3K71A

Structure of integrin alphax beta2 ectodomain
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
1081
structure length
880
Chain Sequence
FNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAANQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPELEMAQEGFSAVFTPDGPVLGAVGSFTWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQSLVLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGAPHYYEQTRGGQVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVVIGAPGEEENRGAVYLFHGVLGPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRVLGLKAHCENFNLLLPSCVEDSVTPITLRLNFTLVGKPLLAFRNLRPMLAADAQRYFTASLPFEKNCGADHICQDNLGISFSFPGLKSLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRYVAEGQKQGQLRSLHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANVSSENNTPRTSKTTFQLELPVKYAVYTVVSSHEQFTKYLNFSESEEKESHVAMHRYQVNNLGQRDLPVSINFWVPVELNQEAVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVLDCSIAGCLRFRCDVPSFSVQEELDFTLKGNLSFGWVRQILQKKVSVVSVAEITFDTSVYSQLPGQEAFMRAQTTTVLEKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Integrin alpha-X
publication title Structure of an integrin with an alphaI domain, complement receptor type 4.
pubmed doi rcsb
source organism Homo sapiens
total genus 119
structure length 880
sequence length 1081
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2009-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
A PF01839 FG-GAP FG-GAP repeat
A PF08441 Integrin_alpha2 Integrin alpha
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1460 Mainly Beta Sandwich Immunoglobulin-like Integrin domains. Chain A, domain 2 3k71A02
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3k71A03
2.60.40.1530 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 4 3k71A04
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3k71A01
2P26A 2VDRA 1M1XA 5E6RA 3FCSA 3V4VB 3K72B 3V4PB 2VDMB 3T3PB 3V4VA 3K72A 3V4PA 2VDMA 2VC2B 3ZDXB 3T3PA 3NIDB 2VC2A 3ZDXA 4O02B 1JV2B 4UM8B 4Z7OB 4G1MB 3NIDA 4JX0A 4O02A 1JV2A 4UM8A 2VDPB 4Z7OA 4G1MA 3K71B 2VDPA 4WK0B 5ES4B 3K71A 3K6SB 4NENB 4WK0A 3IJEB 3ZE2B 5FFGA 1TYEB 1L5GB 3K6SA 5FFOA 4NENA 3IJEA 3ZE2A 5HDBB 1TYEA 3T3MB 1L5GA 2VDNB 3ZE0B 4WK4B 5HDBA 3T3MA 3NIGB 2VDNA 3ZE0A 4Z7QB 4WK4A 3NIGA 4MMXB 3VI3B 2VDLB 4MMYB 4Z7QA 5E6SB 4MMXA 3VI3A 4Z7NB 3NIFB 4UM9D 4MMYA 4MMZB 2VDLA 5E6SA 4Z7NA 3FCUB 4WK2B 3NIFA 3ZE1B 4MMZA 4UM9B 3ZDZB 3FCUA 4WK2A 3ZDYB 3ZE1A 4UM9A 3ZDZA 4IRZA 2VDQB 2VDOB 3ZDYA 3VI4B 2VDKB 4G1EB 4NEHB 4WJKB 2VDQA 2VDOA 3VI4A 2VDKA 5E6UB 4G1EA 4WJKA 5E6UA 1U8CB 2VDRB 1M1XB 5E6RB 1U8CA 3FCSB
chains in the Genus database with same CATH superfamily
4YFEA 4W4OA 4QD2E 2IANA 2BINA 3HHMA 1KYUA 4JQXC 2A7BA 1AR1B 2X53A 1U0QA 3KLSA 5I1KL 1Z3GL 5I16A 1T7YA 2JELL 4G9FE 4TMPA 3UTSD 3KW8A 1GHFL 1YEJH 3SLED 2GSIA 4K23H 1WFOA 4WSGA 5HGHA 4POYA 4G43A 5CXBA 3TCXA 4HLEA 1A0RB 1H15A 5AWNH 4TVUA 5JPMC 3TEUA 4J3OF 4IJ3B 2NMSA 5JIIA 4YE4H 2J88H 1ET5A 2MOVA 4NQSA 4PIRF 5ENWB 4Q9RH 3KLQA 4EDWL 3I50H 4LCYB 1RZGA 3JYCA 3ENEA 3CZLA 1NCBL 4U3CA 5INDB 1WAAF 1J0IA 4MCZB 3T9WA 3Q13A 4QRQB 1F2XK 2X4OA 2HVJB 1UXLA 2XWCA 4NZJA 4XP5H 4Y19E 1JS4A 3CFQA 5B1AB 3TO4C 5I18H 4BSWB 5EBWA 2H0JA 5DA0B 1ORSA 1Q8MA 3JUZA 3FGBA 2B5MA 1Z7JA 2FJFA 2WP3T 3FO2A 4X6CB 3VSQA 1GZHA 3SE3A 3ZE0F 4WUUA 1AQHA 2FEDC 3UO1L 1UENA 1F3JA 4UTAL 5EU7E 3DK0A 4ZXBC 1H9DA 4ZFZA 5C8JA 5CJBA 2HUEA 2UZPA 2H9PA 2C9RA 4ADGA 3V79C 4FFZH 4HUWA 4UOW0 1HOEA 4WI0B 3IETB 2VLJB 5F0JB 3DC0A 3VGBA 1CFVL 2Z8VC 3T65A 3CG8A 4Z7QA 3TBSA 4O2CB 1G0XA 5DS8B 4B0MB 3Q3GB 5C0IB 5T3XL 2BFVH 3ARVA 1I8IA 3VFOB 2CDFB 2VQ1B 3O2DH 2O26U 5DJAA 5I5IA 4FFZA 3MGAA 1BBDH 5C7XH 5TGBB 5E6IC 1CPUA 2EYSA 5IB3B 2H1PL 2VR8A 3AADB 4GAAA 2H3KA 4GSXA 1TJXA 1SZNA 3MO1B 2IBGA 3BD4A 5D7LB 2YNNA 5C07A 3BX7C 1BQHB 1U8HB 1Z5YD 4EE2A 2DYPB 3GTVA 3ASNB 4N0CD 3SY0A 2D0HA 4NM4H 1U6AL 3JV5A 4HIIA 1LMKA 3IUQA 2DMBA 1KYOJ 4WEUD 4A2LA 1JZ8A 2MKWA 2V4LA 3RTQB 3MRRB 2FO4B 1ZDQA 4TM9A 1VFAB 1ZDSA 2G9HB 3MNDA 2O6EA 1KGIA 4WTXA 4XXWC 5GRJL 3TP4A 2OR9L 2WXQA 5C2UB 2R2BB 3F62A 1T04B 2B4CC 2XA8L 4GSRA 3AU1B 3WMQA 4HAKA 4KFMA 4AJWA 4GT7A 2AXHA 1ZPUA 3V4LA 3L4OD 4HMEA 3ECBB 5DSCA 1NAMB 1UXMA 3C6EA 3I74A 5I8EB 1PKQE 1TVHB 5G4NA 2EDQA 1E90A 3IKCB 4M5TA 3BGAA 1JPGA 1DE4A 1KB5H 5HHVH 3U48A 1T1WA 4HGWA 1YN7B 2WB7A 3SN6N 4KK8C 1FJ1B 1AR1C 3PPEA 4QTHA 3NN8B 4CRPA 1BWWA 4WFHE 4NYLB 1M7XA 4Y2NA 1IARB 2CA3A 3C6LA 4U33A 4LPXA 5DHVH 4A68A 5JYLA 1GGBH 4GQ1A 4NJAL 3QC6X 1U8QB 1QP1A 4X5QA 5F3HA 3P4NA 3PWUB 4WJ5B 3VFVA 2BWIA 4NZUL 4W6WB 4S1QL 4PLJC 4AH2B 4Y4HA 5IMLB 1NGZB 2V2WA 3DIFA 4RRPG 6TAAA 4IJ3C 1N6VA 3ZZLA 3VCLA 4BZ2H 3ULUL 3LMJH 2IGTA 5MP6H 5CCHE 3LHPH 1FFTB 4M7LT 3LB6D 1FYTB 3S6CA 2PABA 4P4KD 1KJMA 2QQQA 3BH4A 3FCBA 3AUWB 3I84A 1TFPA 4L4TA 5HI3D 1MJUL 2WLIB 3Q6GL 3SDCB 1SFHA 2HRHA 3VXSA 2HFFA 3LZRA 2X4QA 1LXMA 4DP9X 2AJZA 5HDBE 2D0GA 2BZDA 2P24B 5GIRB 4K8RH 3ULUE 2A77L 3HMWL 4JHBA 2CUIA 2XTJB 1IAIL 3D4YA 3CGTA 3ARTA 3QCTH 5KSAD 4LCWE 4NT6B 3L16A 4ZMPA 5IJBC 5IUSA 4L4VE 1KC5H 2VDOL 4Z7NA 3T2NH 4JRWA 3KR3H 2YGNA 4WK2B 3PV6B 2DLGA 3GSQA 1P84K 4JSPC 3H9HA 1IAII 2EDWA 3OF6D 4R7DB 5TQ0L 5JOEA 2WKLA 3VYOA 4JMXA 1I2MB 2NR6D 2AHIA 2JJVA 1QI3A 3PGCB 2Y1ZA 5EULV 3LIZA 3U36B 3FRPA 3D85A 