3K71A

Structure of integrin alphax beta2 ectodomain
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
1081
structure length
880
Chain Sequence
b'FNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAANQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPELEMAQEGFSAVFTPDGPVLGAVGSFTWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQSLVLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGAPHYYEQTRGGQVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVVIGAPGEEENRGAVYLFHGVLGPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRVLGLKAHCENFNLLLPSCVEDSVTPITLRLNFTLVGKPLLAFRNLRPMLAADAQRYFTASLPFEKNCGADHICQDNLGISFSFPGLKSLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRYVAEGQKQGQLRSLHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANVSSENNTPRTSKTTFQLELPVKYAVYTVVSSHEQFTKYLNFSESEEKESHVAMHRYQVNNLGQRDLPVSINFWVPVELNQEAVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVLDCSIAGCLRFRCDVPSFSVQEELDFTLKGNLSFGWVRQILQKKVSVVSVAEITFDTSVYSQLPGQEAFMRAQTTTVLEKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-X
publication title Structure of an integrin with an alphaI domain, complement receptor type 4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 119
structure length 880
sequence length 1081
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2009-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
A PF01839 FG-GAP FG-GAP repeat
A PF08441 Integrin_alpha2 Integrin alpha
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1460 Mainly Beta Sandwich Immunoglobulin-like Integrin domains. Chain A, domain 2 3k71A02
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3k71A03
2.60.40.1530 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 4 3k71A04
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3k71A01
2VC2A 4Z7NA 4MMXB 4WJKA 5E6RA 4G1EB 2VDKA 4JX0A 2VDQA 1JV2A 4UM9B 3FCUB 4IRZA 2VDNA 4G1MA 4Z7QB 3K71B 3T3MB 3K72A 2VDOA 4Z7NB 1M1XB 4WJKB 3ZE1A 2VDKB 4WK4A 2VDQB 1JV2B 5HDBA 1L5GA 3FCUA 2VDNB 4G1MB 1TYEB 4Z7QA 3T3MA 5FFOA 2VDOB 3FCSA 3K72B 1M1XA 4WK2A 3VI4A 3ZE1B 4WK4B 5ES4B 5HDBB 1L5GB 1U8CA 1TYEA 3ZDZA 3FCSB 3ZE2B 4WK2B 3VI4B 4UM8A 2VDPB 5FFGA 4Z7OA 2VDRA 1U8CB 4O02A 3NIDA 3ZDZB 3NIFA 2VDLA 5E6UA 3ZE2A 3V4VA 4UM8B 2VDPA 3K6SA 4Z7OB 2VDRB 4O02B 3ZDYA 3NIDB 3NIFB 2VDLB 5E6UB 3ZE0A 2P26A 3V4VB 3VI3A 3K6SB 3V4PA 4MMYA 3ZDYB 4WK0B 3ZE0B 3IJEA 3VI3B 3NIGB 4NENB 5E6SB 3ZDXA 2VDMA 3T3PA 3V4PB 4MMYB 4MMZA 2VC2B 4MMXA 5E6RB 4G1EA 4WK0A 3IJEB 4UM9A 4NENA 3NIGA 5E6SA 4UM9D 3ZDXB 3K71A 2VDMB 4NEHB 3T3PB 4MMZB
chains in the Genus database with same CATH superfamily
2W81C 3B5TA 3UYRL 5EUOE 1MDAA 4FA5D 2XHNA 2XWEA 5CMAB 3RNQA 2QQKH 5IW1B 2WWKT 1ETZA 3VXTB 2YPKA 1S3KL 3B56A 4UMGA 2I3SA 3D0LA 2CE9A 1TMQA 3AVEA 4OLZL 4X6FB 4JFWA 3H9HB 5DHYB 4J3OC 5JO5A 2P9PC 2NW3A 1JNLH 2XG4A 3AB0C 4GT0A 4YSEA 5H35A 2NY1B 2ZX9A 2WVUA 5GS2D 1J05A 1JGUL 2QELA 4YFLI 2B15A 1U8JB 4TQEH 1DYZA 5LG1A 1BBJA 5T33H 2ZJSH 5FFOA 3VI4E 2A0LC 3VWKC 4N20A 4LIQE 1FQ9C 1HKLH 2Z91B 4PGDA 1HSAB 1NMBL 4Y4HA 2BIIA 4OUOA 1HI6B 3C99A 1C5CH 1PEWA 3V0VA 1KCKA 1NUNB 3FQXA 3L9RB 4WI6A 4O4YH 2X6CA 4LCCA 4RMQA 1NBCA 5L0QC 2GI0A 4R7LA 4YEEA 3GXPA 1M3IA 5F7EH 1J5IA 1AQDB 4GGDA 4JFUA 1HHKA 3BG0A 1E8XA 4P48A 5LG6A 1IGML 4GUOA 4A6YH 1KTCA 4M8UA 2Q20A 3PJLA 3DOHA 5F9JA 1KWKA 3CVHL 4HC1A 3ZE2E 1KOAA 3OXRB 2HA1A 1YMMA 5F89B 4POUB 4ORGA 3NFNA 3CDGA 3L4WA 1SN5A 1IAOB 5D6DC 4LRNH 1J9RA 3ZKQD 1GYAA 1MHPL 2GW5A 4JM2C 4J3TA 4JDZA 3FFCA 4PJHA 4GEIA 4B27A 1S9XA 5GGTH 2QKSA 3IK2A 5MENA 5LJYH 3FUMA 2W92A 3HZVA 4WI7A 3HEIB 4APQA 4CVZA 4M29A 4Z23A 1BEXA 1FYTD 2J57A 3U9WA 2Y7SA 1KPUA 4D3CL 1A6AA 2J72A 3G6JB 3RVXD 3ISRA 3SPVA 2IUVA 1BFSA 2NOYA 4GKZB 3RURA 4AH2A 2XBZA 1TJGL 3RFGA 2OTUA 1NM9A 1S7VB 4P4RB 4FL4B 2IWGA 1INQA 2FO4A 1TO5A 4KKLD 2DWYA 2YGOA 1CLOL 2AJXH 3MV7B 1BHGA 5ACLA 2BNQB 2ZUVA 2XX1A 4GG8B 4AL8H 1X4XA 3S8GB 2B0SH 5KVEH 3CQQA 3N9GH 3VFNB 2QMKA 3U4YA 1FLRL 3LXUX 15C8L 3DRQA 3IFPB 3QYMA 4Y16D 4A68A 5SV3A 4L8CB 1VGEL 1BZEA 1KT2B 5C8JB 1GRWA 1F3JB 2EKJA 1T1XA 3QHFL 3T0EE 1SOSA 1GCYA 3DHMA 4MMXB 3R0NA 3VG9C 3NCYS 2KQNA 3H42L 5INDB 1FVEA 2DL9A 3N44B 4WTZG 3WJMB 1CXFA 3BKCH 5HHXL 2CKBA 2AEQH 3GZKA 4JKWA 4D0DB 4EUPA 4G8FA 3DRTA 3SPHA 3WSQL 5AWNH 3BESR 3C8DA 4LVHB 1PAZA 4CW1B 4ETQB 1I1AA 3SJVB 4Z7UF 4KRPB 1P84K 1S8DA 2YO3A 3MDJA 5SWSE 5I23A 2H6UA 3RY6C 2WANA 4A7VA 3QDMD 2EIZA 1T2XA 3IETB 2OJZL 1AAJA 5DURB 1NC2D 1LP9E 1BJ1H 3CDZB 4KXBA 2X0WA 2DQFA 3KYNB 3WNNA 3GMOB 4XVUC 1MCOL 4L1DA 3UABA 5ES4B 5TEFA 2YR3A 1SBBA 3SKJH 1EIBA 5DVKA 3UACA 4GIOA 2YC1A 5CZVL 2D3NA 3HRZB 3SIKA 1L6PA 3QAZB 3QDGE 1M05B 1U8LB 2OMYB 1BYOA 1KY7A 4PY8J 5J3HC 4PJ9C 4HGWB 4ZNCD 3O9WB 2ODHA 1CDGA 2HJKA 2K8MA 1JVOA 2R0KH 4QRPE 5SX4I 3IDGB 3PWPE 1G9EA 2B5LA 1AQKL 3LH9A 4I2XB 4FADA 4X6EA 4EQ2A 1VCBC 3RWDA 2YD8A 2AQTA 4LSVL 2Y2WA 3KLLA 4L8SA 4PNKB 4AQOA 4OTXL 4J77A 4Q9RH 1J8HB 2FJHB 3RPIB 1YEHL 1U2CA 3C60D 1R5WA 2DQHL 1JWSB 2VDLB 3GS7A 5D1QE 3ZR6A 5IB1B 4IRSB 4DP8X 2R2CA 4N22A 1I53A 4Z7NF 3Q2VA 4YDJB 3ZX1A 4CL7A 3HMXH 2IWFA 3I2CL 4JFEE 5GJSL 2WIIB 5CEXA 1XZWA 5BQDA 4WW2C 1P53A 4O45A 4APXB 5DYOA 2V2WA 1F4XL 4RAUA 3MBXH 1BD2D 1LWJA 3F3GA 2VMFA 3L7FA 3HNTH 4JRYD 1HQ4A 3ILPB 