3V4VA

Crystal structure of a4b7 headpiece complexed with fab act-1 and ro0505376
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
587
structure length
582
Chain Sequence
YNVDTESALLYQGPHNTLFGYSVVLHSHGANRWLLVGAPTANWLANASVINPGAIYRCRIGKNPGQTCEQLQLGSPNGEPCGKTCLEERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYIKNENKLPTGGCYGVPPDLRTELSKRIAPCYQDYVKKFGENFASCQAGISSFYTKDLIVMGAPGSSYWTGSLFVYNITTNKYKAFLDKQNQVKFGSYLGYSVGAGHFRSQHTTEVVGGAPQHEQIGKAYIFSIDEKELNILHEMKGKKLGSYFGASVCAVDLNADGFSDLLVGAPMQSTIREEGRVFVYINSGSGAVMNAMETNLVGSDKYAARFGESIVNLGDIDNDGFEDVAIGAPQEDDLQGAIYIYNGRADGISSTFSQRIEGLQISKSLSMFGQSISGQIDADNNGYVDVAVGAFRSDSAVLLRTRPVVIVDASLSHPESVNRTKFDCVENGWPSVCIDLTLCFSYKGKEVPGYIVLFYNMSLDVNRKAESPPRFYFSSNGTSDVITGSIQVSSREANCRTHQAFMRKDVRDILTPIQIEAAYHLGPHSTEEFPPLQPILQQKKEKDIMKKTINFAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Integrin alpha-4
publication title Structural specializations of a4b7, an Integrin that Mediates Rolling Adhesion
pubmed doi rcsb
source organism Homo sapiens
total genus 126
structure length 582
sequence length 587
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1460 Mainly Beta Sandwich Immunoglobulin-like Integrin domains. Chain A, domain 2 3v4vA02
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3v4vA01
1M1XA 3ZDZA 3ZE0A 4Z7NA 3FCUA 2VC2A 4G1MA 1L5GA 4UM9A 5E6SA 3NIFA 2VDOA 4UM8A 5HDBA 4Z7OA 3V4PA 1TYEA 5FFGA 4MMYA 4MMXA 2VDQA 3IJEA 4IRZA 4O02A 2VDLA 1JV2A 3ZE2A 4WK0A 3NIDA 1U8CA 3ZDYA 3K72A 3K71A 5E6RA 3ZE1A 2VDPA 2VDRA 4WK4A 3V4VA 3VI3A 4Z7QA 2VDNA 5E6UA 4WJKA 3ZDXA 3K6SA 4G1EA 3VI4A 2VDMA 4WK2A 2VDKA 5FFOA 3NIGA 4NENA 3T3PA 4MMZA 3T3MA 3FCSA
chains in the Genus database with same CATH superfamily
5BRZD 5JPNA 2L0DA 1I1YB 4YDKL 5AW3B 5HHNB 1HXYA 1DVFD 2VDPH 4PRHD 1T21B 3VM7A 3TCTA 1TFHA 2FX9H 4P99A 5K1JA 1JNLH 1UKSA 2DYPB 3OKNA 4OBRA 1XMWA 3SOTA 2UZPA 4N90E 5EALA 5FXYA 1A7NL 2P46B 1TZAA 4DAGL 3LZQA 3D0LA 3V2AR 5IESH 2P8LA 4XN4A 4U7SA 3PV6A 4PCTA 3L3KB 4OVVA 3IULA 2ZP0T 3B9VA 1KGUA 4N8UA 4OZFG 1TVHA 5F7UA 4GINA 3L4YA 1NBYA 1K2DA 1SY6L 2GCYB 3J7HA 3QDJD 2PXYB 3GJEB 4XO4A 1JXFA 2X2UA 2HLFD 5CN1A 1X5YA 4PIBA 1YEIH 2FEEI 3KHQA 5IJKC 3GTTA 1FCGA 