5SX5H 4YNYB 2MCAA 3EJJX 4U1JA 4IIZA 3ZYJA 5FHAH 3JV6A 4KTDH 4G6MH 4GP8B 2VDKA 3FTGB 4YEEA 3HBQA 2H8PB 1F4WL 3UTZA 3NJMA 5A6LA 3OKNA 4MA7H 2HCZX 2KZBA 2WD0A 3HN8A 4GOSA 4LLUA 5D1ZB 1MPAH 5E6RB 5E99H 3OKOA 4YDIL 3U6RB 4MXWH 3MRQA 3B3IB 3GJEA 2XJLA 1GOGA 1EBAA 4XBGB 4YAQB 2YQ3A 2FWSA 4J4PC 1R3IH 2DQFA 2BVEA 2WTRB 4KY1L 3DXAA 3SDYH 3A4AA 1G7LA 4OZGB 3W0WB 1NDTA 3JROA 1RUML 1VFMA 3IAPA 2Q3AA 3GXMA 4TOYL 1A7PL 1CFMA 2CHNA 5IVXA 5TFSL 4JNXA 1NCJA 5AVYB 2F7QA 4LKXA 3D9AH 5E1AA 3EFDH 2CHXA 4FERA 2H4EA 4X6DB 3T6VA 4FN0A 3TFBA 43C9B 3GLZA 5IKCB 3CC5B 5FYKU 1OF0A 4BDVA 2H6NA 4ZPTA 3NH7H 3RPKA 2E7MA 4GRWB 4HGMA 3ASOB 5GGTA 5KG9A 1RMFL 2FE0A 4AXWA 3QI9D 5F7LB 5I0ZA 1AQDB 1CGYA 1OGPA 4A1RA 1FVEA 5BO1L 3M07A 3MRIA 4U1LB 1RZPA 2C34A 4G8GB 5ABAA 1NOAA 2VIRB 3L6FB 3W9DB 2GBAA 3Q8BA 4JO4L 4NP9A 3P9WB 1UFGA 2Z7YA 3S3JA 4RMQA 2B77A 3UYPA 5F9AC 3QH3A 3WKQA 3KM1A 1MRDH 1QYGL 3WD5L 4H40A 4IMKA 2CK0L 2PO6A 1A3LL 3UDWC 1JXDA 2Q9OA 4QHLA 4Y1AE 4MQ7A 4JM2D 3CN4A 4MS8D 1KYAA 5HYSG 4KUZH 1B6UA 3CIAA 3LQAL 1D5RA 2G2RA 3FSVA 1V7NH 4LSTL 1TEGA 2MQCA 3PAYA 1UM6H 5BRZB 5GSVB 5A2CA 2DEXX 1CYGA 1E8XA 1RZ8A 1CURA 4F20A 4NRXB 3VQ2C 1G9MH 5FR3A 5KJRH 3M1BA 4FABL 1YNKL 4JHUA 5DD5H 2BS9A 3F5WB 4B9YA 3QR2A 4IOIB 5EO0B 3LH2L 1BQLL 5DZVA 4P3WA 2DWTA 2FJHA 4IBLT 4H5IA 1HNYA 4ZD3H 3DVGA 1L6PA 5IB2A 1SOQA 2XTJC 1I1AB 2WO4A 5D71L 1LE5A 4G8IA 3TO2A 4UQAA 3MRDB 2F54E 5D72L 1UOLA 4NLAA 1Q0EA 1WDAA 1N26A 2VN7A 3DOIA 5KYYB 1NDMA 5FM8A 2DWDB 2HU5A 5E9DB 2VXUH 5TF1L 3KGSA 3MAWA 4PB9H 2DMCA 3X11A 3G5ZB 1KIPB 1OAYH 1WZ1L 2N7AA 2QDWA 1IBHA 4UTBH 1G6RH 3TBTB 2P1YA 2Z3FA 3HRPA 3FQRB 1PPIA 4PRPD 4NKOB 3ROOB 4GGDA 2CO0C 5IV2A 1GOFA 2IGFH 4E9SA 5DRWA 5AZEH 4AQAA 2CNYA 1PTZA 1PZ5B 1OK8A 2YUVA 1CGXA 3QXWA 1JN6A 4XP4H 3TCLA 5SXMA 3VD0A 3FO1B 3W1ZA 2D7PA 3EJPA 5ILTH 5LGJA 3MJ6A 5ACMA 1VAHA 1KN2H 2NNXA 5D1ZC 5C08E 2CGRL 2TAAA 4E2OA 4URKA 3A5VA 5HYJB 5KS9F 1HXKA 1YY8A 1QR1B 3G6DL 4MS6A 5LNEA 3QQ9C 4WGKA 4PJXA 3LCYA 3CPUA 4W68A 3V6ZB 4LRNL 1AMXA 3PL6A 4OFKA 3MRBB 4U1NB 3MLTA 4MJIE 1E8MA 1VA9A 3MNMA 2YNPA 3TBVA 2CAKA 3OMAB 1LWJA 4M7KL 5IG7B 2WKOF 4DK5A 2OMUB 4EZKA 1RH8A 4CGTA 2R29L 4APXA 2WVSA 2ZCKH 1ZLSL 4RDBA 4PJEF 4XGZA 5AVQB 3RB5A 1QBAA 1Z5LB 2EE2A 2VN5A 4JREB 3THML 2NW3B 2R0ZL 2ZYIA 4UNTA 5GRXG 4ZYKB 3ZK0A 3QUZA 1TJHH 3VXUD 1R5VB 4AQEA 4K3DH 3GI8H 5DUPL 2PBIB 2GYSA 3CD4A 3NK4A 2BNUB 3MLYH 5FDYA 5GZNC 43CAA 4AI7A 3L4WA 1LL1A 1MN4A 2J7LA 4S11A 4OQ1A 4WFEE 1H6TA 1I8LA 3SPVA 2YSTA 2BP8A 4RGMB 3O0RH 1VGKB 4ZSOE 5I1HH 3BE1H 1TJIH 3IWVA 2HWZL 4JFDE 5D1QD 1KXVA 3DIVA 3BD5A 4Z23A 4ODHH 4M1GH 2OYKA 1NGXB 2H32A 1ONQB 2LLLA 1LD9A 2ZP9A 3FUKA 3CZKA 3TYFA 1R75A 4Z78A 5A3IC 2JXMB 1K4DA 3LN5A 2JKJA 3SBWC 3T0EA 4ODVH 1IBGH 1D7FA 2W07B 1MVUA 4NSKA 2P5ED 3B9KD 1XGQB 1Q0XH 1T2JA 3P11H 2CN3A 1NFKA 1BD2E 1BFVH 3BWAA 1TNMA 3ESVF 1BYOA 4JMNA 4KO9A 4JO5A 4QMEA 5I1LB 3FTZA 3H3KA 3ML9A 1FDLH 1MY5A 2EH8L 1A6PA 2FWUA 3DV4A 3S98A 5PCYA 5KWYC 3I6KA 1UD8A 3NJGA 4ELMF 3L3DB 5E8OB 1EX0A 2GJ6E 1MFAH 5FGCE 1U30A 3BQUC 4TNVK 1XF3B 5KVGH 4RSVA 2A1WL 3BLBA 5FUOL 1MKFA 3WO3B 3W37A 3G08A 1I1AC 3ARUA 5AAWC 3ILPB 5LO7A 3N0PB 1OP4A 4N2CA 4NM8L 3MZLA 4PV8B 4X80L 1RIVH 3MV9E 1R5IA 3GSXA 5FCUH 4JFHE 3TNNA 1T22A 2G0KA 4NPKA 3LQZA 4OJDH 1MDTA 4L37A 5CYKA 1N5AA 3GJFH 4RAVA 1RZIA 2YXWA 5HGDB 3MKKA 2R0KH 1SLXA 3AREB 5GRUL 2XRAL 4AJYV 1P69B 3VMPA 5I26A 4O9DA 4N2NA 3PPSA 1C9LA 4UQIM 4F7CA 2L4OA 4J3XA 1AY1H 4PJFE 5EIQA 1ZLWH 4XBPA 2N7SA 2IADB 3FW6A 4DGYH 1JNLL 3VWKA 3U7WH 2OCFD 3FN3A 4HK0A 4ZOZA 4YLQT 4ERSH 3RGVD 4BBWA 3D6GA 5E03A 2BJML 2NY1B 3SJVE 2DOCA 5C0CE 4B60A 5FKRA 4N2KA 3T1FA 5DWUH 2J5WA 2X05A 4UM8B 5CINL 4U3SB 1TZHB 4AK1A 4HKXA 4X4YA 4LDLB 3HS9A 1G9NH 4PW4A 2XI9A 4G8FA 4KVCL 2CRIA 4BCYA 3WEXB 2XV0A 1IGYA 4RA0C 1AANA 1DBBL 2WXMA 1GYWA 2CR3A 1EVTC 1FORL 2X4RA 1P7QD 5F6IB 4K5OA 2FJGA 4G9DB 5ICXA 5T3ZL 1KJ2H 3K4AA 3KVQA 3HMXH 3AUVA 3DSFL 3QDJD 4Y0GA 5IVZA 4GKOA 4OWRA 3IDMB 5IQOA 2YZ8A 3GT6A 2GITB 3IULA 3OC8A 4OF3A 5I76B 3MMEB 2XHNA 3V0HA 4OZIB 1YEWA 1AXSB 1NMAL 5I74C 2QPFA 5M61A 4LT7A 2K4AA 3TA3B 4V2CB 4JREC 1PVHA 2BC4A 4ZW8A 4BZ1A 5B1JC 1KXHA 3ZLQC 3HMXA 3AU0A 2BS71 1J1PH 1CG9A 1QUPA 4FQXB 4X9BA 5F93C 2Q8BH 4DWHA 4HUXB 3L5WA 5C09D 5T3ZE 1T21B 5DTFB 3SE8L 1HSAA 3C5MA 1R34A 2NUTA 2VDNL 3B7FA 4XX1E 4RDQF 1DSYA 4DN4H 1ZLDA 2V2XA 3AB0B 1YEKH 1JMXA 1V27A 5IEHA 1U4CA 2F9BT 3P3TA 4NC1E 2ARJQ 2IFFL 3BGMB 4RGMC 3QUXA 1AGFB 4JFOA 2KERA 4GXVH 3TURA 3ROLA 2F7RA 4BCDA 4GG6A 2E9IA 2Y07H 1WTLA 3GINA 3MV8B 3U9PL 1TCRB 2VLME 4I1NB 4XPGL 2G3XA 2L8AA 1FFNA 2UWEA 1A6WH 1BVKB 3LKNA 2FO1A 1MFNA 4JFEA 5T1JA 3CZNA 4GUCA 1D6VL 2QHLA 4DKFL 3ZDYE 5L9DL 3IGAA 1FC2D 5CIPA 5T1DL 4KKAD 2R0LL 4OJEH 2GK0A 3FQ4A 1RLBA 3AABA 3L2LA 3OX8A 2OM5A 3HC0A 4P9HH 2N4IA 3DIDA 4H88H 2BNQA 1XGYH 3A4DA 2GC4C 2XZAL 4MLSA 3ZT6A 5EZPA 4NCC2 1UEMA 2FB4L 1HE8A 3QHTC 3K4DA 4QXTA 1TDQA 4E9RA 3LKPB 2A9NH 4ZNEE 2I7SA 3EOTL 3DGDA 4MXVF 1J5OH 1GZQA 1MQKL 5CILH 1MEXL 1BZ9B 2LU5A 3B2VL 5B22A 3S5LB 1BGXH 3I75B 3NFPB 1DVFD 4J3OD 1S7VA 1X5JA 2FQEA 3IDNA 3MBEA 4PJEE 3AREC 5JQ6L 3CVCA 2RQ8A 4MKTA 4Q6IB 4AYSA 5FKPA 4JR9H 3H7LA 3H53A 1RZFL 1G7QB 4M5YL 5IGXH 1A6UH 5FKAA 2NY1C 2P80D 2FVNA 3UR4A 1S7WB 3VW3L 2PCPB 1CD1A 5DGQA 3P4FA 1KEGL 1HH9B 4QLRA 1RXLA 3UJTH 