3K71A

Structure of integrin alphax beta2 ectodomain
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
1081
structure length
880
Chain Sequence
FNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAANQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPELEMAQEGFSAVFTPDGPVLGAVGSFTWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQSLVLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGAPHYYEQTRGGQVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVVIGAPGEEENRGAVYLFHGVLGPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRVLGLKAHCENFNLLLPSCVEDSVTPITLRLNFTLVGKPLLAFRNLRPMLAADAQRYFTASLPFEKNCGADHICQDNLGISFSFPGLKSLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRYVAEGQKQGQLRSLHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANVSSENNTPRTSKTTFQLELPVKYAVYTVVSSHEQFTKYLNFSESEEKESHVAMHRYQVNNLGQRDLPVSINFWVPVELNQEAVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVLDCSIAGCLRFRCDVPSFSVQEELDFTLKGNLSFGWVRQILQKKVSVVSVAEITFDTSVYSQLPGQEAFMRAQTTTVLEKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-X
publication title Structure of an integrin with an alphaI domain, complement receptor type 4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 119
structure length 880
sequence length 1081
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2009-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
A PF01839 FG-GAP FG-GAP repeat
A PF08441 Integrin_alpha2 Integrin alpha
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1460 Mainly Beta Sandwich Immunoglobulin-like Integrin domains. Chain A, domain 2 3k71A02
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3k71A03
2.60.40.1530 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 4 3k71A04
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3k71A01
3VI3A 3FCSB 3IJEB 3K72B 1U8CB 4WJKB 3NIDB 4UM9D 4MMYB 3K6SA 4WK0B 4UM9A 1L5GB 3FCUA 3V4VB 3ZDYA 2VDPA 3NIGA 4Z7NA 2VDKA 1JV2B 4JX0A 3VI4A 3ZDZA 2VDKB 3K71B 3VI3B 3T3PA 3ZE0A 3ZDXA 2VDOA 2VC2A 3K6SB 5E6RA 4WK4A 4UM9B 3FCUB 3ZDYB 5ES4B 2VDPB 3NIGB 4MMXA 4Z7NB 3T3MA 4WK2A 4WK2B 3VI4B 5HDBA 3ZDZB 3T3PB 1M1XA 1M1XB 4O02A 4UM8A 2P26A 5FFGA 3ZE0B 3ZDXB 2VDNA 4Z7OA 4NENA 2VDOB 2VC2B 3NIFA 4G1MA 2VDLA 5E6RB 4MMZA 4WK4B 4G1EA 2VDQA 3V4PA 3ZE2A 3ZE1A 3ZE1B 2VDRA 5FFOA 3FCSA 3K72A 3IJEA 4MMXB 4Z7QA 4Z7QB 3T3MB 1U8CA 4WJKA 5HDBB 3NIDA 4O02B 4MMYA 4UM8B 5E6SA 5E6SB 4WK0A 1L5GA 2VDNB 3V4VA 4Z7OB 4NENB 3NIFB 2VDLB 4G1MB 1TYEB 4MMZB 4IRZA 5E6UA 5E6UB 4G1EB 2VDQB 1JV2A 3V4PB 4NEHB 3ZE2B 2VDMB 2VDMA 1TYEA 2VDRB 3K71A
chains in the Genus database with same CATH superfamily
2YEZB 3O2WL 32C2B 4U3HA 3PF2A 3MV7B 5D93B 1SMDA 5IB4A 1ZGLB 2OXGB 3KH3A 5L6YH 2DMCA 3E9TA 4IW4C 4EQ3A 5KG9B 4PJEE 1OP4A 3MLSL 4F2EA 1YJDL 1Y6MR 5E8NA 3VTAA 3OL2B 4A0BA 1UYWH 2ZUTA 3T2NL 4JNXA 2P7TA 3O41A 4WGKA 5FK9B 3F58H 3I6KB 2Z1PA 2X4RB 4HGWA 4MDIA 5ERWA 3SODB 2QKIA 2BHZA 2WQWA 3F3HA 4R26L 5IVNA 1EXHA 1HDMB 1HE8A 1V05A 2PABA 5IVXB 2P46B 4Q58C 2K70A 1Y0LB 5BOJA 5ALBL 5J89A 4JDVA 2LQRA 2VM9A 1NGPL 1R3LB 2Z4QA 2ENYA 5D96B 5HPMA 4P23C 4HSQA 5MERA 1LK2B 6FABL 3TV3L 3DDUA 1REIA 5EU4B 4XO9A 3CIQA 1AVAA 5D7KE 2OMZA 5F9JA 4RMBA 3O3BA 4C56A 4EPSA 3W9DA 4KAQH 3MLVH 4LOUD 4JHPC 2BSRA 3AMKA 5F9WB 2P44B 3T04D 4DZ8B 2KZWA 3FTUA 4ALAH 4EE2A 5ES4B 1SBSL 5D71L 5HHVH 4CN4A 5E1AA 3S34L 4XN1A 4PREA 1SJXA 2HT3D 4RNRA 4L9OA 3UJJL 3X1FA 4CUCA 2F0CA 3IMSA 1CPUA 3AJ7A 2H4EA 1MFBL 4ONGH 5IVOA 2PWFA 3JZNA 4J81A 4X4ZA 2BNUA 2XVLA 3VXSD 5J11B 2J5LB 1XAUA 4B97A 1T89A 5FX3A 1N3NB 3EJSA 4HVBA 1EEZA 2CZNA 3BSZL 4HZLA 2VXSL 5D9SA 1DBKL 1KLGB 3UPRB 1C08A 4PV9B 4QAMB 2KZBA 3AQYA 4IBSA 1HQ4B 5KJ7E 1EVUA 1CDJA 4CJ1A 5M94B 3MUOA 3QR0A 3TN0B 2G9HA 3BDYL 5M7QA 2OLDA 4LCWD 5DRXB 1DQMH 1KTLA 1NM4A 3IDIB 4JY5L 5HDQH 2NY1B 4Z7AA 3LXUX 4ZO6A 4Y4KD 5AVSB 3EGSB 5I23A 4U1IB 3BJLA 2IBBA 4LSQL 2NYYD 5TD4A 1MVUA 4HWNA 2FVNA 3KR3L 1TETL 5HYNB 5DQDL 5H2BA 5JORB 5KVGL 3RNQB 3BG1A 3QZLA 5FOBB 1GMIA 5LO7A 3MBEB 1P4LB 2HLFD 4P4KA 4JRFA 2MMXA 4V11A 4FQLH 2WCGA 4E9WA 1E5TA 2VXQL 3BZ4B 4ZMPA 5BXFA 3SHFA 2H2PC 2ZX5A 3RUGA 4YK4B 2HYEA 1NGYA 4PG9A 3H54A 1SM3L 3L3KA 4K7PH 2WLZA 5EIIG 5IBLC 2RFXA 4QTHA 1NJ9B 3BIKA 4XB7A 4PJ9D 3CFQA 3QS2A 3GM0A 2A83A 4OLEA 3NPSB 1XEUA 4HU8A 5JIDA 5DZNA 3ELAT 2V4LA 1THCA 3TPKA 3QYNA 4ZPVA 2RTTA 2HKHH 4Z7VB 3OWRA 4ZD3H 1UENA 3IDXH 2FWOB 1SJHA 2B1OA 4CBZA 1RJYA 1XT5A 3HZVB 1N0XL 3UYPB 1BFSA 5D7IE 5E9DA 3TA3A 4GGAA 3HB3C 4U1JA 4MVBC 1U2HA 2VC2H 3LRHA 3NIGE 1KELL 1YSOA 2EVJA 4RCAA 1QFSA 2FSDA 1U8PB 2X4QB 5AALA 5T33H 3D07A 3SBPA 2WN2A 4NC1E 2PM6B 3QORD 3TWCL 5AVQB 3ZUNC 4GJTB 1LO4H 4HS3A 1J1XL 1PAZA 2JLLA 4RWHA 4L8BA 5DDHB 1XIWA 1FAIL 3DSFL 2P5WB 3PDGA 2CIKA 4OCSL 1FA4A 1VENA 5D8JL 5E4EC 1N5AA 1IFRA 2JKNA 5JIKA 1JMXB 5E95B 2F74B 4BFGA 3I6LE 4X80L 4CVXA 3L2MA 4HDJA 2X6UA 1SXZA 5I19L 1LNUA 1E4XH 4JFYA 4JG1H 4OT1H 3PDDA 2JCCA 4P4RA 4B5EA 3U1SL 3UEZA 4XTRD 3TX4A 1W91A 1CU4L 5AYTA 1I2MB 2NQ3A 3F7VB 4LVHC 3V5HB 3ISWA 3DURA 1Z1WA 4IBWA 3QDJE 3OKLA 1A7OL 1CLYH 4LVNB 1QAWA 2AGWA 1P6WA 1SOSA 1T7YA 1IC4H 2FTAA 2AV7B 2BOCA 3MLUH 4HBCL 4MCZB 1GL4B 3UMTA 5IV2A 3JZ7A 3MUGA 3WSQL 3VWJC 5EWIH 4AT6B 3TS8A 5BVJA 1EHXA 1MJJA 1E6OL 4J0WA 5CO1A 2JJSC 2WM0A 1F4HA 4CZYA 