1FH5L 5EORL 1IBGL 4EWRA 1OD7A 3T6XA 5HPOA 2LU4A 4B9IA 1BZOA 1MIEL 4HCFA 3IRCA 4QRSA 1SLWA 4TOYH 1SOQA 3PWNA 4E9WA 3QUXB 1QUNA 1QLEB 1H0DB 1T0NB 4TRPH 5AAMC 4A39A 7TAAA 1GGBH 1JV5B 3T0WA 4JANA 4BRJA 3KWWB 4ODUA 5I8OH 2VDNH 1UOKA 1CLYL 3PNWB 3CSGA 4PD4J 1I1RA 2VDOH 3ROLB 1KIQB 4XC3H 1C08A 2GYSA 2YBAA 1EWHA 4I1RA 4CADA 4Y7OC 1E9PB 3WKNA 5CD3B 2IAAC 1GSKA 1IE4A 2BSED 1E4XI 2AJSL 3OKNA 4NKMA 3L3IA 3T0AA 3VFRA 4A7SA 3UYRH 1EFXA 5IFJA 1N7ML 3D4GA 4X98B 1MI5A 1NPJA 3MLWL 4GMTH 3TVMB 3FB6A 4FFZL 4NP9A 1AZCA 3C5ZB 1ORQB 2X4UB 1SYVA 2ZSVB 4OLXL 4B0MM 4OLWH 3UPRA 1Q94B 3SN6N 2VLKB 4OLZH 2F61A 1TVDA 3WLWC 5IT2L 4OZHA 4B9CA 1PW3A 2RHEA 3RFZB 1SF3A 2Q0ZX 4JDEB 2J6EL 1CFTA 5EO9A 3DXMC 1PZCA 3Q7JA 2BRQA 5D7EA 3BGAA 2NY2D 1C12A 2V3FA 4QXUL 1RXLA 1JGUH 2WPGA 1AIFB 4DKEL 4G8GE 3GI8L 4ODHL 1JMZB 4WUUD 4IBVA 5DD3L 3LZLA 3ZRFC 3IJCA 2G2RB 4MQSB 4N8VG 1RERA 1ZEAL 3AG3B 3GMPB 1NDGA 1MQKL 3TBTB 5CLZA 2H47A 3NOIA 5ISZD 4JO1L 4PJ5D 5DF0A 1TO4A 3RU8L 5IHUL 2GK0B 1OALA 4WEEA 2UYLB 5J1AB 2ENPA 3SN6B 4I85A 1WPCA 1TYJA 2DEWX 3EFFA 2R1XB 1N18A 1IGMH 2Q10A 5DVNA 2CUHA 5E1AA 3VFPA 2NXZC 3I50L 1QBML 4U1SB 3WHXB 2JQMA 3V4VA 6FABL 1J7VR 3QJHB 2Q3AA 3CVHH 2Q76B 2X4RA 4K8RD 1AZBA 1BPLB 4OCRL 4F5CA 4FA9D 3L3OC 4DIXA 5E9AA 4X61B 1JZ4A 3SHSA 1R3IH 2J1YA 3QG7L 2JWYA 3QFJD 4OGYL 3F05A 5IVXF 3D69B 3U9PL 4EMZA 2O61A 3IMTA 4GQBB 1EJ8A 2CWRA 3GGWB 3MXWL 2VM3A 3VXMD 4M8QB 3L3JB 4GAJL 3T77A 2Y2YA 4XN5A 3H54A 4BJLA 3UOAB 4GRLD 2HN7A 5E6IA 2WINB 1MAKA 1XH3A 4Z9KB 4PIBA 3UDWC 5K5YA 3JWDC 4MAYD 3CFNA 1OM3H 2XACC 4M93B 4RDBA 4HUVA 4JY4B 1KCRL 4EI5D 4LXFA 1GSMA 1PMYA 2BCMA 2OULB 4ZMZA 4D9LH 2P80D 1YQ2A 3WTVA 5CSBA 2Y3NA 2VDQL 1KY6A 2ZZUT 3BOVA 3N1GC 3UBHA 3AU0A 1YYLL 2OL3L 4PCKA 1IM9B 2XN1A 4KKCC 4ZQTA 1PLGH 1VFBB 2QDWA 2WLNA 2XTJB 4L18A 3EJYC 1CLOH 2MQ0A 4NZJA 5AFU3 3VFTB 4HAGA 2EYTB 4LSRH 1WFMA 1UKQA 3IJHB 1UD4A 3MNWA 1YMHA 3QR2A 2FIRT 3NA9L 3VU2A 1FLRH 1N2RA 15C8H 3ARDB 4LCIL 4MDRA 5LB1A 4CY2A 1MRDL 2KUTA 2WXRA 1RK1B 1VGEH 4FFWD 2R29A 4R7NB 4RIRA 2RJMA 3N55A 4E9RA 1K85A 2Z92B 4AE1A 2AH1A 1ZHLB 1JI2A 1I4FA 3OLIA 4IRJC 4JY6B 5I66B 3NGBB 4TNVK 3H42H 1PCXA 4AMYA 2E27H 5EMMB 1MRFL 2IAMC 3BAYA 4MQXC 3WN5C 1FP5A 5EC1B 5M61A 4FNLL 2MCG1 5SWZD 3TURA 1MJ7L 3HUJE 1SLVA 3KVQA 2NQ3A 3T3ME 1T0MB 3QA3B 5ABZA 5BOPA 4X5WA 3VWKA 4YHNB 2GITA 1VHPA 1W9XA 4PRDA 4QYAA 2WLYA 2DWXA 4ODSL 2XL2A 3EJPA 5GGSY 4NJ9L 3C6LB 3E6HB 1U95B 4PP2B 3V6FB 1EAPA 4F2EA 2OJZH 5T3XD 1JHKL 1M42A 4UT9H 1CF8L 4HDIB 4M5TA 4ONGH 4RGNE 5EBGA 5F7KC 3N0AA 3EG6A 3ZRSA 3WIHL 3HLKA 3NRQA 4JG0H 4WFHD 3GJFH 1XF1A 5H37G 1Q9WA 1EZVX 3PE9A 5CZVH 5MP6L 2W1NA 4DGVL 5CCJA 3UTSB 3K6NA 4JPVL 3NIDA 5IB4A 5D6DA 3IVKA 2DYPB 5IFAL 2EC8A 2ZOLA 5IZ7A 2HB0A 4ES0A 1SOXA 4JM2A 4LP4A 3UTPD 4IOFD 4PJIE 5EM2A 3WNJA 3II1A 2OX5B 3QUMB 3ES6A 3L95B 5EU5A 5L2KE 4QGYA 3WKQA 1SHMA 1KDIA 1XHMA 2D31B 3KXFB 3DGDA 4ZJ9A 2JKSA 1KN2L 3TTSA 2KYIA 5B39B 4KFMA 4M7ZC 2DQHH 1IEAB 3HVNA 4LEXL 4I48B 5I19L 1EXUA 2DTSA 3I2CH 4IJ3C 3PNRB 4B5ZA 4PJBA 3X3GL 2IDCA 4YIQA 4NQDA 3EJZD 1E28A 2H2PC 3OR7A 5CJBA 4YHZL 1KXVC 1NA8A 1NGWB 4OFPA 3T8MA 3FB7B 3L6FB 5C0CD 5DJYB 2VDMA 3BUBA 3IDNB 4Q14A 1BWWA 1FUNA 3Q6FA 1R19A 3HHRB 2K7QA 1QACA 1XF3B 3W38A 2XIBA 1IBGH 1P4IL 3L1EA 1TEYA 3QRLA 2F19L 5J9PB 3FU6A 3BN9C 5F6HI 2VJXA 4BFOA 2OI9C 4FNPA 4G42A 3X2QB 2VR4A 3VXRB 2FJSA 2HMID 5K9JH 4E41E 2XKSA 4L0PB 4R7AB 4YSTA 3T65A 1OVZA 2J8UE 4JHWL 4LL4A 5EZJB 2PYED 3QCUL 4Z7VE 4N5UA 3LZNA 4FEIA 2Y1VA 3L08A 3OB8A 3QWQB 5F1NB 5DD5L 1E27B 3FTGB 3RDTC 3P11H 3MI6A 5A16B 1YRKA 1UGKA 4JFDB 4F20A 4G80B 4NUPA 4HSQA 2AK4E 4WNQA 3WTWA 3KE0A 3DURB 4UB0H 1N7MH 4UZGA 3RY6A 5I17A 3F01A 1L5GA 3MLWH 4JQIL 4PV8A 5JW4R 1I3RB 4FFZH 4PJDE 4C4BA 4M6OL 3LH2H 4K9EC 1S5HB 2ENJA 5CILL 5IT2H 1PTZA 5JHDD 1AI1L 4M5SA 2F54D 2A5UA 4DQOL 2CRIA 2XZZA 5C0IA 5B3JF 4ECNA 2NY1C 2HTKD 4QXUH 1UM4L 3SDDB 4PJ9A 4I1NB 4ZW7A 3SYPA 4DKEH 2ED8A 3GI8H 4WQOA 1MUJB 2F9BT 2CPUA 1JZ5A 3P77A 5DD3H 3O41B 1AMYA 3TT1H 1QSFD 4OI9A 3HE6D 1GW0A 2WQSA 3D85B 4JG1L 2EO9A 1ZHKA 3AXLA 2XKNB 3GEWB 3PXHA 4PB9L 3GLAA 3CC1A 3GSVA 2YEQA 1MQKH 4EIUA 3H4HA 5AENA 1JYVA 2QQNL 1BOGB 2JJVA 1UWXH 3RU8H 5IHUH 4JY5L 4H25A 4YDMA 5C92A 1RUQH 3O3EA 5F7DB 1U8NA 3RVVC 3EI2A 1CGVA 5EO1A 2G5UA 4OFIA 3I50H 3PV6B 3FYIB 2CM6A 4OCRH 2UWEA 3MGTB 5HHME 1Z3GH 2YSSA 1JPSL 4ZPVA 4R5VA 4OGYH 5FUCC 1P4BL 2H6KA 3NCEB 4WW2A 2XVLA 4LLDB 4YHOL 3I6LD 4WSKA 3MXWH 5TF0A 2WKGA 4PVMA 2A9AA 2QSVA 3FYEB 3N43B 4L8DB 1WCBA 1XH2A 4WTWA 3H9ZA 2IGFL 4Q2ZB 1CTMA 3HPJB 5DEFA 4V2BA 1AR2A 3SYAA 3SKMA 5KSVA 1WD9A 4H26B 3PDDA 3BUYB 3ZDXA 1HE7A 3JV5A 5HDBF 5SWQB 4RGMC 4LPYA 1BXVA 1YCSA 2WZAA 2WCGA 3B5HA 4L48A 3VXNB 4JO4H 4ESKA 3TFBA 5DHVA 4OZGA 5E99L 1AANA 2VDQH 1B2WH 5E99H 2ENYA 4BQBA 1H3UA 3TEUA 2OL3H 2PR4L 1TBGA 4XMPH 3LQZB 2TRYA 3GSNL 3HW7A 5KS9F 2Z2PA 5GGSB 4GQPH 4JUSA 5BRZA 4AZ8A 3NZ8B 4WWNA 2IAAA 3VFGH 1IM3D 1BV8A 4W68A 5E23A 3SE8L 3NA9H 3U2JA 3GSWB 1XGZA 5DZLA 4PWIA 1MRDH 2I0RA 2KBGA 1IGFH 4UOZA 1DEDA 1T1WB 1XKSA 2LABA 1PKQA 5CBEA 5BUAA 1PL3A 3B3BA 3PWUB 5K9OA 3ZQXA 1GC1C 1U0QA 4MMXC 3VXUE 4PLOB 3ECBA 3IJ9A 1MHCA 3HHMA 4HJTA 3ZOAA 2BO0A 1DSFL 4PSWB 1E9OA 2WLIB 2OAAA 2X2HA 1G5AA 4MDJB 1TT6A 1G4RA 3I9PA 2OMZA 2MKWA 2UZXB 1UFGA 2VGLM 3O3AA 4FNLH 3ISWA 4OVUA 3RUGF 