3BH9B 2X88A 3DV6B 3IJ7A 4PJGF 2QQKL 3BWSA 4QT5A 1U92B 1A66A 3ML8A 1MCLA 4UOZA 5FYLD 5E94B 3HZKA 1TETH 4X8JA 1KYDA 1SY6A 3V6FB 5HVGB 1DANU 2J71A 5E51A 1G7MB 1NLDL 1NUFA 4G8AC 3D25A 5F6IC 3TBWA 1J86A 1QKZH 2HKFL 4N0UB 1AGCA 3SODB 2CJ3A 3GF8A 4U6HA 1Q9LB 4L3EE 4OU3A 5THAA 2QLVB 1HNGA 4S1SL 4YXKH 3VI3B 5GGRY 5ABDE 2A9AA 3L2NA 3F3GA 4B9IA 3HFFA 1B0GB 3QRBA 3QXDB 3TA3C 2EUVA 1LP9B 2FBJL 5JOFB 2PWHA 1T20A 4JO1L 4JRYD 4C4UA 5IB1B 3II1A 1MIML 1X4XA 2JJWA 4J12A 3RWDA 3L7FB 5EU4A 3V0DA 3V5DB 1CCZA 3ZDZB 4FQXC 4RBPK 5IHLB 3E9TA 2HU7A 2AXGA 4FGMA 5JDSA 1GPOH 2APXA 4KK6D 4LF3B 4LVEA 5DEFB 3QJXA 3DHJA 1DO6A 3AB0C 3RWGA 2CGYA 3ECVA 5CNHA 4ACTA 1P1ZA 5AENA 2VLKB 1BLNA 3NEXA 4L18A 4G56B 1FWXA 2BSTB 2A83B 4L9LA 4OLUL 3TESA 3GSRA 3GO1H 3NCBB 3SDDC 3N55A 5DCCA 4MA8L 3BKYL 1Q9OA 2JJUA 3GXUB 4P59L 4QEGA 1A6VH 2P5WA 1F1GA 4MWFA 5EU6A 5LBSA 4W9EC 4TNVF 1TMCB 4ZMNA 3W82A 2FYVA 2WWNA 4CC4C 1G87A 3VXNB 1TZIA 1BZ7A 4WKZA 4UUJA 2A74B 4JO2L 1DQQB 2IMNA 3VRJB 5DD3H 1EEZB 4J39A 5M94B 3CHSA 3G5YB 3ZZ1A 4J3WA 3SGEI 3X13A 2VDRA 2J73A 4R4NC 3O6FB 3B7YA 3TVMB 2K9FB 3IJ1A 2IGLA 3MLUL 3V4VA 3QDMD 5D4IA 1MWAL 3S36H 3HI1B 5IR1A 5EEXA 4I5BA 5GS0H 2QLYA 3MJ9L 3ISRA 4YL4A 4HJGB 4XMXA 5F7YC 3TU6A 1KB9K 4OZHF 3H7BA 1K2DA 1LEKA 2I0SA 4MAYB 1GH7A 3NIDA 2NY4C 3BWUF 4XVSH 5DT1L 3OGCB 5F9OL 4HHAA 1NBZA 4JE4B 4UOJA 4LLDB 2WV3A 3C8DA 1QTPA 1VFOA 4J8GA 3G6JF 2YPLB 4MZIA 3KL0A 5ITFB 2LAAA 1UM4L 5F1NA 3PYCA 2AJSL 5BRQA 1K8KC 1E42A 3POCA 2WXGA 1IX2A 1QSFB 3K6SB 4DCQA 5E2UH 4ZZKA 1EMTH 2NUPB 3QIWA 1CFTA 4Q6IC 3RA7H 2NYYC 1IGMH 1P7BA 1JRHL 3P4OB 5ELIA 5CJXA 1XAUA 1P22A 3BT2L 4JFSA 3WN5C 1RCYA 4P2CG 2ZCHH 4Y9CA 5FA3B 5K9OA 3DHPA 4FFYH 3CCHA 2IPKA 5HHOD 5J3HD 4DNLA 1KYFA 3DPDA 1JRHI 25C8H 4LLYB 3D39B 1XCQA 2Y6SD 1YEFL 4JFFA 5KANI 3DM0A 5AD0B 5D8JL 4HOWA 4LHUB 2X9YA 2VGLM 4TL5A 3SGKA 1VKXB 3QEHA 2XPZA 3FZUD 1KCSL 3O4JA 4CU7A 1RSFA 2J6WA 5D5MA 3GHBH 4PD4J 1I3GL 2H1XA 5AALA 1MJJB 2FJSA 4NQTA 2VDLA 1ETZA 5FCSH 4LCCB 3B7TA 2CLVA 2WXHA 4F2FA 3IF1B 4ONGL 4GW1B 1ED3A 3T4AB 2ZYRA 1J9QA 4KDTC 2FECI 1BCIA 1Q9KB 1G0YR 5TE7L 1AJ7L 2ZF8A 1B4LA 3RDTA 2A4ZA 2FWOB 3CPLB 3FTYA 5EEUA 1DFBL 4CDHA 1KTJA 5E5LA 4U1KB 1EFXD 4G83A 4NWTH 5GISH 2X3BA 3S35X 1TZ8A 4NCC1 4DT2A 3KS0H 4N2BA 1I8AA 3DTDA 2QELA 4DTGH 4GQ9L 1AFVL 1KBWA 5FKSA 2H47C 2IANB 3QQ3A 3OGOE 3KH3A 5HDRA 3EFOA 1MIEH 4BIKA 2QC5A 5I16B 3MA9L 3ARFA 2D3JA 4GIPD 4MJHA 5F3BA 5H35A 3B37A 1P9MA 4BKLA 2GSIB 5HGHB 2FR4A 1ULVA 4G43B 5CXBB 1H15B 2A74C 1YMMA 2DQ6A 2B0SL 4NQSB 4K5LA 3K2MC 4X7DC 1RZGB 4CY1A 1TOXA 4OIIL 3OC5A 5K9JH 3L9EA 3SKUD 2NY5L 2OFQA 4KX9A 1U8JA 2X4OB 3RDJA 3TVMC 4NRYA 1DSFL 3K5SA 3D4ZA 4HF5L 4Y5XC 5DYFA 4L1HA 5GXIA 2RTTA 3WEAA 1T6BX 1V55B 5EBWB 2WJ7A 5CLTA 1ORSB 1NCCL 2FJFB 3FO2B 2DZEA 1AS7A 5EA0H 1DUYA 1I7TA 2XWBA 4NPYA 4WUUB 1CZ8L 5DRXA 2Z31A 1F3JB 3IXAA 4YHML 1JZ4A 2DQEH 4NENA 4ZFZB 5C8JB 2E6QA 2PR9A 1XHHA 3O81A 1EK3A 1F4XL 2R39A 3LRKA 5KUMA 3WAJA 3DXKC 2GIMA 2J4WL 2H41A 4HUWB 5TDNA 4UF7C 4OQTL 2ATKA 2E46A 5FUCC 5BV7L 5DFAA 1FIGH 4KOBA 5K59F 1CGUA 3T65B 4Z7QB 3TBSB 1IKNA 3QJQB 1WA2X 3TX4A 3EYOA 3ZYZA 5FLVA 3V5KA 3O2VH 4BCCA 1I8IB 3PXSD 2GBUA 2NCMA 3RU8L 2C3XA 4K3JB 1F3DJ 5DJAB 2TSAA 2BNRD 4YDVA 4TUUA 4WI4A 2DQDL 3PP4H 2VISA 3H54A 4M8QA 3REVA 2EYSB 2BP0A 1U93A 4OIFA 1E4JA 4FI7A 4XAWH 3TBBA 1UFUA 5C07B 2VC2H 3FBKA 4UM9A 5A2FA 3N41B 3SY0B 1QLEL 3QSKB 4PJ8A 1J8SA 4KX7A 4HIIB 1I8UA 2D03L 4YZFF 4K55A 3IFNH 4Q74A 4DESA 1SJMA 4AX4A 1RJYA 3EO1A 4K07A 4ZZFA 3PP3H 5F2FA 3MOQA 3VXTA 2OMXA 4GSDL 2EAEA 4AIXA 4CU8A 1SXBA 1BWMA 3V6OA 3T4AC 1NEXB 1CC3A 1ORQA 1PL3A 2IBZX 3QULA 3UYRH 2DL2A 3PWPD 4JPKH 2DWEA 4PJ5D 4HA1A 1BMGA 3U1SH 4FA4D 4XXDA 1BXVA 4KFMB 3ZYOA 4ALAH 4EI5A 1N6DA 2WB1A 2PMZA 1JGEA 2OSXA 1JE6A 5E6ZA 2BY1A 5KVEH 4JVWA 2B1HH 5D70L 5C6TL 4FG6D 3TEWA 3HLKA 4G6FD 5DSCB 4XE0A 4LQ1A 2IBZY 4KVNH 4YHKH 1NCNA 2BW4A 2C4FT 2XDHA 3EOAA 5H8DA 1CB4A 2FT7A 2GFBA 2MOGA 3IS0X 4DOHE 1KELH 1JPGB 1DE4B 2VZOA 3D0VA 4HWUA 1T1WB 2HVBA 4HGWB 3ARGC 1W72L 1CFBA 2R2HA 1F2QA 4ANVA 4QTHB 1NBVH 2XN2A 2WGNB 2O1AA 2Z9TA 3FONA 4PD4K 1L0QA 3C6LB 1BFTA 5JW4R 1K3ZA 5K1CC 4JDTH 1ZA3A 1O6VA 2R4SH 4TVPH 4CZXA 4CN1A 5F3HB 3QUYD 3P4NB 3DARA 4OF0A 1KOAA 4JRXE 4X0KA 3VFVB 3RFGA 1QFPA 4Y4HB 1WWBX 2VXVL 3DJSA 4G1MA 4HGKC 2V2WB 4YXLH 3DIFB 4U0RB 4D9QD 2CXGA 2ZX5A 2Z93A 1JGLL 3ZQWA 3VCLB 5F7KC 4P2RD 1QWUA 5JHLH 1U2YA 1GIGL 2GBVA 2EZ0D 3QHZL 3K71A 2JKRM 4KXZH 3MV7D 1WQVT 1WGVA 3FU0A 1A12A 1KJMB 4L4TB 4BA8A 2LU3A 5C0NC 3QRFM 2WBXA 7FABL 2V37A 3VXSB 5FS5A 1TU2A 5FX3A 3ILDA 2HFFB 2GVYA 1WSST 3VXPA 4RGOL 1DLHA 2X4QB 1ZHLA 2WLJA 2AJZB 4N24A 4X7SH 5LAPA 2Q2EB 1UT1A 4V1DD 2DM7A 2OSLA 2HT2D 1MAML 5JZ7D 3SE3C 3WFCL 3TJHC 4LL9A 1FUNA 4PBWD 3QZLA 4PJCF 3VNYA 3CXDL 4CAGA 5EORH 5I8OL 3DYMA 4EKJA 4WSJA 3UAEA 1CGTA 4Z3HA 4Z7NB 4OLYL 2OP4H 1IC7L 1ODUA 2PPEA 4Y9FA 5DJ8A 5F7WC 3GSQB 3H9HB 1B2WL 3DO4A 1DCLA 4KKRA 4ODSH 3VH8A 3HVNA 3JB9L 5FC9A 1L3WA 4UT6L 4H20H 5GQBA 3FRPB 3D85B 1Y1DA 4U1JB 3JV6B 5I1KH 1THCA 1Z3GH 2VDKB 2JNZA 1BJ8A 5IQLA 2FGWL 3OTTA 1GHFH 3KPSD 4UT9A 2WXJA 3F85A 3UTZB 3BN9C 3OKNB 3BH8A 3VNZA 2XXMB 4LLUB 3N04A 3WGUB 3OKOB 1GJUA 4QRRE 3VE0A 5C6PB 5ACLA 3J8F7 3G5VA 3MRQB 3IN2A 3GJEB 2GJPA 1BQ5A 5DQDL 1QRNE 2CDGA 2H2SD 3MVSA 3OLGA 5CJQL 3RE0A 1AKJA 