2ZUUA 5CD5C 3FOMB 5JDSA 3G6JB 4PWEA 1V3LA 4HAKA 4AJWA 4I48B 2C9SA 3PFQA 2V8MA 5JHAA 3FK3A 2CDFA 2IWGA 3CE1A 3C8KB 2CA4A 4XNDA 1KV7A 3WXWL 1SY6L 4G6JH 4JHVA 5JMOC 2H0JA 3O2DA 1CE1H 3GTVA 5J7CC 1A1OB 2OP4L 2YGPA 1CLZL 1XTLA 4Y19A 4OB5L 3TVMC 4ZFFA 1GCFA 5DMJB 3W56A 4WI2A 1A6VH 5DR5L 1MCBA 2AJUH 4RQQA 3DV6A 3KDMA 3EJJX 3QFJA 1XH3B 1ZY9A 3DUSB 4QXUL 5CHNB 5HVHB 4OLXH 5G5DB 5JLZB 5AVXB 3JWNE 1DQQB 3MREB 3UBHA 1PEZA 3ARDD 4YDIL 2BNRB 4LLYB 1A3QA 4WHDA 3QR2A 4H20H 3GBML 4LPXA 3UVLA 1UB6B 1IC5L 4H5JA 3KLLA 1M42A 4IBQA 1HH9B 2KPWA 4DPCX 2G3MA 3B2VL 3K71B 2AQPA 4K5MA 3B7FA 4XVJH 5CEZE 1M7UA 3FTXA 1HCFX 2EYSA 4GINA 2G5BB 1OGAE 1JNHB 4Z77A 2EICA 1AGDB 5C0BA 5JPNA 2BNQD 1Z9SA 4PJAA 4KHXH 1H8NA 2QVKA 3RBSA 2J71A 3SHSA 3VFUB 3T6QC 3UP6A 1ZS2A 4WI6A 3T0EE 1A4CA 2XN2A 4ZNEE 2GI7A 4Z95H 1BF5A 5KYUA 1BQHG 1KCUL 3S48A 5JXEA 4LVEA 3DXMC 2G4GA 1KYAA 3I50L 5I2IA 4F7CA 4RBPK 1D9KD 2KDGA 4E9XA 3D5OF 3AQXA 4TQEH 3CQQA 3WKMH 4FF9A 1U95B 5FOJA 2JKXA 2WC7A 4HC1H 4UV4L 4WCYH 5JIHA 4NQCA 3RLSA 1Q72L 1YEDB 1YJDC 4A2DA 1EH9A 4I8DA 5DJYA 5TF2A 3RFRA 4PRIA 4JKNA 3WS3A 4D7PA 3AWGA 1JF1B 1B0GA 2GY5A 1FAKT 2Q8BL 2Z4TA 3ILPA 3MLXH 4NX0A 3K1KC 1L0YA 1N6UA 1A4JA 5C6PB 2EQDA 2ZYIA 1KIUB 2QADC 4P23B 2AEPL 1QFUH 3TYGH 2W9LA 3CUPA 2XQBH 5TQ0H 3VE0A 1DLHA 1RKRA 4Y89A 3CFDA 4GQPH 4JN2A 4Y5XA 3I6GA 4IIQC 3K8LA 1ORQA 5CBAA 3TXAA 2EDTA 4E41E 5CUSL 4KKCD 1QRNE 4J3SA 2HT4C 3ML9A 1HZHH 1UASA 3FCGA 5CMAA 3QG7L 4GAGL 3SKMB 4DCQB 1ZLEA 1KB5H 2XZQL 4HWBA 4WFED 2P9RA 4JO2H 4WW1B 2H8PA 3GWJA 1NC2D 3QZWA 4EI6A 4NM4L 3NFSH 1ID2A 4QYOB 4NI6A 4GXUN 1JXJA 4IOIA 4PBXA 2Q3XA 3MV7D 4ABVA 3EDDA 2PPAA 4H1LG 5DHMC 5DEGB 4D0CA 4OU3A 3IDMB 1MPAL 2KMWA 3TNNB 3QYMA 1MKFA 1YEFL 4ZBJA 2OK0L 4XP9L 2FRGP 5I6LA 3K81A 4MD4B 3IUQA 2JKWA 4K3JB 2EDLA 1CE6B 1YNTB 5HP5A 1NIBA 4KX9A 4LK4A 3C12A 1ZGLM 2BZCA 2TAAA 4PN6A 3AC0A 3FSVA 4PJ8D 2FDBP 3PP3K 2WXQA 5B8CA 3ZSSA 2J57G 3WKNA 5E1GA 4E42A 3H7BB 3MRCB 3QZMA 5JOFB 5ESVB 2CBPA 1WA0X 4FEIA 3FTGA 2Y6SC 3GMNB 1JBJA 2A77H 1GC1C 2A9NH 1AFVL 2W9EL 2YS4A 4WEBH 2QSCL 3O4LE 4P5KB 1S7UA 1E27B 3B5GA 2VR8A 1MWAA 3NQIA 1OCWL 1YYLH 3HRPA 5KVEE 2EDBA 1ZVSB 2E86A 3S36L 3TYFA 4AYMC 4TLTA 1E8NA 2M83A 3MJ9A 1ZIAA 2OTUA 2XLLA 4X83A 5TE4H 3EF7A 4DH2A 4Z7NE 5HYSA 2VDPL 5FUCC 1FGVL 4AYBA 1CBVL 2BVOB 2L3BA 3MRBB 1JF5A 4HJTA 1BBDH 1UEYA 3C5JA 2X4PA 3NA4A 2GBTA 1KJVB 1WP6A 2X5PA 3GMRA 5JUEL 1QLEB 5F7EH 2HKRA 1WITA 3PHQB 3KLAB 1QSFA 1EX0A 1I1AC 1OSYA 3EBAA 1UUSA 4YSEA 2QLVB 1B9XA 3ESVF 3H3KA 4PJFB 1FLRH 2CO7A 4QRPB 2HFEA 3MGAA 3TASA 4FG4A 1BD2E 3TF4A 1S7RA 2H6UA 5DUPH 1A6TA 5HI5D 1ZOXA 5DRNA 5KSAC 4J12A 1U4EA 3PIQB 5DJXA 1UACH 4XPAL 3QO1A 4CVZA 1JXGA 3IGAA 5DD5H 1HL5A 2HT2D 1H3VA 5ICXB 1INQA 3VH8A 3TN0D 3HB3B 1QFPA 4A2GA 2DWSA 2PCXA 2XZGA 2ITEA 2NY1D 4K71C 5IROD 3MZTA 4FQPA 5CS7A 3M7OA 3SZKC 1J8HA 1I8AA 2HPTA 4UNUA 1ZHBB 1QNIA 3QEGL 4OZIB 3WNJA 4ZDHB 4KY1H 5KYYB 3Q48A 4U1NA 5JHMA 3GBEA 4D8PA 5E4EB 2EVGA 2X89A 2VSCA 2QGDA 1R0AL 2M2DA 3QC6X 4P9MH 4XYHA 3J80g 4G9DB 5I6XC 4LPWA 2CGZA 4FFVC 3ULUH 1MFEH 4FOMA 2PN5A 4CNIA 1YNLL 3QUXD 1JZGA 2FJFA 2PNDA 5T1DL 2ZOLB 1BYNA 2DQIL 2JI1A 3OGOE 3D51A 2ZCLH 3FQUA 4XNQB 4KJPD 2QZQA 3U1PA 5ABDE 4LVHB 2DQEL 4KK6C 3OR7A 3GJFK 5HHQA 5DU7A 1TZOA 4N8VB 2WNGA 4N2KA 4D3CL 2HJBA 3OAUL 3JV6A 3K2UH 4NZRH 3VYPA 4BWTA 4OJFL 2BP3A 4ZQKA 2HRPL 3LV3B 4OV5B 3ZDYA 2YD5A 4OQTH 2D7MA 4WF7A 3TEZA 3VWJB 3TESA 1S7XA 4ACTA 2BMKB 2X6AA 3QWRD 1SYSB 4R84A 2ARJB 2XZCH 4J3OF 5GRJH 1JV5A 5KVFL 4JPKH 1S5IH 5D1QE 1IGFL 3FTVA 4AEEA 4KWUA 1QX1A 2W81C 4LLDA 1ZMYA 1R3KA 4XNAA 1Q94B 1KEGH 1OAKL 2YD3A 3FFCE 5J13C 4ZTPH 1OB1B 1Y07A 2RB8A 3IAQA 4NKDA 3VGGA 5IHUL 5IHZA 3MNZA 1LDPH 4NSKA 4DAGH 5IGXL 2CN2A 2X10A 1HWWA 3NZSA 3OHXA 3QNFA 4NT6B 3N06B 1RZIA 3WL9B 4ATTA 2EE0A 1FRGH 2XVKA 2P5WD 3HAEH 1RULH 2Y2TA 3TVMB 1F00I 1H3PL 1NLDH 5SWZE 3TT1L 3MX0A 4GP4B 1CF8L 1LO0H 1T04B 1OAJA 4OF0A 2YSTA 4H5SB 5SV4A 2YOCA 4GG6E 3F8UB 4OD2B 1IKFL 3IJYB 2JWYA 1FO0A 4W9JC 3T71A 2I3SA 5L4FA 4NZFA 1CQYA 3HC3L 3PAZA 2G30A 2V9RA 4TS6A 3V0FA 1LLAA 1MUJB 2YRPA 4I18A 1G1OA 5L2KB 5E6ZA 4RVBA 1UURA 3GTNA 3TEWA 1IQDB 2YAQA 1X44A 2CNXA 4HS8L 1JNNH 5D2NE 4ZMWA 4G7VL 3QJFA 2EE3A 1KFGA 1MLCA 4WJKA 5F6HI 1AMYA 5TE6H 1MFCH 2J73A 2D7TL 3ES6A 3UZEA 4QUOA 2CLZA 1DUYB 4TQPA 2HG0A 4MGXA 4KDTA 2HTLC 4HEPG 5A2CA 3WE6B 2GJJA 2OW7A 4IBTA 5E51A 1I9RL 2UUDH 2WXKA 2HJKB 3B6SB 4GAFB 4JDZA 1DVFA 3RX9A 1B4JL 1EHAA 2MCG1 5KTEL 4AIXA 1NSNL 2QV2A 5DZAA 1BGXL 4HYTB 5C0GB 1VPOH 4OFQA 1E9PA 5FKAB 2IGFL 4GFXA 1I1FA 3KGRA 1TO5A 4OCRH 3FN9A 5GJSL 2NR6A 4XP1L 5IMKB 2AGJL 2AC0A 4IJ3C 3RFHA 1OLZA 2QADB 1FFTB 2Y69B 4DETA 2Z7UA 5E03A 4BFIB 2YSSB 1HVXA 1BOGB 4HH8A 1AZZC 1NIEA 3CMOL 4U1MB 2W07A 3LKOB 4HA1A 5DRZB 5FHBH 4FA5D 4XN4A 1MRDH 5CCJA 1JUFB 3PWVA 2QVMA 3ETSA 4IIQB 4M1CC 3F00A 2D7QA 5ICYB 5IFHH 3S3CB 3OAZH 3K4AA 4QXGH 4QHUA 3UGXA 3TO4D 2GC7A 4HIQA 5H37A 1SOKA 4XMLL 1UWGH 2Z92A 1VGKA 3V0DA 5IHLB 3GPEA 1A6ZB 1HHJA 4GRMB 3TOPA 3GIVB 4OM0H 4ANKA 1WA1X 4EDXA 2B5NA 2E46A 3IKCA 3QR1A 3ZMNA 2KHAA 3CFBA 5AENA 2WLNA 4ODSL 5BRQA 1JI1A 4QRUB 2AGXA 4G8EA 3BUPA 2EXTA 4LARH 4N3TA 5BS0B 1CI5A 4CSPA 2NNRA 4P46A 3CAFA 4X9YA 4Y88A 4OVVA 4XWOC 3U4EA 5LAPA 3FU9A 1ZHNA 5I0ZA 4EQ2A 1HXYA 1OM3L 2ZOKA 1K8IA 1VCAA 2K7QA 4HQQL 