4G9FD 1T7XA 4Y5XC 1I85A 1HFUA 5JO5B 2BP8B 4ZZKA 1AGFB 4JFDD 4Z3FA 5E6UA 3K4ZA 4TUJA 1E4WL 4V33A 1WBXA 5FM4A 4ZX3A 4KMQA 1FV1B 1S8DB 4IU2A 3ZZSA 1IU1A 1B0RA 2V5SA 3IJHB 3CFBB 4FC3E 5CLWA 2HTKD 4G2AA 3I9PA 4PVNA 1FDLH 3TT3L 4PJ7B 4XCFH 3WFBH 3ROLA 1H9VA 2LHAA 3N44B 3PJLA 4ZTPH 2I7OA 1FG2B 4GIPD 4GQRA 2WMPA 2N7AA 3L3OA 4OB5H 2ZXWB 3GKWL 1NGXA 1G94A 1PEVA 2AVFA 1SUHA 4I18A 3FFCA 2P9LC 3O45A 4LEXH 3TURA 2CDEA 1CD0A 4K73A 3HI6H 2EIZA 3QE5A 4PRHE 1IGYB 2HU7A 5F72S 3TESA 3C6LA 4TNWF 3OKMB 1FLRL 4PP2A 1O75A 2J8UF 4X5QA 5DJ2A 1MPAH 3IGFA 2HT4C 3VG9C 1TCRA 2H0JA 4MASA 3ABKB 1KDIA 4QRAA 1HYSC 1KB5A 2JKJA 3I7PA 1BZ7A 4KRLB 1MNUL 4KJYB 4IDLA 4PN6A 1JZ4A 5FAAA 4WO0A 1LP9F 2VR5A 2HKRA 4H5JA 3UFIA 4G11A 3C9NA 3I3EA 1X9QA 1AR1D 1SHSA 3QDJE 1AD9A 4FULA 6TAAA 1KC5L 3Q8BA 3C08L 5CGMA 4DKAA 1IBYA 2VERN 2NY2B 5BOPA 2B5IB 5IGXH 2AH1A 1OE1A 3VH8B 2JCCE 3RDTB 1I3RB 3HTLX 2YNOA 1G5AA 5HDBA 1VFAB 3IMUA 1G6RL 2V17L 3IJYA 2D7TL 5I73B 4JFDE 4U2ZA 4WEEA 3ZDXE 1AS8A 3FB6A 3X17A 3KR3H 4F80A 4KTDH 1E4HA 4GM8A 4XP9H 1B6UA 1HOCB 4QNPE 1F4WL 2WBJB 2A1WH 1MJUH 2XA3A 4FN0A 2VDKA 3X1FA 2ED6A 2I32A 3LRGA 4XBMA 4PSRA 4GSRA 4JG9A 3QEUB 3VWJA 1NFDA 4RH4A 3WEMA 4K8RL 2WNKA 3PHQA 3OJ2C 3MV11 4OZHA 2C9SA 1C5CL 4Y1SA 5LCVH 2X3BA 4QRBA 5CF3A 3FHQA 3VFWA 1UADC 1LEGA 4F1SA 2CE8A 1QFWH 4M6AA 2EE0A 4XVJH 4UT9L 1BAGA 4JHNA 2CGRL 2H32H 3OX8A 4GKNA 4WHYG 4ES0A 3ARED 5IB3B 4HZAA 2HLAA 2E0PA 2Q8BL 1H6FA 4L4VE 4UOZA 1G87A 4Q6IB 4U1SA 4PB9H 5CXPA 5GGUA 5H94A 1QR1A 3BAKA 5HHXL 1RP9A 3MRGA 4POYA 5AMSA 1KTLB 1YJDL 3MRHA 2KH2B 3ALXA 4PNKB 3SZKC 3EJRA 4PJHB 3PXWD 4M6OL 1KCBA 2X28A 5HDQH 3GHEH 3TT1L 1JZGA 3MLSL 4X8CA 3DI2B 1G6VK 3APFA 2NQ3A 1RK7A 3GXNA 4XNQB 1HCZA 1OSEA 4XC3H 3V4PB 3OLDA 2X1PA 1BFVL 1QKZH 1S9YB 2WINB 2BP5M 2ED8A 2VISB 4ONGH 4ZRGA 1QWHA 4DP0X 1OGPA 4N2HA 4UM9D 3IMVA 2AABL 5SWZD 4OUUA 4PBXA 3AC0A 4UIMB 1NDGA 1XIWC 4JL1A 4YGVA 3V4UL 5KVDH 4GFXA 4DO6A 4IIZA 2NLJA 3MRKA 5D1ZA 4PJIA 5HVHC 3K2MC 4MJ6B 1UB5A 1CR9L 1JGUH 5D93B 3D18B 4R26H 5FKRA 1HHHB 2D73A 4PRBA 4LSDA 5DHMC 4JREC 2VE6A 3QJRB 1DQJB 2MRYA 3NVQA 5JZ7D 2EINB 1VEMA 1ZT7B 3WBDA 1J9RA 2DYSB 2NY3D 2PLTA 5BUAA 2GKIA 3WNKA 4XPGL 3WFDH 3O3BA 2NY7L 4YBQC 2VDRL 4PRAB 1FSKC 4HJJL 