZJC 5HHXL 3LHAA 1NPNA 2WQWA 3FYIB 5ESVB 1YEIH 4XX5A 1JZ4A 2XWCA 5AAMA 4PY8J 2XX0A 4JREB 5DHMC 4ADJA 2IDTA 1EZUA 2IGFL 1A7RL 2DQEH 5MEQA 2OYMA 5DJZA 5JDSA 1Z3RA 4MJIE 2P49B 4KV5F 2NY3B 3BGMB 5HYSG 1E4WL 2C7UB 4O45A 4N2HA 2WCSA 1YYMH 4YWGH 2I5YL 2ISDA 1PEVA 4RGNC 3VU1A 3P4FA 3AFCA 3PDDA 2NXYB 4KKBC 2BXYA 2D7TL 5HVWA 4MQSB 3MODL 5B4MC 2J6WA 5H14A 1W72L 2DI7A 2B2XH 4FHJA 1IGFL 4CVUA 3MRKA 5HHQA 2V7NB 1QSFE 1MREL 3RWCA 3QUYB 1OAZH 1MCLA 4A2DA 2NR6A 1KY6A 5AKRA 4F7KA 4YDNA 2V37A 1IQDB 4K3JH 2RAMA 1L9TA 1PKQE 2EDNA 4M1DH 4ZOEA 1IE4A 4K8RC 4UM9A 4U7SA 1F2XK 2ZOOA 1PF3A 4RAUA 4N2AA 4PP1C 1Z7JA 5ICYA 5JW5B 1CT8B 4YPGB 1YN7B 2FATL 1QW8A 1W8NA 2I3SA 4GSQA 3NT0A 4BQ6A 1A1NA 3O9WB 2DLIA 4U3SB 3TC9A 3S37X 4ATTA 4UQAA 5ICUA 4X6CA 1A2YB 4JRWA 2DWDA 3EBGA 4KRMB 3ZKQD 5GGRB 4NO3B 3VD3A 2IDCA 1ZTXL 2X4NA 1Q38A 1A3LL 2UY7B 3M17A 4CKQA 3PXTD 2AMGA 2AXFB 4MJID 5H37H 5I8KL 1BZ8A 2BVPB 3BIKA 4ZS6C 5H4ZA 3MBEB 4JZOB 4A08A 4C4UA 4KO9A 3QFGA 4OLXH 1N70A 4GQBB 2BY2A 4PJHE 1U8NB 3HS9A 4YFDB 1MCFA 3WO3B 4A09A 3VNYA 3RVWD 2D4DA 4JG5A 4X9BA 5F21B 3UZQB 5KJRH 5GRUL 2BNQB 2AVFA 3AQZA 5E0QA 1A6AA 4M9PA 3RFZC 2HG5A 2DLEA 3EJUA 3NTCH 5DK3A 4CMMB 5C0EA 2NY0D 1VSCA 5L0QC 3T1WA 2CGZA 1MXDA 4U6HB 5TE7L 1QSFD 2N7SA 3T2NL 4NFBA 5GSAA 1N59B 5CCGE 2DWXA 3N91A 1OGTB 2XWJA 1WAAE 3W2DL 3UTSA 1MRCL 1BVNP 5DO8A 4UQ3B 2NXZB 2Y6SC 2ZCLL 5J6GA 4CGUB 2XDWA 2IFGA 2DYRB 3HZ3A 3BP6B 4ZXBD 4PJHF 3C09B 4PRBB 4RA3A 3GI9H 3D3VE 1HZKA 3FZUD 1MRFH 2ALWA 1I1AD 3ARYA 3FOLA 1HHJB 3DJSA 4I0PD 4RBPH 3U9UA 5D1ZD 1YR2A 2CM5A 1QKZL 2W65B 4LDEB 5IJKC 5IJBC 5IC7A 5BV7H 4MX7B 5DGQA 1KPUB 2XJLA 3IXAB 1YSOA 2HXAA 4L4VE 1U8JA 1WAAF 4QDGA 4AMXA 1HK6A 1XAUA 3SCMC 5E6UB 4HJ0D 1U4CA 2BOCA 3EYQD 1GCYA 2GY7B 3O11B 2YC1B 3KPTA 4OY9A 4ZMVA 4JFDE 1MCDA 4MQXD 2PTUA 1FZJA 8FABA 1MCOH 1FZKA 4WFGE 1F6LL 1VAHA 2CUIA 3SE3A 3EBAA 1XDTT 3UKRC 1FH5H 1M56B 2ZONA 5K9QG 3ZE1A 4U1HA 4XMWA 4AYSA 1E4KA 1AKPA 3GO1H 3RB5A 1LO2L 3KWUA 4A38A 2VMJA 5L4MA 1RY7B 2Q86A 1QTYT 4E36A 1NANH 1A3ZA 3QIUD 4GINA 1A12A 2FECL 3JROA 5IB1B 4AYMC 2R15A 4PHXA 4KKLD 3JUYA 1PZ5A 3ZDXB 1ZANL 3GXFA 4GXFA 4YHMH 3TFBA 4ES9A 5IBLD 4K9EC 1H3VA 3TBYB 5DRXA 2G0KA 2HMID 3IJCA 1M1SA 3ULUH 4GRLC 2E7MA 1YUKB 3D3VD 5F9WB 1KBKA 1CI3M 1ZE3H 1ZHKB 5AJAA 4PVLA 1T0NB 2H8PA 4DZ8B 4M7LL 4L3EB 3LIUA 4MS8C 1GGIL 2I7SA 4NBYB 3BVVA 3ILQC 2XWBA 5DC2A 4G9FA 3RWIA 1WHPA 1X5MA 5JXAL 2ADIB 4L4VD 5ADOL 4YNYA 3ZYOA 2P3YA 2WBJD 2V7HB 1IFRA 2EIKB 1F5WA 1IBFA 2XUWA 2YQ3A 4BGDA 5EM2B 4OFQA 2IADA 1Z9SB 2A9CA 4JFDD 1WF5A 4UM9B 2Y3NA 3P0VL 1F4WL 4UINH 1MCHA 5JNYA 2YPKA 4WZ9A 1XKSA 4WFGD 3FN0L 1FA4A 2X6BA 1YYLH 3RWGB 2L04A 3V95A 4AQ1C 1DQML 4F8OA 3GLDA 3FBQA 4JFFE 4DETA 3MGOA 4ONHA 4X9FA 2FWLB 4HMDA 3T0EE 4X6CB 1LMIA 