2Z2NA 2DQFB 5B3NA 1PX4A 3V7AE 3DXAB 3FUNA 3N1PC 1BPVA 1NCBH 3VGZA 4BH6A 1G7LB 5C70A 1MELA 4Y2OA 2X6UA 5E08H 2Z92A 4S1RH 5IVXB 1CIDA 5K93A 2P9NC 1JIBA 3ZHLA 1TSRA 1H2WA 3HI5L 4LKXB 4ZUVA 5L6YL 5E1AB 1WGOA 3K1DA 1NC4A 4PJBF 5SV3A 3ZZSA 1L0YA 3B9VA 4Y2DD 3RVTD 3HKFA 1KCLA 2Y5TA 3UO1H 4BDVB 2K8QA 5KZCD 4ZPTB 1JPST 5ISZD 2EUXA 1TTGA 3RN0D 1ACYL 2HT4D 5DO2C 3RUGA 5KG9B 4JPQA 4JRFA 1WCQA 2R56L 4AXWB 1X5XA 3L3GA 4A11A 3NYKA 1FVEB 2OL3L 3GEFA 3MRIB 3VSUA 5A2LH 3UTTA 1MFVA 1OTTC 4XHJD 4N2EA 1JYNA 4N6QA 2HU8A 4ISVA 3C6LC 3FMGH 3BQVA 5H37A 5HYFA 1GW6A 5GMKn 4UTAA 2WZ6A 3QFJE 2IH1A 1M6UA 1N0XH 3KPRD 3UYPB 2F74A 4Y4HC 2EXWC 3QH3B 4JDZA 4RMVA 4KXAA 4LHJB 2V6HA 3EYFA 5MHSD 4ESGA 3VQLA 1KG0A 1S4IA 2PO6B 4MNQA 4QHLB 3P9LA 3U4EA 4MQ7B 3WS3A 1I9JH 4APQC 3OKKA 2H1PH 5EEZA 4I87A 1HCYA 2G2RB 3FU8A 1MG3A 3I6LD 4PWKA 3QRGL 4KZDL 1RZ8B 2O5YL 4I3RL 5A6IA 4S0SD 1U6AH 2XL2A 4G7VL 5FW8A 3TL5A 3I7PA 2EC8A 4A7TA 4X6CF 4XWOD 5D2NE 2LVEA 5HHMD 1OD9A 1WD8A 3PWVA 5I0DA 2AJVL 2FJHB 4RLDA 1KY6A 3DVGB 4JPVH 4DKEH 1E8WA 1Y7VA 5FPIA 5IB2B 3WNKA 2DRUA 1BAGA 2H2PD 3HFQA 1LE5B 2OR9H 4G8IB 3TO2B 1MCQA 1GOHA 3LH8A 5E0QA 2CR0A 3S97C 5FEBA 3VVWA 4AY0A 3O4IA 4ZS6C 3B2UD 1E0OB 2XA8H 2BFGA 1MFBL 2IXQA 4YHIA 3CFMA 3U83A 1NDMB 3KYMA 3IJYA 2XQYG 1PKQA 3DHMA 4K8RC 3X11B 2MJWA 4UIKL 3AXHA 5DMIH 4CMMA 3GPEA 5IV2B 3AFCA 4ONFL 5DRWB 1AD0A 4AQAB 3LIUA 4PCKA 3HR5A 2YS4A 5DI8A 5IFJA 2QTEA 5B7EA 4D9LL 2JH2A 4DN3L 1JN6B 3TCLB 2VW6A 4CSZA 4GYBA 4W6XB 5LGJB 3CTTA 4XOCA 4PS4L 3P0VL 5HI4C 2DWXA 4NZUH 4S1QH 5DEJA 2E47A 4UI2A 1YY8B 3CFJA 2ESVE 2X09A 4R5XA 4NAJA 4TSBL 5FOJA 3E6HA 4PJXB 3PF2A 1S9YA 3QA3A 3K72A 3QDAA 3ULUH 3M7FB 3FTVA 4M8RA 4FLSA 3PL6B 5GRYA 5ESQA 3DK2A 4RAUA 1YN6A 5KBKA 3MLTB 1CLYL 1M2OA 3OWEA 4NUQA 3TBVB 3DYPA 5CSZA 2O6CA 3H4FA 1MJUH 3N1GC 4HOZA 3E0CA 3SJLD 3B5TA 3D8MA 2BOLA 4BSJA 3H6AA 4N86A 4APXB 4PP1C 4WWKA 4PTTA 3MMYA 3BPOC 3QWRA 4XGZB 3FT4A 1YYMH 4N2DA 5CBAA 4ZFFA 4GH7B 4YSOA 3HE7C 2A77H 2EE0A 3QUZB 1XF1A 2PUQT 1LO5A 4FLRA 4L05A 1U4EA 1OZUA 2IG2H 3QJFB 1IAIH 1X7SA 4FS0A 4ODTH 4AQEB 2HP4A 3LKOA 1JERA 1KGXA 4LOVA 3UP1A 3FUEA 3K8LA 1N6UA 1M2VA 3S37L 4KV5E 3IMSA 43CAB 1OAQL 1JNNH 2VDOH 3VXQA 3ZKQD 1FAIL 3FH5A 3SPVB 2BP8B 3U30C 3MUNA 5FKTA 4BXSV 3OAYH 3WYRA 4TV3A 5L2KE 3IRPX 1ZT4A 2YLKA 4KKBC 4N0RA 3S3PA 3CH8A 2MPVA 3BJ91 4TXVB 5GJSL 3AQDA 3MV01 3Q5YA 2H32B 1LD9B 2CH8A 3TYFB 2DL9A 3Q01A 1IC0A 4Z78B 2LFEA 4AGOA 4WU7A 2AGYA 3BKML 1K4DB 4IMKC 2NNCA 2PO6C 1NCWH 1SEQL 3LN5B 3PDDA 4UYPA 4UYQA 5DRZA 3T0EB 2HTLD 3LXBA 1MVUB 4NSKB 4B96A 4JJ5A 1A4CA 1UOWA 5DRNA 1TJGH 4YDIH 3BWAB 1SBBA 2W0KA 1FL6A 4KI5C 1GKOA 4NHCL 3BKCH 2GJZA 5DZPA 3DV4B 2WNGA 8CGTA 1IKOP 1IL1A 3I6KB 1SMDA 1OAXL 2MRYA 4KY1H 1J1OH 3ZE1E 4WTZA 3OXSA 2CWRA 4IRSA 2E76C 1RUMH 3AACA 1RPUA 4TOYH 2A9CA 4TSCH 3MGTA 1OSZA 2E4TA 3QNZA 4J0WA 3G08B 2X6VA 1BXUA 3GWJA 3ZTEA 3J2PA 1G9MC 1KZYA 1ZD6A 1R5IB 1XAKA 3U79A 3A67L 3GSXB 1FH2A 5GS3A 4FLOA 4H8PA 3TNNB 1T22B 4NUPA 3LS4H 3LQZB 3OD3A 4K5NA 4L37B 5LN4A 3UMNA 1N5AB 4RAVB 4XX1G 1RZIB 4MDIA 5FXCH 3VRLF 4W9IC 4MCNA 2QSTA 5JOPD 1HI6A 1CL7L 3QFGA 2NY3B 1GGTA 1X9UA 4F7CB 1RMFH 3EJZC 1M9SA 5SWQA 5I0VA 4XBPB 3ALPA 5FF6A 3VWKB 5BO1H 4HK0B 2JJSA 3MRGA 1XF4A 1EDYA 3T1FB 4L8DA 4ZOVA 1U2CA 4DW2L 1RVFL 5IHUH 3KAAA 5CO1A 4HKXB 3EYSL 1P4BL 4X4YB 2HFGL 2XWXA 3DX2A 3H56A 4PJHA 1JUFA 4G8FB 4NFCA 3MCYA 1JTTA 1QYGH 3SDXF 2K6WA 1IGYB 3WD5H 2CK0H 1URIA 4ODUA 3AFLA 3ULSA 2G9AA 4MB5A 1T66C 1UD2A 2X4RB 1QO3A 2ZUTA 3W11C 5BVPH 3E6FA 3SGDI 2FJGB 5ICXB 3ZUNC 2CDEA 3HG1D 5F1IA 4W9FC 1PX3A 3KJ6L 4BUJC 4TLSA 5IVZB 1I1YA 1KBGL 2GT9A 3AXIA 4XMKH 4DO6A 1YMHA 1UD6A 4FABH 3GYRA 4MD4A 4X6DF 4WFFE 5C0DA 1DQLH 5LBGA 3T3MF 5J11B 3O9WC 3LH2H 1BQLH 3HC3L 4I0CC 5B7FA 1PAMA 2BC4B 4AMXA 3ABGA 2WINA 3TFKD 1VIWA 3DBXA 3QUZC 2FO8A 5D71H 3QEUA 2E9WA 2X1PA 3WAKA 3L5WB 1HSAB 1X4YA 2NUTB 4NZTL 4HS6A 2CRZA 3NCEB 2V2XB 4HJJH 1JMXB 5IEHB 1PF3A 1I8LC 4A08A 4WDIA 3QUXB 4JFOB 2VLJE 1WZ1H 1K3IA 3ROLB 4XO8A 1KPVA 1HZHL 2I26N 2ZNWA 4GG6B 1KXVC 1RJZA 3KJ4B 4J7RA 4QHPA 5DVNA 4GBXD 4P2OD 1FFNB 4NO5A 2UWEB 1VESA 4P48A 2QHRL 1WFIA 3DRTA 3KXFA 3LKNB 2ITCA 4JFEB 2I9TA 4PWHA 2CE8A 1LHZA 2Y22A 4HJ0D 3IGAB 4EIZC 3T0EC 2BXYA 5CIPB 1AD9A 4XMPL 3ARBD 1VB9A 2GK0B 2VH5H 3OX8B 1T80A 3HC0B 1E50A 5ANMA 3G6DH 5DS2A 4PI0A 3WJJC 4KKPA 5D7LE 3D5OF 4QT8A 2BNQB 2IQ9L 1JGUH 1PSKL 5FGSA 1TPXC 2JKLA 4QXTB 2ZE0A 5K69A 1K85A 3PGDA 3RIFF 4ZMZA 1IT9L 1E7UA 3FAWA 1GZQB 2ARWA 3BAYA 2R29H 3PVUB 4ANWA 1ZLSH 2ZWNA 1OEZW 5EIVA 2Q3ZA 4AQOA 3NJHA 5AW1B 1MREL 3DETC 2XVGA 2VDMA 1S7VB 3MBEB 3IDNB 3WTVA 1OSPH 3BUTA 5IFAH 1B88A 2H7WA 2Z35A 1EXGA 2NY3C 2JKWA 3QJTB 4IGBC 2EIDA 5FGRA 3VYNA 5FKPB 1AO7A 4HWZA 1UUSA 3VWKC 2DM2A 1FNSH 1FZOA 1ILSA 1MCHA 5FKAB 3TH2T 4HJUA 3PY9A 1F42A 2XTSA 5KYXA 1JL8A 3DROA 1CD1B 2QQLL 2F5AL 4OZ4A 4JM4L 1UM5H 4Z0BH 4NOFA 3MYJA 1OGAD 4QT5B 4HFUL 4GMTH 5CGYC 3ZDWA 4AVHA 1R5WA 3HZKB 1PQZA 4X8JB 4W9JC 5AYUL 1FYHB 3TH4T 1RI8A 4YSRA 3UXFA 5AFAA 4OGYL 3V0VA 3D25B 3TBWB 4M48L 3FQWA 3D3VE 1AGCB 1QI4A 1DVXA 4U6HB 2IDFA 4ZAKA 3D06A 1FYTE 1G9NC 3B3BA 2CJUH 4XPHH 2EH8H 4Z95L 2G2NA 5GGSY 1E43A 5J11C 1AYOA 2V8LA 4U6XA 5JW5A 3UG5A 2DQUH 1T20B 4KJPD 4Z3TA 4JQIL 2A1WH 5FUOH 3RWDB 5EU4B 5FYLL 4B7LA 2DM3A 1KN4H 3IBEA 5EIIG 3CN2A 