1JF1A 4IBVA 5L7XH 3QJSB 3MRRA 4IRSD 1AE6L 5CZXC 3B2UC 2Z35A 5E6SA 3CZJA 3TN0C 3W37A 5CILL 2BVQB 4JG1L 3IT8D 3G5ZA 3FUHA 4Y16C 5DRZA 3ZSSA 4J6RH 2ZICA 2F1BA 3N41F 2A74C 2XWJB 2BMKA 2F7OA 2BS71 4I9XA 3ULVD 2E7BA 3KM2A 4WLCA 4XAWL 3N42B 4YO0A 3QXWA 1A3ZA 2R4SL 5DEZA 4LSRH 1OVZA 3RN0D 1S7UB 5JPMB 3VM5A 5D4IA 4N86A 5TGBA 3P30L 3ARBC 2WIIA 3LKSA 2WLLA 1CLVA 3AL9A 3SKUD 1IJNA 3DROB 3HG2A 3SODB 3BMWA 4JPKL 1HAUA 3NRQA 4LPYA 5EIIG 3CNKA 3BAXA 3MOQA 1EZSA 4PJFA 1TETL 1M6UA 1J12A 2ENPA 4MD4A 3EHBD 3R19A 3M8OL 5MP6L 2J1ZA 3QJFA 3GRWA 1CBVL 3RVVD 4I87A 3PGCB 3DXAB 3KPOB 3BZDA 1P5UA 4I77L 4HIHA 4XMWA 1NEZA 4JHWL 4N6RA 4FZEL 5SWZE 2WWOA 2WVSA 4GQ1A 1A9BB 3PGDA 4CW1A 4KKZA 5AOIA 2IG2L 4X7EC 2I0RA 4IBLT 5D7JD 1TYQC 3S4SG 4FYTA 1NL0H 2C7UB 4ERSL 2WSKA 3NQKA 3MJ7B 3BDYL 3DRQA 3D7PA 4O3TB 3ME0B 2WNWA 3QQ9C 3KPPB 4JE0A 1C16A 3QNZB 4M7LL 1H15A 5GGTL 3HC4L 4BH7B 1A6WL 1UHVA 1M42A 3K4DA 3WN5C 5KVEH 1DR9A 4U1HA 1LE9A 1E8NA 2IDTA 1L9TA 2ZX5A 3MOBL 4L48A 1X44A 1A7QL 3O0RH 3BAEH 5DI8A 4RGMC 2AP2A 2KZBA 4Y2DD 1JGEB 1UWEH 3TYFB 1HC1A 1UYWH 2DMCA 2Q86B 4AXWA 1I1FA 1Z6JT 2X1OA 4Z7WB 1T1XB 3SDXA 2D9CA 3M7OA 2F08A 3V9CA 4EIZC 1NTDA 1OCOB 4AEFA 4GYBA 3LKOA 3RUGF 3ULVE 2NY6C 2DW5A 4XVOA 3BQVA 3UJIL 4ZW6A 2P5EB 4BELD 2VAJA 1NOLA 3VXMD 3AQYA 5B3SB 5CZVH 2JXMA 4LLMB 1N0XL 4LVOB 1E5UI 3Q01A 4CC4A 3EYFB 3W39A 2EZ0C 2AJUL 4HS8L 2AGZA 3BKMH 4JHUA 5A2IH 1S4UX 1U36A 3T0VA 3HG1B 1YMHB 4CKQA 4BWTA 5JHLL 3FTUA 3N2JA 3IDYC 4A63A 1JOFA 5AZ2L 4XTRD 5J12C 3QUYA 4BIKA 1CF1A 1UZ6E 1T89A 1XZWA 1KYAA 1C7SA 1JZIA 3LPFA 4QJ5B 2MPVA 4L2YA 1F4XL 1CICA 5CSZA 4FFYH 1Q0YL 3IF1B 4P3DA 4P2QB 3MJ9A 4KOCA 1HESA 4RAUB 3VD1A 5FYKU 1H2ZA 3JWOH 3EQ8A 1JMXA 5HGAB 2D9QB 3G9AB 3KPQB 5CZRA 1AZVA 2WO4A 5DD6B 1ZVSA 1MFAL 4G9DA 1F18A 2O4EA 3RVXD 1TITA 5EARA 3RVTD 1TYJA 2JJSA 3V55A 4ZFFA 5C9KA 2SEBB 1YFQA 3GS7A 2OJEB 3ZYOA 3D09A 5BZXA 4Z7VE 3UYOD 1EAPB 5DRXB 1KN2L 1MJ8L 1PG7L 4MS6A 2JQZA 3KEHA 3H6JA 1SFDA 4DH2A 3DRTA 3VRLF 2XHNA 2Z3FA 1B4RA 4AN0A 1E4JA 4QRUA 4TSAH 4KTYA 2C3HA 2UZXA 4UIKH 2FGWL 1ZHLA 2VDMH 4M1CC 3HRPA 3SDCC 4UOJA 1I2MB 2EH7H 2HESX 2CCVA 2W60B 2Y36H 3LEYH 3IDJB 3TONA 5I1IH 4AT6A 3ILPA 4AKPA 4EOWH 4IK7A 3ZMEA 1RULH 2APBA 3NIGA 4WWKC 