2BP8B 2DWDB 2FGZA 4G6FD 3LKSB 5TDOA 5E5UB 1KCUL 3WN5C 3MOAH 4OB5H 2YGNA 4TNVK 1JD9A 2A4ZA 3L3GA 5EN2B 4JUSA 3KLAB 5AW3B 1UA3A 5B3JE 3C87A 3KBEA 1AP2A 3CMOH 4PGBA 5I16B 1IGCL 5FC9A 5L7XL 4AN0A 2ITCB 2OR7A 4EUPG 3NIGB 4FQQB 4MAZA 4PSPA 1RZGA 1MUJA 2A38A 3FU3A 5F3BA 1HHIA 3EOBA 4LL1A 4HKZB 2VAAB 4QR7A 3S6CA 3N1QC 4ZUWA 3QO1A 4L3CA 1A6AB 3MLSH 4C59B 4OFKA 5C0EB 3HG1A 1ZPUA 1L3WA 2EILB 5IHBA 1KIRA 4HCRA 1IV8A 3GRGA 5F1IA 4PWFA 2J21A 3Q6GH 3WFHA 3T4AB 2XWJB 5B3JF 4N4YB 3UTSB 3N1PC 3HMXH 1NGXB 2TAAA 3E6HA 1UD6A 4YSSA 3I02B 4ZMZA 2F0CA 3VX1A 3D4GA 2WLNA 2IAMB 4NNXB 4NKDB 5FXCH 3HUJA 5JW4M 4PJ7E 1J5HA 4MNQB 4NCC1 2OX5B 5BVJA 3ERXA 3MV11 3KWWB 2XXCB 4JFFD 1NEZA 4FAVD 1YN6B 3T0ED 4JGUA 1SYVA 1EGJL 4D9LH 2OXHB 1JP5A 4R8WH 3JT2A 2JCCB 2JNZA 4LSQL 3BESR 1F8TH 3ZKMC 1MF2L 2ENQA 5C6PB 2QADB 1AGEA 3VD0A 3OHXC 4H8PA 4GMTH 1BFSA 3BT2L 1X7QA 5KSAD 3E8UH 1M3JA 4FD0A 2AQPA 1TZHA 1W0WA 1JYVA 2QV4A 3ZE1B 2CKBA 2GC4A 4U6YB 5D7SH 5HJDA 4AMZA 4FA5D 1P6FA 1AE6L 4BINA 3I9GH 4OLYL 4NC0B 2MEJB 1TFHA 3DVFA 3VVVA 1G7LA 3RMZD 2Q86B 1TF4A 5ABAA 2CLVB 3C08L 3SDXE 3V6FB 2XFXA 3T6ZA 4PB9L 4LVNC 4YHZH 3ZMNA 5A2BA 3CHXA 2WD0A 5FM5M 1SQ2N 3GKWL 1PZ5B 1GZPA 1URIA 1UENA 1IC0A 4PCYA 4HHAA 5DA0B 5DRXB 4LPTA 5TJWK 4A7SA 4FFVD 1WA0X 4AQ8A 2HESX 4JRYA 1N6QH 5AAWC 3Q8AA 4RQQB 5F1KC 4BCZA 1SEBA 3TWCL 1MH5B 2VYRE 3L13A 5SX5K 3PWLA 4KPHL 5I23A 1SOXA 5DJAB 2EJ1A 4GP5B 3DOIA 1FNAA 3OKNA 4Q2ZB 4R97B 5CJXA 1DZ0A 5BUPA 2G0LA 3UPAA 2YMUA 2QKIA 4XOBA 5DWUL 2XWBB 3SDXF 4Z3GA 4JMNA 1WFNA 2WQXA 4NAJA 2VLRE 4FI6A 3WIFB 1TZAA 2BRRH 3KVQA 3ARGB 5ACZA 4G5ZH 1CXEA 1FP5A 2Y72A 1DLFH 4OZ4A 4ZYKA 1MCPH 3T3MF 4LB8A 3CLFL 4H44C 2NLJB 3U46A 5JNYB 5FA4A 3L4WA 3EF7A 2AXWA 1YY9C 4MHHI 5E1GA 1J1XH 2HG0A 3MGOB 4AMKL 3RY6C 1C08A 5C09B 2GBTA 5IQ9B 5F3HA 1N64H 5DS8A 3FUNA 4NO5B 2WKOF 5AL8A 3VG0H 2W94A 5IMMA 4GM8A 2OR9L 4I1PA 1I3GH 4GW1B 5KBKA 2TRHA 1AKJA 3OXRB 2HKAA 2UY6B 4UIKH 4I2XE 4R4FH 1NIFA 3CFDA 5EZOH 2GI0A 1HHIB 4L8CB 5JHDE 3K4AA 5IROC 2DWYA 1I9IL 1OSEA 2W0LA 3GXIA 4RESB 4WGVB 3T71A 3F3FA 1S7QA 5DHVH 4CJ0A 1ACCA 1C9IA 2XETA 3UR4A 4L3CB 3U1QA 1ICTA 1G7MB 2OMWB 3QUXA 3DUUA 3TT3H 5EEVA 1ASQA 2VDQB 2VZ1A 3D05A 4TLUA 4EN3A 3GBEA 1C1EH 3P0YL 1UM4H 5F1IB 2VLRD 2ZKYA 2GC7C 3BAKA 3MOBH 2YD8A 2L4OA 5SWQA 3WTUA 4PU2A 5D1ZI 4GM9A 3N1MC 5EWIH 4LSSH 4CN4A 1PCXA 2KERA 4OD3H 1NIBA 2Q2EB 4J23A 4U4BA 3HZYA 3OLGA 5C07A 5IJ7E 1PQZB 5D8JL 1YAZA 3GXNA 1NBYB 1EDHA 2DTML 3P4NA 5PAZA 3UYRL 4OIIL 3ZPDA 4Y5RD 2O6FA 3GSNA 1OD7A 1UKQA 1I9JL 3ILDA 3UJIH 1G1OA 3VM7A 2BERA 3P9MA 3MA9H 4BK4A 5A6MA 3T04D 2NZIA 4Y2LA 3HZKB 1FYTA 1N4XL 2FO1A 4BUHA 4GUPB 4X0KA 4OLZH 3SYAA 1LEGA 1NEXB 1JHLH 4PG2A 4FNLL 4AIZA 3TF7C 1D7DA 1N5AB 2W38A 5JHDD 1WJ3A 5BRPA 1BIHA 3EJRA 5E6IA 