5IM7B 3GO1H 3R4DA 4TQHA 4QJ5B 3TFKD 4ZOCA 3RLMD 4HX1A 4JRXB 4UYPA 3C6LA 3VI4B 4TNVF 3QCVH 3LKNA 2DMBA 2GAZB 1X9UA 1L7IH 2JJTA 5C07D 3SYQA 3VXTA 4FULA 1HH6B 2IANA 4DP1X 5AKSA 4QRSB 2APVA 3GMQB 4R0LA 1E3XA 3EYQC 4ZAKA 5IEHA 3TEYA 1XH2A 2VDOB 5HDOA 4P23D 2PXYC 1CD1B 4OZFA 1KJ2B 4GRWB 2K4WA 4GG8A 1IC0A 4KKBD 1RIHH 2PTUA 3WNKA 2P80D 1L9TA 4TKWA 1ODAA 1H3GA 1WZKA 2K3TA 2ICEA 2QKSA 1WHOA 1M7IB 2GBUA 4LHUB 1MRFL 3QSKB 3PY9A 3FRXA 3VXUB 5EUOF 2J3SA 4G8GA 4EUPG 1QUPA 1I1AB 2H47C 2HH0H 4F9LC 1E2VA 3DK2A 4K8RH 4FA4D 1D5BA 3S5LB 4AIOA 2PYEA 3K0YA 4LAQL 2VN4A 2YK1H 2Z9TA 4K7FB 1A3RL 1VEPA 15C8L 1LD9B 2J25A 3IFPB 4FG6C 3FGBA 1ZV5A 1A7RH 2AFNA 2XICA 3FCBA 4N2CA 4YLBA 4RFNC 5KSAB 1TNMA 4R4FH 2YAPA 4M7LT 4AZ8B 1FN4B 5GZOA 1YAZA 3A23A 2AXFB 4G56B 1DE4B 2MQCA 3EZJB 2IXQA 1H8LA 3Q0HA 1VE7A 4GAJH 1B9ZA 2DWTA 1INDL 3P4MB 1OP3H 3TIEB 3QEHB 1JPGA 1KYUA 2EE6A 4K71B 2NLJA 4E9RA 1HKLH 3THMH 4QHNB 4WWID 4YPGB 3GSQB 4A39A 4KRMB 3T8MA 3QUYC 4OGZA 3X11A 2WIIB 4TLSA 1A9BA 5FDWB 3ULEC 5LGJA 4YSUA 4TULH 3ME0A 3AL8A 4KX8A 1GZPA 5BQDA 3B5TA 3TPUA 5FYKH 5IBTH 1IGIH 3N5AA 3KCPA 2XZZA 2X40A 3HE7C 4KUZL 4DO6A 3VCLB 1JPFA 1KZQA 4KDWA 1WG3A 4U6TA 2QLYA 1CVSC 3NFNB 2ITCA 2VL4A 3KJ6L 3NCWA 4N2EA 5J8OA 4J3WA 5IKCA 4X4ME 3BO8B 3VMOA 3D05A 2HESX 3ETBF 3H1ZA 3D0LA 3EH4B 2JKJA 5CXPA 4A7UA 2FO8A 2ERJC 5IB3B 1U8NA 1G9NL 1E9OB 2KUTA 4LEBA 3FN0H 3FMGL 4LU5H 3SE9L 4J87A 1M1XA 3OMIB 1CG9A 4X5XB 3F3GA 3EU7A 4PJXE 3OJDB 1JGEB 5F7LB 2CRIA 2CXGA 43C9A 5JWZA 2E5EA 4MXVE 4PGBB 4CDGC 2VDNA 3S4SB 4L3EA 3G6AA 2DWYA 3E1ZA 4LVOC 4PW9A 2AEOA 3HB3D 2YMOA 4FYRA 5GQBA 2FT8A 3X13B 5CJXC 5J13B 5EIVA 2D3LA 2WWMC 2GHZA 1AG0A 2PCYA 4PB9H 1N64H 3P40A 2L7JA 3BD5A 4FA6A 5DMYA 1VE6A 1TCRA 3T0BA 3V2AR 1GIGL 5ICZB 1RK0B 2G4EA 4JFDE 4PLOB 3RWJB 4DVRL 4L3GD 2MHAB 3IDUA 4AM0B 1AGCA 4OZHA 4PJBB 4FFZA 1HN1A 3I9IA 3VRLE 4M7JL 3LZNA 5IWLA 1AO7A 1CICA 4NN6C 3HFFA 2HX9A 4NQSA 1QLEH 1KGJA 2EXSA 2VW6A 3I2CL 4GKSB 4G55A 2JQAA 4CU6A 1KFAL 3ECVA 1FZKB 3ZT7A 2IMNA 3NEOA 1JHLL 1FP5A 4A2EA 1QBLL 3POHA 2WQSA 4FTVD 4LPUA 1ZKAA 4AG4L 3LIZA 5LBSA 3QJZA 1JGLL 3C60A 3HI6H 2VDRB 2HFGL 4HK0A 3TONA 1UXLA 1U93B 3DUUA 3BD4A 4HIEA 5CEZL 5F1SA 4PSWB 2QKIC 4BL0A 4QLWA 4KNUA 3EFFA 4JVWA 4YDVA 3GI8L 3GI9H 5C97A 2X88A 3AG4B 3D2UB 5I1KL 4LPVA 2EACA 3O11A 4YPJA 3VWJD 1IT9H 3WJJA 4ELKB 5KVMC 3VD1A 4ZMYA 3QCTL 1BFOA 3I9AA 5T3ZL 4F37K 3E3QC 5F8RC 5FGSA 3SKJH 3ZDZF 4LBAA 3L6FB 3RA7H 2C1PB 4KC3B 2CU9A 4YHKH 5B4MC 3GB7A 5CD5D 4GQ9H 1J0JA 1AQMA 2HLAA 5IW6A 4MJIB 1I82A 1TU2B 4KI5E 4KJYB 1NL0L 1LEGB 2G2NA 1RZJL 3EAKA 3RPBA 3P11H 1G6RH 4FZ8H 5FYKU 3IMBA 3VW3L 3ZXAC 4PNKB 3OTTA 1M2VA 2ZX8A 3DYPA 4L18A 4I0PD 1AE6L 4E9SA 2G9KA 1R24A 5D7SL 4YHLH 3H0TA 2F18A 4QD2E 4GSXA 2YXFA 4EN3A 3CZSA 3CLEH 4X60B 3FFDB 4IJ3B 1P53A 2VWEC 3I02B 3FB7A 4DKEH 3VQLA 4F58L 5KN5B 1K4CB 1T89C 2N7BA 5EO9B 2QELA 4O02H 5F89B 1YYMH 1XCWA 5DD3L 1BZ7B 1F4XL 1HHKA 3A4DA 2P5EA 1IL1B 2NZ9C 1MJ7L 4ODXB 3JPXA 2AAAA 3PJSB 1HILB 1L0PA 2WOYA 3QUZD 3ZMEA 2N01B 1PZ5A 2C7UA 4Z7OA 5TK2A 3HUJA 3IBEA 2I0TA 3HZKA 1ONQA 3JV5A 2V6HA 5CCGE 5D5MA 1T20A 5EMLB 2O5YH 3K3QA 4WK4B 3CFJB 2OYMA 1X4ZA 3L5JA 2NY5L 3EYVA 5FGCE 4N14A 4WSGA 3NCYS 1JZJA 1DVTA 5CLWA 5B39B 4OH2A 5F93C 3C5ZD 2QQKL 1GYAA 3S88L 4M7LH 5HGAB 4YO0A 4Z7IA 3UIZA 1RJZA 3NSYA 3IN2A 3QIWA 3MRLB 4P4KC 3ZRCC 3US0A 5E6SB 2UZIL 3FTWA 1JZ7A 4K5LA 3O4IA 3LEYL 2XN9B 4A68A 2JV6A 5F3HA 3WKYA 5EUKA 2V2WB 3HMWH 3GJEB 5DMKB 2CUHA 4JGJA 4YHYC 3KYOA 4Z0BH 1VADB 4UMGA 2ED6A 5GS2H 3FU7A 1B88A 3GS7A 2VDKA 1FL5A 1PBYA 1J5HA 1T0NA 2QADD 5KVEL 4QRTB 3V4VL 2PXYB 1UXMA 2X4UB 2FYYB 1CJYA 4IU2A 4OJEH 3A47A 3LN9A 3VFGL 4DQOL 1WRFA 4J7RA 3H55A 3CLWA 3F5WB 5I1DB 5HYEA 4E5ZA 4PJXF 5JDJA 2GSMB 4M8VA 5IF0A 2NY0C 2Y2WA 3VVWA 4BXVA 2WLIB 3T65A 2KPNA 4DFIA 2HT4D 2CWRA 9CGTA 4PYGA 4LIQE 1AJ7L 1NBQA 4J2QA 3OZ9H 1QR1A 3NFPB 2GUOA 3UJIH 1MI5B 1NGWB 1TVBB 2X9XA 4UNVA 4UB0H 3GMOB 3WS6A 4LQ1A 4Z8FH 3RKDD 1CC3A 1FG2B 4MB1A 4JKWA 1JWUB 2E9GA 2ZNXA 1MW1A 4NLHA 3KLDA 5BS0D 1KJMB 1XIWC 3QQDA 5E0FA 4FQ2H 3ZR6A 1FFNA 3WY3A 1LO3H 3DDGA 1C12A 4RFNB 3W3BA 1HYRC 4WJ5B 4PRNB 3DVIA 4MXQC 4G2AA 2G2RA 1CXFA 2CNZA 3BPCB 3FU3A 2I69A 4H4NA 4N2IA 5IJVA 4X99A 4JRXD 4IKIA 1QZNA 1QTSA 4HLJA 4ICWA 4Z76A 5JQHC 3OKTA 4WI0A 3I6SA 5K5YA 2Y6SD 1MHPH 2YAEA 4ONHB 3WJMB 1P1VA 3A6CL 1NPNA 2ICWJ 5AW1B 1YAIA 5EOTB 3QUYB 1U8OB 4YBQC 3C08L 3N04A 2NY4C 4HALA 4JPWH 4GUQA 3PNRB 4P2RE 1I7RA 4JPVL 4D94A 5IHHA 1W2KT 5K19A 2R4SH 3BFOA 1NANI 1X6NA 1KG0A 1YO4A 1NFDF 2ZNWA 4DUXA 1LK3H 4FN0A 3RMZD 3BQUA 1J8KA 3DX4A 3HE7B 4APXB 5H94B 2J56A 2HG5A 3BT2H 3P9LB 4WUUA 5IMMB 1QA9A 2IDQA 1XDTT 2BP0A 3VXUD 3LZOA 4LL1A 3OM3B 1FJ1A 5J3HC 4PJGB 1I1AD 4PJDA 2E4TA 4Z7OF 3LSOB 3DMMD 4YGVA 3SYPA 5GGUB 1TJGL 4KH9A 1A0QL 4FQ1L 4HU2A 5MEPA 1CFVH 4HXBL 5ABZA 2HSIA 4GMSH 5C0AE 3WELA 4FE9A 3KYNA 3QVAA 5EZIH 2ERJB 1Y1DA 1QLFB 4ANXA 3ARSA 4JPIB 2ZKWA 4FCAA 4TSBH 2HFTA 3CDZA 1XAKA 4BE6A 3VTMA 5IP4A 5EIQA 2FB4L 2C8NA 3BKYH 4AEIL 1LEKA 2Y7SA 2Z34A 3R7RA 2AJVL 3GPSA 1OQXA 3IXAA 4JMNA 4LVOB 2WTRB 1RPUA 3DPBA 3FTYA 1X7QB 4OIAA 3RP1A 5GISL 2C1OB 3WGVB 1SVBA 4XBGA 1BIIB 1OTSC 1EAOA 4PJ7B 2IOIA 1KJ2H 5A2AA 1QFWM 1WBYB 2EIKB 2WLLA 3CCHB 3FHEA 3S37L 4W93A 5C0FA 3BP7A 1PCSA 4B41A 5HHMB 3AZUA 5KS9B 4NQVB 1XSKA 3L7EB 