2DIJA 3OGCB 2VDNL 4PFEA 4PJ9A 3VXQB 1WS7A 2KBGA 3D9AL 4NHCH 1ZIAA 3H2PA 2FH8A 1MCPL 3NIFA 4GAYA 2P44B 4DPBX 4GP4B 5IJBC 5KYUB 1Y0LA 3FYEB 3OMZA 3QFJB 4K9EL 4DGWC 2OSLB 4KKAC 4ZXBD 1P84J 2IOOA 1G7QA 4O51B 2E5EA 5TE6H 3EYVB 35C8L 3KYOA 3KCPA 3O8XC 4P4RB 1RIVL 2LU5A 1ILSA 3U0WL 2FSEB 3RWCB 4G7SB 3V0HA 1NCTA 2UY6A 3VJ6B 2C3XA 5DRNB 5F7YC 4U7KA 3AAZA 4EZMA 5G55A 1QUNA 5DMIH 2XE4A 2H9GA 4JFFA 1ACYH 1W0WB 3HE6B 3KS0J 3ZDZA 3AU0A 4CZXA 5IHZA 4WF7A 4LHUB 4OZIA 3W11D 5HHPA 4FNSA 5AFU3 4DQAA 5AUMA 4I48A 3WFHA 3FFCE 3EJQA 4NRYA 4C56A 4IBQA 3FT2A 4I8DA 4KITB 4J39A 3VFRB 1AXTL 1W8EA 1DSYA 3B9KA 4B9KC 4JHAL 3EXLA 3Q2NA 1Q9WB 2IMNA 4N8PA 4FNPA 2XXGA 4G7VL 5TJWK 4CY5A 2B2XH 3V8OA 3RNQB 4AYID 1BYNA 4GMSH 3RGVB 1SYVA 4JRYB 5EMJB 3TYGL 2E56A 3V6OA 1O7DE 5EU6D 2XYCA 4KHXH 3WS3A 1G9MH 1F3DJ 3AQDA 3D69A 1M05B 3C2AL 4WU5A 4L3HD 1O6VA 2BINA 3D06A 1K9TA 4YLQT 2NW2B 4E9YA 4P9MH 4RMTA 4HU2A 1ZGLA 1KGYE 3OR7A 2VDLA 4LGRB 1BIIB 5E08H 1GGUA 3ILQD 1CFQA 1J87A 2PR9A 4LVNB 5KAQF 2Q8AL 3FT4B 5T1DL 5HDBE 4WV1A 5CJOH 4WW2F 5DD1H 4Z0BH 1WTLA 1Q8MA 4C83B 3TBCA 4YE4L 4LEEA 4NO3A 1HCVA 2G9HB 2Q6WA 3WFCL 1IM9A 3Q2WA 4J3SA 3NIDB 1QPPA 3CLWA 3H4FA 4N2IA 3KJ4B 3RILA 3H3BC 3R0MA 3C5MA 1JOIA 2OMVA 4FI7A 4ICWA 3HOGA 3WIFA 2A6JA 2YQ3A 3D2UA 1MY5A 1MDTA 3DX7A 2O61B 3D34A 5C7XL 4ZD3H 2WJ5A 1U8PB 4D0CB 4MX7A 4WKXA 1BQLL 2CAKA 1NFDE 5IMKA 5KJ7E 4H88H 4GAAA 5ILTL 3U2SA 5I30L 2OPCA 3U7YL 2P43B 3JWNG 4OZHE 4U6HA 5E8PA 2CJUL 4A38A 1PLGL 5FUZL 5IHLB 1FGVH 3OQRA 4QHUA 1K4CA 4JPWL 1P7QB 1MCCA 4YVNA 1E40A 3KS0H 4HJIA 3WAJA 1RV6X 5EBLB 4MQSB 1YY8A 3GUFA 3GXFA 4PJCF 3RX8A 4ODUB 1TEGA 3GBMH 5JIQA 2EEFA 2UXTA 3SBWC 3QEGL 3WY4A 2E75C 3MRBA 5EU6E 2ZUVA 2G4GA 3EO0B 3B9AA 3QORB 3WHE0 4ZMLA 2FWOA 1AGCA 4YXHH 3VW3L 3CX5J 5EFIA 3OBAA 3DI3B 3GSXB 3DOSA 2QQLH 3T4YB 1EFQA 4EKJA 5KZCD 5I1JH 1NUFA 3GFUA 2J72A 4Y4HD 5LB1A 1F3DH 1UWFA 5CKGA 2XSKA 2W88A 4ISVA 3I02A 3RHWK 3JWDC 4Y5RD 4X6CA 2VM4A 1VYHC 5BRZB 1MIML 1T4KB 3WKMH 1IAKB 4F8QA 4YSEA 2H3KA 2RAMA 2J2ZB 1R1CA 1QD0A 2GIMA 3BDXA 1DVFB 1MHPH 4PRHB 4GM9A 4D9SA 3IFPB 3BQUA 3HC0A 3H2QA 5JORA 5J1TC 1YYLH 5GS0H 5IV2A 3QZBA 4W9HC 3JB9L 2DLHA 1KBBA 2QQNH 2YKLH 3GMOA 1CD8A 3T3MF 4A6YL 4EDWH 4DGIL 3GXPA 