4L3AA 2CKBB 1HEZB 3FFCE 5I1DB 1K3ZA 5JW3H 2PNDA 3CMGA 4O4YL 5HHOE 4E9VA 2R29L 5CEZL 4NSKA 1G7LB 3Q2LA 4PJAA 1IU1A 3Q8CA 2OL3L 1NL0L 1BM3H 2FX9H 3ESOA 3PIQA 4K3EH 3WKNA 2YNOA 2VJ0A 2AGYA 3KPQB 4J2XA 1E6OH 2DDQH 2FYYB 2R69L 3TH2T 4KROB 5FYLH 3CC1A 3OB0H 3TH3T 3V5HB 1VHPA 4AXWA 2GJZB 4JRYB 3X14A 5IFJA 1KLUA 4DAGH 4JANA 2IPKA 1SEBB 3UTZA 1AGBA 3HTLX 3FU8A 1YQ2A 1GOFA 3L5XL 1B4LA 3EDJA 3EO9H 4Y4KA 3TT1L 4QRPE 1U92B 3REVA 2QSQA 4N2LA 5D7IE 4YDLB 3ZE0B 5SXMA 2PYFB 5DQJB 3O4LB 1CZ8L 1EWHA 1H3UA 2DEWX 2NRDA 3BD5A 4FLHA 1WZKA 1YEDA 4GO9A 5ACZB 5F0LB 5IMKB 5M5SA 3F3HA 4JRXA 4HG4K 2P48B 4OZ4B 2H2PD 3LV3B 4HZLA 4MMZA 4ZYKB 2HJFB 4EI5B 2JCWA 3ARZA 4XVJL 2ZWNA 4KMTH 5JHLL 4APQD 4MXQD 3L5HA 4GMSH 5FA4B 4DKFH 1X5GA 5LNDA 1J18A 4DVRL 2IALA 1AI1H 3QEUB 2VZUA 3CDCA 5IOPA 4FG2A 5D7IF 2F19H 1AZUA 1XTLA 1CGSL 3FFCD 1SHXA 1UJ3B 5HHOD 2AK4D 4O02L 5F3HB 1QVOA 1P0SE 4BQ8A 1QI3A 3QA3A 3UACA 3JTSA 1UT2A 3C6LD 4IKLA 1HHHB 1PLBA 3VD9A 5BPPA 1CQKA 4KKCC 2PXYA 4NN6B 2YSSA 4JM2A 1PD0A 1XMEB 2J1ZA 1JPTL 3POCA 1GCFA 4CZYA 3VMPA 5LJYH 5GGRY 2UWEB 2ITDA 2VC2L 4YHNB 1IO4C 1LYQA 5I1EH 3ZYJA 1FGNL 3TO4C 2J57A 3ENEA 4ZDHB 4ZOYA 1RI6A 2AJVL 3DUUB 4QEGA 2AJYL 5L8JB 1CF8H 4KRPD 4QRPD 1CLCA 3IM1A 3QWRD 4XWOC 1LMKA 2Z7YA 4Z23A 4E0RA 5SWQB 1CG9A 5BZXA 1A6VL 4WI6A 3DUSB 3EJCA 4ETYA 3ARBC 4IU2A 2FB4H 4M8VA 3U9WA 1T2JA 3NH7L 4GG6E 4EBQH 3HI6L 5C07B 3HHSA 1ZVHA 2Z0UA 4S0SD 4OSUH 4XCYA 4IMKA 4TL5A 1CPUA 1WZ1H 2IANB 3FB6A 3SY6A 3UBXI 1JDAA 5J11C 1T4WA 2VH5H 3AU0A 3CDFA 3TN0C 5GS1A 3FW6A 2B5IC 4PJ8D 3L1GA 4TUJA 2X1PA 3S5LB 3OD3A 4B7IA 3P9MB 5FF6A 1KT2B 3QIBD 4M7KL 4AC4A 2QQNL 4DEPC 3V4VB 1HSBB 1IC7H 4N0CD 1OTSC 1J8HA 2E9JA 4GG6F 2VCOA 2XLLA 1BOGA 3ZHNA 4LL4A 3PDOB 5JQ6L 3PRZA 5GGUA 4IM8A 4PGDB 1OTTC 1NCAH 4LP4A 2R23B 3MLWL 2G2RA 2YNPA 4UV4H 1PLGH 5EBMA 1U95A 3HG4A 3V7AE 5KSBE 5H4YA 5G55A 5GZOD 3SYOA 2ZUVA 5CZRA 5C2UB 1JG9A 2B5MA 1EMTH 3CFCH 3FFDB 4HGWA 4PI0A 2DD8H 2J55A 4R9HA 2ZP9A 3FTUA 1KCRH 3TV3H 2FIRT 2BHZA 1YMHB 2J5LB 4X6DA 2CCWA 3ELAT 5TGBB 5I1HL 4E54A 5KVEL 1R3JB 4X5RA 4PUBL 3APCA 6PCYA 3V7MA 1RL1A 1R3KA 4M6NL 1CF1A 2JB5H 3T6VA 3ZE2F 5IFJB 4A0AA 4LHQB 2Z35A 3UYPA 3ULSB 3UTZB 4U6TA 5F0PB 4EOWL 1DBBL 4A2MA 2AJ3B 2ZX8A 5KSBF 3I3BA 4WUKH 4KC3B 5GS0D 4C4KO 3B7FA 2R9HC 5IVZA 1A6TA 1A4JA 3VRIB 4U7MA 1E27B 4Q58C 2WUCH 2YD3A 4UILL 2IH9A 4FJZA 2JKLA 5I28A 3FHAA 5DFTA 2NUTA 2P45B 2DKMA 4X2UA 1XSIA 1NICA 3MV8A 4JCWA 3L4TA 4JRXB 4M93C 3PHAA 4MMZB 4HZLB 3RI5F 4HWEL 4R3SB 2ADGA 3FCUB 2Q8AL 4MNGB 3VWKB 2AH0A 3BWUF 4OZGB 43C9B 5M61A 2ICCA 2Z8WC 3OJ2C 1JAEA 4KHTH 5IOPB 1UH4A 4R5TA 3UP1A 3CH8A 4WW1A 1A7QL 4UDTA 3UGXA 4XP9L 3A4FA 4ZMLA 1JZ3A 5IV2B 4UT6L 1CBVL 1UASA 1SVZA 1EIBA 3PHSA 4G8IA 3EJYC 4NHUA 3E9UA 3QA3B 5D2NA 