3UTZA 5AB2A 1N0XL 4ZT1A 5E9DA 4GW4B 2K6ZA 1CK0H 2WXPA 1IVLA 3CE1A 4KRPC 3ULSB 2YGVA 2F8OA 1DZ0A 3L17A 4D8PA 1GZHC 3FQTB 3HN5A 4GIPD 5D72L 5C08B 1K8IA 3FT3B 5GXBB 5CAYB 1TZHB 2NNFA 4QUOA 3CSFA 3L45A 4K7FA 3VSTA 4A2HA 5D7LD 4EZKA 3KPRD 1TTAA 2MWCA 1OK0A 3H9SA 1ITCA 3HKFA 2ILLA 3QAZC 3QPXL 1ZVYA 3L3OA 1T5WB 4DGVH 3O6FC 5A6LA 2VDPA 3Q9QA 1HHGA 4K5MA 3O9WC 3GBNH 4QJ3B 4ZS6C 1TTBA 3VTAA 1O9VA 4Z7QF 4IBTA 5I1LA 1B90A 1BQLL 3IM1A 2Q8AH 5IESH 4HD9A 1V27A 3F7VB 1AHKA 1N8OE 1RVFH 2WC7A 1D5XB 3UDWA 5HVWA 5JW3L 3QWNA 1DSYA 2GTWB 3NACL 5CCKH 3GSRA 3LCYA 3EI1A 4AX4A 3SVWD 4X7CC 1KN2H 2AXFA 1BVLA 3MLZL 2UX6A 2ZWYA 3IDIB 4L3EE 4NWTL 4ALAH 4YHML 1ZK9A 4LEXH 1SNRA 1H3TA 4IRSC 1PFOA 4L3GD 1HYSD 1AY1H 1KENL 3TIEB 4XN1A 4G11A 3JZNA 3X3GH 1VEMA 3HI5H 4QY8B 1J1OL 3F2LA 3GF8A 5E94B 5JA8B 1CL7L 3NSCA 3T71A 2LOEA 1DBAL 4WU5A 5HYQA 1MFNA 2A4ZA 4ABQA 1OL0A 2UZYB 4E9LA 3T6WA 5AMSA 5A43C 3ULVL 1Q0XL 5AOZA 1P4IH 2AJVL 1IAII 1DE4A 1IC7L 3FFOA 4P2OD 4IRJA 3DI3B 4B41A 5AW5B 1EHXA 1X5XA 1QRNE 4AIZA 3QJVB 3QUXC 3RWJA 4IRZA 2EJ1A 4OZIB 2AGLA 2IAMA 3WN5A 1FJ1A 3DKHA 5T1LA 5KSBB 4GQZA 3PG2A 3TBWB 4BXVA 5EU6D 3K74B 2Z93A 4F9LC 3K3QA 3EYOB 2UVEA 1A6TB 4DGUA 2H68A 4OCXL 1YFQA 5DD5H 1LE5B 1X6NA 4AYBA 3S35H 2W07A 3GSQA 2TSAA 3F12B 3GJFK 3CDCA 1W8EA 1E50A 2JF1A 1UVQB 4JS7A 3D30A 2PTTA 4PJFA 2GJ6B 3C5ZC 3SDXF 4M6OH 1VAHA 3D1MC 3OKEB 4PRAB 5CILH 1WBYB 3BP5A 3O3BA 1AI1H 4LOVA 4C56A 1ASPA 5GS0L 4LBEB 2OMBA 3DJRA 4FEMA 4FDWA 3WTUA 1MCEA 2PW2A 2YMUA 1PZUB 2BZDA 2EKSA 2Z1PA 2CMRH 4KGJA 3MJ9H 3LN5A 3R18A 4MZIA 1ZSHA 3BAIA 2XCMC 3C5JB 4PYGA 3DXAA 1JZJA 4OM1H 4NERA 3ML8A 1NGZB 5A7EA 1QWHA 3ZYOA 2ZAGA 5B4MC 3I7KA 4BL0A 3GTNA 2ZCZA 5DS8A 3LMJH 4B7LA 3G6JE 3I9AA 3D25A 4OU3A 4AG4H 2G0KA 3F84A 5BV7L 3VG0H 2EDDA 1QHPA 5I8CB 4YHLL 2EVHA 4NNYA 4P23D 3K26A 4LFHD 2I7SA 3VVWA 1G7JA 4OGAC 4L1TA 4HUKB 2EIBA 1JHTB 3NEOA 3OXSB 3MZTA 3TU6A 1SEQH 3PHQB 2B5NA 1B9XA 3FBKA 4K23L 4R26L 2VLMD 1EJ6A 1JPSH 2AHIA 4XBEL 1P4BH 4MXVE 3AGVA 4LLVA 1TU2A 4LLUA 1FORH 4NRYB 4FABL 1BVNT 1MOEA 3WEXA 2HLFC 3TEYA 2BSRB 1DVFA 1ODAA 3D3VB 4N5EC 3QSKB 5HGBB 2R4RH 3RWFA 4XGZA 4S1SL 5IB3B 4IS6A 2DTMH 4KX9A 4ZW3A 1WFJA 3NUKA 1UH3A 2BXZA 2ZXDA 2TAAA 2AI0H 2FLMA 5JIIA 4R7XA 3K71A 4EVNB 3LKPB 4J0XA 4MMZB 2VRQA 4YEFA 3PUCA 4OD3L 3LSOA 1JGEA 3I3BA 1OAKL 1RURL 1QFWM 2PO6C 3TYGH 3S2CA 2PR4H 3O6LH 3P0VL 1NEPA 4H5JA 4FQPA 3GSNH 2XTJC 3D4ZA 2YEZB 2JKRM 3RDTA 2UV3A 2DM4A 1NC2B 1AZNA 3U36B 2WLLB 5DRNA 4NN6B 1N0LA 2DEXX 4Y2NA 5CS7A 3LN4B 4PJGA 5LXGL 5C3LD 1EZVY 1ECZA 3MACH 3MRMA 4MD4A 3V9CA 3A5VA 3HPLA 3VM5A 3TH3T 3UKRC 4X6FA 1YNKL 5LBGA 3NGBC 4LKCA 3RYMA 3ZLQC 3SZ6A 3QEQD 1F1GA 2MCMA 1D3CA 2HVJB 1WWWX 4ZMXA 5ESVB 4NS0A 3QRGL 1A0QH 3DVIA 1U8JA 4MAZA 5FOJA 3VQ1C 3UTTD 3IFOB 3IRPX 4N8PA 4JQVA 2HJFA 2RCSL 4AKOA 4UTAL 3LQAC 1HI6A 1NMCC 1J8HE 6TAAA 1EGJA 4NBYB 1I31A 4N2GA 1RK0B 5EN3A 1IQDB 5A7BA 5IW6B 4TSCL 1G0XA 3UADA 1OAZL 3TTYA 5GZNA 1AQDA 3OJDB 4YBHA 1NCGA 4OQTL 2F1BA 4FYTA 3E8UH 4RRPG 1MG3C 3L4TA 4PBWD 5BQ7B 5GRVK 2ZONA 1X9UA 1OGPA 2H0PA 5I26A 5KSUB 3SKOB 2Y07L 2D7NA 1M7DA 3VGZA 1DEEB 4MNQE 1TPXC 5HGAA 3V6ZB 1WVZA 3OXRA 2WVSA 4JRYB 2DQCL 2FQEA 4S1QL 4BYHA 12E8L 5DMGD 3U0PA 4KNUA 1AKPA 2EEBA 1CXEA 4TUJA 2ERJB 1IAOA 4J6RH 2YD1A 3WTTA 3LYRA 5EU3A 1NFIA 1ZE3C 2GQHA 2MOGA 1ZLWH 1NC4D 4H1LG 5EOQL 3NH7L 4GW1B 2QPSA 1OV8A 3OKLB 2BWQA 3S3JA 5AYUH 3TZVD 5C3IA 2WZPA 4XPGH 5DRXB 1UFUA 4GP5B 1BQHG 2XQYK 4DK6A 4N90E 1OANA 4KHTL 3HBPA 1MY7A 2RIKA 4NWTH 4CU7A 4YHMH 4BUQA 1QP1A 2IWKA 2ZG2A 4HETA 1KTDA 4N2DA 4GKZA 4AQZA 5LDSA 3BZ5A 5B38B 2R4SH 2MCPL 1KENH 5C70A 1S7VA 4P4RA 4L4TA 4R84A 1J1OH 5C1MB 3MV7A 1IKNA 3AABA 3CN2A 2ORBL 2BNQA 2X9WA 4AK2A 2VLKE 4GG8A 4X0KA 2J6WA 1J9QA 3DDGA 2VE6A 1OQOA 5MHSE 4HF5L 2G60H 3BCFA 1MJ8L 3QIUD 5KBMA 3U4EA 2IQ9L 4AGQA 2XPGA 3PF2A 3ULVH 4CVUA 1ZMYA 1KT2A 1T66C 2P5EA 4TN9A 1NCJA 2K78A 2HLAB 4JN1L 1IC7H 5FGBC 3V4UL 2L7EA 2NY5C 1ES0A 2NY2B 5CXCB 1QTPA 2EABA 5FCUL 2OSWA 3WTXA 1CMOA 4BFIB 2YXVA 5I28A 4Y2LA 1XIWD 4ZMYA 3KEDA 3WJMA 3B5GA 5KANI 1ZT1B 2QZPA 3CSPA 1IGJA 1SXZA 1MVUA 3FCSA 3RRMC 2F53D 4ZUTA 3L9BA 5ISZB 2P8LB 2BZ7A 4PJ5B 4HKBB 1BQSA 5A40E 4U6XB 4MAUL 1WUNT 1A4AA 4R0LA 4CW1A 3RFHA 3APNA 3UG4A 4WIQA 1PD6A 2XVBA 2B9AA 3KR3H 4JHBA 1T1ZB 1GZHA 4M61B 3O4LA 1HAWA 5PAZA 2HT3D 1U58B 1MJUL 4X5PA 5FKAB 4BXSV 4RLDA 4YSRA 1KCUL 4NCC1 3AITA 4NT6B 5C9JB 5ID0A 2BIMA 3PGDA 3FMGL 4KX8A 1BW8A 5TGBB 3RLSA 1C16B 3GMOA 1KIUB 3QFJB 3VNYA 2WKOA 1UH2A 4V1DD 5ECGA 4DEUA 5GS0H 2FRGP 4CVWA 5D9SA 3VXMB 1GW6A 1W0VA 3ARGB 1Z0NA 3PWJB 1M05A 2YJQA 3DUUA 3O6FA 3SDDC 4QYOB 4HPYL 4YL9A 4ACPA 3IIYA 3IGAB 2X2UA 3ZW3A 3O9WA 2UY6B 3PHOA 3TFKD 3EO9L 3C2AL 3C75H 4MAYB 3IDGA 2KI6A 3KJ4B 4LLQA 1NIEA 4WHCA 2F7QA 2YPLE 4I2XA 4BSWA 5IUCA 4PCSA 3AL8B 3GMNB 1MXDA 5IQ9B 3I7HA 5HHNA 5K9QI 3K6SB 5BV7H 4X6BB 4YHLH 4BD4A 1P6FA 4JFPB 1Z9LA 5KBPA 3UGEA 4I87A 4N2LA 3RPIA 4XAWH 5DQDL 4PRIA 2DWSA 2AQ1A 2FIKB 5DK0B 1AHWB 1U21A 4GAFB 1G0DA 5IB1A 2Y0SA 3CFSB 4IRSA 1L9TA 2HXAA 4YDJA 2YA2A 2HJLB 4G6AD 1BYPA 4TPRL 4PJCA 3V52H 3F7KA 5EBLB 3EZ8A 1RD6A 1QBLL 2DQIL 3U4KA 2PUQT 3S88L 3BPLB 4J3UA 4CI3A 2LFEA 3BD3A 1XD1A 1HILB 3IJEB 2NCEA 5GRZA 4AQAB 3RGVD 1CDUA 2R9HC 5SX5K 2XTLA 3KH3A 3WFBH 5DSCB 1R24A 4JKKA 3U6RA 2X42A 1J5HA 5J5EA 