3FQNA 4NM8H 5TQ2L 5IFHL 2XTJE 4MVBD 4JCWA 5DURD 4X80H 2AXGB 4E0RA 3PQYD 5JDSB 3N44F 1BVNT 3MFFA 1QSEA 2J8OA 4FFTA 3RWGB 3L9BA 2XZQL 1P1ZB 1BLNB 1FLRH 4FFWD 3ZN6A 4M6NL 1AG0A 3CSBA 3PV7A 3QUXC 2XRAH 3GSRB 4L9LB 4PJFA 4XO9A 5GRUH 2XWDA 4AYID 2W65A 5I1DA 1UXSA 4LP4A 4X8CA 1Q9OB 3ZYIA 2P5WB 5LWYL 4MWFB 3ARZA 5EU6B 5T1LD 3ARWA 5BQ7A 4FG4A 3QR1A 4YIQA 1TZIB 1BZ7B 4WKZB 4UUJB 2BJMH 2WNXA 3DUSA 4PJ9C 2HH0L 3GIVA 5D1ZI 3WNMA 3DWTA 1B4TA 1IGJA 2WQUA 4KKCD 4TULL 5CINH 3A0FA 1KTDA 3X13B 2VDRB 5KANG 1MZYA 3CDCA 4KVCH 4CY5A 3H0TA 1XDTT 5BCAA 3RLSA 1D7DA 1UZ8A 5C3TA 5TDOA 5CFAA 1XX9C 5SWZA 3V4VB 1A4JA 5DEGA 1UGNA 3WL9A 2MH4A 1FORH 3S3CB 3FU5A 5IR1B 5EMJB 4I5BB 2HLFD 3QCUL 3UMTA 5T3ZH 3VG9B 4LDOB 3DSFH 3H7BB 4I88A 4NI6A 1K2DB 1LEKB 4HCIA 4OZGE 1A7QL 1L6XA 3NIDB 1B90A 4P9HC 4HHAB 1NBZB 3VXOA 3EJTA 2ZQKA 4GQZA 4W9LC 4WSKA 3U7YH 3JUYA 4X4XA 3FFCD 3BZDA 4XNYH 4AGLA 3N9GL 5F1NB 5C0AA 2JCWA 3AVEA 1P5UC 1T7XA 1BZQK 3FN0L 3MBEC 2XX0A 4FMKA 2ZZUT 1NAKL 1QABA 4DCQB 1WWAX 2VR6A 4KMQA 3SE8H 3QIWB 1CFTB 3CX5J 5C2VB 3E7JA 4GRWE 1E8ZA 2F8XC 5AW4B 1JCVA 2YRPA 3PLYA 4CKVX 4IDJH 3QUGA 1HHKA 5F7FA 3C87A 5CCJA 5K9OB 3CCHB 2IPKB 1CXHA 4Q52A 1D2OA 3GMNA 1XCQB 2VABA 4KWUA 4X4KA 4JFFB 1GS7A 3W3BA 2VDNA 12E8H 2WQSA 4I48A 3VXRD 3QR0A 4LNVA 1B9ZA 3QEHB 5JXAL 1BEYL 5D5MB 2ED7A 4U1GB 5KYNA 3QDGA 4IOSD 1MHCA 3S3BB 1WIPA 4DKFH 1CLVA 1P1VA 2VDLB 3P2BA 1ETZB 1KTBA 4JUTA 3TIEA 5CZVL 2FHFA 2CLVB 2R0LH 4GI6A 4R5VA 1BOYA 4OFQA 5H2BA 1CICD 1ED3B 1DBJL 1WUZA 5BRZE 4OZIF 1UWXK 4TUKL 5F96L 1QA9A 2FB4H 3CSYA 4N2FA 1DJYA 3RDTB 2R9HC 4ZMLA 3DDUA 2EILB 1LK3H 5D9SA 4YDLC 1MQKH 1MEXH 2D3VA 3B2VH 1NINA 2YEQA 2ZP0T 3FH8A 2TRCB 1CF8L 4J73A 5F7DA 4HS8H 2EDXA 2ZAHA 2E5EA 5BZDA 1RPKA 3JWDC 4HVBA 1EAOA 3QQ3B 2WQAA 5BQDA 3EFOB 4L9LC 5JQ6H 2WP3O 5E9DE 1J11A 1H0DA 2X4UA 1YQVL 3ARFB 1JPTL 2DJMA 1C5BL 3WBDA 5H35B 3ARDD 5F3BB 4BKLB 1NLBL 3ZSSA 4NPJA 4C54A 3SHSA 2AMGA 4ZO7A 2FR4B 1RZFH 1UJTA 3WFBL 2P26A 2X44D 4N4YB 2ZX8A 5ADOL 4FFVC 3UJIL 1YMMB 4QPEA 1MCJA 2CG9X 3KBHE 2RH0A 3KBEA 2YPVA 1KEGH 4G6AC 1SHWA 4ZW7A 3UL4A 2HJ4A 5B38A 4CDGC 3T77A 4G80A 1ES0A 1KEML 2QQKH 2OVPB 2EEBA 1KCWA 1MNUL 4LU5H 5HYJE 1U8JB 4J2QA 4NRYB 2B5LA 1ITBB 3TBCA 4KK8D 3V0GA 1TTFA 2Z1KA 4NN5B 5LB1A 1J0HA 3ESNA 3TYGL 1AR1D 1WG3A 2HKFH 4ZQTA 3VG9C 4QRPD 4XX5A 3JYBA 1N8OE 3W9EA 1ERJA 2W95A 1UB5A 1SF3A 1VZGA 4JGJA 1DUYB 1I7TB 2XWBB 4NPYB 5DZAA 3TJEL 2RCSL 3VU1A 5DRXB 2Z31B 3IXAB 4GM9A 4NENB 3EH5B 1H8SA 4OT1L 5JHDD 5C0GA 2EXTA 1CD9B 2FBJH 4A6YL 5DLLA 7PAZA 4JO1H 2JMRA 5TDNB 1MIMH 2VMDA 2ATKB 4PV9A 5JQHC 3SB3A 3ATEA 3ZIMA 4A7SA 4PIBA 2DEYX 3QIWC 2RQEA 3M45A 5CJXC 3EYOB 3VD7A 3G5XA 4BA0A 4YFLF 1B3IA 3V5KB 4FADA 1NC2D 2YZ1A 3GREA 4OFVA 1ASQA 1JF6A 2X6AA 4YDVB 3PJLA 2VISB 4MA8H 2R8SH 1G9EA 1ECYA 2O5ZL 3BKYH 3V4UL 4M8QB 1E67A 1V7ML 2TRYA 5IIEA 3REVB 2BP0B 4NKMA 1EUUA 1QNZL 1U93B 2C9QA 3GMOA 3SGEH 4MKMA 4OF7A 4JDEA 3F3PA 1UEYA 4KXCA 1EXUA 2P8PA 4UM9B 4QY8A 1IC4H 1U41A 3KGTA 4NBYB 4U1GC 3K1KC 4PJ8B 1RZKC 4DP1X 5HXMA 3NSJA 1NSNL 4JHNA 4WFGE 3UP6A 3NAAL 2CHZA 1M05A 1RJYB 3EO1B 4UMSA 2E6PA 3VXTB 2W91A 1QEWA 2OMXB 4GG8A 1CDBA 2V5MA 1J8HD 3O4LA 1HYSC 1ORQB 3QULB 3KLHC 3MRHA 3FNKA 4WHTA 4AEZA 2DWEB 3LKQA 3VDCA 1LP9F 3CX5K 4O2WA 3VSVA 3MJ9H 4XNXL 4XXDB 1D9KD 2NQ3A 5LGHL 1A1MA 1VYHC 4EI5B 3RJOA 4QWWC 4CSSA 3ZDZF 1JGEB 3P2TA 4PRDA 3UBXA 4RMRA 3GUTA 2DIJA 4XMUA 5F9OH 4GRLA 4P5MA 3QORC 3IURA 1RFDL 3EOAB 2EIMB 2WQ8A 4H4NA 2ZKXA 2GFBB 3GGWA 1MWAA 1UM4H 4DGUA 3D0VB 3MJ9A 2B5IC 1NUDA 4N5ED 5ACZA 2R2HB 2VZ1A 5KAQF 4A0AA 2QQNL 2UUDH 3FONB 4OM0H 5AUMA 4QHMA 1PLGL 1IAKA 3UG3A 1ZA3B 4FQCH 3T3PA 1JI2A 1JRHH 3UTOA 3SPHA 2ODIA 3PHAA 4XOBA 1U8OA 3BT2H 2FX9H 3CXHK 5M5RA 2KKQA 1UVQA 4G1MB 4UWQB 4XTRC 3UEZA 2Z93B 3Q2LA 5I6PA 3FT1A 1TZAA 1TBGA 3H2PA 4M7JL 1YEFH 4E9WA 1MRCH 3K71B 5D8JH 2VR9A 2IAMA 3V7AG 3HE6A 4IEFA 4KRPD 1EO7A 3RX8A 5CJ5A 1KCSH 3S36X 4PJ5E 5FM5M 2ITEA 3DKHA 4PN6A 2ZXCA 1FVDA 4NN5C 1TU2B 4ELDA 9CGTA 3VXPB 3Q9QA 1A6ZA 1DLHB 1ZAGA 1ZHLB 4E54B 1XMWA 1YEHH 5MENA 2CBPA 3I7KA 2XZCH 2OSLB 4HOMA 5L88L 2WLKA 4ONGH 1FE8L 1KGWA 2GTQA 4AJVA 1P7HL 2Z31C 3MUGA 2I0RA 1AJ7H 4RISL 4DSYA 5H94A 5HVHC 1XH3A 3T0BA 4XMVA 4QI3A 1N7MH 1TQWA 4OZIE 3BHBA 5FFLA 4MBRA 3RWFA 1V05A 4G71B 1FGNL 5DJ8B 4OGAC 5AZ2L 1GP2B 2LHAA 4D8OA 4EN3A 4EQ3A 3QCVH 1DN2A 4H1LG 3VH8B 3WG7B 1IKNC 2LW3A 5IEKA 2MSPA 1ZXQA 4KHTL 4X6FA 1OT1A 2R59A 4QR7A 1NOFA 1JPSL 3WJJA 5CHNA 3MA9H 1NANH 1ZVYA 2EVHA 5CR8A 4MTMA 1YPZF 1SJHA 3PIQA 4NGHL 2P49B 3NDZE 4R2GD 3BH8B 2DBJA 3MOBL 2G2PA 1UZ6F 1MFEL 3UPAA 3VE0B 3MV8E 2H6KA 5H14A 1XZWA 1SGKA 3G5VB 3OKLA 4I1RA 4O2EA 2KYIA 3WNNA 5EF2A 4BH7A 2B0SH 4G1EA 4PJ8C 2R0WL 2CDGB 5IMMA 4V1DE 3LZQA 1AKJB 2K3TA 6CGTA 4F7MA 2W38A 1QFSA 1R24A 5B8CA 2AGXA 2IH3A 4Y2OB 3V6OC 4HEME 2Z92B 1PZ3A 5TE4L 4F57H 3H42H 4JO8A 4ZUVB 1YG9A 3ILQD 3NACL 4WHCA 1NC4B 2CA4A 5PAZA 5SX5K 4EI5C 2XSKA 3H9SD 2VQTA 4RA3A 4WW1A 1MG2A 2Y5TB 1CZ8H 4YHMH 3FQYA 1IBFA 1HL9A 3RUGB 2ZOOA 3QQ9D 3UTSA 1F4XH 3ECWA 3L3GB 4O45A 4A11B 2J4WH 3EI4A 4ALAC 3UTTB 1VZHA 3WTYA 5BOZG 3CNKA 4ISVB 3HG0A 3RVXC 3U4YA 3CDFA 1IKFL 3F65A 3UX9B 4TZ4A 4HK3N 1UGKA 1AG6A 2IH1B 2IV8A 4FXLA 3U9UA 3Q8CA 3HNVL 3RU8H 2F74B 4LXFA 4JDZB 5BO0D 5IT9g 2PTUA 4WK0A 2VM9A 1CIUA 4F9PC 5IC7A 2DQDH 3EYFB 3MBWA 