5JPNC 1KCRL 4NN6B 1YEHH 3LXCA 4Q52A 2OYKA 2KT6A 5FXCH 4NQEA 1M7DA 1SN5A 4HIHA 3GSVB 3OR6B 5IB4B 3KWXA 3AAZA 3MOAH 2XL3A 1G43A 2YLKA 4DGUA 3M8OH 1M57B 1B90A 2YNPA 1PLGH 5PCYA 1E3FA 4RDQG 5JXEC 1P4BH 5E8NB 4A0BB 5AB0A 1HE7A 4QMEA 4KXZH 1QZ1A 2P7TB 3DV4A 3O41B 4I2XE 4LSSL 5AWNH 1RUPL 2FYVA 4HGWB 2VCOA 5ERWB 2APFA 3MRIA 1HIMH 1FFOA 2QKIB 3EDFA 5ADPH 2N7AA 5LGHH 3GZKA 4IHBA 3SO5A 1A7NL 1I85C 4JDVB 2NNAA 5GGSA 3X1GA 4LSRH 1FZMA 1G0DA 2NTSP 3A5VA 3O0RL 3JTBA 5CP3H 3WI9A 4KX7A 4HG4J 2Z4QB 4WAFA 5BO0D 4OGXL 5HPMB 4PY8I 3BT0A 4XNUH 4WNJA 2OSWA 2DBJA 4KZEH 4LP5A 2G3ZA 5F9JB 2OMZB 5J6HA 3O3BB 4C56B 2IG2H 2JJVA 3FPXA 4OCLC 3EMHA 4JRYE 3W9DB 4LSUH 4Y5XC 5DQ9A 3R06A 4A7SA 2BSRB 1L3WA 5AQ0A 2GG1A 1UOVA 2OL3A 3QI0A 3AG2B 1AHWA 3H8NA 4K5NA 2FIKA 3NCBB 3JB9L 5GSRA 2XWTA 1JIBA 3BJ91 5E1AB 3W2DH 2VISB 4PREB 4CA4A 1L7TH 2K45A 4RNRB 3RL2A 2LFGA 2VMJA 3PGFH 2EEBA 1T7XA 3BYYA 4Q4EA 4H8QA 4WFGE 3GUFA 2IDSA 1QACA 3GRWH 4JPQA 3DLQR 4XCEB 3V4LA 1SJMA 5LAXA 2BIPA 4G11A 2BNUB 4LNVA 3B9AA 4MNGE 4FG0A 2XBTA 5I71B 1EEZB 2R1YA 4FC3E 4HZLB 2A7BA 3EW3B 1C08B 3DARA 1NPUA 2J88L 3J07A 5JR1L 3DC0A 4PWKA 4I0KA 3AU0A 5KOMC 4XHJC 1NWPA 1QBMH 5GRXG 4E54A 3A4AA 5C0JA 2G9HB 5B8CC 3MBWA 4XO8A 1NKGA 4JZJA 1KTLB 4HOXA 3VD9A 3BRFA 4L29A 2F53D 3NH7H 1HQRA 3D2UD 2X87A 4DP5X 3EBGA 3GEFA 3LIUA 3PYCA 3RVWD 1IZKA 4PHZA 1A22B 1XGRA 4ZZKA 3CX5K 1HL8A 3BKJL 4OCWL 1MVUB 1ZJAA 3ELQA 1CUOA 5DJ0A 5H2BB 2L7EA 2HTLD 5I15H 1DZ0A 3HBZA 4L48A 4MJID 3RVTD 2Y0SA 3N44F 4P4KB 1U2VC 1LP9A 2BH0A 1G87A 4XOEA 5LGYA 1PDKA 1SQ9A 3DHJA 1FVDA 4QPEA 5T5NF 2AVFA 1QOKA 4UBDC 3RUGB 4JHAH 5GMKn 1NGYB 4PG9B 5B7MA 3PJNA 1ZT1A 3V79C 3L3KB 4YHYB 3BC9A 3D1MC 4NPJA 2DJ4A 2MPVA 2RFXB 3G7TA 3FU8A 4QTHB 3BIKB 3KL5A 3G9AB 1ZJBA 3UZVA 2VZSA 3BW9A 4AMWA 4PJHA 2IFFL 5D2LE 3UVKA 3RVXC 2HCZX 4TUKH 3PXHA 1XX9C 2DPKA 3ECWA 1IC7L 1UXSA 2IH8A 2JI3A 2WBWB 2YC1A 4ERYA 1A3LL 1IGCL 4I5BB 5CAYB 3PWPD 4ZPVB 2DLFL 4HEMA 2NY0B 4OJYA 3CSGA 4DGVH 1XF3A 2R7EA 4G42B 1SJHB 5FYLH 3RWHA 3RAJL 4PRBA 5HHXL 5E9DB 1EUUA 5DO2C 2OMBA 3FRUA 4U1JB 5CR8A 2KLTA 3WTXA 5EH1A 3B83A 1DL7H 1OL0A 2XYBA 1GPOL 2IV8A 1B2WL 4AQEA 3PPSA 3ZE1F 3FH8A 2VDMH 5DA4A 2ETWA 4MMZA 3A24A 4HS3B 5EU6A 4LCCA 1HCZA 4OGYH 1XIWB 4HKXA 1MNNA 2CIKB 4XVSL 4F7TA 4KKAC 4XWOD 4KH2A 4XC1H 1N5AB 1WIOA 5FO8A 1NCNA 2DQDL 2OV0A 5BPPA 5I9QC 3IVKA 4GMBA 1L9NA 4Y1TA 4CVXB 3MLPA 4PVLA 2NXZB 4JSXC 4RBPH 3E1F1 1U6AL 1LNUB 5AOJA 4H8HA 4JFYB 3KEDA 5LG1A 5EN2A 2VERN 2IBZX 1GGCL 4P07A 4N2MA 2XN9D 3MLTA 4RESB 4P4RB 1PD1A 4XN2A 1VF5C 4ZS7L 4FI7A 3DURB 4Y4FD 1E50A 1UUNA 3FNKA 4I3SH 4PJEA 4TLKA 1PY0A 1UWFA 4KKLC 3EYQD 4YLCA 2DD8H 3KLSA 2Z7WA 2BOCB 4ZOEA 2KDYA 2PXYD 2CKNA 1NGXA 1BJ8A 1BJMA 2CBTA 2R0ZH 2R56H 2NY4B 3CZJA 1T21A 4PH8A 2EVIA 5IV2B 5E23A 3MUGB 3WFBH 2P9KC 3FBQA 3LH2H 2NX5D 4AOWA 4IGBD 5BVJB 3IVMA 3PDOA 1MJJB 2AJZA 4NN7C 4U49A 4L1QD 4NQDE 1OKEA 5I5MA 1FNGA 1BZDA 5AW9B 1KOAA 1IIIA 2Z8RA 4Z7WF 5JDSB 1FC1A 1Z32X 2YAFA 4H8WC 1GS8A 1MJUH 1MI5D 3OWEA 5IQMA 1SDAB 5FLUA 3US1A 5HYJB 2CDFB 4CI3A 5C9KA 4WWKA 3OHXC 5JW4M 2MOGA 2XC8A 1E40A 1X5LA 4BK4A 4PGJA 1BW8A 4AYEC 2C3GA 4Y19B 2O26U 2ZKYA 1N6FA 2A1WL 4UILL 4ZFFB 1UWYA 4HPHA 2HXCA 4ELMA 5FO7A 2Z7ZA 3EOBA 5LKNA 4RQQB 3DV6B 3KDMB 3QFJB 4H1LH 3CFCL 5B3JE 5I28A 3D50A 4GFTB 2NCEA 4BQ9A 2YB8B 4P9HL 3P4FA 3LQZA 2X38A 3T6VA 2D2OA 4M61B 3QH3B 3IDGA 3PP3H 5EDXA 1A1MA 4FS0A 3RB5A 2J43A 1AQDA 4QY8A 1Z5YD 1J0ZA 4TVPH 4N0CC 1EWHA 2IIJA 3PJLA 3HMXA 4I18C 1JYXA 1PZDA 1JGDA 5CCHE 4KU1A 2EYSB 2HP4A 3D30A 2RR3A 3EO1A 4YDKH 1CTOA 3KPPA 4XP6H 5C0BB 2MCMA 4Z77B 1Z9SB 1GGBL 4PJAB 4NIYE 5JPNB 4J8RA 4JQIA 3H9ZA 5GHWL 5LJYH 4U6HB 3NP3A 5J0BA 2IUPA 3EQ7A 1IVLA 3CWGA 4ZW8A 3NIFA 4A6YL 5HDBE 4QRBA 3OKKA 1UCBL 1UD4A 1MCLA 3X14A 5GGTL 3EG9A 2WXRA 2XPGA 1I3GL 4BP9A 4KMLB 3RBGA 3UZEC 5KYUB 3V7MA 2DQMA 3GSUA 4W9DC 4YVUA 2MCAA 1WFNA 3NAAL 2DIAA 5I2IB 4F7CB 4KDTC 4KJWC 2OCCB 1DN2A 1U8CA 1Q0EA 1G9ML 2LW3A 1DVFC 2K9UA 4MKMA 4QOKE 5TDOA 3WLBA 2AZAA 4NQCB 3N6YA 3VD7A 4ADJA 1FPTH 4JO5A 2PO6D 1QSZA 5DJYB 2HZHA 2EIDA 4XPBH 4PRIB 3WS3B 3D4CA 3QCUH 1B0GB 5F7YC 3ILPB 2VSKB 2NR6C 5D4IA 3U0WL 2CK0L 2C9UA 4U6VH 3SCMA 1A4JB 5DFVD 3PV6A 4XP5H 4PUBH 4Y2DA 4CI8A 3IULA 4J2XA 2VLRE 1CR9H 3INOA 4UTCA 2WPGA 2Y4SA 5DEZA 3VI3A 4B53A 1KY7A 2WWMD 4U1KA 3VE0B 1DLHB 4XWGH 4JK0D 3CFDB 3CU7A 4JN2B 4QLRA 5EORH 5F88A 4Y5XB 3I6GB 1DBBH 4D9RD 4C55A 1ORQB 5CBAB 2LLNA 5DO8A 3U48A 1F42A 3RJOA 1F97A 4KNTA 2GC7C 2XA8L 2BZ7A 35C8H 1CGTA 4PVBA 4ZFGL 2FWLB 4FI8A 3M86A 3MACL 5CMAB 4P2CG 5AVZB 3UAFA 5EMJB 1S7QA 2YN5A 2X1QA 2HWZL 3L08A 4N24A 2F7OA 4HGMA 4YDZA 1FSKB 5D7IA 1Q47A 2H8PB 3QZWB 4EI6B 3NIGA 3GZOA 3UJTL 2PP8A 3ZT6A 2X2IA 3GLDA 4IOIB 1F58H 3VGZA 2OPCA 5DJ2A 4HKJA 4OM1L 4RMUA 3MLRL 2IGLA 4D0CB 3SGEI 4P46C 5TQ2H 2Y06L 4AMZA 3T0VA 1VIWA 2ZCKL 2SEBA 5DUMH 4MD0A 1VDGA 4NM8L 3SPGA 1SJEA 1XL6A 4Y8AA 3OPZL 3DOIA 1F02I 1X5KA 4MAUL 3GJFH 3QNZA 3C6LC 1J5DA 4PRDA 5EU7C 5B8CB 4XMUA 2BIOA 1CDHA 1FNFA 3PWLA 4Q9QL 5E0QA 4E42B 2JJTC 4HJSA 4FKKA 5IQOA 2CXKA 4NQXA 3FTGB 4AEHH 1OLLA 2AZUA 4Q7DA 4YSOA 3SPCA 2NUPA 4FFWD 1N12A 3KBHE 2L4OA 4R0LC 1S7UB 4RFEA 4ZAKC 5FCUL 1MWAB 3CVHL 3C9CA 1YDPA 1IBFA 2VKXA 3H9YA 1EANA 3TYFB 1NCWH 5HVFB 4KROC 4DP6X 1BZ9A 3O2VH 4N8CH 1Q9KB 3QHZH 5HYSB 4BZ2H 1M9SA 