3CQFA 4YBLB 3OF6D 1XF5B 4HUCA 2ZWZA 4QTIL 5SWZB 1DBBH 3ETBF 5L4FA 4ILDA 3QUXA 4F57L 1T0NA 4GQ9L 4FA7B 2H2SC 2DDQL 1JS4A 3ARBD 1J0YA 1EJOL 4JL2A 4OD3H 4JR9H 4TTDD 2ADGB 1OAKH 1RURH 4F9LA 5FKPA 1A4KA 3P0VH 5ABAA 1MCWM 3DX9A 4ONHB 4PGBB 5FA5B 1VFMA 9PCYA 1E9PA 2C9VA 2NNRA 4ZFOL 4ZTOH 3ZGHA 1JTDB 2ZCKL 4NC4A 4QOKB 3ZUNC 5DUJA 3HMWL 4G9DB 5IBTL 3S34H 3ZHFA 2JV6A 5AZ2L 2DLGA 4X98A 5FO7B 1CBJA 1E5BA 1GYCA 2A1WH 3C5ZA 5AW1B 2X4UA 4TSBH 1BECA 1UXSB 1CLZH 1QWUA 2ZSVA 2J57G 3QYCA 4FP8L 4HGKC 4MGXA 4BDVB 3EH1A 3GC3B 2BVYA 2PWEA 3FUEA 2OSLB 1IBHA 1MJJB 3JUZA 5CYKA 3IPBA 3QEGH 4PYHA 1INEH 1FI8C 2A6IB 5JXEC 1JJUB 1TVHB 3QRGH 3DK2A 4N2HA 4XP6H 4X2UA 1X5MA 1JMZA 1HL8A 2RCSH 3MX0A 4KHXL 1USZA 3B7YA 5GXHA 1HSBA 2CA4A 1L0PA 2YD0A 3HCVA 4U05A 1R33A 3UYPB 2X89D 2B1HL 2JKLA 4YLBA 1NBYB 4KVNH 2CDFA 4TSCH 1X7TA 1OAZH 1SXCA 2FJGA 2B59B 3OF7A 2UYLA 1CD1A 5J1AA 1FZOB 5EEUA 4L1BA 1BGXH 4PTUA 2CN2A 4QHKI 3ABKB 4JQXC 4LGPB 3ZSSA 2N01B 2VMJA 1OB1B 4U1SA 2BJML 2Y07H 3MUNA 1UT1A 4A6YB 3L1FA 3CXHJ 5C0CB 3GZQA 1Z5LB 3CD4A 4EI6B 5I6OA 3VO0A 4HU8A 4GAYA 2DQCH 4RX4D 1Q72L 3EOAB 4S1QH 2NXYC 4JMXA 12E8H 4GLRI 3VGDA 2BKLA 5ECJE 5IBLD 3HB3B 3KWXA 1GIGL 4XCFH 1QLRB 4XMZA 4HJJH 2NUPB 4NI6A 3Q2LA 5F44A 4NWUH 1G84A 4WKZA 3NH7H 4MMYB 2RGSA 2WINA 3E3QC 1I2MB 4Y4KB 5MENE 4XNZB 5I1CH 2IH3B 3JQOB 1GP2B 1DVZA 4JVPA 2NMSA 3RQ3A 2PYEB 2NSXA 4GO9A 1Q9KB 3RPKA 4CY1A 2KLSA 1N26A 3G9AB 3S35X 4BE5A 3PAZA 4JFDE 1F56A 3FO2B 2WAHA 5F96L 1OSPL 4TV3A 2QR0A 3OAZH 1JFHA 2PO6A 3DOSA 4IIQB 4KJWD 1S4UX 4A2LA 1TZAA 1E5UI 2OMWA 3NYKA 3VFTA 2ORBH 3UO8B 2EYTA 1YEFL 4FERA 1CDIA 1KJVB 2ESVA 3Q8BA 3QK0A 5C0FB 2LAGB 5JHDB 2IQ9H 3QEUB 2F54B 3GK8H 5KW9H 2GBUA 3L5HA 1W72A 1ZHLA 3BGFB 4M7KL 1WEJH 5DJ6B 3H3BC 4UUJA 2IH8A 1NQBA 3NCBB 4E9TA 2X88A 5EC1A 3HE6B 2HJ4A 3FCGA 3HHSA 2Y6SD 3E6FB 5D7JC 5A2AA 3BIKB 3AU1A 4X6CE 3SYQA 4YHNA 4Y9FA 1B9KA 2ATAA 2D0FA 4XB8A 5CSZB 5C0EB 4O02H 4U3SA 3SQOL 1YG9A 5JNYA 2EEXA 3PHAA 3VB9A 4BH6A 2Y5TA 4BK8A 4YDIL 4JFOB 1EBPA 4PP2A 2WZ6A 3POHA 5I15L 3O4OC 2LR4A 5LN8A 5EMJB 3S36L 4HDIA 1IGYA 3ARWA 1I9IL 3BT0A 4Z7UA 2AEOA 3CGTA 1N4XL 1MG3A 2W0PA 5J13B 2XYBA 2VC2L 3EH3B 1Q9OB 1ZV5A 4N8CL 1ZLWK 4I9XA 1XSKA 2J71A 4K7PL 3NN8B 5HHVL 2WAQA 3UTSA 3W3BA 4KX7A 2QXVA 3LRSB 5EA0L 4K07A 2ZOKB 4X42A 2X2JA 3C2SA 5C7XL 3F7PC 3OQRA 3QUYD 3EO9H 3L4VA 3ZZ1A 2H9LA 3C2AH 1MVYA 4XXDB 2ZX5A 2FJFB 4W9JC 4WO4B 5TQ2H 3CTTA 4W6YB 1HINH 5HDRA 5B1JC 1NKGA 3CFCL 3QUMA 2SEBB 1WGVA 4JHAL 1JERA 2E8ZA 3RVXC 1CGYA 4XVOA 3FCTB 5D93B 3KXFA 4H8UA 4ZUVA 1A8JH 1XL4A 4LPWA 3QR0A 5DQDH 1XCQB 4KKLC 1F90L 2IAND 1ZSDB 3LZFL 1JOFA 2WY3B 1JMXB 2Q7AA 3RE0A 1RZJC 2EH8L 1IM3B 5IQMA 2ZUYA 2VLRA 1T3FA 4TPRH 4M3KB 3DSFH 1BMZA 5TDNB 4L2YA 4ABVA 4Y16C 3MO1B 1SHYB 2NNCA 3V5DA 4CI8A 2VERN 5JXAL 4H0GA 3WCYA 1CGWA 2NQCA 3S88H 1ZGLA 2IUPA 4HX1A 1MHHB 3TEZA 3MRKB 4Z7NA 3UAJD 2PCPA 1DZBA 1V7NL 1T0OA 1XF3A 2EDJA 2Y7NA 3MLSH 4P49A 4QR7A 4TVUA 1A4CA 4NO5B 1NGPH 5FGBA 5THAA 1UWEL 4QTIH 5CLXA 2P5WB 3VXRA 2CK0L 3ZRCC 5MEOB 4KY1L 4L1LA 2P7TB 1YEEL 1OGAA 5IW3A 3KL5A 3GXMA 1JV2B 2YAHA 4HMEA 1A1OB 1A7NH 5C08E 3TNMB 5HVHC 2VDNB 3MVSA 3SOBL 1BG9A 2NTFA 4JREB 4UCFA 3MLUL 2J8HA 3MRPB 2VDOB 3FTGA 3F58L 4WK2A 3BQUD 4F80A 2JFCA 3ZE1B 4CILA 1M2OA 2N7BA 2XV0A 5FHAL 3HMWH 4NN6C 3AMKA 3NPSB 3OQ3B 1NGXA 3CN1A 1MI5E 3X3FH 4BIKA 5D7LB 4NC1C 3P4LA 4WO0A 5DA0B 2APTA 2YAQA 3EGSB 4PY7B 4XAKE 5D7KD 4Z1PA 4FXKB 4FP8H 5E2UL 5IY5B 1HJCA 1GPOL 3ORJA 1ZVHA 2WVTA 4CI2A 2JCCB 4LRIC 4D9QE 4PC0A 1VZHA 4FA1D 2ZE0A 3SDAB 3X14A 3ULVD 4N2FA 1BZ7A 1JWUB 2H3XC 4Y1TA 2XETA 3KLKA 5L7XH 2A99A 2MFNA 4ABWA 1U8PB 2EAEA 2V37A 4OF5A 3IULA 3IAGC 3HAEB 4QMEA 1FV1B 3OVUB 1MUJA 1Z3RA 4RCAA 3L8QA 3O41A 3PDOB 1MAML 4L8BB 5HYJD 1OIOA 4QEGA 2ZCLH 2Q7YB 3TV8A 3MV8D 2XKNA 1BPVA 4WLCA 4BFJA 2A9CA 3EO1A 2B1HH 3FO1A 3O6ML 1ADQA 1MW3A 3C60C 4J3OG 1SY6A 5IMKA 3U2IA 4K4KA 3P4NA 5E7FA 4WI2A 1KPRA 1Q1PA 3ABGA 1MRCH 2VXVH 3C9NA 2H32H 1W0WA 3HG4A 4KJYA 4UYQA 1U2VC 4L9OA 2YD3A 4YO0A 5A6IA 3VXSD 5BXFB 1REIA 2X10A 2E4FA 4X6DE 4RSVA 3BE1L 1QHQA 2OMVB 1QSEB 3INOA 5J6GB 4U6YB 1AD0B 3CVHB 3O0LA 1Q72H 3H0TB 4MD5B 1S9YA 3DVNA 4U1JA 1TXKA 4UF7C 4RFOL 2MCAA 3HZYB 3STZA 5GS0D 4J3XA 2WN2A 5IVOA 5JHLL 1BXXA 1NJ9A 3IDJB 4OZIE 4LIQH 1U8OA 3GXTA 2X5PA 3N5AA 4KTDH 5C6WH 2MKLC 1WISA 5IVXA 2B3RA 5KSBE 1OGTA 4DPCX 3QGVA 4YDZA 1FHNA 8FABA 3H1ZA 4QHLB 2VN5A 1MWAL 4DZBB 5KYXB 2CNYA 2FLRT 3MRDB 1IMHC 4NOBA 4N2MA 5EO0A 2P42B 4O2FA 5FYKE 2WXFA 4QRJA 2Z35A 1AGDB 5EWIL 3ILDA 2UXVA 5CN2A 4UU9B 5F96H 1OSPH 4ERQA 2YA1A 1AZUA 1E9QB 2A9DA 3MHZA 4Z7WB 4PJ7F 4NHCL 2OCFD 2X1XR 4HKJA 3FUDA 4P9HC 3U48A 2GJ6E 4BM7A 1ZHBB 2WVVA 1ACYL 4XWGH 1C8PA 3ASNB 3NZ8A 1MN4A 3LIZL 3SE9L 4Y0GA 1YEFH 4LHQB 1D9KB 4XCNB 5FGRA 4FQXC 3QW9A 4X9HA 5FYLH 5I5IA 1FN4B 4BZ2A 5FF6B 3G08A 3US0A 1T1WA 2BLFA 1CBVL 4P3DA 4U6HB 4XTRD 3L3HA 2DRUA 4LLAA 4X8GA 2NY2C 4NZUL 4P2QD 3TIDB 5I18L 3TH2T 4XCCH 5IWLC 1X9QA 1WRFA 3QDJD 4HV8B 1NFDB 1A9EA 3DO4A 5I0ZA 5JXEA 5JR1H 4AIEA 2CGRH 2XX0A 2QC5A 2QDVA 2E0PA 2XA8H 4PP1D 3WNPA 2WXNA 1G7MA 3SQOH 2O5ZL 5FECA 3MV9E 2P24B 4EOWL 4P23B 4W9GC 3ZDZB 1FL5B 1H8SA 2OVQB 5FUOL 5EAMA 3QQ3A 2ZUQB 3ZU8A 5I15H 2GTQA 5DHXB 3FT3A 5ICXA 1BQ5A 1GGCH 3L3DB 4K8RC 4P2RA 5AVYB 4YXKL 5I6MA 1TZHA 3S36H 1YPZB 3CSYA 3O4JA 