1FFNA 3VO0A 4A66A 3KPOB 32C2B 3JTSB 5EOQH 4DGWC 5FXYA 3PGFL 1MCBA 4MMXC 4A7UA 4EDWH 4L48A 2YSSB 4MQ7A 1WBZB 3DO4A 4H8QA 1JXFA 4KJYB 4YSPA 1NMCC 3C5MA 4MJ5B 5FOBA 2CLRB 4F37F 5CILL 3VI3A 1GZQA 3ZTEA 1PG7L 4D8PA 2ZZUT 1WCBA 4WCYH 1N0LA 3BXNA 5DZPA 4BFEA 1QD0A 3K2UL 3T0WA 5I5IA 3RSEC 5IMLB 1SFDA 2WXLA 4JZNA 4N1CA 3NJKA 3MROA 2WP3T 2BJMH 2B15A 3LHPL 1RZ8B 1IUZA 3BPOB 1L6ZA 1QI4A 5GSVB 3RWFA 5DURB 3QJHA 1HILA 3ZDYA 2I9LA 1M7DA 1RPQA 1CC3A 3R8BB 3ASOB 2J73A 3O6KL 5AW6B 1UATA 3D0VA 3HC0B 2ODIA 3LEVH 2BKLA 5T5FH 1OMWB 4I13B 4K71B 2YMXL 4H1LG 5E0FA 5B8CA 4GKNA 2BM3A 3FB6B 5AW8B 3AWGA 1JGEB 1XGTB 4HLZH 4JRLA 1L4IA 1KCSH 1JGDA 1NGYA 1NMAL 4H20L 3OKDA 2P8PA 1JZ2A 4OLWL 5A16A 3GXDA 4EQ3A 1Q8MA 2FCBA 4UM8B 2VDNH 5FF6B 5TK2A 4ELKB 3NIDA 3TH4T 3D34A 3FYEB 1Q0XH 4PJXE 1J8HB 5SWZA 1LWJA 4TTDC 3PXHA 1BOGB 2Q7YA 3BUYA 2LFGA 1AXTH 3O6FC 4PIRF 4JDZA 3AY4C 4M7JH 4PJDA 5HDBA 1RIVL 2G2RB 4YDJA 3W57A 2EYRA 4P9HH 1TNNA 4HA1A 4L9OA 3H2QA 2E9WA 4RMRA 3BUDA 2Z4TA 3WTWA 1YEFL 1AY1H 1AIFA 1NSNL 3BAYA 3TA3B 1CE1L 2X0WA 3A6BH 1ZVYA 1J05A 5T1MA 3P11L 1LK3H 1D5ZA 1XGPB 2GJRA 4PJXF 4U05A 3KPNB 5TDNB 1T7WA 3BDBA 3U4BH 2VW6A 3CFUA 1A9BA 1YNTB 3SN6B 1A4AA 4A67A 4IGBB 2CO3A 2B5NA 5EMMB 2W88A 3BZEB 4CY1A 3UYPB 1K8IB 2AXHA 5I8OL 3V9CA 3D6GA 5L6YL 3BVNA 2G3XA 5D7LA 4L9LC 2VZVA 3LRMA 1CYGA 5CJ8A 2YLKA 3SDAB 4BBWA 4FQCH 4A7JA 1HWHB 1A6TB 3K6OA 4V1DB 4WENB 3COOA 3U2JA 3TWYA 4NJ9L 1IBHA 5KW9L 3VD2A 1JNHA 4DOHB 1G84A 3IDIB 3PGCB 2P9NC 2NUTB 5FW7A 1K5NB 2FJUB 5L2KB 3AQXA 2CO1A 4LCCA 4AVJA 1E7UA 5F96L 4P2AA 4ELDA 2H13A 2FWUA 5D4IA 3FO2A 4ODXB 2ADGB 3JXAA 4FQLH 1FNLA 3HB3C 3QWQB 1F97A 5K1JA 2H2SD 3QQ4B 4PV9A 1JN6A 4BZ1L 3D07A 4YDIH 4WW1B 3RY4A 4UDTB 3UABA 3O3AB 4Y4HA 4DN3L 1AQHA 1BGXH 4MDJA 3L3OB 4HSCX 3FC8A 1PIFA 3BUQA 5F71A 4HWNA 2DLHA 1QO3B 5CJOL 5D2NB 5HHXH 4GAYA 4ESKA 4KHXL 3S36X 4OLUL 3FQXA 5C7ZA 3IRCA 2F7QA 1KTLA 2IGFH 1BVLB 2CCVA 4MQ7B 1A7RH 3T3PA 4KFMB 2VRAA 1IIIA 5E23A 4PJFE 2D2OA 5BO1L 4FQ1L 3K1DA 3LEYL 4PWJA 5D6DA 1I3RB 5EUOB 1WCBB 1E4WH 4L8DA 1J12A 2HPOA 5K59F 3JTBA 1TZOA 2I5YH 4Y9GA 1D9KD 1J48A 1N6FA 1W16A 3U1PA 1T80A 5AB9A 3BCFA 5JOFB 1DUYB 4GSRA 3AT9A 2HX9A 4WI3A 2D7TH 1QZ1A 3S2CA 5HD8C 3MROB 3MODH 1W72H 5CSGA 3WY4A 1T1WB 4EPSA 5LKNA 3O2DA 5E5LA 1IGFH 2NNCA 3Q5TA 1FZOA 2I9LB 4CDGC 1P5UA 2VZ3A 4JFYA 1MREH 3NK3A 5C8JA 2V9QA 5FFLA 3AAZB 2ED7A 1C5CL 4H8UA 4R7DB 5KBMA 3ZMRA 3RNKA 2OJYA 4MAYB 1D5XA 4N3UA 1B0WA 1BFOB 1E3ZA 5JO5A 5DFVD 3N42F 3RJQB 1KIUA 4KI5E 1HCVA 1BEYL 1TT6A 5EFIA 4BWWA 3ULUE 2VJ8A 4BFGA 5FDWB 3B43A 4GKZB 5FB8A 2P8PB 5B39G 4GAJL 4DN4L 2FATH 2PCPA 3BQUD 3CSGA 4K8RL 4WI0A 2BZCA 3NIDB 2CUHA 2LAAA 3RBSA 3J7HA 4X60B 5FHAL 5SWZB 2GITB 4WF7A 5EDSA 4L0YA 2Q7YB 4AKQA 4A55A 3MV01 4HEME 1A3LH 