3KYKH 1A6VH 3OPUA 3QCUL 4E0RA 3HZYA 4BK5A 3DVNA 5D4JA 1RIUH 5IB1A 2CA4A 2ITDA 4MNHB 3MUJA 2V2XB 5E5LA 1HN1A 3K1KC 2J56A 2P28B 2VZTA 5B39G 6PCYA 4ECNA 4O2WA 3LEXA 1KCRH 4P5MA 2CIIB 3DSFL 4G9FB 3OD3A 4L4TB 4XP6L 5E6RB 1OSPH 5LG6A 4JZJC 4BSWA 4OW6A 5B38B 4G6FD 4JFDB 1SOQA 1QATA 4GT0A 1HXKA 4LLQB 4AEIH 5AB1A 3O4GA 4LSVL 4R8WL 2GUYA 3GZKA 2PP8A 2RR3A 1MREH 1RVFL 5F88A 5BZWA 1SEQL 4ZX6A 4V2BA 4PTUA 4RDQG 2PM6B 2ZKMX 4YFLI 4B0MM 4PJFE 4UINH 1E6OH 2XIIA 1HKLL 3BC9A 2BSBA 3TFKC 3TH2T 3ZVVA 1AZBA 1I8IA 5C6PB 5AAWA 2QVMA 1WV7T 3AU1B 3MUGA 3PWLB 1V8HA 4CVXB 2CKNA 1QZ1A 1Q9KB 4TNVF 2YUWA 2W81C 4JZOB 1IGIH 1YUHB 4E54B 1WT5C 2B1AH 4RE5A 4I5BB 2HT3C 4MYWB 1H2WA 4GI6A 4HT1L 2J3SA 5EOQL 4YHIA 3V9EA 3T0ED 5I82A 3NK4A 1LEIA 1IZKA 3AXLA 1MCDA 5GZND 3VTMA 2A6KB 5A6MA 5IT2H 2EACA 3IE4A 1T04B 43C9A 3V4VB 3EO1B 3I6SA 2YAHA 1M4KA 4ZOZA 1WEJL 3RIFK 3CFJA 1SVZA 2LAGB 1AR1B 2HX9A 3WAKA 4OGAD 5DC4B 3S35L 3NSYA 5F1IB 5I1AA 4LLYB 1HI6A 4Y8DC 5DJCB 4WSKA 2QSCH 3LQAC 3S3SA 5IB5A 1EAOA 4OJFH 1R5IA 5K9KB 5SWSD 4YR6B 4OLEA 4PSXB 3G5YA 1CVRA 2WTPA 1MFDH 3ARBB 4URKA 3CH8A 2E27L 4NNPL 3A5VA 2ZCLH 4D8OA 3J2PA 2MCPL 1X6NA 2OAAA 1HT6A 1P1ZB 2BY2A 1IL1A 4JFPB 4DVBB 5IFHH 3VXSA 3ZRCC 3VQ1C 2FYVA 2CN2A 2GJZA 4NO5A 2J71A 3L54A 1W8NA 4XI5D 1OKEA 3V7AG 2YXVA 3AWEA 4HWUA 1E50A 4Z78B 2V5TA 3QA3B 3MXXA 3F05A 1CTOA 1BQRA 3TF4A 4MJ2A 2G5BB 1IQDB 3HRZA 4RISL 1RURH 5GRUH 3NP4A 4HOWA 1SBSL 5AWNH 3VRIA 5FKAA 5CEYA 3MV01 3C6SA 1DHKA 4NRXB 3AREB 5DR5H 5I8EA 3HZVB 4H1LG 3W5MA 4R5VA 4QRJA 4PY8J 4MB4A 4RGMB 2VR3A 5DK0B 1LQBC 4LSTL 1KF9B 2BCKB 4MQTB 4BK4A 4RGNB 5JHMA 2IPTL 3NA9L 1R5WB 2RBLA 1MRDL 4J79A 3WNMA 1NWOA 4AE1A 2FJHB 1BG1A 5M5TA 4I0PA 5DJYB 3DPBB 2FJGA 5I8KL 5AKTA 5IOPA 2HB0A 4PJBE 1RZ7L 3FRUB 3GBLA 3BFQG 3OVUB 5E2UL 5EZOL 4ZOEA 4F9LC 4X6DE 4CC9A 4J4PA 3GSNA 4TMPA 4CY3A 1J18A 5SWSE 1OLLA 2W1NA 1H3PL 4NNYA 1E6JH 2YPVH 3NIGE 3WXVL 1S3RA 2XQBH 2D3VA 4H8HA 2YLKA 4HA1A 3GXUB 3TZVD 3MREA 1IMHC 1YYML 1FLTX 5SWZB 2R1XB 3KD4A 4HJGA 3LDBB 3ZKQD 3BG0A 3A6CH 3KLKA 1NCAL 3ULVL 3BZ4A 5HGDA 1OM3H 2BCJB 3OXSA 1IKFH 1GPOH 1JZJA 2JB6A 3QHFH 4Y0GA 4WW2C 5EO1B 3HZKB 3WY3A 1TJMA 1HU8A 1SHYB 4OJYA 4RRPM 1J5HA 1ORSB 1CLZL 4E42A 1LWHA 3CSFA 1QX1A 2IH8A 