3NG5A 4Z78A 2X4NA 3HHMA 2EDRA 4DWHA 2ICEC 1LO2L 1V7NH 3C5JB 3V7AG 1OMWB 1CVRA 2DJSA 3JWDH 4A08A 3CFMA 3GMRB 2WV3A 3V0VA 5B3NA 1J9CT 1OAXH 1GOTB 1QSFB 4Y0GA 2ODHA 2HX7A 5D4JA 4Y9GA 4OIIL 2J6WA 1UATA 4JE4B 1JZ4A 4JR9H 4L3AA 2ZOUA 3C75H 3A21A 4Z6AT 4XOCA 3SE6A 2HFEB 2EDYA 3DECA 4E5XA 1FDLL 1S7SA 1DBJL 4LB8A 2WLHA 3QYCA 1S7RB 1FIGL 2V5SA 2IBZY 1A6TB 2CRMA 4CGTA 5DRNB 2Y1VA 5DJXB 4DJMA 4GO6B 2A9MH 3QO1B 4CVZB 5GZOC 3H9SE 5B3JF 5F0MB 3MQIA 3IGAB 2IH3B 1NGZA 3MLZH 2QSTA 2A9CA 4OF5A 4P57A 3FYIB 1INQB 2XN1A 3VH8B 2FHCA 3QZOA 1TQSA 2VABA 3IS0X 3DX7A 2F8OA 4L05A 5TDNA 3Q6GH 4WTZA 4TLUA 3TFBA 4CC0A 1K5NA 2AI0H 1UWEL 2BCKB 1FNLA 3KHOA 3SLED 2BINA 4Y5VA 4HSAC 4X7FC 4RZCA 3MRFB 4DUWA 3J81g 4U1NB 2RJMA 4CSTA 3W39A 4TF4A 4D8PB 3NGBC 1O9WA 3UTPD 5I9QB 1FFRA 4DP7X 1PNDA 4HJJH 5I1CL 2OBGA 3KMDA 2CDEA 3T09A 4YVDA 1OGAA 2C9QA 2AABL 5I30L 1B2YA 4CNIB 2FJFB 5GRUL 1PD0A 1GR7A 2UZXA 5HDRA 3FQUB 2ATPA 3R1GH 3KM1A 3SJVE 3T0EA 2ADFL 4NO5A 2F7QA 3OR7B 4WTQA 5HHQB 4W4NA 4UTBA 4G43A 3ECBB 5E1IA 2WW8A 4MZRA 1L6XA 1NCAH 4H2CA 5CKAA 3JV6B 1J5OL 2ED7A 1N19A 4FP8H 1J1OH 4M5ZL 4ZQKB 5E9AA 2EVFA 4K9EC 3V0WL 2H1PL 1AKJA 1CXHA 3ZDYB 2FCBA 1KTJA 2VAAA 1S7XB 3MV8E 2F15A 4NC2B 3I8CA 1WVZA 2VLKE 2WTPA 4NN7B 4FTDA 5AB9A 3PL6A 3US9A 1A5FL 3V5KA 4LLDB 1R3KB 1V7ML 3VXRA 2VLJA 1ORSA 2FEJA 5IHZB 1MIML 3ZVVA 3MNZB 3PXLA 2OR9H 4NSKB 2XWJA 4TM9A 5FHAL 4XB3A 4AZUA 4JANA 5DLML 4F5CA 3LPGA 5K93A 3VQMA 3EXJA 2D0HA 3OHXB 2YPVH 2IWKA 1RZIB 1CTMA 4R7XA 1FC2D 5AVRB 4ZFOA 3OX8A 2EINB 3QIUA 2HKFL 1JFQH 1IFHH 2ZOWA 3UKUC 4E41A 5IWLC 1CICC 4FNUA 3MX0B 4M6OL 5I8OL 1E42A 3R0MA 3QHFL 1C9SA 5IT2L 3K72A 4UT7L 2NXZD 4PS3A 5HE1B 1KCVL 5IREA 1DFBL 1MY7A 5FS5A 3NOIA 2XWBA 4PRHA 1FO0B 4BM7A 3D48R 4DUVA 5LDUA 3ZZSA 4HF5H 2F68X 5DZOA 4AMYA 5FGRA 1RIUH 3V95A 2IMMA 3C60C 4KY2A 4QT8A 3UX9B 5I1EH 4I18B 4K3EH 1MWOA 4LSPH 4IRZA 4NQUA 3P3TA 4Q9CA 1MFAH 3Q5YA 2XPYA 4ECNA 1BG1A 3MJ8A 4M56A 3EJZD 3KPNA 3CVIL 2J8HA 2G75A 3QJFB 2NQDA 4XPGH 2JSFA 3HG1E 3WJJC 5AVWB 3T08A 1MLCB 1WWBX 4HIXL 4WJKB 1XF5A 3ZKND 2WBJA 5ISZD 3B7TA 1T1XA 1UM6H 3ES6B 1RP9A 2CLZB 1N0LA 3I7KA 2BJMH 3WFDL 4KVCH 5DT1H 4NGHH 3AGVA 5J3HD 2NYKA 2WLYA 3EOAA 4MYPA 4W70A 2UXVA 5C0RH 1I7UA 3DK0A 1X9RA 5HYJD 4AYGA 4Y9EA 4JDZB 4FQHA 1DVFB 2BRQA 1RP8A 1EFXA 4RMWA 2DI7A 4EUPH 4W9HC 4Z7NA 4JB9L 5M5RA 4OCYH 2WXGA 3SE4A 1CO1A 4Y19D 2ZSWA 3ZSTA 1E9PB 1UKSA 4YUEL 2IBGA 3GREA 1I1FB 1QI3A 3ORJA 4LHJB 4PBYA 3QULB 2AGLA 4GQBB 4N20A 3QFJD 4EN3C 1BYPA 3QI9A 4LP4A 2B3IA 3M1CA 3VDCA 1NMBH 3PWUA 2Q76A 3OKNA 4RRPA 1T03L 1SQ2N 1OANA 2RAMA 5I1IL 2NZ1A 2W07B 1RUAL 1EXUA 4UAOC 1MAKA 1X5ZA 1JJUA 1HZLA 3U82B 3BEVA 3PWVB 3QRGL 3SDXE 2CKBA 5E2WL 4GI9A 1JK8A 3NABL 1RVFL 4JFZH 3QFGA 2BY3A 4QHUB 2CJUH 1YEKL 2C5DC 4P5RA 4NUGH 4OLWL 4HXAH 2Z92B 4DN3H 1VGKB 4AK2A 4AQ8A 4K94L 5C70A 1IAIM 3RWGA 1KN2H 2VXUL 1HHJB 3CQFA 2IH1B 5C0BD 4C57C 2XKSA 12E8L 4EDXB 4F7MA 3IKCB 5DHVH 3OG4B 3MOQA 3CFBB 4UTAA 4FQXD 1WK0A 3S37X 4G8EB 3Q01A 3VUAA 4P46B 3U4EB 5KBPA 4GZ8A 2EKSA 1UGKA 5JXED 3O2DH 1ZHNB 1HXYB 2ZOKB 1K8IB 5E9NA 3QIWC 5IQ7H 2R29H 4ZUTA 5GS0C 4HX1B 2CHDA 3VXSE 2WB1A 4NQCD 4NKIL 3C6LB 4U3XA 2RCSH 1AQKH 2VH5H 3LKNB 4AYSA 1DBAL 3GBLA 1P7QA 4PRID 3VXTB 1O6GA 1A4KA 3CBRA 1UA7A 4Q89A 2A74C 2IANB 3H7LA 4GSDH 2WXHA 5AOZA 3MJ7A 2V2TA 4WK0A 2MTAH 1IAIH 4GBXD 3VVVA 4R0LB 4P59H 4K23L 2K78A 5IEHB 4ZAKB 3S3BB 5SWSD 1FVCA 4P06A 1R3HA 3LKQA 2AXHA 3LNIA 4LCWE 4YBLC 4DOHE 5HGDA 3FQ2A 4OZFB 3B2UD 4GG8B 4KROB 5FPIA 2WKGA 4OBSA 2DM2A 4G9FD 5T3ZD 3JAMg 4M1DH 4PV8A 3BUIA 4KTEL 2P48B 2YBRA 2B4CC 5FW6A 4NQQA 2ICEB 4QF1B 1BA9A 4S1DC 1E90A 1MAMH 3FQTB 4AGMA 1YMMA 4PYHA 5AW5B 1WIUA 1JYVA 4G8GB 3KPSD 1CQKA 5TJWK 3FXIC 4NS0A 5I18H 4MA1C 3WS6C 1D5BB 2CALA 1IC1A 2PYEB 5BOZG 3KWUA 1XGUA 4O51A 4FJ6A 4U6YA 3IU4H 1VZ3A 1KLUA 1BXXA 4MQXD 4XCNA 4EVNA 4HWEH 1NBCA 2DV6A 3OLGA 4J3OD 2HKMA 3HNTH 2VN3A 2WNXA 3GGWA 1TYRA 2J1ZA 3SOBH 3DXAD 3FHAA 1EZUA 5SWZA 2IXQB 1KBPA 2Q2LA 3DBSA 1HXMA 1OARL 4NUJA 3WFEH 4GSQA 1B0IA 3EH2A 2VZVA 4BCXA 2VC2A 1F4WL 4GG6A 1EA9C 3BGFC 1JPGB 2NLJB 1Z2KA 3B56A 5JZ7C 4HHGA 4JHBA 5DSCA 1T80A 2PCFA 3DOHA 1ZE3H 6PAZA 1HCVA 1L6ZA 5F6HJ 2I60H 3L9BA 3X11B 1AACA 1A9BB 5CZRA 5K9QI 4GM8A 3RY5A 3NYKA 3A0FA 5LGJB 4UI2A 1QTYT 4Y4HA 1RZPA 3LS4L 3NGBB 1N6VA 3AL8B 2R0KH 1GZPB 2F1EA 4FERA 4F15C 3TPUB 1G7JA 3OMAB 4NYLA 3WAKA 1KACB 3QXAA 4HWBH 2ICCA 2MKLC 3KCPB 5D2NA 4F8QA 3DSNA 5K59E 4Z3EA 3A67H 4IBZA 4YS4A 3DJZA 1JPFB 3MV9D 1F6FB 2BS9A 5FB8A 2LVCA 2MPAL 2ITCB 1YEEL 1F6LL 3D06A 3D3VD 4ZOYA 5AW0B 3GXTA 1FYTD 3NMEA 1TMCB 3RI5F 5KAQF 3X3GH 1XCQA 3IJEA 3NIDF 4OZGF 1KV3A 3UTZA 3IKOA 2P9IC 3RVXD 1RSFA 1U8NB 1NCCH 2VDLL 3ULVC 1IGYA 1DVUA 1HL4A 3LN5A 4F8OA 4ZN4A 43C9B 3QEQB 3RGVD 2YUZA 4R97C 1Q9WA 3DPDA 2VDNB 3T3ME 4L3EB 3G6AB 3VWKA 4JM2A 1JHKH 1QFWI 1ROCA 3ZX1A 1GTNA 2I7OA 4IU3A 5E6UB 1OHZA 2P8MA 3HC0A 1TXKA 1JZ5A 5E94A 4AC2A 1TJIL 3JZYA 3OR6A 4YQXH 5KSBF 5L2JA 1JVOA 3EJRA 3MJ9H 3QPXL 2ICWA 3D7PA 4CKVX 1KCSH 5T5FH 3B4NA 5A6MA 5CSGA 1AGCB 2AK4D 5E6YA 4OZHB 4KKAD 2FNBA 1TDQA 1AO7B 1CICB 4UM9D 2DDQH 4NQSB 3GSNL 3H42H 5BO1L 1CLCA 2E7MA 1GKOA 2EIEA 3T8VA 1K3IA 3ZPDA 3SY0A 2EDKA 1RZKL 3S35H 2J2ZA 1TSHA 3C60B 4HK0B 4IBYA 4I3RL 2QQQA 3DUUB 4LAJH 3X2QB 4ICXA 5LN4A 4YE4L 1B9YA 4HIEB 3FN3A 