2XPZA 3EJSA 5DD1L 4NHCL 4ZUVB 3RUGE 1X6LA 4JNXA 1BQLL 5I8KH 3CX5K 1RUPL 3ULUF 1JTTA 4YDJB 3C2AL 3UPRA 2EYRB 3VFVB 3WHXA 1T22A 1EXUA 1VACA 4IKJA 3S35X 4RLDA 3HBQA 3VXME 2BOBB 1PJ9A 5LGHL 3KYMA 3JQOB 1K4CB 3ABMB 4Z7UE 5GRUH 5IVNA 1D5ZB 1EUUA 2OI9C 3PUUA 3L6FA 1XB3A 4CNIA 3D4YA 4FMVA 3T2NH 5TE7H 1F13A 1SDYA 5AVTB 3N6YA 4KK5D 4LIQL 3CXHJ 3RUGF 3IJHA 2FUQA 3W2DH 4ZNCD 1MRCH 4S11A 5LXGL 3OF7A 3II2A 3PWUA 1LQSR 4POYA 3TZVD 1SJEB 3GLEA 5D7LB 2ZCLH 4UOQA 1ZT7A 1A25A 2Z1KA 2ZICA 2WLIB 5FK9A 5AW2B 2WLKA 5IBTL 3T6XA 4KI5D 3ULUD 4IEFA 4AQAB 5T8IA 4Z7UF 1HOCA 3KPSE 2EXSA 5AVRB 1JNHB 1CD1A 1NCWL 3DSFL 1QKZH 5M94B 3RRMC 4PTUA 4CMHC 1DJIA 4JFTA 1D5MB 1SDAB 4KXBA 2EVJA 3WJLC 1XEUA 3B9KB 2VDQL 1UQSA 4BKSC 1S4IA 2G60L 3TX4A 4Q4IA 1JN6B 2VXQA 2AQTA 4J4PD 4NI6A 5KANI 5KUMA 3T77B 1I3VA 2X70B 3ARFC 2ROYA 4HDIA 1GZHA 1I85A 4JJHA 4MDJB 3VXMD 1WUZA 3MRFA 2XVLA 1WC7A 3WKYA 2GAZA 1XD0A 3FH7A 3WGUB 3KWXA 3PL6A 1LO2H 2UXVA 5DQDL 5EO9B 3K8LA 3WEXA 5KVDL 4PSWB 1FN4A 1TMQA 2W0FA 1S7VB 3IUMA 1U8IA 4IBLT 1MI5E 3FUMA 4HJIA 3QUZC 4KDTC 1DLHA 3QAZC 1UOPA 1ZANH 4Z77A 3GINA 3GQFA 2DMCA 3IGFA 2VDPB 5GZND 3KDMB 5I71B 4A1RA 1SNRA 2MKLC 3OAZK 3X1BA 4WVRA 1KGJA 1GSKA 3V0AC 4PRDA 3MMEB 2PO6A 2NY3C 3L48A 5J1TC 2H1LM 4TLKA 4BFFA 3KPSD 4K9EL 4M7LH 1H9VA 5SWSE 1IAKA 3U6XA 2EXTA 1GGIH 3VD5A 4F3FB 1ZVNA 4A63A 2OAAA 1IAII 2NXYC 2N59A 5DEJA 5C8JB 2OMTB 1BF8A 5JXAH 5BS0B 1KBWA 3FXIC 5ADOH 1GSMA 2PTTA 5E8DL 4X4XB 3QORD 1WDAA 4XNMB 4KQ4L 1GYUA 1AANA 3FK3A 2BY1A 2LABA 3VD7A 3VDBA 2Z7WA 1RXLA 3QUYC 4I0PA 5KJ7E 3P0VH 1F4WH 4FFYH 2WLMA 3GMOA 5GJSL 3QZPA 2C4FU 1FORL 3WLWC 5J57B 3FN0H 1DQMH 2GJ6E 3QZOA 3ARXA 1V3LA 4OFPA 1XF3B 4WTQA 3FPYA 2R2HA 3QIWC 4JE0A 1EJ6A 4S2SA 2Q6WA 1DQKA 1KCUH 2QSVA 1OLZA 3IDGA 1N67A 3O9WC 2YRBA 3FH8A 1MI5D 3CVBA 1JV2B 4GP4B 4PJHA 5JPMA 3AU1A 1IGCH 1T66D 5L7XH 3WHXB 5FECB 2F5BL 1T22B 5CSZA 3UPRB 1RULL 1G6RL 4PLKC 4AGPA 3GDBA 3OLDA 2X1OA 5I73B 4KAQL 1OP5K 3V0WL 3MRIA 3NA9L 1XBDA 5DJXA 4X4ZA 1EO8L 3FTGA 3KYMB 1GYAA 3KGTA 1B3JA 1XQ4A 3BP5A 3BE1L 3L6FB 4CNIB 1WAAA 5SWSD 4ECNA 4BFJA 5JZ7C 1FVCA 2J8HA 3DSNB 1UC6A 3D52A 3I84A 1MDAH 3ZW3A 1J88A 5GXHA 4KITB 3X12A 1KLFA 2K7QA 4UQ9A 1FFOA 3IU4L 4HV8B 4G8AC 4I4WA 3QUML 3CZFA 4XO3A 4OIBA 1G9EA 4QRTA 1GKEA 5EH1A 1SXBA 5DVMA 1G43A 3D06A 5DZVA 1TQCB 1I8LA 5FGSA 1HOCB 4L4VA 5E1HB 3KGUA 2X4PB 3LIZA 2WBJA 2VMCA 2GJ6D 1KNOA 4MBRA 3H56A 3RI5K 1TR7A 1CYWA 3C09C 3VSVA 1V10A 4P23D 2YD5A 4JFDA 2IXQA 5T3XL 1XGUA 4DIXA 3ULVC 3CVHA 1EGJH 1QBBA 3FH5A 1ONQB 2BRQA 3N44B 1KWKA 1RURL 4G6AC 4HCIA 2F2HA 1GPOL 2CHXA 3L54A 5IQMA 2V9UA 4LSQH 4WV1B 5CZXC 3ZMEA 5KBPA 3D4ZA 1MF2H 3FCBA 1B4RA 4HJTA 1JNNL 3BT2H 5DHEA 1F3DJ 1E67A 2HJKB 2M8XA 1BF5A 4NUMA 1JVOA 3MRFB 3QDHA 5CS7A 5IHLB 1H6TA 