5AZEL 4NQVB 1I7UA 1G6RH 1N4XH 5KWYC 5M5UA 4JQXA 4U7SA 2W5PA 2VC2H 2XSKA 3KYMB 4PG9B 1HU8A 2VR6A 4N8CH 2CDEB 3Q01A 2W65B 3GJFB 4K7PH 3TX4A 2DZEA 3D3VE 5HYFA 1GZQB 4GRLC 2YZ1A 3DGGB 3NIDE 1C1EL 4KO5A 2YQ2A 4IEFA 5E1IA 5C7XH 2BBKH 1XGTB 3MNDA 3BP7B 2WBJD 2GJZA 5KBKA 5HYNB 1NAKL 3ZE0B 3KJ4C 3KPLB 4BFRA 4EE2A 4EI5C 2FYYB 5C2BH 3Q1SL 5IGQA 1QFWL 4F33B 5IEKB 4JPKH 4JHAH 5DQJA 3BSHA 3TLRA 1MZYA 3N41B 1MW0A 1E3FA 1LK2A 1RUML 2HZHA 2NYYD 4H5SA 2ITFA 2I7OA 2Z31B 3Q05A 2P43B 4KK5D 4JRXD 1FO0A 3H56A 1XGUB 1AHWC 2CLZA 2JKIS 4Z3EA 3QYNA 1JRHI 2L7QA 3OBAA 3GHEL 3ZYJA 3NCCB 4JKPL 3B9VA 3ABLB 4Y5VB 3LKNB 4N2NA 4QY8A 2Z7ZA 3PLYA 1L9PA 4FFWC 3C5SB 4G1EB 4R7VA 5FLUA 5B22A 3BPLC 4LLYB 5JXAH 3DARA 4H2CA 2QQLL 4TL5A 2HT2D 2NW2A 3WDHA 4BH7A 4TQIA 3HLAA 2X3BA 3ROOB 1FWXA 4JGNA 1DCEA 1YO4A 3Q48A 3DX8B 1TNMA 1V7NH 3MMEB 2H26A 4XX5A 2G9KA 2VH5H 4NOFA 1XGQB 3QXAA 1JN6B 4R3SB 3EUDA 2PBIB 3MA9L 4KK8D 4HIQA 3UTTB 4KY1H 5EU7E 1SMAA 3OG6B 3RVTD 2CGYA 1QD0A 4X9BA 4PGCA 1I9RH 1CF1A 1ONQB 1XBRA 1UD2A 2D4DA 2GIYA 3GWJA 5D7JA 5B8CC 3JZGA 1T5XB 4KH2A 5F9WB 1A6TA 3SOBH 5FFLA 2P8MA 3MLUH 3GJEA 3OKOB 1DBML 5F3HA 3UTOA 3NK4A 5BS0D 4W9EC 2DJUA 3F12A 5FHAH 1UQSA 4EZLA 4LSQH 5DJXA 3PE7A 2CA3A 1Y07A 2ITDB 1I8LC 2CU9A 3WOVA 5C2UB 2X2IA 5DRWA 3FSWA 1KBGL 1OOWA 4MRBA 3FB8A 1WBYA 2AQNA 2V9TA 1GPOH 1PD0A 3K0YA 1ZV9A 4X3EA 3RWCA 2BCKA 1CE6A 2E7BA 4H88L 2PM9A 4MWFA 3QI9D 3DIFB 3RWGB 3TO2B 3M1BB 2BIHA 1I3UA 2VQ1B 4BCYA 2FWLB 5JOEA 1Q38A 3KDMA 3ZYIA 5CGBA 1VEPA 3V4PH 4IOFC 4GZ8A 1LGVA 3V5KB 4JPQA 4AMWA 1SM3L 1GR7A 4G9FD 4PJEF 5CM1A 4ZNEA 1NGZA 5TF1H 5C07E 1MAMH 3MUGB 1IO4C 2GFBA 3WXWL 2H1PL 4CY3A 1FYTA 4LLWB 3O6MH 4F7PA 4ANWA 3GYRA 2DWEB 2OK6A 2YMXL 5D70L 5DEZA 1JBJA 3EJZC 5C0AE 3OXSA 4HK3J 4MB1A 1UYWL 4ACTA 1ZT4B 2JB5L 3WHE1 3EYQD 3O3DA 1KLFB 1IFHH 2NR6C 3L3GB 4ZG1A 3QIUB 1F5WA 2BHYA 3LRGA 4Y16A 3LPWA 4TZ4A 2HKAA 3WKMH 3IKCB 4RFOH 1IL1A 4EDWL 3U25A 5HP5A 2BSRA 2EECA 2YPVL 3THML 2H9MA 2NX5E 4PRPD 2Y4SA 4BZYA 4MKTA 1DQLL 3BWSA 2L3BA 3P9LB 5IB3A 4XNZC 2GIMA 3CNKA 2HMIC 1JPGA 2DICA 5E8NA 1NL0L 1P9MC 5F2FA 1BBDL 3BWAB 3G04A 3O45B 4PJ5E 3LKPA 2YUZA 1UD3A 2IOMA 3BXNA 1CURA 4GOSA 2A83B 1KJMA 5EWIH 3B9KB 2KPNA 43CAA 4DZ8B 2HH0L 4N24A 4BUHA 1SLXA 1JWMB 3Q5YA 2VDQB 2D7MA 2X4NA 2O5XH 4MA1B 3U4AA 3S5ZA 5HDBA 2OL3B 5I6NA 1AJ7H 3QDMA 1ACYH 4ADJA 4BHUA 4E9QA 3CFKB 4GBXD 3TH4T 4ZI8A 1ECYA 2VLLB 1NC2A 4QHMA 2Y7QB 3A4EA 2OCJA 1FFNB 2I32A 4JUTA 4EKJA 1DTUA 4FFYL 5F0PB 2D8KA 2DM7A 3BC9A 4MLIA 4V1DB 1UGNA 2DQ6A 3HNVL 3MJ8B 1CBVH 3Q13A 5DYFA 4Y1SA 2BWDA 1LE9B 4FG6C 4HWBA 3LEXA 4NZUH 2HTKC 4XVSL 1EXHA 4X99A 3IMRA 3KWVA 2IDFA 1MKFA 4KO9A 4LRIA 3AL9A 2VXUL 3PWVA 4QXTA 5J6HB 3HFML 4J81A 4DQAA 2H3XA 4QHUB 2RR3A 2C4XA 2NY4B 3HE6C 5IK3B 5EDXA 2WMPB 3PXJA 4NQEB 3ESNA 1UCBH 3IFOA 3TL5A 3MTRA 5LBSH 1QEXA 4NP4L 5E9DE 1LM8V 1Y6NR 2O5ZH 2AXGB 5CJ8A 4PRHB 3FQRB 1F8TH 1THCA 3RP1A 3RUGA 1OAUH 5FUOH 5HJ3B 3C60A 3KPMA 3VM7A 4FAND 5A2LH 4G2AA 1AO7B 4J79A 1J48A 2N4IA 2XTSA 3IKOA 1RLBA 1AFVH 5AVSB 2A73B 2LTQB 3I6KA 1CB4A 5F6HJ 1QFMA 1FZKB 5DEGB 2H5UA 3MRNA 1L9MA 5G5DB 1BD2A 5EIQA 5I1EL 4H13C 5KYYB 1Q0EA 2PETA 1IC4H 4JRYA 4P46D 1UOQA 1ED3A 2JCWA 3WN6A 3RGVB 2V7NA 3K91A 4DKTA 4KV5F 3S5LB 5M5TA 3EJSA 1OE1A 1MWOA 2V0AA 4GXVL 2IQAB 5FA3B 1J0ZA 4IGBD 4JAMB 4BKSC 2X70A 4EN2A 1NAKH 2ICEC 2OJEB 5H17A 5D2LF 4OJFL 3W2DL 4GW1A 4KJPD 4A11B 2XWBB 4N2IA 4KTGA 2R69L 3B7RL 3Q1SH 1QFWH 3QXUA 4OZ4A 4BQCA 3MLVL 3ARBB 3D9AL 1L4IA 2I07A 1J8KA 1KLGB 3I9GH 3M17B 1AKJB 1X5GA 1QNZL 2EO1A 3WKPA 4HHAB 3CN3A 4NQSA 3ZL2A 2X1PA 4KI5F 4QOKE 3RWEA 4OM0L 4JKPH 1H15B 1P5VA 5FW7A 1H3PL 2XUWA 1JE6A 4M7LT 1J1PL 3ECWA 3MRBA 4HIPA 3BKJH 3X1EA 1Q47A 1TCRB 4M1DH 5AB9A 3TEXA 1T22B 3BUTA 5CU9A 4FQXA 3S97C 3LD8B 1VSCA 4AV5A 2J73A 4XNUL 5I76B 4JLRB 3KPQA 2NTSP 4XH2B 2H9PA 4FCHA 1BP3B 1ZS8A 4D0CB 2F5BL 4PVBA 3BDBA 5CXCA 1XEDA 4BFIA 4MJ6A 1HVXA 4U49A 2COVD 2I69A 4N2CA 3EAKA 1NCAL 4RAHA 4LPVA 4WUUA 1XB3A 4M7JH 4PB0L 1A7RH 1L7IH 2HX9A 2VABB 5K59F 3VGAB 3IWVA 3TNNB 3T1FB 3B2XA 1FFRA 5ISZA 1WYJA 3EOBB 1SLUA 1Z9OA 4U6XA 5F7AA 5KZCB 1DBMH 3RA7H 2YD6A 5EIIB 4X4YB 2D0GA 3ZSTA 3CZJA 2VDRA 2P8PB 2APBA 2HJBA 3LRMA 1YUHB 3GMMA 4A37A 3FT4B 4PJAA 4NO2A 4HOXA 5FKAA 4Z3IA 2VQ4A 4PJFE 5C9JA 2IDTA 1MFAL 3QQDB 1S78D 4FXKC 3RDJA 1I1FB 5T8IA 2AGJL 1E40A 4YXLL 1E4HA 2ZP8A 3KJ6H 2R2BB 1JK9A 1YLBB 2MHAA 3DX6B 4H88H 1MPAL 5I71B 1VGKB 4Z7IA 1E6OL 2G4GA 3AGWA 3PWJA 2B3IA 3SDXA 4LPCA 1UD8A 1HHJB 1IBDA 4LVEA 5JZ7D 3NAAL 1IGCH 4OFYD 3ZMNA 4GRLA 4TQPA 2DB8A 4KRLB 4U1HB 4PREA 4YDLB 2XL3A 3NSFA 3L54A 3WXWH 1BWMA 2X1QA 5I9QB 2CHXA 4PJXF 4EI5A 4LSPH 1JHLL 3DPBA 4FG4A 4NNXA 2IBZX 3AL8A 2NNAB 3N6YA 4P4KD 2P80A 3V8CA 1RJYB 4F3FB 3RX7A 5KUKA 2CQVA 1HYSC 1WJ3A 5D70H 4FQQB 5EZIL 1DQML 3FQNA 2IGLA 3WDJA 5DK0A 5HQGA 1AHWA 4XP4L 1UYWH 4GRMB 2HTLD 2JB5H 2I27N 4B9FA 4E9VA 2HJLA 2ARJA 4PAZA 1N67A 3GO1L 4AQ1B 3X13A 1KJ2H 4PLKD 5EBLA 3GREA 4NAQA 2D03L 3ULUE 3TWCL 1AGEA 1PZ5B 4KO7A 3QNXB 3T0ED 1EX0A 2AV7B 4JPIB 5DJ8B 3VWJD 4EDWH 1V55B 4HUMB 1ETA1 4P2OC 3ZGIA 4AQAA 4ZN4A 3VH8B 2YPVH 3THMH 3FCUB 5DSCA 1T7WA 3WS3A 4OD1L 3VCLB 4MCZA 5IKCA 1XQ4A 4PV9A 3QQXA 5FYJE 4NKIH 1NL0H 3IU3B 1BBDH 1XF5A 4KXZI 2NDFA 4JGMA 5HGDB 3GXFA 3T4AB 1PX4A 3TO4D 1XGPA 3KLAA 3UC2A 4YDKL 4FTVA 