1TJHH 1VA9A 3N1FC 3EFFB 4YDVB 5GJTL 4MAYD 4JSPC 5DEJA 3GXNA 3JVFC 4YWGL 3O11B 4IBVA 1FI8C 1HCYA 1TTBA 2D03H 1GOHA 4H88H 4PSXB 4CSZA 1C5CL 2COVD 1ECZA 5DEFA 1UOQA 5BZDA 2OZ4A 5G2NA 1OAUH 2CMRL 2BNQE 4X9GA 3GB7B 2WVVA 2HLAB 3U9PH 5IW6B 4BZ1L 4NSXA 1FORL 1WCBA 4YAQA 3WNIA 1CL7H 2KLSA 2BPBA 4XE5B 5EMKB 3VFMA 3FF8A 1AHWC 1XZ0A 3DIFA 1O5DT 3A4FA 5IFJA 2OK6A 5JW4R 1N5YL 1R24B 2HFFA 1A4BA 3H0TB 3O6LL 1OP5H 4EN3B 2VRKA 2QQNL 4XNXL 4FNQA 3GXFA 4YSPA 3FCSA 5BVPL 3MCLH 3ML8A 2FO4B 2LFEA 3DX6A 1NFDB 3IDYC 3WJLA 1RCYA 4HKBA 3LZFH 4N0YH 4WKZA 1HHKB 4UAOB 1EEUA 2R1XA 1F41A 5LBVA 4UIMA 3D9AL 4AGQA 3GRGA 5D4QA 2FR4A 2I24N 3FUMA 1PZ5B 3EQ8A 2C7UB 4Z7OB 3HUJB 3QUML 1TTUA 3BSHA 3HZKB 1ONQB 4JZJC 3QXTA 1I1YA 1AAJA 5D5MB 1T20B 1AR1C 1UT1A 2J1XA 5KOVC 5C9ZB 3MLWH 1KB5A 4L5FH 2PWHA 3EYVB 4Q9RL 2XHNA 1I7TA 1J9SA 4TNEA 5CILL 1ZTXL 3ZLQC 4F3FA 4KXAA 2XIIA 4FQIH 4FMFA 4K94C 4ZT1A 4H8WH 1MCPL 1AOZA 4HCRL 1A65A 2GSIA 4KRPC 4XPFH 4JW3A 4ES8A 4FHJA 3GFUA 1EFQA 1T7VA 4LDLB 4L9LC 4WFEE 4YO0B 1IB5A 1RJZB 3K1DA 4NZTH 1T1ZA 1U0QA 4EDWH 3QIWB 4ZOZA 3EDEA 3KYMA 1WQVT 4L4VD 2WQRA 3APFA 1N10A 2AJ3A 4HJ0C 1DVFD 1KZYA 1Y6NR 3CFEA 3MV7E 4NC4A 4XPHH 1DSFH 1PF3A 5F3HB 5ACMA 1OAZL 4V2CB 5EUKB 5F8QC 1RHFA 3MTXA 4G6FB 4POYA 3WEXA 2A74B 3KYOB 2DN7A 1F4YH 2NR6D 2Y07L 2ZSVA 3FU7B 2VDKB 4OLVL 2V17H 4EOWL 1FL5B 4H44C 1PBYB 4NP9A 1T0NB 2I85A 1QSED 1ZANL 2VN5A 4UT9L 3PWJA 4YBLB 1GS7A 2QQLH 1BQUA 5IVXE 2YNOA 3K91A 3A6BH 1XF4A 3CVHB 3ZW3A 4LXFA 2A0LC 1HHIA 4E5ZB 5IF0B 3MJ6A 4QXTA 4KO6A 1JYWA 3IFNL 1XR8A 3UO1L 2YA2A 3WKQA 1AY1L 4NO0A 3T65B 4ZMOA 1LTXA 4PLNC 1WUZA 3RFZA 1PG7H 4PI2A 3TBYA 3WD5H 1QR1B 1WEJL 2GUOB 2LHAA 4PIRF 1U8IA 2CQVA 1NCTA 4MA1B 4MMZC 3PV7A 3ESUF 3B7RL 1PY4A 1RLWA 3PS6A 4LCCC 4UM8A 8PAZA 2EJ1A 3QQDB 3GM8A 4P46D 1EGJA 1FFNB 1XHHA 4DKAA 3V0JA 4J4PA 3L13A 1C12B 4HBQA 4WQOA 5AMSA 1JZ2A 2Y6TE 1TNNA 3L5HA 2DLEA 4NCC1 2G2RB 5JW4N 4L8DA 4Z7QF 4M8QA 3T2QA 3VFWA 4EMZA 1TZAA 3ZE2A 5IJVB 4X99B 3EYSL 5F1IA 3VGDA 3KPQA 3C6LD 2J6EH 4Z76B 2GFBA 3F7LA 5IVZA 3TT3H 4WUKH 3F04A 4XODA 3X3FH 3BGFB 4WI0B 2XN0A 5IB5A 3LQAL 3BAEH 4TNWF 3O3UN 3N85H 1ACXA 2IAND 2K8MA 2FX9H 2JXMB 3P4OB 1KEMH 1TF4A 4M6NL 4EZJA 1Z9NA 2E56A 3KVQA 5DA0B 2BWDA 5EOCJ 1W72L 3U9UA 2X12A 3IGFA 1GAFL 4BINA 4J3OG 4L1SA 3QNXA 1U3HA 1DO5A 3TBWB 4MBOA 1N68A 2DYRB 5D7LD 2BLFA 5H37H 3G6DH 3FO9A 2HRHA 4F15B 3G5XA 3NT0A 4S1RH 1COBA 3MOBL 4HMCA 1ADQH 3P30L 2EUZA 3W0WD 2HG5B 1ZT4B 3LRMA 4WUUB 5TPWL 3S3SA 1QA9B 2BP0B 1FJ1B 2GY7B 2WKOF 5E70A 5T1KA 3U30C 5F71A 1FE8H 1XIPA 1K8DA 4PJCE 4YGVB 2BVPA 1FNEA 2WZ5A 1IBHA 5J9PA 4YDNA 3CIAA 5EOQL 4GMTH 3NSXA 3IFLL 1BFVL 4NN5C 3KYNB 1WWWX 3JT2A 5JHLL 1MCWW 4YMPA 2ZCHL 3NTCL 3V10A 1WZ1L 1JGIA 3CSPA 3T0DA 2EIZA 5GZOD 3CDZB 4WSKA 2FX8H 4DK3A 1SHWA 5EC1A 4AVKA 4R97B 1C7TA 4O5LH 1LEKB 2JCWA 4R2GC 4HLEA 4FDWA 3IXAB 3QEUA 1L0QA 3N44B 3DPBB 2J8UA 3BVDB 5IOPA 3SPHA 5K9JH 2XFGB 1FH5H 2UXTA 3GYRA 3UC2A 5J4MA 3LMJH 4UIKH 4EI5A 5HI4C 2VQUA 2OMYA 3T3PE 5AZEL 5C0FB 2YGOA 3BP7B 3JWOC 3RX5A 1MF2H 1KCBA 3UROR 1NEPA 3KGUA 4PRPA 3HAEA 1BREA 4ZOBA 2F54B 1T0OA 2VQ1A 5L6YL 1KENH 3Q3GA 3OKEB 4NQEB 4MXWL 4KMQA 3EUDA 4WSJA 1M7DB 4HIHB 5EFIB 2AJXH 2OMWA 3VGBA 1VFUA 3AAZB 2P5WE 1UYWL 4J1UA 3HZYA 1EV2E 2ZJSH 3TBBA 5GRZA 4YHOL 3GD1I 4MCNA 4YXKH 1ILSA 2AXGA 3HN8A 1S2EA 4DZBA 1WZAA 3L95A 1I9JL 2B77A 1MQKL 3SCYA 1C16A 2V3FA 1QHQA 4NJ9H 1CYGA 5M95B 5C08E 1SEQL 3MRIB 1EEYA 2Y23A 2PTTA 4YFDB 4ZSOA 2O5ZH 3WYRA 3ZE1B 3CHRA 4BELD 4BUHA 4A0AA 2X6BA 1Z9OA 2FNWA 5KBKA 4KDVA 4X5LA 2DQGH 1XB3A 2NNAB 5GGSB 3LNHA 3I7PA 4Z3HA 1FZMB 3QEQD 1FGNL 2ZG3A 3SCMC 3O2WH 4E54B 4IMKA 2PPFA 4POUB 3OQRA 4Y2DC 4KAQL 5F2FA 2YPLB 1O75A 2EDFA 4M8RA 3IF1A 2FATL 5EPMA 5J6HB 3UVMA 3QJHA 3QWOA 1A7BA 1QNZH 3DVNA 3OBAA 2QMKA 5HHVL 4L0ZA 5B7FA 5DQ9B 1ERJA 3R06B 3AH8B 1QVOA 3PAYA 1MNUH 2X3CA 2ZKMX 1AHWB 2O72A 2FIKB 4R26H 5H1MA 2ARWA 5GSRB 2XWTB 1E67A 3J2PA 4WFHD 5F7KC 4CC1A 5IFAL 3RL2B 4ONGL 5KYXA 2FEEL 1AO7D 4X6FA 5ALBH 1KCWA 4R7NB 3DIVA 1DZBA 3DVGB 1ETZB 3KLQA 3CDGA 4TYUA 3NN8A 3B9KA 5LAXB 4A38A 4NC1C 6FABH 3TV3H 3U7YL 4HGKC 3FCUA 1OAYL 4OTXL 3IDYB 4TSAL 2R1YB 3L4TA 4N6RA 4OF6A 3AROA 1GGUA 1LWHA 3IDNA 3ULUF 2V5MA 3IUMA 3DETD 5CNHA 3HS0A 4ZNCD 5TEEA 5J1SC 4LE8A 4QYAA 4Z7WB 1WAAA 2XNAA 2MCPL 4LNRA 1SBSH 4UNIA 3ESMA 3D4ZA 5D71H 5C0JB 3F2LA 1BQ5A 3MBWB 4NRYA 5DVOA 3S34H 4KOCA 4JZJB 3DRQA 4W9FC 5AAWA 1AR1B 1AXTL 3IUJA 1SYVA 3V0HA 3NZUA 1YFQA 3V6OA 5I8CA 5BUAA 3PE9A 1XGRB 1LWRA 1NGQL 1RV6X 1WS8A 3SQOL 3D69A 4KRPB 1DQJB 3ZYIA 3ABMB 2VLLA 1MVYA 2NCMA 1U4FA 2VXSH 2XXCB 3BVNA 5DJ0B 4L9LB 3BRDA 2BVTA 1QHOA 4B3EA 4X6EA 4FFZH 1ET5A 5D7EA 2J8UF 1I3VA 4JHWL 5DD1H 5K1JA 3VD0A 4P2RA 3TBTA 1PDKB 4DGIL 5KVDE 5I1HH 3BDYH 3IM1A 4DGYH 3QISA 4JFPA 4PJ5D 2CO3A 4JY5H 1ZT1B 3MNVA 3FZUC 3P54A 4KITB 2P3YA 3MKKA 3GKZA 2AQ2A 2R1WA 2A6DA 1LYQA 1LEIA 3UZVB 3LIZH 3CN3A 3I7NA 3VO0A 2VDQA 4ZFQA 2HJLA 1U41A 3AS3A 1TETH 3K5SA 4ZD3L 5DQDH 5C07E 3DGDA 5KVGH 1A12A 1UXSB 1PIFA 4DO4A 2YC1B 1ES0A 1AXSA 2DYPB 3LDBC 2IJ0C 3D18B 3WBDA 4WFFD 3GFCA 4A67A 1EO5A 2ZE0A 1P6AB 1QWNA 3UAJA 4ADIA 3MRRA 1XF3B 2R7EB 3RWHB 4BUJC 4HWUA 5LNEA 4PRBB 2YGQA 3V4PL 4N2HA 3FRUB 2UYLA 1LO4L 2VOTA 3G5VA 2EEAA 2XZAL 3JWNC 3DYMA 1XHMA 4KQ3H 1PZAA 2GI0A 3CV5A 4Z7VF 2DMHA 4AQEB 1AZBA 