1KN2H 4JW3A 3DDGA 1KEGL 1VGKB 1JGIA 4F57H 4K94L 3OPZL 4MJIB 4P5RA 1AE6H 2IDSA 4OLYH 3HE7C 3WEXB 4N9GB 3T6QC 3IJEA 4G9DA 2W0FB 2FJHA 3E3QC 1U8IB 4PB9H 5E8PA 2HKMA 4HT1L 3MVSA 2WCPA 1TPXB 3TNNA 1I8AA 1DLHB 3GKWH 2WWMD 4E9LA 5AAMC 4Z77B 3VXSA 5KVFL 2YAEA 1X7TA 1OALA 5GIRA 1FZMA 4MZRA 2YWYA 3LRSA 3KMDA 2XN1A 3ES6B 3KWTA 2NY0B 2NY5L 4XCNB 4NKOB 4GBXD 4RWYL 3V4VL 3TWCH 5DSCB 4L4TE 1QSFB 4QHLA 4KPHH 4C83A 1IAKB 1E65A 4CVWA 1KG0A 4KJWC 5E4IA 4ODUB 5DWUH 2APTA 1PKQB 2YAOA 5JIQA 3VTAA 4DZBA 3DIVA 5F9WC 3T2PA 2JKRM 4ZXBB 3VYPA 1HYSD 2PTTB 3N0AA 3LNIA 4EQ2A 5FYLE 1IX2A 2EDFA 1I1AB 1EFXD 2H1PL 2OW6A 1BXXA 1DUZA 5J13C 1E50A 4I0PB 3FUDA 3MRQA 4QJ3B 5D1ZB 3CLFH 1HESA 2NR6C 4JFFA 4J3WA 1F02I 4ODVL 2MQGA 2WBXA 3EGXA 1UVQB 1MW2A 3GMOB 5ICXA 1HC1A 3PHQB 1LE5B 4G7YL 4BEIA 5F9AC 5T1LD 4LPVA 3ZR5A 3MRMB 2YAQA 3IJ8A 3P77A 4MZIA 3KEHA 3SWSD 4AMKH 3KYOA 4DW2L 1C9SA 1KPRB 3PABA 3UBXA 1OY3B 2Q6WB 1SHWA 3IE9A 2OIZA 2NY1D 1BJ8A 4EIUA 4ELMA 1S7XB 1BQKA 5KSAA 3UTTA 5J6HB 2WN2A 4B0MB 1K8DA 3HHMA 3TIEA 5ANMA 3K71B 4MDIB 3SKMB 5F72S 4QHKI 1NANI 3EO0A 3C60A 3PHOB 1OP4A 4FYTA 1IZKA 4B53A 3KL3A 5EIIA 1ZGLP 5DJXB 4BFNA 3ZHLA 1I9IH 3FTGB 4IW4C 1IMHC 3QIUB 4L4TD 3AQDA 4CW1B 2B9AA 4XZUB 1IM3A 4MTMA 3VGDA 2F54E 4O9HL 4UT9L 2O5ZL 3P0YH 3C8KB 1UXSA 1FFOB 1JUFB 4R7LA 1A6UL 1UXWB 3B8SA 4DH2A 3CZFB 3D3VB 5FO8A 1SLWA 4OV5B 5FYLD 4YQXL 4G1EA 4QRTB 4FC3E 3DX8B 2G3NA 1HFUA 2WZPD 2EAEA 2BIOA 2XIIA 2BSTB 2YEZA 4B0MM 2BSED 2EDWA 2VDKH 4N0FB 4L4VB 2VW4A 4KH2A 5D8JH 3VCLA 2IQAB 2WBJB 2DTMH 3P73B 1PKOA 4OIIH 3IE4A 4W9EC 3UYRH 4QAMA 3C2SA 3L17A 1HJCA 1I9JH 4JFDB 3BLKA 3K8KA 5EU6E 4UYQA 4X9YA 1NFAA 1X5LA 2J43A 2CNXA 4K7PL 4IHOA 4ZFZA 2B4CC 2P5EE 2ED9A 2L7JA 1N4XH 3BW9A 5I8CB 2EC8A 5JHMA 5EOTA 3DDUA 3A22A 1JF1B 1EANA 1ML0A 3FQ2A 3N1GC 4U1IB 2ZCHL 5ABDE 4FNLH 3LKPB 4G6FB 4QO1B 3OX8B 4TULL 3C5XA 3HNSL 4YL4A 4DJMA 4OWRA 1WG3A 2VL5A 4JM0A 4O4YH 4OJYA 4E5ZB 1OCWH 5BZDB 2R29H 1FQ9C 5IK3A 2F54D 3GSUB 3SE3C 4NFCA 1NL0H 2OL3H 4NOBA 3D0LA 4O58L 1HDMA 5HVHB 1IKFL 1EUTA 2YRPA 3CFNA 5CMAA 5CWSB 3T3MA 1B9YA 2R69H 5IB4A 4RGMB 1NIAA 5GIRB 3WY2A 1C8PA 5D1QA 1JBJA 2J6EL 4RBPK 1G6VK 1T03H 2P8LB 3J2PA 3W3BA 3FNKA 5DJ2B 5FKAB 1U8OB 2VQ4A 3L5XH 5M5RA 1I7ZB 1KG0B 1YNLL 2WKOA 4XN5A 3TT1H 3WNLA 2CSPA 2RR3A 4FS0A 3CSFA 4DZBB 1WEJH 1CZ8H 5EU6D 4C55A 2YA0A 4J78A 1IBDA 4R97C 2P5ED 4I48A 1AD9A 2ZSVA 2JQMA 4ADIA 1NEZG 4NQCB 3HN3A 4G8GE 2PP7A 3I9IA 4JLRB 4PY7B 4XVJH 5JHLH 4JFFB 3CFMA 4PREB 1CIUA 3T0EB 4ZFFB 1NAMB 1PY4A 4BQBA 2XXGA 5ICXB 4HUWB 4DVRH 3MNWB 1B9ZA 2R2EA 4QHNB 3SYCA 3P4MA 1IBGL 4MAUL 5ID0B 1MCEA 2XRAL 4FKHA 5JW4N 1CGSH 3MRNA 1NCJA 1AMXA 3MX0B 2KPWA 4MLIA 2M83A 4O02H 3UBXB 1OLLA 3DGCR 2MCAA 4A2FA 5HGHA 4I2XA 3Q05A 2P24B 3MLZL 1J5CA 