4S0SD 3UIYA 4RSYA 3B7UX 4YLCA 2ZQKA 4O2WA 5H1MA 5B8CA 5KJ4A 5SWSD 3V6OC 3QE5A 4PGBA 4U1LA 4W1TA 4I18C 2LV4A 3HZ3A 2A6JB 2F7IA 2X12A 1FZJA 3GSNB 4NSKA 4XPHL 4YR6B 3S36X 3VRLE 4DGYH 1B4JH 3PP4H 4G9DA 3VH0A 4O9DA 1A47A 2VUYA 4X7TB 1QASA 2VXQL 5ITBH 3I6LE 4XI5D 2JKXA 4N28A 1I8LA 3IF1B 1H3WM 4K7PX 4BQ9A 5FEBA 3HNVH 5E8OA 2FDBP 2V17H 1MEXL 3PXSD 3QDGD 1V8HA 3BFQG 4KRMB 4YSAA 4XVSH 5HPMA 1DQTA 4P99A 4Y4FD 5EEXA 2VXUH 2OMUB 2OSLA 1S7SB 2WXLA 3NSXA 2DQTL 2ZX7A 1ET8A 3QUYB 3ATBA 1W2KT 4QRPD 5EZOL 3TN0D 4FNUA 1FNEB 1JJUA 1TVHA 3I9IA 3PWPD 4R9HA 3D2UB 5DWUL 4FXLA 5B3NA 1EDHA 2X53A 2BVOB 3DVGA 3QUZB 4OCLC 3BISA 5EHFA 2ITEA 3SGDI 5KN5A 3PGCA 2GEQA 1S7RB 1UOPA 1AC0A 3V9EA 4P23C 1G5GA 2QADD 4XNMB 4I5BA 1MELA 5HDQL 3HC2A 2ZUQC 1PBYB 5D1QD 2CDGB 1BVKB 1U93A 4F7EA 2FBJH 4UT7H 3N1FC 3W9DB 4FQLL 2IALA 4JFED 1IC1A 2XN9B 3L5IA 1ET5A 4IKNA 4G7YL 1AGCB 1SHSA 4OBRA 3NIGB 4A6YA 5C0CA 1GOFA 5AVQB 4H8WL 5LLIC 5AVWB 1U2HA 1LO0H 2A4EA 2IIJA 1JZ6A 2NR6A 3EOAA 1MCRA 5ANHA 2HT4D 2XICA 4DN3H 1XR8B 1JDAA 4PRBB 1R5IA 3EI3A 2XBTA 4EJ1C 1RP9A 4HKXB 2MNWA 2P5WE 3OJMB 4KQ3H 2I5YL 3HRPA 5ELIA 4OJFH 3W2DH 4AVKA 4HAFA 1I8KB 4ISVB 2R69H 3G6AB 4HIIA 2GB2A 4W70A 2DY2A 3MAWA 5DCCA 2BW5A 3Q06A 3D9AH 4IBLT 4X5QA 1KV7A 3ZDYF 4K0OA 2VDLL 4M62L 2FHFA 2PYEA 4LHUB 4O5LH 1M1SA 5DXWA 1WAAE 4Z5RA 1A7BA 3V0WH 5DVPA 4LVNB 2P52A 5AFAA 4TLUA 1FZMA 4L29A 3ZE1E 2E7LC 1CFNA 4GNKB 4CSTA 3BQUB 1FVCB 4PMEA 5IJ7E 2BOCB 3QJUB 2VDKB 3LB6D 2VAAB 4EF3A 1SJVA 2VN6A 3SBRA 1NSNL 2AAAA 1IVTA 5E8DH 3ZBMA 5I1AA 4HA1A 5L8JB 5BZXA 3DV6A 2JCCE 4N9GB 4TNGA 4N1EA 2XOTA 5JHDA 1P4LB 2F54A 2IPKB 1A7PH 2HG5B 2P5EE 2ZP9A 2BMKA 1KMGA 4E5ZA 2IWEA 3HG0A 1A6WL 1QLEL 3UGXA 4B50A 2WQAA 1IT9H 5DJ6A 2Z0UA 4G8GD 4MYPA 5IHZA 5J1SC 2YRPA 2XU7A 3LN9A 1FBIL 1T03L 4QT8A 5DC0A 1OKEA 1A6VH 1QSFA 3D50A 4JO8A 4PB0H 4UM8A 1N6VA 2GNQA 3IUQA 1JTPA 4GUPB 3MV8B 1P1ZB 3SY0A 3QH3B 3VFSA 3DM0A 2LU7A 4BH8B 5TK4A 4GQ2P 4NJAL 2QKIB 3T3PF 1HNFA 3GZOA 5FUZH 1IBFA 4UIKH 3U1SH 1EAOA 2R83A 3GMRB 1NDMB 1I8UA 4DPAX 4JFOA 4NLHA 5L4IA 3VXSB 4R90L 1QSEE 1ESOA 2WTOA 3SD2A 2BW4A 2OLDA 4F2MB 4OF7A 1BSIA 4WFGE 1S7UB 3WLBA 2AGJH 3FPYA 3EYFA 4LF3A 2RFXA 5DMGC 1Q9OA 5EEVA 1MPAH 1RU9L 3QZNA 1E6OH 2ZOTA 2PN5A 3NN8A 4XMLH 4O9HL 3P4MB 3NZHL 5FYKU 5CIPA 4G6FD 2QL1A 2ADYA 3DIVA 4K5PA 4HHGA 4KWUA 3TZVC 3II3A 4QLRA 2Z8VC 2JMRA 2PWHA 5IJKC 4XXDA 3SYCA 2FJFA 2ICEA 1LMIA 5D1XB 1OF0A 4FG0A 4B7IA 3DX7A 2AXJA 1T1YB 4QO1B 3U7YH 2SEBA 2VW6A 5DO2D 2M83A 5T1MB 2CKNA 2QVKA 1PY0A 4Z7WE 3WGUB 3LKOB 5BV7B 3V55A 3GDBA 2E86A 1UJ3B 3MLYL 3L4UA 4W9CC 1U6AL 1E8MA 1JMXA 3OR6A 4ELKA 1ILSA 4YUEL 3M1OA 2JB6B 3TWYA 4PJHF 1F6FB 3GO1H 4QRTA 3GMLB 3QIUC 4L1SA 2W0KA 3HMXA 3MO1A 2D03H 4WWID 1DQKA 1TLKA 1DJSA 3GIZL 1MCQA 3QXWA 3ODTA 2ZSWB 4A2MA 1HHIB 5EARA 3MRKA 4I3GA 3CHPA 1FIEA 3JUYA 2GY7B 1XIWC 3EBGA 5IOPA 5AYQA 1J0HA 3MREB 1T7XA 4NO5A 4R7DB 3F7RA 4J3SA 2XE4A 2H0JA 2QVFB 4R97B 4DERA 4XNQB 1N19A 4IM8A 2C8NA 1INDH 1BQUA 3ZDZE 2XXMB 1NEUA 4P05A 1NLDH 4WGWB 1DJGA 3R4RA 1XCTB 4MA1C 2OSYA 5J89A 2HT3C 4K3EH 2OZ4L 5KTEL 3RI5F 3MRPA 2VERA 1N12A 4FYSA 2JLLA 1AXIB 3P9WB 3SBWC 1A4JB 3OJVC 4ICWA 1VZ3A 4RGND 2C9SA 4CGUB 3R19A 3RY5A 6CGTA 1RPUA 2X6AA 2AK1L 1U2YA 3GM0A 3KPRA 3SB3A 5I1HL 2BHZA 5DS1A 1FNHA 2J3SA 4FXKA 2ADJA 3IXTA 1MEXH 3MKSB 1UHVA 1P5UB 3MCLL 1F00I 4CZVA 3ARTA 5EZLB 4NZ8A 4X5XA 2ZD0A 3V0HA 5HHPB 3HVDA 2DQTH 3TFKC 5AG9A 3ZE0E 4M3JA 2EYRA 4V2CB 4J28A 2ED9A 5DWUH 3S4SB 2VZVA 3I7NA 5AW7B 2EDRA 5HHQA 3ME0A 4ETYA 1A5FL 3MBED 4J73A 2VO5A 3L7EB 4FQJL 2G5BB 2X0VA 3PDOA 5L2KD 3RB5A 1EEYA 2PW1B 4JJ5A 4JHVA 5JHMA 4GS7B 2GCYB 4KZDL 2E9GA 1MCDA 2MEJB 5I6LA 4TQ8A 5TE7L 3ULAB 2YLHA 2CR3A 3DJTA 4JRXB 5HDQH 2WJ7A 3TBSB 5JIMA 1JFQL 2P46B 4IMLA 1W0YT 1JXFA 5F3BB 2FE0A 4G6AC 4UQEA 4AUUA 3FSZA 5DT1L 2LTQC 4GO6B 5AAWC 1NLBL 3P9MB 4XO5A 3VFUB 3BWZA 5GHWL 1L3NA 1UKTA 3KYOA 4H8WH 4ATWA 4U6YA 1R5MA 3L2NA 3CVHA 3KBPA 2BZCA 2PWFA 4ZK8A 2VKXA 3LKRB 1GMEA 4UM9D 3VI4F 2HUHA 3OLGA 4G59C 1DBJH 4M03A 4YSQA 2DEYX 5FK9B 4OCNC 4NPYB 1BPOA 2E8YA 4TSAL 3EGXB 4P2OA 3CUPB 1D6VH 2I5YH 3AQDA 3JPXA 3MYJB 4GKSA 4NZTL 3AUWB 4KK6D 3S3SA 4E5XA 1N3NA 4RAVA 4HIJA 3ESMA 5DJDA 2NUTA 4HWZB 4E41D 3ARBC 1U8HB 4C4UA 1W80A 4N0FA 3EOTL 4TTDC 4BWUA 4OV5B 2GEEA 3VA6A 5CUSH 4M62H 5EU6A 3A6OA 4MCYB 2P47B 2C9AA 3BZEB 3UYOD 2AP2A 2C3XA 2ZYHA 1MF2L 2K9FB 1P7KA 4ALAC 4UU9A 1WDAA 4QI3A 5BS0B 1DDHA 1RHFA 4Y88A 1E9QA 4ODWA 2AK4D 5FO9A 3TPKA 4IU2B 3V6OA 1UWFA 4I18A 1QUPA 1ZHBA 4MJHA 2WB1A 1X5KA 5FA4B 1NSNH 2WXQA 5HJBA 2NNXA 3DI2B 2RA1A 4MYWB 5GSRB 2H6OA 4CZXA 4GW5A 1Q9LB 4ZUSA 1PSKL 2XVKA 4YVUA 3LD8C 3BP4A 3MXVL 5HTSA 4BFGA 1WICA 2PWGA 4EZJA 1GY1A 1U3HB 3FU0A 4FXTA 5C2WB 1H6EA 4KZ0A 2G4EA 5HE1B 3PL6D 3NEXA 1SFDA 3QO1B 3QI9B 4BFFA 1CDCA 3TIDA 3RWHB 2V2TA 4PJ8D 3QJRB 2YNPA 1HAUA 2ATPB 3GS0A 5FKSA 2D9CA 2IFFH 3K2UL 3ARED 4G9FB 4HOMA 1E0OB 2Z8RA 2CJSA 4PH8A 4DKFL 5JUEL 4W81A 2P9KC 4I89A 4Z78B 1NFDA 5BZWA 5E5MA 3WHE0 2X4TA 3EW3B 3VGAC 2P9NC 3OKMB 4ODTL 2IBZY 4E9YA 4NJAH 4Y5XB 1MREL 5ESAA 4K94H 4OZHF 2JJSC 3JRPA 2DN7A 4O02B 3P0YL 1RZGB 4P23A 5C0DB 2HSIA 4XZUB 3FOMA 1S7WA 1C9IA 2CLVA 3VTTA 4F2FA 4BA8A 2X6VA 3BO8B 4HCRL 1HQRB 4LE8A 4AC2A 2A6KB 5HHMD 1YEDB 4Q56A 2C7FA 1E3XA 3MROB 4Z7UE 3RHWK 3UERA 2XWDA 4H8HA 3CFVA 4P06A 