1P84K 5TE4L 1I9RH 2NY3B 3CVHH 1JMZB 1KUMA 3KEDA 3W9DA 1AGEB 3BPOC 4MRCA 3ZDZE 2QSQA 1T1YB 1Q72L 5HI3C 4YX2L 1P4BH 2F5AH 1FNSH 4OZIE 3MCLL 4M7KH 1DBKL 4NAAA 4PP1D 5E8NA 5CCKL 4C56E 4PWIA 2NY4C 2OVRB 3UAEA 4JNXA 3RX9A 5HYSA 1UZ8B 3UZQA 1GR7A 3OAYK 2NR6A 1NFKA 2X5PA 5DHVB 4HV8B 2DF3A 5KVDE 4F8NA 2ZX9A 3CIAA 3MRDB 4XNMB 2QBWA 4O4YL 3BZFA 1J0ZA 2WLIA 3ABLB 3H1ZA 3V6OE 5HE2B 3RZCB 1NMBH 3JRPA 1IBZA 1RZFH 4M1GL 2VN5A 3ARRA 1OHQA 4M62L 2Z93A 5D71H 1M2VA 4I0KA 3QSKB 4YDIH 1PBYB 3G6AB 2X89A 3MRMA 4PRIB 4ONFH 3CBRA 3VRJA 4AYMC 1DP0A 1BD2D 4JFUA 5SX5K 3VI3F 3UDWC 5CM1A 1NBVL 4PHZA 1A1NB 1LP9B 8FABA 3TASA 1XGQA 3ULSA 3EHBB 5I1KL 5KBLA 2WW8A 4UOW0 5JNYB 4LPCA 2KQNA 1VEPA 3UTQA 2W38A 3S34L 3MUUA 1SXBA 3D25A 3L5XL 1F56A 1PCXA 3JUZA 1QVOA 1KELH 2ZXDA 3LRSB 1J05A 3HUJF 2BY0A 1QEXA 4AMKH 2WVUA 4Q4EA 4KXZI 4L29B 3WGUB 5TTRA 1AOHA 2ED7A 1PNDA 4KH9A 5AVYB 3GPEA 4EAEA 4WO4A 5A3IC 4X7SL 3BO8A 3VXUA 4Z7VB 2DEXX 1BPOA 3IVMA 1UJ3A 1AR2A 1XVSA 5FO8B 3ECWA 3GNML 3IGAB 2LLGA 4GAGL 4FHLA 4Y2DB 5IIEA 5L2JB 3MLVL 3NZ8A 3W38A 2XBDA 4XO9A 5HDOA 1BZEA 1W72A 1DDTA 1SOKA 2IH1A 2R8SH 3N9GL 1RP8A 2DJSA 3DETD 3DX6B 4H20H 2X9XA 4HKBA 4I1RA 3LKRB 3U4EB 3VXOA 3IDIB 4IKKA 1T20A 3FQTA 4WGWB 1I1AC 4F2EA 3O2WH 4E5ZB 1TU2B 1KYOK 1MDAH 3FCSA 3VXMB 3HW7A 4PQXA 3NCYS 4OZFA 3KDPB 1WWCA 3DSMA 5C2VB 1QI5A 5EC1A 5BQ7A 1RZ8B 4L05A 1IAMA 3ARDC 3FO9A 4H40A 5D5ME 5DJXB 3WE6A 4WEMB 4B5ZA 4FP8L 5IFAH 1CDJA 5IEHB 2O6PA 1OAJA 2H5UA 5IQLA 4KTGA 5I66B 3MNDA 4DW2H 5JDSA 4KKBC 4G7YH 4JKKA 4ZNEE 3ES6B 1H0DA 4G80B 1XCXA 3SJVD 3ULUH 1G4MA 4OZGF 4KWUA 3PWUA 2XWBA 1NFIB 4L1DA 3ARVA 4D9RD 1YVLA 4NT6B 5E4AA 4DGVL 3Q2CA 3DV6B 3CX5K 3LEVL 3BDBA 2DIAA 2CRMA 4K7PY 1WA1X 4H0IA 1BQUA 4WW1A 4AQEB 3FCUA 3HBGA 4G5AA 4NUGL 2I69A 2QPFA 5T1KD 1IQWH 1BMZA 5EU7E 4X6CE 1FNHA 1F4AA 2GC7C 3FUKA 4U1KB 1J5IA 2HKMA 1Q1JL 3P40A 4IKJA 5M95B 4IU3A 1RU9L 1KFGA 2G60H 3NJXA 3GXMA 2J55A 1CUOA 2ZXGA 4KMLB 4PW4A 4B9CA 1IC4L 1P5VA 4LARL 5SWQB 5CIPH 5AOMA 3L3IB 1DVUA 4WWNA 3HNVL 3L5IA 2H26B 2COQA 3NTCL 1II4E 1FFRA 4FJ6A 3C5JB 5H35A 3CFEA 2YMXH 5K5YA 2VDKL 1MRFL 4HDIB 1R3JB 4FKEA 1NLBL 5GSVA 1J1OH 3FQWB 5CR8A 5LGHL 4K8RC 2XIDA 2J5LB 2VQTA 2OXHB 1UXSA 3LHPH 4H25A 3I6KB 4NQCA 