2RCSL 1RZIA 3IPEA 2E6QA 2WINA 1S2EA 2KC0A 3IDJA 1H8LA 1K8DB 3MCKB 4W6WB 3TPUA 5JHDA 1XD1A 3LMJL 3ZTJH 1FO0H 3K6NA 2EDDA 1BVKA 1I9EA 1PZAA 3M7OA 1T0MA 1JPTH 1DEEB 2PYEE 3KL0A 3SHSA 1N68A 3LNDA 3NJNA 2VC2H 4MS6A 4R4BA 2CRYA 1A65A 1FGNH 2OTUA 3F7PC 3L45A 1N6VA 2XWZA 5BRZB 1J8RA 4E68A 1W6WA 2KL6A 1YEWA 2AJVH 2ZUWA 4IRZL 2AJYH 4HAFA 4K7FB 2ICEA 3EUUA 2H32A 5HI5C 2LE9A 5H94A 2B0SL 1UXSB 1A5FL 4NBXB 5DS1A 5I15L 1WITA 4AMWA 5KZCD 1L9MA 2J72A 1FPTL 4PJ7B 1A6VH 4G1EB 4DQOL 4XH2A 4DO4A 1QABA 2WVTA 3WUWB 5EEXA 1HH9B 1YDPA 4G8GD 1SYSA 1SXNA 2X4QA 3NH7H 2D31B 5E6SB 5IJCC 3HI6H 4QRRE 4P3WA 1TO5A 5AD0B 3VCLB 3L4UA 3KGSA 2SODB 1RUQL 3AUVA 4MXWL 5FCSH 3GTTA 4BKTC 3D85D 4QLRA 4L1MA 4N26A 1DVFD 2EVHA 5IUSA 3F7VB 4Z95L 3L3HA 5E70A 1JMZA 1N7ML 2FIKA 4R7NA 4A2LA 2Z9TA 3IJSA 3QNYA 2GBUA 1XH0A 2QQNH 4M7KH 1CFTB 4LSVL 2OCFD 3FT1A 5GGTA 5T1DH 1FL5A 2CBQA 5ANHA 1KB5A 5JQ6H 5KYYA 3VB9A 4ZMOA 5KBDA 4M5YL 4JO2L 4QWWD 1Q94B 2PYED 2OSWA 4KJPC 3MLWH 3SDXB 5DI8A 4OF8A 1P53A 3ZWLB 5IEKA 2A6JB 2CHWA 4N0RA 3C6LA 4NQEE 4BZ2A 2VABB 4KK8D 4DT2A 4CI3A 4X83A 2RHEA 1SY6A 3FAXA 1K5WA 1PGRB 3QQNA 1HDMB 2Y1VA 1IGYA 1BW8A 5CMAB 5DD6A 2GC4C 4L8BB 2X9WA 1GYVA 3D25B 5I1JL 6CGTA 5I1HH 5KVEH 2CIIB 4LHUA 4JY4B 3NPZB 4PUBH 2ZUTA 3MMYA 4M6NH 2PUQT 3EG9B 5GISL 1BV8A 5D7IA 3S37L 3V5KA 4EOWH 2OSLA 4QRRD 1DBBH 4M61B 2VLRB 1S9KC 2NY7L 4GXUM 1IAOA 3VJ6A 3DIFB 4HK3N 4AQ8C 4BH8A 2PWDA 3LZLA 3GJFH 4XX1E 4HH9A 4R0LA 1AR2A 4UILH 1P7KB 2D0FA 2HKRA 3CBRA 5F2FA 5ITFA 1CICD 3OQ3B 1TTGA 5C0AA 1I8MB 5CJXC 1VEMA 3MKGA 1AD9B 2ZSVB 4GGAA 3ZL2A 3MI6A 4JHZA 4YDLC 2J1WA 2Q8AH 5IG7B 4FI8A 4MA3B 3FQNB 3H54A 2DQGL 3DX6B 1LEIB 2ZCKL 4M5ZL 3MXXA 3NPSB 4GKLA 1PBYA 4JPSA 1GXEA 4FI7A 4ZNEA 5JW4R 4S1DC 3MR9A 2C5DC 3MO1A 3PU7A 1A7QH 2I07B 3QIBA 4XP9H 2RFXB 4N0UB 4NQED 4XAKE 4UT6H 1CBVH 5G4NA 2Z4QA 1MJ8L 3X1FA 4I2XB 4P59L 2IUVA 4OR1A 4HIHA 1L0YA 1E5CA 4LDOB 3TPUB 5JHDB 2XVKA 3PGFH 2QEJA 4Z78A 3PFUA 1NIDA 1KTDA 4LVOC 2BSRB 4WU7A 3D30A 4Q14A 1T0MB 1TVHB 3IDMA 4FXGA 1F11A 4N24A 4U1GB 2UVFA 5CILH 1PG7H 4R4BB 1LNUB 4WI8A 3HS0A 2KLRA 3K2UH 3VFUB 5IQ7L 2XQYK 1KDIA 4YFLF 4C58B 4TXVB 4FXKB 5BUAA 2ICEB 2OMXA 3LHPH 3AC0A 5LBVA 4GG6A 1O9VA 2CDFB 2YXMA 3DVGA 1NKRA 3BWAA 1R24B 1DJZA 2R1YA 4UTBL 4Y9EA 4Y2OA 3I7KA 4EN3C 2ED6A 3I6KA 4PQXA 3DC0A 3WXVL 2WNXA 3O6KH 3V6ZA 2M26A 3WNIA 4HOMA 5CD3B 5HGBB 1MFMA 4BCDA 3L4YA 5C70A 3OKEA 4B27A 2YMXH 4YVUA 1VYHC 5IR1A 4PYGA 1TBGA 1NMAH 4WSGA 4FNUA 3MNZA 3NFNB 4H20H 4XAKD 5C0DA 4AIXA 4OLWH 4APQB 4PGEA 2DLFL 1JMZB 5HE2B 2WQ8A 4GS7B 5DMGD 3WMSA 3QNYB 4RNRB 3ZDZF 3ZE2A 4D0CA 5CLYA 2C9VA 4AH2A 1DQDL 3EI4B 3FFCB 2YZ1A 2KZ1B 5HHOB 2Z93B 2AK4B 3DX7A 5KSBA 1MLBA 3I8CA 4LCYA 5AZ2L 2Z3FA 3B37A 5HY9B 1RIVH 3QZBA 4Y5VA 1MIML 3GMRA 1UZ8A 