3UMNA 5IBLC 4TULL 1AGBB 5I71C 1RU9H 3GXNA 3W0WA 1TG8A 1N64L 3FTZA 1JGDB 1I1CA 1GZQA 4U1IA 4FA6A 3DGGA 5FOBB 1MFEL 1B0IA 1RZFL 2LLNA 5BOJA 3IIWA 3JV4B 5HDOA 3E2HB 3QQ9D 2BP0A 3BQVA 5D7SL 2JVUA 1XGRB 5I9QC 1JDCA 1P4UA 2ZF8A 4LCUA 3Q2NA 2YN5A 1PZ2A 4ZFFB 1LP9F 1ACCA 2W9EH 4KJWC 2QPFA 3H2WA 1C7SA 2ZWSA 3R8QA 4RBPH 2Q7QA 3TGXA 4MJ5A 1U6AH 4PGEA 2E7LA 4NQXB 3GMQB 3UZEC 4AMXA 4YFLF 3ZKSD 2BK8A 3F3HA 4U4BA 2O5YH 4LGRB 4W9KC 4AQEA 4LLYA 3GIZH 2WQ8A 4K7PY 1DSWA 5TFSL 3OKYB 5FGSA 5D7HA 4IOIB 1GGIL 1MZZA 4G1MB 2I9LB 3FTVA 3UJTL 4DH2A 4URTB 3VXUD 2W59A 4Z7NE 3UKUC 5LGJA 2F15A 1VYHC 3MMEA 3K72B 5I74B 3QEQA 1H3GA 4E68A 4HU2A 3NJHA 1XGQA 2Y36L 2J55A 4NQEE 3U4BL 1O7SA 2JK5A 2R1WA 1F1AA 2Y6SC 4XP9H 4YSUA 5F3FA 1LK3L 2DLIA 4YHKL 1PNCA 1NCWL 4QHKJ 2IG2L 3HKZA 3SDCD 1LEIA 4NN5C 4TNEA 2H8PB 4PRHE 2NPLX 1ONQA 4YS4A 2AZUA 1R3HB 3F04A 1AZVA 1CLVA 4CN6A 1CXLA 1T5XA 5TPWH 4O3TB 3RMZD 3FOLB 3IS1X 4DK5A 2GHWB 5KTEH 4MFHA 1AO7E 3OKOA 4A66A 3DA0A 1UUNA 4HZ1A 5FM8A 3PXWD 3ZTNH 3QRFM 1IBZA 4H5IA 3UXFA 4JFFE 2KL6A 5IMLA 4LGNA 1TSHA 5HI5D 5E08L 3INUH 3DETD 4WDIB 1F86A 5I1HH 5IUSA 3IUMA 4LKXB 4YSCA 1UT9A 5CEYB 4RZKA 4FFZA 4P46B 3MGOA 3NJIA 3CPLB 3MCLH 3QCTL 1S9WA 1RULH 3FTUA 4YDNA 4K3HA 5DFWH 1ZLEA 2XRAH 1URZA 1XSIA 4KVCH 3TO2A 3NESA 3F3PA 1D5IL 1T89C 2J6EA 2VQ1A 3DV4A 2F08A 1KIRB 3D6GA 3RTQD 1NC4A 2VM4A 1I7ZA 1N8ZB 4OGXH 4KDWA 4JFQB 5AW4B 3B9DA 1T21B 2EDYA 2XFGB 3HC4L 4OZFA 1A6ZB 1K9TA 4XBGB 3TZVA 5EEZA 3X12B 3MCYA 1LYQA 5IJKA 1KTBA 1A2YB 3CC5A 2VQTA 5LVEA 5GS1B 2HVKB 3DX2A 1ZA3B 4BV1A 1M57B 2EUVA 5E8PB 5BVJA 1AG0A 1JFQH 1RHHB 3GNML 3CLWA 4L3ED 5GS3A 2F18A 2F0CA 2J5WA 1S6NA 2JIXB 5J4MA 4X9GA 1MDAH 3DDUA 4FULA 4YVDA 4YFEA 5JDSB 5EUOB 5DT1H 1UXLA 5ETUB 3KHOA 2XU9A 4PRNB 3MXXA 2H32B 1ZT4A 4JDVB 3V8OA 5J11B 5GHWH 2ALAA 5GJTH 2V33A 4YGVB 4Q52A 5DI8B 4JFXA 3HE7D 3W9EB 3L3GA 2ADIA 2N0KA 3IXAB 3QIUA 3VACA 1FVDB 3RX5A 3UAJC 4AYFB 3VW3L 1BMWA 1M7UA 3DX3A 3EJCA 2ARJQ 5EOTB 2DLFH 3NVXA 2X7LB 1YC7A 3EBAA 1QRND 1SEBB 3MOBH 1SVCP 1XF2B 1XIWA 5IVXE 2MQGA 3HS8A 4R4FL 2ICCA 4P5MA 4DW2L 4EBQL 1ND0B 1MFUA 3B2UD 4PJBF 5ALCL 1T7ZA 5L88L 3KVDD 3RKDD 1SJXA 2F5AL 4CRPA 2F53A 4DNVA 2Z2NA 4WGKA 1CGTA 5IR1B 3F65A 3BQUC 5HE3B 1V3KA 2HRLA 3GIVB 4NYLA 2DAVA 3WFEL 2OL3A 2NY6D 1XB8A 5AZUA 2OTWB 3VI3F 3QZWA 4UI9R 3OD3A 3CFKA 3SBWA 2NY0B 1GS8A 3EYUL 3VXPB 1KPVB 3ZE2B 3QRBA 5IVNA 1SBSH 4QHNB 5EF3A 2D7TH 1EHAA 4D0KA 2FVNA 3ULVC 3KPNA 3P3TA 1LE9A 3EI4A 4ZOAA 1D7FA 4U6VH 3GRWL 3D08A 1O6TA 4UV4L 4TUUA 1HH9B 1HFUA 5DVMA 1EA9C 1A7OH 2D0HA 1UATA 4ZFGL 4MA7H 1W8NA 2VCOA 5J6HA 4WV1C 3Q3GA 4A55A 2P9LC 4LAQL 4DKFH 1TR7A 1GHFL 2HRGA 3OKDB 5DDHB 1E2WA 4AM0B 5F7BA 5FYKL 3DO7A 1QO3A 4JJOA 4A08B 3QJFB 2YQGA 1AR1B 4JHZA 3E0GA 1PG7W 4ODTH 1ZAGA 2QKIC 4P4KB 3WO4B 2AV1A 2WUBL 2YHGA 1O6VA 1TEFA 2CJTA 3UVNA 4NNPH 5EU4B 4D7BA 3WEBA 2AJZA 5HJ3A 5LKNA 2R2EA 4HXBH 1GGTA 3GRGA 5LGHL 3VFVB 4HCRH 1RKRA 2AW2A 1EK3A 2UY7A 3BFWA 3I6SA 5FXCH 3PJNA 5GIRB 2DBLH 4PBDA 2UZIL 3GM8A 1SOKA 5AAWA 1G6RB 2O6FA 1TJMA 5FYJU 4TVPE 5D4IA 5G5DA 2VC2B 1CL7I 3T0EB 3WIHA 2ZUSA 2BVUA 4F8OA 5GS0C 1BZ9B 1KELH 4HD5A 3TT3H 3VWJB 3HUJF 4WCYL 3CFDB 4XMKL 1D6EA 1LO5B 3AW5A 5DMIH 1BMGA 3JVFC 3NJNA 5FA3A 2ATKB 2CKBH 2CR0A 5D7SH 8PAZA 4EUPH 5E56A 4WJKA 4WNJA 1HH6A 5BUPA 3RBGA 3WNLA 4AYDC 2UWEF 4HS6B 2GUOB 2IPUG 2NLJA 1PS3A 2ENSA 1IKFL 4WW2F 5BV7C 3M17A 1Y1DA 1MFDH 1UJ3C 3C09B 5SWSB 2WYTA 1N5YL 4YXHH 4H8QA 1RUPL 1IJNA 3D0VB 2JKJA 3N42B 4RZCB 5DURD 4H8PA 1L7TH 1RIHL 1ZXKA 3BI9X 4Q0XH 4Y9EA 1JNHB 2EINB 1HDMB 2JQAA 2W18A 4O51B 1FHGA 3OC5A 3SE3C 3BAWA 1KBWA 4PJ6A 3QXDA 2G99A 5T1KA 5TFSH 3WXVH 5B7FA 4YSPA 3BH8A 1T22A 4RWHA 4XTRC 2DQJH 3CN0A 1KN4L 2E7HA 3HR5A 2K6WA 3UJTH 1CVRA 2GHZA 3O2DL 3VD1A 4JLRA 4X4ME 1CWVA 1WC7A 1K6QH 1U8IB 7PCYA 3TN0B 2X9ZA 3BLPX 1JYXA 1LK3H 1PLAA 3FONB 4YHKH 4H2AA 2IG2H 2VKWA 4F7CA 3OZKA 4KZEL 1OEZW 2FB4H 3V5HA 3BVVA 4PP1C 4GI8A 5CP7B 1R3KB 3LS5L 4W9LC 5F0MB 3IFLL 1J8HD 3JWNE 1GAFL 2OV0A 4NM4H 2X89A 4IBUA 4FKKA 3TNNA 1UB6B 2QADB 3T1FA 4ODVL 3L4CA 1EAQA 3MA7B 4YWGH 3FHEA 2JJSA 5CU5A 4LLMB 4QRFA 2XN9E 4A7JA 1YY8B 4JFEB 5A1AA 1YUHA 2CH8A 1HWWA 3WFHA 5I2IA 2K4WA 1CE1L 3UVKA 2I26N 4PN6A 5E08H 2PF6A 4MNQD 5CN1A 1JOIA 1I8IB 1IEBA 4JQIA 4YZFE 4XBMA 1KXQE 4OJCA 4MNHA 5F88B 5G4OA 4RX4A 3QCTH 1VZ2A 1T7VA 2R2BA 3IN0A 1H2ZA 4NBZB 3RWIB 4UT6L 3IJ8A 2J8UF 4MBOA 2WBJC 1JPTL 1CZ8H 3GQFA 3EQ7A 1ADWA 5DUPH 1JTOA 1YYMH 4CDHA 1IEHA 4BBWA 3V4PB 3WY4A 1KLUB 3BFOA 4N2BA 3GSUB 1FGVL 4XXCC 4P3CH 1KYAA 3O2VH 4GAGL 3ZTJG 2NYYC 4P57B 4KVPA 4N90D 3QULB 3N1PC 2X1WL 4KK5C 3DNKA 2PPEA 4AOWA 4J1UB 3BUDA 5LWYL 4PJDF 3EJRA 1O75A 4PJEA 1H19A 4EDXA 3DYPA 1ULVA 3QHTC 4O58L 5DUMH 1HNGA 4Z0XA 3VYPA 4F3FA 2YS4A 3EF4A 4PG2C 3TVMD 1F6AA 2D9QB 5KJRH 1CT8A 5ACZB 3TV3L 3Q8EA 5LNEA 1A21A 4JM0A 5IHBA 2XNAB 2MPAH 3UZEA 3VTMA 2DLHA 2HT2C 3CHOA 4ZD3L 4DCQA 5MHSD 2CNXA 3CFJA 4K55A 4W9DC 4OB5L 2OR9H 1K8DB 3MLTA 2YBRA 4ZMNA 5JOPE 3VW3H 1DJHA 4JPIA 4KAQH 5DC4B 1OPGL 4ZUWB 4WK4A 5HGGS 3MBWB 4HWUA 4KK8C 3FCUA 4UQ2A 4JSNC 3QC6X 4G8GB 3OHXB 4FI8A 4XCEA 3ARFD 1Y18B 3VCLA 3GSOA 2HFEB 3RVTC 1QVOA 2D3JA 5C6TH 3QNZA 1C5DA 1NH6A 3GLEA 3E1ZA 4HMDA 2F5AH 1TVBA 1RL1A 4UNVA 3GXUB 1S7QB 4P9HL 3RNKB 4WTXA 4L1MA 4IU3B 2FNWA 1BFOB 5HDBE 4F2ME 5GSVB 4I0PA 