5AVQB 2OR8A 4JDVB 3JVGA 2EC9U 5ACMA 3AW5A 4LF3A 2NY5H 3ARTA 5I8OL 4DK5A 1T22B 2HU5A 4HKXB 5FM8A 5CBAB 1U8MA 5DVMA 1KCUH 2QVIA 2FX7H 4FXKC 4S1RL 4ZXBB 1FVCA 4JDTH 3SKOB 4N2EA 1NJ9A 3DC0A 3L9BA 5EZJB 4PGDB 4FHKA 1GYCA 1YEFL 4FLQA 4HQQH 4N0RA 4PI2A 4FFZH 4B9YA 1HHGA 4NUJA 4K7PH 4HWZA 4R7NA 5PAZA 3QQXA 3VXRA 1P4LA 2NNFA 3SJVE 3SGEI 4D3CL 1YJDC 3LIUA 1QLEL 2FAUA 1VPOL 4D9RE 5FUOH 5J6GA 5FHBH 4P23C 3CSPA 2DQHL 2FB4H 1S9WB 4MDIB 2HN7A 1KJ2H 1IE4A 5IF0A 1OAYH 2PCFB 2Y06H 2KZKA 3U30C 4R83A 2X0WA 3OPZL 4W6YB 3IJCA 1KIQB 5FOBB 4N5ED 4NQTA 3LKPA 4XCYA 1KCSL 4S1QL 3ROOB 5GZOD 3WJLA 4DP8X 4YHLH 1SOXA 4CSZA 4JRXD 2CE9A 5CCJA 1NAKL 2ZXCA 2OM5A 1VESA 5EU6B 4APQC 5FKQA 5TE7L 2X53A 1ZT1B 2BP3A 2YSTA 3IAGC 4CY2A 5EU3B 4Z7QA 2R0WH 1ACCA 1YPZA 1E4XH 2BWQA 2P8PB 1CFNB 1OAQH 2RJMA 4MAYA 3SKNA 3WNOA 2WCGA 1NAML 4UILH 4I0PD 5GS2H 4HISA 1D5MA 1EDHA 4N3UA 2AJVH 3L17A 5D7SL 3F85A 3K8LA 4WCYL 3EWEA 3KPLB 4PH8A 4ODWB 1J0JA 3HS0C 3OSKA 2E7DA 3HPLA 5EN2B 1CFBA 2VQ1B 2XX1A 2BIPA 1WA0X 3DURB 4PLJC 5HHMD 1U3JA 3NACL 2R4RH 3T9WA 4PJEA 3VYNA 4OKVB 4OFKA 5BMFL 4BYHA 1ZEAH 9CGTA 4K7PX 2BZCA 2ORBL 3A3YB 3FTGB 3FZUC 3QWRD 4IMLB 3QXAB 1XF3A 5AOJA 1TUPA 3RTQD 4DZ8A 3BLBA 3L7FB 1F42A 4PHXA 4MA1B 3UG5A 3VXSE 5DJAB 5I15L 1NAMB 4XAKE 2VDPL 1JZ5A 1HZHL 6FABL 3BZEB 2FX9L 4QHNA 4MNGA 4GH7B 1S7QA 4L8BA 4DKDC 3KHOA 2OTPA 3DMMD 2B59A 1EUTA 1JV5B 4FFVC 3SKJH 3OF6A 2OZNA 2X88A 3OHXB 1G1OA 4JFQB 5D7HA 5DRWB 3ECQA 1JFQH 2YA0A 1G7PB 4CVUA 4X99B 1G7MA 5D72H 4H0LC 1S7TB 3EH1A 1C5DA 2JCCF 3K6SA 3L3JB 2R59A 3HR5B 4N0FB 4U31A 1TCMA 2BVPB 2AV7B 3D0VA 4U7MA 4UWQB 2WN3A 2KC0A 1RZIB 4PWFA 1OSZB 2H45A 4PJ8B 3VCLA 1NPJA 1XCQA 4L23A 4OGYL 3KLSA 1MW3A 2VDPB 1BQHG 1ZV9A 4W9FC 4Y4KD 4F9PC 1LDPL 2CHZA 4YH6A 3IJEA 3M86A 3Q1EA 4U0RC 5EUOA 4K5OA 1RLWA 4DT2A 1J11A 4Y4FC 2DQFB 2HXAA 3WS6C 1RAMA 1J0IA 5KZCB 3KVDD 2YJLA 1RCYA 3SE8L 1H8NA 4AGMA 4Y4HB 3MNWA 3OZ9H 4K3HA 4JGJA 1U93B 1BGXH 4ZTPL 4FQ1L 4G56B 1GJUA 3C5ZD 2D7PA 5ENWB 4IDJH 4CL7A 4MD5B 2Y1ZA 4W4NA 5HHME 1BVLB 1A4AA 4M6ML 1CQYA 4HXBL 3AMLA 3EZ8A 4JQVC 5EIIA 4XH2B 1AD0B 1FJ1B 4FQJH 1KENH 4K3JH 2WYTA 1QRNA 4GBXA 4PSPA 1EDQA 5IB4B 5E0QA 4AH2A 1ZA6B 1EHLH 2I9TB 3ESOA 3GHPA 2Z2OA 1YA5A 3HI6L 3IK2A 