3C6LB 1L7TL 4IJTA 4LOUD 3RJDA 4DK3A 2E46A 3WS6A 1QFWL 4CJ1A 4YLQT 3ML9A 3ZZLA 4BP8A 1NSNH 3VRJB 1U36A 3SQRA 1O7VA 1CE1H 4OT1L 5LN8A 1IGYB 3P11H 1CR9L 5E6IC 5DD6B 4XVTL 3UFIA 4EWRA 2J57G 3VRLE 1LVEA 1JXJA 2YMTA 3QVAA 2J44A 4LBAA 3FRUB 4ZTEA 5TH2B 3KR3L 4KRPB 3OMIB 4I8DA 1LO4L 4LLQB 4QRPB 2J7LA 3V5KB 5I8OH 2JQAA 4DO5A 1JXKA 3FT3A 5L6YH 5J12C 3VXRA 5AG9A 2FDBP 3C5ZD 3VJ6B 2WXNA 2WXHA 5A2FA 3HEIB 1KY7A 3KDPB 3PWNA 4AL8L 3MNVA 1E8NA 2ZAIA 4NJ9H 5HI3C 5IF0A 5KW9H 1YQVL 3ESNA 1OAYL 2AH1A 2VN4A 3FCTA 4GY4A 3ZGIA 3SGEH 1JCKA 1XR8A 5F96H 1T20A 2CHNA 4ENEC 3BGFB 4HMEA 1V7ML 1N0XL 5INDA 4G43A 3EHBD 3AL9A 2K4WA 1VKXB 2BCKB 4PJ8B 1ZDQA 3U0WL 3LPGA 2DYPD 4MMZC 4BZ1H 3B3BA 2AJUL 1ASOA 1MQKL 2CH8A 3MR9B 2KHAA 1KJ2B 1FV1B 5ELIA 1H3XA 1GS6X 3QIBB 4DN3H 4X6BA 2GVYA 3OMAB 3OB0K 1HT6A 2Z4QB 5CLXA 2DQ6A 4NPKA 5CJOH 1WGVA 4PJCE 4ONFL 2P9RA 4HIHB 3VB8A 4PRIA 2YA1A 2HLAA 1AOHA 1BCIA 2VE6B 3LN4B 4HFUL 4KHXH 4OLUH 5JORA 5DK0A 4D7BA 1XF5A 4DEWA 1KTDB 1ID2A 3CVCA 4C56E 5F88A 2F7PA 2PWGA 4FXGB 1O6FA 1F11B 3OTTA 4YK4B 4FQ1H 2VDLB 3LEYH 4GGDA 1J5DA 3V0DA 2EIZB 2Y5EA 2CMRL 3EXLA 3OC5A 5CXCA 5IHUL 3FOMA 2RJMA 4X98A 2YGPA 3H6AA 4JM2C 4JB9L 4S1SL 1A22B 3HN5A 5DJCB 3K6SA 1X9LA 2VZOA 2X4SB 3VG9B 3LZPA 4IBQA 1A14L 3ABKB 3QNXA 3KHOA 3ARQA 1JSYA 3UPCA 4GG6B 4G55A 5INCA 3X11B 2F7IA 3GMNA 3NQIA 2FBJL 4GW5A 1N3NA 2XTJC 3PVWB 4UIMA 3HC3L 1C5CH 1Q9KA 3DECA 2L0DA 3V6ZB 4OZFH 3FU7A 4HUXB 3UBGA 3G5YB 5DJ6A 5AL0A 2CBTA 3PXSD 5C7XL 2HU7A 2EXYD 1JZEA 2VW7A 3QO0B 3PSCB 3JWNG 2A74B 2E0PA 3CSPA 4YDKL 1BEYH 5J6SA 4ERSL 1X44A 4CY5A 4WGWB 4IS6A 4NYLB 4AVKA 3LOWA 4DKDC 1DO5A 1BWMA 2QFPA 4GAJH 5C0DB 4DN4H 5I2IA 3K8MA 4IOFC 4IMKC 3LZRA 4K8RH 3DVNA 5D9SB 1UTDA 2XZCL 1OCCB 1U8CA 2AITA 3F84A 2QHLA 1II4E 4MD4A 5ACMA 4G3YL 1WO2A 1KJ3L 5GS1C 5FHAH 4TM9A 3IVKB 2F1BA 4J7RA 4QF1A 3MKKA 5I0XA 4C56D 5KSBB 3DX7B 5DD1H 2YPVA 1MLBB 1LXMA 5C0CE 4WLCA 4LCYB 1MVUA 5HHPA 5IW6B 1BQLH 5F7DA 3F85A 1KENH 1RUPH 2WQAA 4KXDA 2JMRA 3C2AH 3N50A 4RFEB 5FKTA 4X6FA 1NDMA 2G99A 3VXNA 3RWHA 5E94B 5LGHH 4PJ9D 4ERQA 1J0YA 5DT1L 3EYSL 5D4JA 5JMRA 1MVYA 1MCJA 3T0BA 4KNUA 2FGWL 3JBG7 3N85L 4PJ6A 2YD9A 3GB7B 4HIEA 4X7SL 1D9KA 2VOTA 4LIQH 4FFWC 4NKMA 3GEWB 4F5CE 2GJPA 5CGYD 4AY0A 4ANWA 4KXAA 5LXGH 3B2MA 3VQMA 4OF5A 2OQJA 4KK9D 4E9YA 5IBTH 3KS0H 4EDXA 3V4PL 1AHWB 4LOVA 1GJWA 4P2OD 2ICWI 2KZWA 1NCWH 3DSFH 4AOWA 4FNRA 1QTPA 4WEEA 3US9A 2P47B 3KPRE 3U0PA 1EEZA 1A64A 1T20B 4OCNC 3SD2A 3O2VL 3OAYH 4POUB 3BYYA 3OWEA 4I3GA 2VDQH 3ZQXA 1P9MA 1B4TA 3VSUA 3L08A 2G60H 3BAJA 3JWNC 4Q74A 5C0CD 2NCMA 3TASA 1SXSA 5FA3B 2FT6A 1TXKA 3CDGA 1RJCA 1FG2A 1BP3B 1NPJA 4P8QA 1GOGA 4AI7A 1CXFA 1R3LB 1M2VA 2YBRB 3TCXA 5JIIA 5ESAB 5HGGS 4YR6A 1KTJA 2VDOA 4Z7AA 5D5MF 1EX0A 1OF0A 4K2UL