1P5VA 3S2AA 4MMZB 3L3JA 2FD6H 2LV4A 3N43F 2PLTA 2RA1A 2E27H 5EU6B 4LCCB 1WLHA 4QKTA 4Y5VC 3ZR5A 2H13A 5I76A 1TVHA 3CSYA 4HKXB 4F7TB 4JDEA 4LP8A 1YNKL 2YRBA 4UQDA 5IESL 1FNAA 5B38A 3AXIA 5FO8B 2YMUA 3IVKB 4OT1L 1CD8A 2ZXWB 3Q1EA 4JZOA 4XRCB 3F01A 2V9UA 1QKZL 4DTGL 5GS0D 3MO1A 1N0XH 2NSXA 3II1A 5EN2B 4DW2L 4PBWD 1MG2A 2XTJD 2JIXA 3MLTB 4ZUVA 4L5FE 2D0FA 2H1XA 4TRPL 1CLYL 4HIJB 3C8HA 3T0EC 4Y1AD 2YD1A 3ABZA 3LHPH 3TWCH 3SXTD 4G80A 4PJEB 4ZMVA 5IC7A 3O9WA 5HHOD 1BQSA 4H7VA 4X9FA 5I8KH 2VW4A 3IPFA 4PY8J 1FAIH 1PX8A 3DSFH 3L8QA 3IXTA 1XMWA 4OCSH 2BSTA 5EWIL 2B39A 1NGXB 2VMDA 5D8JH 5F7WC 2WMPB 4HUXB 2BIQA 1T21B 4X80H 1L9OA 1U91A 1F56A 3PDOB 1PX3A 5FA4A 2I0RA 1A64A 2AJZB 5IGOA 4M5YL 1MOEA 3PL6C 1GRWA 5ANME 3ZWLB 2JB5L 3MBXL 1NQBA 3U1SH 4A7GA 1OOAA 1CU4H 4WI4A 4NBMA 2YD8A 1IBDA 1WAAF 1YY9C 4BJLA 3U30B 2NRDA 2R9HC 2VMFA 2CO2A 2E8ZA 2PWGA 4XN7A 4AGLA 2MSPA 4J82A 1BMGA 2LOEA 1WFIA 3MXWH 5KBNC 3AY4A 3BVUA 1FWXA 1J18A 2QTEA 4JRYA 1D6EA 4HBCH 4AMKH 3EF4A 1PX4A 3APCA 3QIUC 1H6TA 4XXCA 3KG5A 5JO5A 3G6JF 2DQHL 2CPCA 3WSQH 5FO7B 1KYFA 4ELMB 4Z3GA 5C9JA 2WP3O 4PC0A 1OSEA 1W0VA 2W0LA 1E6OH 2EDWA 3V9FA 2XQYA 2Y7QA 4R2GB 4J28A 2KQNA 3UTOA 2VQ4A 4YZFE 5AL8A 5C3IA 4JHZA 3IDGB 1JNLH 43CAA 3P4NA 1I8IA 4OWRA 4AE1A 3ZL4L 3AXLA 4QY8B 2AJSH 3WXWH 1SY6H 1NUGA 4KHXL 4RISH 3WNOA 2F7PA 4C47A 2BIHA 1JGDB 1OE1A 4OB5H 2B4CH 2J1KA 1V27A 1S9YA 3EO1B 3KPPB 1T2QH 5DR5H 5I66A 4J8RB 4Z95L 4QXUH 3MGTA 4NO3A 1PZ2A 3NIFB 5AOMA 1ZLWK 3OKKB 1YEJH 4CL7A 2R2EA 2H26A 2VN7A 2WBJC 4LESA 3TH4T 4PLKD 4TQEL 4YDIH 2XPGB 2CH8A 3GBMH 5GSVA 3WKML 4UQ9A 2EYRA 4WUUD 5GXBB 5LB1A 1IC5H 3GSUB 4HC1L 4DGWC 1I3UA 1PCXA 2CCWA 3OZKA 4WHTA 1O0VA 1U8CB 2GHWB 4Y9BA 3DSMA 3WLBB 5TDOB 2BCMA 1GJUA 3MLXL 3SE4C 4DKFH 1OHQA 4FTVE 2HU8A 3IFOA 1WAEA 3LHAA 3ULVD 4ABWA 3CVBA 4P2OA 4QR7A 3QI9C 2NTFA 2CRZA 3SCMB 3UGUA 4QNPE 3MA9H 3GXPA 3PV6B 3DTUB 4Y2DB 3VQ1C 2BKLA 4KVNL 3ZYZA 4MAZA 1KCUH 1GGIL 1XSIA 3I50H 2F19L 4ZX5A 3VI3B 7PAZA 3IAGC 4GW1A 5CLXA 5D2LA 4U1KB 1HZHL 5F88B 1IAII 3L81A 3QQ9C 4FXGA 5I5IA 1WGVA 4UV4H 2XXFA 3SFZA 1Q72H 2YR3A 3BVVA 2NZIA 4FFYL 4HG4K 3AREA 1EAQA 2A38A 4ALAC 3NFSL 4AQ8C 1G6RA 1VRSA 1S7QB 2Z31D 1AQHA 2F54D 2QPEB 4P5TA 3V8CA 1HINH 2J56H 3PG2A 2Q8BH 5AD0A 5GGSY 1X5IA 1DCEA 2A4ZA 3NIGB 4ESKA 2H0FA 5AG8A 2AEPH 5DJ2B 4HKJB 3BSGA 3WNNA 2EDHA 4PEEA 4O02A 4TN9A 4B6ZA 4TTDC 4V1DA 4ZO9A 2A73A 4MD0B 3C09C 1SJEB 2FQGA 2P42B 1BX2A 4IS6B 4PS4L 3ROLA 2IDCA 1FHGA 5CUSH 3WEBA 3V0IA 1F45A 3FSWA 5EF3A 3PFUA 2A77L 4XBEL 3QNZB 4PRDB 1JRHI 1KIRA 3T1FA 2C7FA 2UX6A 2YMXL 3PWLB 2XZQH 4TPRL 3SPVA 4NQXB 3IAPA 1VESA 1YYLL 4JKLA 2Q2EB 2OMUA 4ODWA 2NUPB 4NM4H 3QDHA 4EO5A 2Q87A 4ZG1A 4RFEB 1A25A 1YDPB 5TE4L 3LRKA 2W0PA 1MPAH 2AEWA 5AEAA 2YPLD 2AQNA 4R7LA 1YEFH 3A3YB 4HPYL 1HOEA 3ZQ9A 1BZ9B 4B7LA 1XSJA 3UBXG 3UTTB 2ZOOA 2ADJB 2I0SA 2P9LC 1O7SA 1DUZB 2X4NB 4PWIA 1DEEA 1SRDA 2MNUA 3ARRA 3ZKMC 3LNEA 4HWZB 4A08B 4OD1L 1IU1A 3V5DA 3QDMD 3SYCA 1A6PA 4KK9C 2ZICA 4NQDA 2W1NA 3PHOA 1QFMA 1X9LA 1RHHA 4O58L 1HT6A 2QSCH 4WV1A 3L1EA 4WVRA 5IJDC 4MKTA 3C87A 5DUPL 1RUKH 4QEGA 1IGML 1VCBC 2VRQA 1PEVA 5FO2A 4E5XB 3S36H 1OM9A 1S7SB 2OJEB 3S0PA 3AVEA 4G71B 3V5WB 1CBVH 3LDBB 2VDPH 4WTXA 3EXLA 1D7FA 3FDWA 3QXUA 4M29A 1OSZA 5ID0A 4PJFF 1NGZB 5CJ8A 4YXHL 3B1TA 3WUWA 4P57B 1JWSA 2AQ3A 3S3PA 1VZGA 3V9EA 2VABB 3DX7B 3JUYA 3FRPG 3RDJA 1W6WA 1AR1D 5TDNB 4XNZC 2FQDA 1SVCP 2O9KA 2C9RA 2BFGA 2XSKA 1K5NB 3ZE0A 1B0WA 1ZVNA 4OJDH 2OTWA 4Y5VB 2B9AA 3QPQD 4RZCB 4KPHL 4P9ML 3HPJA 2OL3H 4OCNC 4Y4HC 1ILUA 3ULUL 1I8MA 4E9TA 4K5PA 1ZHLA 4XPAH 1F1AA 2CDEB 2NW2A 1YR2A 1OGAB 1H3WM 4C54A 1HWHB 1MAJA 4GLRI 4HJ0D 4KKQA 4TQ8A 5D2NC 4ZO8A 5BS0E 4OZIF 3BN9C 4A09A 1CLVA 1VEOA 3ARZA 3BESR 5HDBA 2UZXB 2DH3A 2ATPB 3BG0A 3T0EB 4NAMA 5F7DA 4L4TA 2YHGA 4HISA 4Y16A 1BVLA 3KGTA 1BQLH 3OJMB 4ENEC 4NO5B 4B27A 3N3EA 4B9GA 1MCOH 4G43B 3FUHA 1IGTA 4JRXE 3IMUA 3MLYL 1MDAH 3DJTA 4OQTL 3VI4E 1RURL 4KI1A 3IUNA 3SKOA 3ETTA 4DFHA 1T1WA 4JE0A 5D72L 4ZMTA 1GGYA 8FABA 2XZCL 1OVZA 5FWQA 5GRJL 1AKJB 2XWEA 3CN1A 3QFDA 2DYPD 4ZK8A 3ZIYA 5CINL 1R0AH 2EDJA 2VAAB 3IKKA 2A0LD 3FULA 4I79A 1OXYA 4ZTPL 1YNLH 1X9QA 3PL6B 3VWKC 1DJYA 5E1QA 5T1DH 3V5KB 2H6OA 4HJGA 1T66C 2FAUA 1F2XK 1KPVA 1W8EA 3VXRB 4R90H 4P3DA 2VLJB 1ORSB 2DQEH 3GT6A 2WXIA 3MODH 4MMYA 5GZNC 3CXFA 5FUCE 1FRGL 2VIRA 2XWJB 3RNKB 3LNDA 4C8XA 4JANB 5CLTA 2UVEA 2YNNA 4D3CH 2Q7YA 3OAUH 3G5YA 2XY2A 3MROA 1I4FA 3OX8B 4GIAA 4ZFOB 1JMZA 3VXUE 2XQ0A 3H3PH 1A7QH 3NJHA 2HRPH 4E41B 4KFMA 2X70A 3BZEA 1AGFA 3VA6A 2OMVB 3K72B 3IIWA 5CJQH 3L4MD 5D1ZB 4PI0A 4X6BA 1B3JA 1UD8A 3FU5A 2XWBB 4PRHB 5CIPA 5FR3A 2JQZA 1OY3B 4KNQA 5EC2B 5G4OA 1NH6A 5CM1A 5F0PB 3K6SA 2NY2C 1MQ8A 4H0IA 5E4AA 2DWDA 2BXZA 2JJUA 4IHOA 4OFYA 1G1YA 4BQCA 2EH8L 3QDAA 3I7OA 3TT1H 3EH5B 4NKOB 3MJ8B 3KPNB 4WJG3 1CF8H 4FJZA 2G75B 1YUHA 5TE6L 2J20A 4GQ2P 4EBQH 4MBRA 5KYWA 3DVFA 1MFCL 3MZLA 2F58L 1DQDL 2OXHB 4J6IA 1IKFH 1OF2A 1XF5B 5ADOL 2WBJB 3RHWF 5C7XH 5I17A 2Z8WC 4X63B 1T1XB 4X7TA 4BK8A 4KK8C 3Q06A 2BHUA 2DEWX 3SOTA 3VXMD 4HD5A 3PSLA 1N0LB 3I3BA 3HC3H 1V3JA 1HFUA 3EOAB 2W8CA 4JFSA 9PCYA 1KDJA 4FRWA 1I7UB 2Z8SA 1VPOL 3EZ8A 5T1MB 3UFIA 1UOOA 3OF6D 5JYMA 4FQHB 1SEBA 3ZN6A 3VG9C 1EFXB 1RZQA 4GP5B 4OCRL 2DBLL 1YEIL 4MMXA 4Z7NB 2AV1B 1BM3L 