4OQTA 3WS6A 1WEJL 4NQDD 1KG0B 4N87A 4MNQB 3P9LB 4XRCA 3U4EB 5E4AA 3WS3B 3BEVA 3OKKB 2J6EL 4HJIA 1IIKA 2WO2B 3ARSA 1QSVA 4FNLL 4OVVA 1GGCL 4K7PH 1CE6A 2AZAA 3Q0HA 3B5HA 4KK9C 2D03H 4M3JA 3MLSL 4FTVD 1BVNP 2QADD 2UYLA 1JZHA 3PWVB 4GSDH 1UCBL 1L3NA 2AABL 3GIZL 4GKSA 4O5LH 3C5ZC 1BQSA 2VMJA 3U4BH 4L2LA 2A4EA 3VG0H 3PUUA 4MXQC 3VI3E 3ZHDA 5ITBL 1QBML 1AYRA 1MCWW 1YCSA 3A4FA 2ZCLL 4M7LH 5FYJE 4M1DH 4ZX5A 3ZTNL 1EO8L 3HTLX 1A47A 2C9PA 2IXQB 1E3XA 1BJ1J 4YHIB 2ILLA 3DI3B 4XNAA 3KYMB 3SD5A 3RPBA 3IJYB 5C6TH 1XSOA 1HQRB 2X2HA 1PKQB 4Z7QF 2VAAA 4KMTH 3WKMH 4ZG1A 3KPRE 2PWFA 2X4TA 2ITFA 3ZDZE 2UZIL 5J57B 4CMMB 4MFHA 3LDBC 4MJ2A 3BVNA 4HUCA 1AD0B 3GI9L 3ZHNA 3HR5B 1AGEA 1W72H 5DI8B 3N43B 5IFJB 1OM3L 3DTXA 2W80C 4WJKA 2F8VA 2VLKE 1BDYA 4U3HA 4WEBL 5EBGA 1S5HA 3BQUD 5HHXL 4GIAA 3K26A 1H3VA 3N1MC 3V95A 3FTWA 1SOSA 3QZWA 1YEEL 1PNDA 2XN9D 1KGYE 3N85H 1EGJA 2B15A 1Z32X 2VXVH 2EP6A 4O58L 4PLKC 2AK4D 1P4IH 2UV3A 3CFJB 2ZPKH 1N67A 1ACCA 1W72A 4ZUUA 1UOQA 3GFCA 3E6HB 4MYPA 1S9YB 1NCUA 3QA3B 3K72B 1H8LA 2BSSA 1GIGH 3EHBC 3QHZH 4H8VA 4TNWK 3F2LA 5ESQB 2VM3A 3HC4H 4RAUB 1YN6B 2N7BA 1CE1L 2QJDA 1NUGA 1JZ7A 5CSZB 2EEXA 4IKJA 1WS7A 2RGSA 1SM3L 4JPSA 2ZUUA 4PW3A 5DJ2A 5F8QC 4Z7OF 1AHWA 1OY3B 4Q2ZA 4WWKB 3C8KA 3V7DB 4PTTB 4M62L 1RY7B 4GJTB 1Q1JL 3V4PL 3WUWA 2G75A 3FT4B 3AM8C 4UAOB 5CBAB 1MAMH 4ZFFB 4L1SA 3GFUA 5AB9A 1LO5B 2JCCE 1VRSA 4BKTC 4Q9CA 3LKOB 4HG4K 3CXDH 1GVIA 3MCKA 5I8OH 1FH5L 1M2VB 5ES4B 3NTCL 3F7VA 1Q9WA 2YPLE 2HFTA 2HLEB 1IC7H 3VXQB 3ZL4H 1JNHA 1B2WH 2Y36L 5FUCE 3Q06A 4HDIA 1QSFE 1ZT4B 2Z64C 4NFDA 3RRMC 4UT6H 2EDLA 1B9XA 1YECH 4ESKA 1YAIA 3N50A 4PJDA 1E5TA 2AGJL 1MHHA 4DO4A 3TWCH 4FAVD 1G7JA 5EOQL 4WU7B 1XL4A 2XOTA 4P4KA 2JLLA 4Q14A 2OZ4A 3WNJA 2FGWH 5DVKA 1IFHL 3RURA 5DRZB 1JDDA 1EHNA 2QFRA 4XP9L 3FFOA 4JJ5B 5D7KD 4ZX6A 4UT6A 3D39E 4F24A 2FDBP 1MG3C 5DRNB 5JHBA 4KDWA 3MLZL 3TZVD 3V7MA 4EJ1C 3I3BA 2E9JA 3BSZL 5DVMA 1FL6B 2GJZB 1JZ6A 3S88L 5DQDH 2NNAA 5CJQH 1IL1B 2XTLA 1XFPA 4K4KA 4I3GA 3WSQL 1NWOA 3TV8A 3OXSB 4AUUA 4F15B 5C0RL 5KSAA 4IRSB 4BQBA 3U46A 4L8SA 5LGYA 3MGTB 1OSZB 3QNZB 4N2LA 4X83A 5AVZB 1EXHA 4G6JL 3T0AA 3OF6A 1KJVA 4H1LH 4ABQA 2AJUL 4OBRA 4TUOA 1TF4A 2VE6A 4FG0A 2NR6A 4A2FA 4Z7NF 3RKPA 4IKLA 4QJ3B 1UYWL 2OA9A 3INOA 1K6QL 2VRKA 4XCCL 2GI7A 5FO8A 2YMXH 4D7BA 4MDIB 3H1ZA 1WFTA 1QFOA 1CQKA 3TM6A 1HI6B 1A7OL 5HJ3A 3SO5A 3SPGA 2ICEA 2R56H 5SWQB 1X44A 3LXCA 4CU6A 5FF6B 1U3YA 1OKEA 1XT5A 7TAAA 4J81A 2BIOA 4JFQA 3MRGB 4J3TA 1J8KA 3KPTA 4W9DC 3QFJA 1XF4B 3BUDA 2PN5A 4L8DB 2J25A 4N3TA 2XETA 3VMOA 2IMMA 1KT2A 3MXVL 5CKAA 1XO8A 5F88A 4DQAA 1AQ8A 4PJHB 1JUFB 3WTTA 2Y7SA 4RE6A 2WLLA 4R4FH 2OL3A 4RBPH 1AC6A 4L5FL 1MFCH 4ODUB 4P4RA 3ULSB 1QO3B 3C60D 3E6FB 3LRSA 1BQHG 4MD0A 2CDEB 4UTCA 5F1IB 3Q43A 5BS0D 1I1YB 2GT9B 3PE7A 1YMHB 2O5YH 3GS7A 5IMOA 4I3RH 1WD9A 2O9KA 2NZ9D 3AT0A 4MD4B 5C0DB 4WWKC 1ZLWK 2NY1D 3IU4H 5BW7A 3ULUC 2AP2A 2FAUA 4UAOC 4QL1A 2AJVH 4L5FE 4FQJH 3QI9A 1UXWA 1CVRA 2WINB 3ARRA 1XXFC 3DBXB 1SLUA 3FH7A 1EANA 2PR4L 3QEUB 4MMXC 4WUUE 2COVD 4JFTA 5J9PA 3INUH 1J88A 5IOKA 2P9LC 2EIEA 4HS6B 3GPSA 4MB4A 4K3JL 1MFBH 2WMPA 4K7FA 3ALXA 4YSTA 3CLFL 1KCRL 2Q10A 4WK4A 3GMLA 4A08B 1Q0YH 2X4NA 4WDIB 1NWPA 2WBKA 4JL1A 1L9SA 4UIKH 5B1KA 1KPVB 2XN1A 4Z7QE 1RJZB 3U2SA 1FNLA 5CGTA 4JM2A 4JVUA 3BYTA 5GRWA 3MX0A 2CE9A 2GIXA 4NO5B 3KXFB 3DRTB 4FYRA 4D9LH 2MQGA 2ITCB 4DN3H 4F9LC 2I9TB 3ASWA 4MMZA 1IB5A 4NZRH 3LPOA 1U2HA 3DSNA 3K6FA 3RX5A 2VR7A 3LZFH 1AD9B 4KRNA 4Z8LA 4KI5F 4TYUA 1AQKH 4JT6C 5ANMB 2DQGH 4UZSA 3VRIA 3BOVA 4YSCA 2PYED 2X9ZA 3ABLB 3OSVA 1E3FA 4JLRA 5KBDA 3V52H 2YNOA 3SDDD 3UPCA 2K7QA 3PGDB 4MAUL 5I9QB 4F15C 2NY6D 4IRSC 2J8UA 1RKRA 4TLUA 1CLYH 2WQXA 2B3IA 5IQMA 5JQIB 2Z8WC 3R1GL 1U91A 2DTML 1BA9A 3DOHA 3O6ML 2A4CA 2VJ0A 4QTIH 4W1TA 1QW8A 5E2TL 1BF5A 3RQ3A 4ZUTA 5CD5D 2MNWA 4ZW3A 4I3SL 1IFGA 1L9NA 2VDMB 4IIQC 4RH4A 5I71B 1L6ZA 4QGYA 4RSYA 5EOCL 4G6KL 3KZ8A 2CIIA 2P48B 3CSGA 3S96A 3I8EA 4TPRL 4LPCA 2Z35B 4R4ND 4R8WL 4QXGH 3RIAK 3S37H 1QBLL 3KPPA 1EAJA 4TNWF 4OGZA 3ZT5A 1OAQH 1AO7B 1BQKA 3QHFH 4HWZB 3JWNC 3FUFA 1FZOB 1MSPA 3ELAT 3U1PA 2JJSC 1NIEA 5EDXA 1RIUL 2X3AA 1U3HD 1JZDC 4HJSA 5DJ0A 3DROB 5KYXB 4GGAA 3FB7A 2YMTA 2CMRL 2NY4D 4BQ8A 5GJSH 1EHLL 3WO4C 3F01A 2WXRA 2D3LA 3CZFA 1KWGA 3MYJB 3CVIL 4JAMA 2FD6L 4XC3L 4PJXF 3OKTA 5EC2A 3MKSB 4ENZA 1R5WB 4O4YL 3DI2B 1PQZB 4NUGL 2KZKA 3VFRA 6FABL 3SE4A 3SQRA 2YBRA 4XN8A 4AL8C 3V0VB 4DP6X 5C2WB 3FQWB 3P2DA 2KLTA 1WA0X 2XWZA 1OCCB 1XF5A 2V2TA 4ZAKB 3BUPA 1VJSA 2NYYD 4NHCH 4QRUA 2B4CH 4OLXL 4L4TE 3RL2A 5CEZL 3VXUA 1Y6KR 3J80g 1AQMA 4FKHA 4U6XB 2GI0A 5JW5B 3VXSE 5CZXC 3SSGA 3WEOA 2QMJA 5B3SB 5BUPA 5I2IA 3NIGA 5E95B 3LQAC 5A7EA 3S2CA 3QJRB 1NBYA 2ZOWA 5CWSA 3RIKA 1AR2A 3FQNB 4E0RB 2H26A 4ZMXA 3LHAA 1RV6X 5BZWA 3A67H 3MFFB 4AGMA 1NM9A 1QSEB 5D1QA 2VDKL 5CEZE 3UAFA 4Z7NE 1JK9A 5J6GA 4NN6B 4LOFA 4PJFB 2OJ1A 4RNRA 2W65B 1CL7H 1L9OA 1UXSB 1Y6NR 4TS6A 4P5SA 5I1DB 4H25A 4KNTA 4HUNB 2X2YA 3LEVH 5I5RA 5C0BD 4X8XA 4R90L 5BQ7B 2P5EA 3B9KA 4YIQB 2PM6B 3UH8A 1DEEA 3DUSB 3GIVB 4YDJA 1IGJB 1JOFA 3R06A 4OF6A 1KTDB 5D6CA 3EYSH 1P4BH 2HFGH 1X3DA 2VQ4A 2BLFA 4EEEA 3SGDH 3CDGA 3NABH 3H0TB 4M00A 1WO2A 4N20A 1Q1PA 1UZ8B 5TDOB 1TZOA 4FC3E 5SWZB 1A4JB 5DEGB 1RUQL 1FN4A 1KLGA 2JB5L 2NSQA 