1R3JB 4M4RA 2F58L 2CM5A 5EH1A 1L0QA 3ZT6A 4KTEL 2QQQA 4DEPB 1JCKA 1WWBX 3GFUA 2DQEL 3MQIA 2J1WA 3FK3A 1J87A 1RZ8B 2GC4C 5KS9E 3G6DL 3IF1A 2O5NA 1UACL 4NBMA 3QI9C 4JFYB 5DFTA 4LU5H 5IBUB 5CXBB 1DUZB 4H7VA 4WI4A 3RJOA 5FXYA 4ZAKD 3LTVA 1JUFB 4NN7B 3GRWH 3FTSA 2BVQA 4UV4H 1H8NA 3ZTDC 5B38G 4OZUA 2ARWA 4ZFGH 4ELMB 1LTXA 2B1OA 3KW8A 1GHFH 1T89A 4IMMA 5D1XE 3ZKMD 3RGHA 1FNEA 3WFZA 1DCLA 1BX2A 4FKEA 4GP8B 5MEQB 3K6FA 2YPLD 1A1NB 1XWVA 3APFA 4ZOEA 4X8JB 1J10A 1P6AB 2IH9A 1KBVA 1WAEA 3CFEA 4N25A 4Y5XC 2YAEA 4ONOA 1IM9D 4M5ZH 2WUBH 2BNUB 2XZCL 4N0YL 1DO6A 4OI8A 3U0WH 4XNMA 3RUGE 3GHBL 4CAGA 3GKZA 3ZTCC 2CDGA 4HIXL 1BVKA 2IANA 5LGHH 5ADOL 5IB2B 3IDYB 5DJCB 2VWEC 1TQUA 3BZ4B 3EYQC 2N7AA 3ARDD 4O1QD 2WN3A 3N91A 2A74A 2FSEA 4GJTB 3I6GB 2UZIH 1AGCA 2R8SL 3NIGA 5E2JA 5AVRB 1CICC 4YSDA 1Z32X 3QNFA 2VIRA 4NDMA 4OGQC 4J3OH 4FZEH 3VDAA 1OCCB 4WCYH 3F83A 3WMQA 5CR1A 4Q6YA 3UAJA 3LXAA 1IV8A 4L4VB 4LQFL 3BGMB 2AGWA 5FO8A 4HUUB 1TQWA 4N1HB 4RA0C 1QABA 3VD4A 4MA3B 5CJ5A 3FHQA 2QSCH 3H6AA 3RIAF 4P0DA 1UZGA 2DMHA 2FGZA 3T3MB 5KVDL 4WI8A 2AKRB 4A04A 1B9ZA 4ISVA 1Q1JH 3G6AA 1NZRA 1LQBC 2PWDA 4XE5B 1XGYL 1JZ8A 3FU7B 4JM4H 1WA1X 4AYID 4UV7H 3UEZA 2E56A 4HLZG 3C6LD 4BK4A 4Z7QE 2K6YA 1IKFH 4YPGB 2YRBA 3QUKB 5I16B 1JPFB 4UDTA 1N5YH 1AOZA 4FHBD 1RUPH 5JHAA 4QAMA 1RV6X 4QQEA 3KD4A 4GBXC 4PGZA 3O81A 3NVQA 5CFHA 1AC6A 1KZQA 4BCDA 1FVCA 4RGNB 2FYVA 3L5XH 5IM7B 4DAGL 2VZUA 4OKVB 2IXQB 1J0IA 1F97A 1FE8H 3VFMA 5DD6B 3MRRB 3OKKB 4Z3TA 3UG3A 5EEWA 4HJ1A 1YZZA 1GGYA 5T1DH 1G43A 1KN4H 4GSRA 5D7IF 1YEGL 4RGOL 4NQCB 2FX8L 2YARA 3QFGA 5I74C 2DYPD 2HG5A 2WGXA 5DD1H 1YEKH 1DJXA 2I60L 1FIGL 2J4WH 3U30C 1UWGH 2PLTA 4PJIB 2OSXA 3P73B 3KMDA 3GFCA 4G56B 4WV1A 3HG1E 2GT9B 4OSUH 3PCYA 3LS5H 1UM5L 5AOLA 3K46A 5IB5B 5HYJA 3IFLH 4Z7OB 1T4KB 1FFOA 1GAFH 3MV8A 1LO3L 3VRIB 2X05A 3LAFA 4ODVH 1YSOA 3KPOB 3NIFB 1OPOA 4GI9A 1XF4B 4G72B 3ZTEA 3AWGA 1RFDH 3GMRA 4ORZC 1NDMA 4XP1H 3H7BB 1QX1A 5I6PA 3RI5K 4DPRA 3S2AA 4Z3HA 2CPCA 4FFVD 3VXSA 2VDMH 3CFUA 4LARH 3UEQA 1R5VB 5FW8A 3RIKA 3MRHB 4WHTB 5GGQL 5GGRA 1S7UA 4P46C 1OXYA 3ZKXC 4BUJC 5D6CA 1CD8A 2GAZB 1JNLL 3BW9B 4NENB 4XZ4A 3B37A 5C0BB 5TH2B 4UT6H 5SX4H 5BJTA 2Q87A 1U8KB 4IGBC 3UVMA 3SDXE 5FO2A 1FFPB 1ZIBA 4UINL 4N1CA 5I0XA 3PJSB 2BY0A 5T33L 5IV2B 4KJPC 2X4OA 1OM9A 5F7MC 5MEND 1NGQH 5MERB 4GM9A 1I7TB 3ZN6A 2ENQA 1OP3H 3C75A 5GS1C 4O4YL 4Z7VB 3RILA 4JPSA 3GLZA 5DQ9B 1MCLA 1QQDB 5T1MA 4MTMA 3TBVB 3J81g 3MCKA 4FRWA 5BS0E 1UUSA 5HHOA 4HH9A 2FR4A 2KLTA 4ZXBD 2CIKB 3LKOA 4O58H 4HJSA 2Z7WA 2WXOA 3CVCA 3T9WA 1AYOA 3FFDA 4PJXA 3EWEA 3A6CL 5J11C 2DKMA 3MMYA 3CXHK 1M2VB 2TRCB 5KYNA 3K1KC 1WFUA 2VR9A 2MQCA 3GMLA 5HYSB 2C3WA 3CFMA 1KJ2B 3L3KB 3P69A 4AWJC 1TCMA 4ANXA 2HU8A 3PL6B 5F21B 3SZKC 3SHFA 1J12A 4Q9QH 1UB5A 2A2QT 1OPGH 3PPSA 4J2XA 2OS7A 4P2QA 1DVUA 4LG8A 3K5RA 2Z4QA 4PJ8B 5JW5A 5GGTL 2OZNA 5DHDA 1HEZA 3G6JF 2WWKO 3AREB 1WIPA 2EE6A 2FH8A 3D85D 3QDJA 5A2Qg 3BHBB 3QORB 5EOCJ 3WL9A 4CMMA 3BPCA 3RSEC 4ZDHA 5G4NA 3OKTA 2EYSB 5ERWA 4ZZFA 1NIDA 1SJEB 5E1GA 4P59H 4A0AA 2YA0A 1FRGL 4UMSA 3VFWA 2PYFB 2WB7A 4FTVE 2BS71 1E4XH 3O6KL 1JZIA 3PY9A 2LLLA 3CFBB 3FU8A 3WEOA 3AADB 4MXVF 4Q9CA 2XWXA 4WRLA 3W56A 3V7MA 1GTFA 2EVFA 1JAEA 4AL8L 2FEEL 3TJPA 3N9GL 3IMUA 3SYOA 1S78C 2F58H 3QDAA 5HHMB 1HC1A 4KTEH 3ULUL 2F8XC 2CO3A 3N44F 2K45A 1W6LA 5D2NB 4GRWH 2GVYA 1HWGB 4DP2X 1CFQA 4DESA 1GYWA 1U3NA 4F15B 3QQ4B 1YYCA 2B9BA 2CUAA 5JZ7C 5M94B 1TQVA 3G5ZB 5FYJL 1JTTA 2ICWI 4ZFZA 1NANI 5DLML 4RRPA 4N6RB 4N85A 4TNWF 2QPUA 2UX7A 2WBJA 2MIZA 1T20B 3JTSA 4BP8A 4YHPB 1WA2X 2FGWL 4TQHA 2BSSA 4ZW8A 5DHVH 2G5BA 4N0CD 2Z0BA 2V3EA 3P40A 1HXYA 1E65A 4P4KC 4XXCA 3WO4C 4J4PD 4GEJA 2EDEA 4UTAA 3WD5L 3MUOA 1PQZA 2WKOF 3VE0B 2WZ5A 1G94A 4N0YH 5E6RB 3D34A 1Y0LA 1BCIA 2VT0A 4HIXH 5ADOH 5F1SA 4HGMA 2HTLC 1IAKA 1CCZA 4Y1AA 1WAPA 2BERA 4OCMC 4PG2A 2PPDA 4I7ZC 4OQTA 3SKJL 4PLKC 2YXFA 1YEWA 3JBG7 2XPYA 3P9MA 1UADC 4KOCA 2R8SH 3T0EC 4Y8DC 3HBQA 3VWJC 2BOBB 2YD4A 3F5WA 3VXUB 5DRZB 3R8BB 1CIDA 4QNPE 4LQFH 1I85C 2R0KL 5TF2A 2XVGA 1SYSB 2BM3A 2B14A 3P54A 4AX3A 1OAQH 3MYJA 1TZIA 4Q4EA 2XI9A 3MPCA 2H9GB 3SDCB 3TO4C 4HWZA 1N59B 3HG5A 1XGYH 4JKLA 1U8HA 3KVPA 4OV5A 3O3UN 4Q9RL 2EDNA 5C08D 4MCYA 4HYTB 3FUNA 3O11A 3BZEA 4BELD 2FL5A 5BZZA 4A0BA 1IIKA 2BFVH 3QBTB 4OBSA 5KVGE 4MZRA 4DAGH 4IU2A 3FL7A 1DFBH 5BVPL 1ZVSA 4KUCF 4AYGA 1MI5D 4XI5C 4HBQA 4W93A 1KTLB 1P2CB 1K5NB 3HNTL 2X4SB 4XAKD 3UZQB 3REWB 1UZ8A 3GUTA 3V7AE 1FNGA 2R0WH 3OGCA 1WSST 4CVXB 2GSIA 4JHNA 4D9QD 1YEGH 4Y4FC 3CH1B 2FX8H 2GC4A 3QB7C 4L5FE 4UIMB 5JW4N 4TUOA 2VL5A 4Y19B 4ADGA 1IGTB 2XFXB 4TOYL 2I60H 4EN3B 1IGIH 3FRUA 1FIGH 1B6UA 1XT5A 32C2A 3RTQB 5C09B 4FNTA 1GGBL 4LQ1A 4G9FA 3ETBJ 3JWDH 4Z76B 5I8OL 2J1ZA 1MNUH 4Z78A 3CSTA 3RFRA 5E6UB 4G6JH 3CZFB 1QFSA 2VDOL 4XC3L 2QADC 3OKMA 2V2XA 3SKNB 1JXKA 4XN7A 5D1QC 1A6PA 1GJIA 3LEVL 4UBDD 1FAIH 3BUPA 3S9DB 4Q4IA 2OQJB 2XIDA 1GMIA 5KYWA 2JXMB 4GMTL 2VOTA 4XZUA 2IPTL 3JYCA 5JPMC 4JG9A 5HDWA 2ZKWA 3SEPA 3BO8A 3X1BA 3GSXA 4QF1A 4CU6A 1HQRA 4OLWL 4GSDL 5GGQH 3T3PA 1USQA 2A6KA 1C9SA 4AY0A 1D7BA 1WP6A 3HE7B 3HI6L 5DMKA 3US9A 2HT4C 1SN2A 5JLZB 5F9OL 1SFHA 1AGBA 4GQ1A 1CICA 4KKRA 2J7LA 2OXGA 3L13A 4WI5A 4UINH 3X1GA 3MNZB 1MVFA 4IRZH 3KPTA 1QRNB 1UM6H 4PRPA 4XCYB 5ANMB 4IBSA