2IAAA 1MRCH 5EEZA 5EIIA 3QT2A 5CF3A 2ZSWB 2FUTA 4E68A 4G7VH 4M7KH 4LCIL 4XZUB 1N7MH 5F1NA 3E6HA 5E5MA 3QZPA 3QI9B 1NUFA 4R3SA 5CP3A 3PWUB 3ARGD 3MI6A 2Q76B 3NCCB 3OKNB 1J11A 5ENWA 4CVWA 4S11A 2D7TH 3FB6A 4K2UL 4IOFC 4ERSH 3U4BH 3WJLC 2RD0A 3EYFB 5IFHL 4NNYA 1ZEAL 5J6SA 5BNXD 1EXUB 4QXGL 2F5BL 5IJCC 3NK3A 1AR2A 2GBAA 1UWGL 1JJUB 1CXKA 3BEVB 5FKTA 1XGQA 1B4JH 1JK8B 1JS4A 4OM0L 5I74C 1NSNH 1BGXH 2VLMD 3H9SA 3N1QC 5LCVL 1FG9C 3RWGB 1OV8A 4F7MB 4HK3N 2AGJH 1Q0YL 5IW1A 3D52A 5I0DA 1JXDA 5ESAA 4FAVD 4XAKD 2CUIA 1IEAA 4ZMQA 4ERZA 4PJBE 3GO1L 4AQ1A 5T5NG 2EKSB 3CMOH 1TZHA 5GGVY 2E9JA 3PGDA 3C09B 4FQCH 4A2LA 1VZIA 1C1EH 1G7QB 2BXYA 1S9VA 1L7IL 2FJHA 3U4AA 3UDWC 2CCLA 2W0FA 5AVYB 2Y72A 4XMLH 2CO0A 4N2NA 3T8XA 3FOLB 3T6ZA 2EKJA 4OF8A 4G3YH 1P7QB 3BUYA 2WK2A 4UYQA 4XPTL 1A4KB 3PSCB 1ZA3A 2CO6A 3CZFA 2PR4L 3KXFD 5MI0C 2V2TB 1ASOA 3BLBA 3NSDA 4M5TA 3MJ7B 4WK0B 1RD6A 1HK6A 5DHXB 5LWYH 4N85A 2HVBA 4QHMA 3SJVA 1YCSA 1RIHL 1T0MA 3VI4F 1FVCB 1QUNA 1R3HB 5EMYA 4X7SH 1MIEL 1U3JA 4OUUA 5CN1A 5IBUB 3NRQA 3V7AE 1R5WA 3DI2B 5HGDB 3UYOD 3GS4A 2F53E 3QXVA 4XAWL 1OM3H 1EK3A 2W60A 3NQKA 4HQQH 2FX7L 5J12C 5KSVA 5M61A 2YBRB 3SO3C 1P69B 4JQIH 3SIKA 4U3CA 5K1CC 2F7IA 3REWA 3MV8A 1TTRA 4GRWF 3RFZC 2VLKA 1YMMB 2YK1L 3RDTA 4MJIE 1UXWA 1A7RL 5GIRA 5ITBH 3B8YA 5AFAA 4ZXBA 1OE3A 3LD8C 1XGUB 4O51B 4U6YB 3II3A 4DVBA 1KLUB 3GHBL 4QT5A 4EVNB 2YPKB 4G70B 4R5VA 4QDGA 2BK8A 4J4PC 2BHYA 3P3RA 4GAJL 4PWHA 4LLVA 3E9UA 1CGYA 3GGWB 3FO0L 2WQUA 4PJIE 1HXMB 5IR1A 1MRFH 1A1NA 2J4WL 4ZI8A 2DLTA 2F8VA 2XV3A 2VC2B 5ESQA 5FYJL 4OF3A 1BLNA 4XNZB 3PWPE 3PWNA 6TAAA 2R4RH 3HNVL 4GNKB 1WBZA 5J6GA 5DSCB 5GGVH 5J06A 4PSRA 2OMXA 2PCFB 1NDGA 2Z93A 1B4RA 2ZT9C 1EHNA 3L2LA 4TULL 3BDXA 1CT8A 1EBAA 4XN8A 4J84A 1U3HC 5FYKL 4E2OA 1T4KA 2JKRM 4NO2A 1IGIL 4KXBA 2KKQA 3DI3B 4M9OA 1G7JB 4YDLC 2RQ8A 3UTTD 2UY6A 4NYLB 1ACYH 5DMGD 3LN4A 2KBGA 3QXAB 3TJEH 4FA9D 5D2NB 1K6QH 3DSNB 1INDH 1BQHA 5EBWA 1OP9A 4I3GA 2XXGA 1E4WH 3HG1A 3B1UA 4K3JL 4RMQA 5FB8B 3K8KA 1FCGA 3ROOA 4DO5A 4X6CA 5BZWA 1MHCA 1O9VA 4KTDL 5I75C 1N70A 3IT8D 3L9YA 4PLJC 4PU2A 2RIKA 5DMIH 4LU5L 4XXDA 3U25A 5L4JA 1OCRB 1XCQB 3IJEB 5DS8A 3LB6C 5C09D 2XN9E 3UTZB 3UC0H 1JGUH 4ONFL 4KI5C 3VXOA 1IM9A 1UB5A 2W59A 3CX5J 2W9DL 3PNWA 4ANUA 5I6MA 5JIMA 1IGYB 2V9TA 4D8OA 3MR9A 1RL1A 3F84A 1OCOB 1KCKA 3LN5B 4J8QA 3G5ZA 1XR9A 3SDDA 2K8QA 2XIDA 5E8PA 2KLRA 1Q9WB 4IM8A 4KUZH 3VWKB 4PB9L 1N64L 4MQSB 2X2JA 3E38A 4Y9FA 5DC4B 3JTTA 5DJDA 2D9QB 4ERQA 2QGEA 3KJ6H 1T7ZA 4X4KA 5E6ID 2P8MB 3F7KA 3HC0B 2NX5E 4QGYA 3REVA 4LG8A 4EI5C 4RGOH 5L2JB 4LLWA 2I27N 3MJGX 2ICWB 1IEBA 1NMCC 2ADIA 1QLEL 1OTUD 3HG4A 1G9NH 3L7FA 3SDXA 3FMGH 3FUIA 5LVEA 3L48A 2LVEA 4TL4A 1MI5E 3STLB 2IPKA 1NLBH 2YKLL 3I7LA 4JCLA 4Y7OC 4H1LA 2QPDB 1JOFA 3HE6A 4XVUD 3RWDA 3FM0A 4MK0B 4XO4A 5FV1L 3KBFA 4BH8A 5FKPA 1JFHA 5HYQA 1PYWA 4JFOA 3SY0B 1S3RA 2PM9A 2NY2B 3C5MA 5DK2B 1U33A 2J2ZB 3ARFD 2F5AL 2ZUSA 4WEMB 3SBQA 1GIGH 4YSAA 4F92B 2QC5A 4LRNL 2J57A 4OJAA 3GI9L 3SJLD 2PETA 4DVRH 2CBQA 4LEXL 3VQ2C 1YN6A 4M7JH 3Q44A 3EI1A 3CD4A 2Q6WA 3CSTA 1AKJD 1BVZA 1FHNA 1NCBL 4K55A 4O2EA 4PMEA 3G04A 5GPRA 4M1GH 3AQZA 5AB2A 1SN0A 4YHKL 1KFAH 1S9KC 4IMKC 3LZQA 1QBLH 5DEFB 5BZDB 5KYNA 1NAMA 2BHFA 2Z0UA 4Z7QB 2AITA 4S2SA 3VXRD 2PP7A 2VLJD 2WVVB 1YY9D 1JGLH 1YQVL 1SXNA 2X4OA 3P11L 1ZLSL 4LCWA 2DQFA 1TIUA 5FCSH 1SHXA 4FZ8L 4DKDC 1WCBB 3PGCA 4HUNB 5A6IA 3VSUA 4Y4KA 5CEZH 4S1SH 4G7RB 3VG9B 3H6AA 2YD4A 3MHZA 4S0TD 4TSCH 3VFMB 5LN8A 3IYLW 1XZ0B 3DIFB 1MCIA 5IFJB 2VNCA 3QIBA 3KPRA 2C9VA 3SE8L 3WN5A 5I1KH 1DBMH 4TL5A 2HFFB 3FTZA 4PP2B 3IJHA 1EDYA 3T2OA 3D39A 5D1ZD 5JOEA 3B9KC 3FCSB 4PRHD 5FM8A 1NBZA 2MWCA 4PSPA 4L37A 3ZUCA 2I25N 3DX6B 2VB5A 1MREH 4HKBB 3EJCA 4WKZB 1KWGA 1S8DA 5I8EA 1N8OE 3VFPA 2IURA 4LDEB 1NL0H 2OR8A 3HS0C 4DQAA 4UIMB 1RZJH 5IJBC 4FNRA 2O5YL 2BO0A 4X6CF 5I74B 2H6NA 1HSBA 1WBXB 3IJ9A 5HJ3A 5T3XD 3VW3H 4M8UA 2DLIA 2Q9OA 3MNMA 3N1PC 3MCG1 3RPKA 2H14A 1I1YB 5AAWC 4GRLD 3TH2T 5D7SH 4WWPA 4B60A 1G7HA 1KB5B 4PJ7E 5KVFE 3RL1A 1I7TB 3L3DA 4D9RE 4J3OH 4U6XA 2DEXX 3WIHL 2FH6A 4F3FB 4L8SA 3V6OC 1BWWA 4F58H 2WBJD 2QSQA 4GT0A 2BVUA 1RZFH 2GSIB 1VHPA 1O7VA 3DHUA 5DD3H 3ZDXA 1F4XH 1H19A 2WQXA 1DYZA 4FADA 3CZLA 2VTFA 1T1ZB 2E8YA 1MJ7H 4JUSA 2RBLA 1IM3D 3KYMB 2WYTA 1R5MA 5DTFA 2UXFA 2X28A 3CFEB 5HE0B 3QORA 3GJFA 4Z0BL 1X7TA 1Z0MA 4XX1G 2YJQA 4HCFA 5H8DA 3RY6A 2APWA 3WEXB 4GXVH 5MI0B 1FLTX 3K6OA 2KS0A 1U3ZA 1KGYE 5FXYA 2ZSVB 3GSWA 4PW4A 1B6UA 2XTSA 2TSAA 3V9CA 5K69A 1RUQH 1YUKB 2XRAH 1OZTG 3PWJB 2QQKH 2EO7A 2WWKO 4K15A 3S88H 4DSYA 3V0AC 2WTOA 5EF1A 4GIPD 1XF4B 3FUDA 4AEFA 2VZOA 3H2QA 1HHIB 1UADC 3QQ9D 2ZYRA 3L9RA 4QXTB 1GYWA 3UAJC 3AL9A 2GEEA 3SO3B 4LL9A 3U46A 4BCYA 3JV4A 3C99A 4RRPM 3E3QE 2Z6FA 3IJSA 3TIDA 3EG6A 3OKOA 4UB0L 3WNMA 2BDNH 3RFZB 3VNZA 4WWOA 3L2NA 3TBYB 5I1GH 3HVDA 5IQLA 5I0WA 3IPBA 1U8IB 4PGDA 4I85A 4OIFA 3VFVA 3NCFB 4K8RC 1SDDA 1UCTA 4XT1C 1NBVL 3LD8B 3OGCB 5JIIA 3C75A 2N0MA 4UM8B 5KVEH 3V4VH 4AKOA 1HEJC 1SHSA 4GKNA 3VFGH 2Q86A 4N25A 1K8KC 4HZAA 3Q8AA 5BW7A 1QPXA 2MEJB 4L8DB 4I77L 5FDYA 3BN3B 3VFWB 3ZE2B 3KPLA 3T2PA 3ARYA 1R3IL 1MG2C 2A6IA 5F1IB 3KPQB 2YARA 1W15A 2GFBB 2X9WA 5IVZB 5TDPA 1D5MA 1V3MA 1P7QD 5IB5B 2IPUG 4P2QD 1TBGA 4K7PY 1QQDA 4M62H 1LO5B 2YQ3A 2C9PA 1F0LA