3WL9B 1F8TL 5IY5B 2VRQA 4QOKD 1HH6A 1NKGA 3X2QB 5BRPA 3T5WA 5I9QC 4CI8A 2DD8L 3IPBA 2FSEA 3TF4A 2Y0SA 3DXAE 1RZ7H 3GB7A 3B9DA 2VXSL 1KBGH 1KIUA 3HJ0A 3B8YA 4OZUA 3FF8A 4GNKB 4YR6A 5GGTL 1ECZA 5IVXE 4BJLA 3ZKND 1MF2L 3NVNA 1E4HA 5I1JH 3QJSB 3VXOB 4DJMA 4PR5A 3CBKB 3KM2A 4JGMA 4X4XB 3HC3H 5C0AB 4KNUA 2H0PA 1OANA 4MD5A 4NRZA 4JFXA 4GUPA 3HG4A 4ODBD 1S3KL 2XKSA 2YBGA 5I71C 4AEIH 3C99A 3BVXA 4YSDA 5I6XC 4IKIA 4X7CC 4DVBA 2CNXA 3PAZA 3RGVA 4C55A 4P23C 4NZTH 2FL5A 2K7PA 1QRKA 3IMBA 2Y3AA 1H2XA 4FDWA 4FG2A 3VVVA 2CO2A 1QFWL 1IQDA 4C4KO 5EHFA 1YC8A 4IW4C 3MCLL 2OJZH 1HHKB 2CUAA 4Y88A 2G60L 1VPOL 1KTCA 1QFWM 2NX5D 3F58L 2E7LC 3GMNB 3SEPA 1B3JA 2VABB 3JPXA 1CF1A 2OQJA 2YWYA 4LSVH 5F0LB 1P7QA 1MCOH 2VDNB 3H3PL 4YL9A 4I48B 4G59C 4Z7WF 1L7TL 4X5XA 1XH2A 2GUYA 2IV9A 5KOVC 2D4FA 3QDJA 3QDGB 3QUML 1MHCB 1FG2A 4U1EI 5BPPA 4XMPH 3TIEB 1DSWA 3FB5A 3EI3A 4LPVA 5H2BB 1U8PA 4KITB 3UAJC 1BSIA 1EJFA 2LU4A 2HT3D 2WXIA 2C7FA 3NDYE 4ANXA 5E0FA 1QA9B 3MBXL 4G7RB 5CAYB 2LGNA 3CSYB 5DC4B 5KYUA 4EUPA 4ZFOA 5C09A 3NIFA 1IT9H 4ZS7L 1RU9L 2OZNA 2WHVA 5D9SB 1NAMH 2COQA 4AYBA 4DP8X 4EDXA 4L9OA 1TVBA 4OJAA 2E56A 2FZ3A 2H3XA 3RMZD 3A6CL 4R7XA 2J3SA 4I0PD 4LOUC 3IMTA 3I8CA 2Z2PA 5E6YA 5F7DB 5BZDB 3U0TA 1CGSL 3VI4A 4Z3JA 4YHPA 4H0IA 1I1RA 1XIWD 4NN6C 2Y5QA 1CT8A 1H0DB 1MW2A 2X4UB 3AWGA 3HZYA 3CSTA 4PRID 4XC1L 2HPTA 4GG6F 5F7HA 4F7KA 1G43A 5KW9L 2UWEF 2VZUA 3BKJL 3FQUA 1NGQH 2HYEA 1JTPA 1CTMA 3BVTA 4KJWD 4JO3L 1S6NA 3GBML 2WYHA 2F5BL 1FO0A 1N64L 4E5ZA 2DBLL 5D7HA 4LNRA 4ZO8A 2F5AH 4NIKB 4F3FA 5B38B 2ADIA 3T77B 4KTYA 4G80B 1ES0B 3IFLH 2O5XL 4HFUH 2Q2LA 1ZA6A 2WWKO 2WLZA 2XJKA 1FFPA 1DQIA 2WXOA 4U6VH 5AYUH 1AVAA 3D3VA 3ARGD 2OCJA 5T1KD 4EQ2A 1NA8A 2D0FA 1H5BA 4PJXE 2APSA 3RIAF 3RZCC 4KZEL 1DVZA 4M48H 3K8MA 2BWQA 2VSDA 4B3EA 3GZPA 2QR5A 3W9EB 1DVFA 1UB5B 3I9GL 3K2UL 4L8BA 5K1JA 1GC1L 2ZXGA 4Z95H 4P2YA 4QDGA 2VCOA 4J3BA 4ZFGH 4KROC 4L29A 1I31A 1WFNA 1I8KA 2NY0C 5C0GB 3ORVD 1WAAA 2BM3A 1IU1A 4A55A 4JQIH 2IDCA 4HZAA 3N42B 3L8QA 3GSNL 3I9IA 1OCZB 5TQ2H 5IFHH 3PNWA 4MHHI 2P80A 1PY9A 1CXIA 2YD7A 4OJCA 3D18A 4NC1C 3G5XB 2F58L 4LPUA 4D0BA 2UXFA 4PBXA 3T6WA 4C56D 3COOA 2CPUA 3ZE0A 5C3LD 1JAEA 4RMTA 5I15H 5IWLA 4Y5YC 1WBZA 1KLUA 1X9RA 1N8ZA 1X5LA 4P2QD 5CZRA 5IIEB 2EJ1A 4NKMB 3WGVB 4F91B 3GMOB 3E9UA 4N3UA 2FQDA 5TE6L 3RFHA 3AG4B 1F3DH 3NEEA 4JDEB 2NXZB 1K5WA 1R0AL 3GKZA 1EXUB 2P8PB 3C5XA 3T0VA 4QY8B 3WELA 3SQOL 5FB8A 4XEIC 4TTGA 5CXPA 1FNHA 4TULH 4QRPE 3CFDA 4JG9A 4PJAA 5DZOA 2NOYA 3I6GA 4RX4D 4N1HB 1M05B 3T0EE 2D7TH 2X38A 4M43L 4B53A 4GW5A 3QUHA 1QEWB 3HW7A 3DX1A 4GG8B 4WEMB 4WU5A 1OD7A 1QWHA 4Q0XH 3O4LB 4IRZA 4JRYA 5J13B 1MI5D 4HSAC 4NNPH 3MRHB 4WHTB 3EQ7A 3LKQB 3IVMA 3BFWA 2VDQA 3QCUH 3ZO0A 1E4XI 2ZXEB 2X2JA 3GBNL 2XXGA 1FF5A 1A1MB 1CXFA 2F8IA 3VFWA 1A7QH 3IMVA 4GRWH 4PRDB 3UBXB 1P4LA 3BN9D 3BVDB 3CWGA 4K2UL 1KSRA 3GUTB 4GRLB 2ID5A 3NFSL 4P5MB 4A2MA 4X60B 3CE1A 1H3TA 3GGWB 5CEXA 1MWAB 2R69L 5AOKA 1O5DT 2PWDA 5ACZB 4HXAL 4A0AB 1UT9A 1F58L 1IEHA 4DQOL 1WZAA 1NAKH 2OPCA 2Y2TA 4ES9A 2H68A 5AUMB 2H3NA 1XSIA 4QHMB 2WM0A 1IAKB 5TPWL 2FT6A 3HZMA 4P9ML 3T3PB 1JYXA 2MCMA 1WIUA 3PP3K 1A22B 4Q9QH 3HUJF 1U8OB 2FEEL 5LNDA 1AXTL 3WN6A 1UVQB 1ADQL 4OJFL 1BVLA 2KDGA 4DP0X 3FB8A 1JVKA 3ILEA 3QDMA 1IEBA 2B8OT 2FEEI 2F2HA 3FB6A 3E2HB 4ABWA 3BLPX 4N0YH 2MWCA 2IAMB 2QPUA 3DA0A 3HE6B 2DLEA 4IEFB 1BEYH 4UT7H 2LABA 4XAKD 4BFNA 4XB7A 1YHPA 4EI6A 2W88A 4WNSA 4B27A 1DDTA 1FVDB 3QWNA 1OTTD 4BZ1L 5JDJA 5T5FL 1A6ZB 4P5KA 4NQUA 2DQTL 5MENB 2VJ8A 3NIDF 3ABKB 3GD1C 1DBJH 5J8OA 1SN0A 4XWGL 1OALA 4CADA 4NDMA 3RN1D 4X5WA 4OB5L 2J20A 3MUGB 3FS9A 4TUKH 4Y4HD 5F96H 1KGJA 5H94B 1XH3B 3F7LA 3F84A 2GW5A 1S9WA 4NWUL 4A04A 1SQ9A 1WJ3A 3ETSA 1KJ3H 2NY2B 3BHBB 2WTPA 3RWFB 3N2JA 1XEDA 3LNGA 3S5LG 4APQD 5HHPA 4IYKA 1CMOA 2EACA 2AQRA 4EN3B 5EOTA 2YRLA 4AUYA 5KYWA 3KHOA 5HHOA 2N1KA 5DQ9A 5IEKB 3QJHA 2LLGA 5JLZA 4X6FB 3IMWA 3BW9A 5TEFA 4KKLD 1CLOL 4LEBA 2D9QB 5CCGE 3EI3B 1U8NA 5CHNB 4PGCA 1P6FA 1JPTH 3LN9A 4YBQC 2D31A 4XPTL 5H4YA 3PIQB 1SJHB 5FV2A 5CFHA 1NLBH 4P3DA 1I7RA 5DJYA 4PB0L 4E54A 1G84A 4GG6E 2NXZC 3CC1A 3OKLB 3UJIH 4O2EB 4BH7B 2BVTA 4BEIA 4G1EB 2AJXH 1M9WA 5IMMB 4GQPH 4W9CC 4JN1L 5CP3A 3ZMRA 4F7MB 2EDMA 1XGUA 2DMKA 4K8RD 1R24B 5B8CB 1KEMH 2IH3B 2VO5A 5A2BA 1MNUH 4KPHL 5D4JA 3WJLC 3T2PA 3EBGA 5J13C 3K6IA 3T0WA 3K80A 1UASA 2BNQE 3QWOA 4PRAA 1EFXA 3TYGH 5EWIL 1QPXA 1J0JA 2ROYA 4KKZA 1NTDA 1S7UA 4H26A 4KQ3L 4OD2A 2BHUA 2V33A 3QISA 4P5TC 3KYNA 1E3ZA 4WW1B 5FHBL 4IA9A 3AMKA 5HI4D 2VL4A 4GRLC 4RFOL 5CS7A 3IE4A 4LDEB 3UTSB 5GGQL 3OB8A 2ALAA 2YAQA 4YPJA 3EI4B 3VB8A 4OI9A 1I7UA 3TNMA 4O3TB 1YVLA 1O9ZA 4H8WL 4FXGA 3UCQA 5JHMA 3T71A 3OKEA 4QAWA 2F7IA 3QG7L 1BXAA 4HPYL 1J1XL 2FIKA 3U9UB 5KAQG 1SY6L 4LRIC 3FUJA 4A6YA 2LFGA 4WK0B 5GHWH 3FQTA 2F1AA 3SIKA 3IN0A 3MBWB 4O02L 5BV7B 4PYGA 2O5ZH 1X5IA 3BG0A 3HE7D 3IMUA 3LEYH 1M1SA 4XRCB 3BEVB 3E2HC 2KPNA 3ZKXB 4FP8L 3KLLA 1L0PA 3HE6C 2QSQA 4DGVH 3BCFA 2V5SA 1CE6B 4L1BA 7CGTA 3BGFC 4X9FA 5EN2A 5CLWA 1NSNH 4HHWA 3NJKA 3NAAH 5TK4A 4LSUL 2UYLB 1A2YA 4N90D 4HEPA 4I0KA 5CBEA 2HRLA 1A65A 4KKBD 1I85A 5AKTA 5JTWA 4GKSB 5DJ6A 1IBDA 2YN5A 2GB2A 5LCVL 1WISA 1QLEB 4A39A 4XNXH 2CRMA 2NY2C 3RTLA 4LQFH 3QIUD 2IWGA 1XB6A 2SODB 4WCYL 4RWYL 2VAAB 3VD1A 4ZODA 4QIRA 3NK3A 2ICWA 4AMKL 4DOHB 4EN3C 1RFDH 2BNRA 2X4TB 4E9VA 4S1DC 5LBSL 2D7NA 2CJSA 4KI5D 3QNFA 3VFGH 1PIGA 3F6JA 4DEUA 3BVNB 4Y1TA 4BFFA 3KLAA 4TTDC 3E38A 5EUOE 1AGEB 3OR7A 3DTXB 2QQNH 2LR4A 4WJKB 1WH0A 4IU3A 2VN6A 5CGBA 4GY4A 3MJWA 4RESB 3WE1A 1S5HB 3D30A 3JV4A 1PLGH 2RR3A 3AITA 1PYWA 4JT5C 3PXHA 1S3RA 4FMVA 2Y7OA 5AOLA 1CR9H 3ATDA 3QZWB 2E4FA 4XHQA 2P45B 3FU9A 2P5WE 1R3KA 3PXTD 2MNUA 5EU6E 3NP3A 4QYOA 4BYHA 4M61A 5DUJA 4ZUUB 1W72B 5AW7B 4POUB 3VGGA 3EH1A 4LHUG 2BSSB 4M7JH 3PWPA 5D7EA 1CVSC 5IGOA 4PJ5A 1AAJA 5B8CC 1MFDL 4BFIA 4O51A 5DJ2B 5B4MD 1AHWB 2Z7ZA 9PCYA 4Q2ZB 1WT5C 3IGKA 3C8KB 5CJOH 3WUWB 2G75B 4JY6A 4U3XA 1FZJA 2W9DL 2WKGA 2AEOA 5KS9A 2YAEA 1FE8H 1NJ9A 3L3KA 4LGNA 1MG2C 4FKEA 3RI5K 2NY5C 2K70A 2XZGA 2IUQA 3NIDE 5JIHA 3BUYA 2EC9T 1X4ZA 3MCKB 3HBGA 2F7PA 3EF7A 3P0YL 1VZIA 3F7VB 1Q9WB 4PTUA 2BIQA 3V0EA 1FGNH 1JNHB 3QUYA 2WKOA 5E5UB 1EEUA 2WZAA 5IQ7H 3KH4A 3BIBX 5GXHA 4HJEA 1JWUA 2E7HA 2BOCA 4HDIB 4AUJA 3GMMA 4FQQA 5LQBL 4DZ8A 3NPSB 3W2DL 4P2RA 1JHKL 1DQVA 4WI7A 4PJDB 2HJKA 1MHHB 3O9WD 1WAEA 3TEYA 3MV7A 1JPSH 2R51A 1G7JB 1RUAH 4JHVA 4Q6KA 4P4KB 3WS6C 5BV7C 2X87A 1AZNA 3GM8A 4HWBL 4PEEA 4GS7B 1XH0A 1JVLA 1GSMA 3ZKXC 4DUVA 1MFEH 1OV8A 4JFFE 5I19L 4V1DA 4Z7AA 5C71A 4AOWA 3MRLA 3RG1C 4Y9GA 4FNPA 2R0WH 2ZXWB 2NNAB 2GCYA 4OFDA 1OAZL 5D5ME 4A2GA 4N26A 4KK5D 5I8KL 5KSAB 3FM0A 5TDPA 4AIEA 4HLZG 3DX4A 3U46B 2BW5A 4L8SB 2VXQH 1CUOA 2J57A 3OAYK 1CYXA 2YKLL 1YEIL 4DGIL 1EJ6A 3MLVL 2OJEA 4PRHD 5AW2B 1KJVB 5H4ZA 4R97B 4D0KA 2WVUA 3CBRA 4TUOB 5DLML 2BH0A 2VE6B 3CLEL 3QYNA 3N3EA 3U0WH 3I85A 2P7TA 2F8OA 1A3QA 5FO8B 2NSMA 4Y8AA 4LASH 1INDL 2ATAA 5JR1L 5HJ3B 4XPAL 4ELMA 3A6BL 2ICEB 2ZD0A 3KPSA 2PM7B 4I18A 1T0PB 1N6FA 4J5VA 3GKWL 3SFZA 2JF1A 3GRWL 4JFQB 2XV3A 1CDCA 1INEL 3ATAA 3SPIA 3QFJB 2BSRA 2OI9B 3BESR 2QXVA 2G5BA 3UZEA 5D7KE 4N0CC 5B1BB 4MRBA 5CEYA 2A6KA 1EBPA 1C1EL 1KT2B 5F88B 3GC3A 4WQOA 3HNVH 1E65A 5F0MB 3ZQXA 1J9TA 3MLRL 2WLLB 3NJLA 3OLIA 2OL3B 4G7YL 3DETD 1WEJH 4Y4FD 4QQEA 1NPNA 4P4RB 1YMME 2WVVA 1QHPA 2CBTA 3GRGA 3MREA 2UY6A 3LRSB 2CNZA 3RVUC 4FNLH 4MD0B 3DJRA 5FYJH 2IOMA 4IGBD 1GGCH 1I4FA 4RAHA 5IMOB 2YD8A 1AHWC 4Y2DA 1T5WA 2Y1VA 1K4CA 3FDWA 5ISZA 4HPOH 1DL7L 3LZPA 2CXKA 3AAZA 1WICA 2J6EA 1UCBH 3R8QA 2AABH 3JBG7 3QI9B 1UXWB 4BWUA 4CSPA 4AEFA 3IDGA 5JW3L 4FWWA 2J12B 3RUGF 3OW8A 5IB5A 2X9XA 5ITBH 1QBMH 4R26L 5CGYD 5J9PB 2D2CC 3ZTNH 5D7SL 4JCMA 4HS3A 1FHNA 2WMPB 4K7FB 3S4SA 4N8CL 2WGXA 1O9WA 5T1MA 4WK4B 1XR9A 1WWCA 3KPRA 4UDTA 2OMNA 3GMLB 2X4NB 2ICES 4BFGA 3DWLC 2BPBA 1JMZA 1P2CA 3OV6A 4KI1A 4JFZH 1WPCA 2EABA 3U2SB 1NFIA 5K9QI 4JM2B 1FGVH 1NIFA 3MX0B 1OM3H 3WXVH 2YXMA 3S9DB 3BZEA 4P4KC 3DECA 2JK5A 4MMZB 3T8VA 5HI3C 5HHXH 3DSNB 3LH9A 3RILA 4GS7C 3FO9A 4RFEA 4L4JA 2V3DA 4K7PX 4L23A 1NBCA 4GO8A 4O58H 3M1CA 1AXIB 1ETA1 4EXKA 3VRIB 4PJ7A 1LO3L 1VGEL 1KLFA 3PABA 2K6ZA 1U9KA 1FG9C 4JLRB 1RLWA 3L5IA 2GAZA 3ATFA 4ZUWA 4UMGA 1UG9A 1OAUL 4N1EA 5KSAC 4K7PY 2J8UB 1CE1H 2PCXA 4ERQA 1N18A 1LE9A 4WLCA 4JK0D 4ZPVA 5TF2A 1U91B 3V6OE 3D7PA 1BBJA 1ND0A 3NFNA 2BSDA 2XQBL 4KXDA 2EXYD 5ERWA 4JFED 4LVNB 1Q1JH 3SY6A 4CSTA 4PJ9D 2YGVA 2A6IA 3SD2A 3UO8B 2JCCA 5DD6A 2WSKA 4ZUTB 4OLZL 1XD1A 5I1EL 5AOJA 1SBSH 3MC0A 4FRWA 5EZJA 2CIIB 4LLWA 3HCVA 3S96B 4F7TA 1WC7A 4OCWH 3OKYA 2ICEC 2ZOUA 3KPPB 3NTCH 3N43F 1R3JA 2PXYD 1ZE3C 5C2BL 3V4PA 2DIAA 2CRYA 2WBWB 1P7KA 3LN4A 1OF2A 3IJ0A 2OI9C 2WAQA 2OK0H 5G4OA 3ELQA 5DJ0B 3FB7B 3DXMC 3EDDA 1X5ZA 3S3DB 2VM4A 3CZFB 4BUQA 4EVNA 4JAMB 2HJBA 1DHKA 4PBZA 2NW2A 5EC2B 3D51A 3M8OL 5EOQH 4HALA 3RI5F 4YHLL 1BECA 3VFRB 5B39A 1E8NA 2Y7NA 4M6OL 3Q1EA 2YBRB 4QKTA 4UNVA 2O6PA 2W1NA 3WIAA 5J12C 3MLZH 1N4XL 1XF5B 3H55A 1EDQA 2V2TB 4UQ2A 4OFYD 4QRUB 4QCIA 1DANT 2ENYA 5D2NC 4TL4A 3RL2B 2VW4A 3NZUA 4FQ2H 3VXUB 3ULUF 5IESL 3L3OA 3LY6A 3WSQH 1RPQA 4ZRGA 5C0RH 4PJGA 3NIGB 5I2IB 3QI9C 5SWSD 1C8PA 3EO9H 2MIZA 4HD5A 3SCMB 4RE5A 1NBYB 2OKMA 1QNIA 1LWHA 2LAGB 5CWSB 4LIQL 2G5RA 3BSZA 1IGCH 4MA1B 4EOWL 3WIHH 2H26B 2AJUH 3WUZA 5BZWB 4F58L 3LQMA 5D1QB 2G4GA 3H6JA 1K6QH 4GPVA 1DQDH 4PQXA 4XVTL 5TK2A 1UTDA 4XP1L 1NCGA 1JK9B 1NCAL 5EC1A 2GSMB 5HBBA 2NQCA 3P30H 4M7ZB 1A7OH 4RNRB 2L3BA 2XUWA 2IDTA 3LKRA 4H25B 2TSBA 1E2ZA 2XX1A 2OMTA 1NFDA 2AEIT 4JM2C 4LIQE 5DHXB 3DUUA 2P5EB 4ZFQA 3B9KB 3HLAA 1DEEB 4MMZC 4R9HA 3TN0D 1OHZA 4YDJB 3T6XA 3QZBA 5GSRA 3HNTL 3FQ1A 3UEQA 3R06B 5D6CB 2IWKA 15C8L 4XBEL 4I1PA 3HPJA 2VR4A 1F11A 3CDGB 1UADC 4Q89A 4AQZA 1NMCC 4HLZH 4HKJA 5J56B 2WWOA 3NJVA 4PHZA 4BL0A 4ENED 4L5FH 4M1CC 3CVHL 1FN4B 1KLGB 2GY5A 3KMDA 4OCYL 1CU4H 2AAAA 2AMUA 1HH6B 4AK2A 4CKQA 2FSEB 1AIZA 3GB7B 1KIUB 1UURA 4YR6B 4E41D 1GG2B 1WFMA 2D7MA 3APFA 1DVTA 1ZJAA 2EKJA 4PH8A 4PR5B 1BYNA 4LVNC 4R3SA 5KN5A 1H2YA 1RHFA 2JI2A 2WNKA 3DX9A 1KCVL 2BZ7A 4MD5B 4UILH 4NRZB 4JFXB 4GUPB 4NC2B 3O6KL 2PR4H 3TS8A 3H3BC 4DVBB 5C0BE 5IGQA 3RGVB 1DJGA 2FL5B 1JV2A 4K3JH 3RUGE 2Y3NA 3WV0A 4OZHA 1IQDB 3MACL 4AQ8A 4BXVA 2QSCH 2CHDA 1EAQA 3RFRA 4Z3FA 4XYIA 2DYRB 1AS8A 3CLWA 3UTTE 4NQCD 1R3LA 1PU0A 4JZJC 4C83A 3FN9A 2YKKA 2NDFA 5HHNA 1E30A 4X4ME 1T4WA 2YD3A 2OQJB 7PCYA 2ZOTA 1P7QB 1NIDA 3QEQD 4GMSH 3IBOA 1UD3A 3BZFA 3HG1A 4X5XB 1PMYA 2C8NA 4NAQA 5FA4A 1TIUA 2WSDA 3QDJB 3BC9A 5GS0D 3L48A 3SE4C 1FG2B 3L17A 1Z5HA 4OCSL 1U8IA 5CSBA 1SUJA 4I8DA 5IOPA