1NCHA 3A4DA 3U9UA 4A7UA 1PQZA 4AEEA 1FE8H 3PSLA 4PS7A 1N9PA 4IGBC 4OR1A 1YN7A 1RJYA 2MFNA 4WO4D 1Q90A 2CG9X 4QO1A 1ZLSL 4LSPH 4NDMA 2XG5A 2E8ZA 4NHUA 4UOQA 2JKRM 1A6UH 2J1XA 2KPWA 3QEHA 1ND0A 3JZNA 4F2MA 2MTPA 2MJWA 3PL6D 3QWOB 5IROA 2OK6A 1MEXH 1NGYA 3SY0B 3CUPA 1OP5H 2ATKB 3SQOH 5I9QC 3UVNA 5CJQH 5CD5C 3B9DA 2JV6A 4F24A 1QFHA 4QRRA 3S37X 1EHNA 1X3DA 2E6PA 1IV8A 4MLSA 5I18L 4HH8A 3NRPA 4NZRH 1K6QL 3IRCA 1EXUB 1X9LA 5IMMB 2XYIA 3RJQB 43CAA 1X5FA 2IQAA 3HE7D 5I75C 5T8IA 5F3HA 2OL3H 2DICA 3I3BA 4P5TC 2YUVA 3P2TA 5D1XD 1XAUA 5LAPA 3AXHA 5CSBA 3QP3A 3ZKXB 2EUWA 4K71B 3X12B 4GT7A 1X5XA 3BUYA 4QRSB 5CN2A 2WAQA 1L5GA 1YLBB 2BNRA 4QXGH 5D7IE 5I1LB 1XF2A 1E8WA 4HJ1A 4KTDL 3QDGB 1T5XA 1VB9A 3LZNA 4PGCA 1F41A 2A38A 2RGSA 3NJGA 1OAKL 1WFTA 3OKYB 1MAMH 2B4CH 2Z8RA 2ZSVA 2A1WL 1JTPA 1XCTA 1GJIA 4PS4H 3S5LG 1LM8V 5L0QB 4HUWA 2ICCA 2QXVA 2WXGA 2BIQA 4PREB 3VB9A 4DKFH 1NUDA 5I6KA 1BWMA 1BXXA 1FFPB 1VFBA 4UQIM 1M56B 4FA8A 4E5XB 5J3HD 4DP9X 1INDH 4OFQA 4HC1A 3DLQR 4RMVA 5E00B 4AQOA 2JLPA 4WW2B 4JB9L 3BZ5A 3FPYA 2H47C 2NSQA 3QUMH 4FHBD 2PMZA 1QFWL 2FEDD 1G7JB 2DBJA 4EPSA 1TZOA 1U92A 1UH4A 4DP4X 4K9EC 1DLFL 2RMNA 3T0EB 1ZPLA 1R5MA 3TWCL 1PGRB 4Z77B 4V1DD 1C9SA 3GSQA 3IRPX 5F9OH 5FKPA 2JB5H 3ZYJA 4A09B 2ZUQB 4XOBA 5B8CB 2CO1A 1MW1A 2Z31D 3ARFC 2AQPA 2BFVH 4LQ1A 2O6CA 3V95A 2XZCH 4N1HB 4EE2A 3KYMA 1T5WA 3IJ0A 2VH5H 1PZAA 3UVKA 2YK1L 4PJBB 5DTFB 4HYTB 5F0JB 1XGPA 2QDWA 1U8CB 1XTMA 2CO7A 3I2CL 2HFEA 5DJDB 1OF2B 1E8MA 1WBYB 4XP5L 4HUCA 5HDQL 4AENA 4X6DB 5KW9H 1AQ8A 5SWSB 3S96B 3LB6C 1UUNA 2BY3A 3P1VA 3NJIA 4F2FA 2W59A 5D1XE 3I7LA 1QKZL 2H32B 5E1HB 4L8SB 4P2RD 2ZG1A 5CYKB 1C5BH 3CH1A 4IJTA 3O3AA 1ID2A 3OXRB 4JM2D 2JTYA 4JO2L 1COBA 5KVDL 1DEDA 4XODA 1N67A 2JTDA 5I5IA 2HSIA 3ZE1B 4TXVB 1MRCL 2YC1A 4R26L 2R1YA 5IVOA 3LVTA 3GTVA 3RY6C 4HIEB 5IHWA 1AH1A 2G9AA 3K46A 2H1PH 3NCMA 3IWVA 3BSZL 3NSDA 1I3GH 1CT8B 1YRKA 3H8NA 3CN1A 1QA9B 5AVUB 3T4AA 1A2YB 3ZE0B 3WFDL 4Q4IA 3IDMB 5G5DB 1LD9A 5G2NA 2VDLL 3MBEA 5F8RC 1SMOA 3C60C 2JCWA 2QQKL 5AQ0A 3MLWH 3VVVA 4DESA 2ZUSA 4TRPL 5KBNC 2V4LA 5JXED 1EAJA 1NZRA 3V6FB 5DO2D 4J6RL 2ROYA 1QSEA 4WNSA 3V5HA 4ZPVB 4U1IA 2M1KA 7PCYA 2J44A 5DEGA 4V1DE 4RE6A 1W80A 4PGZA 5E6IA 3HI1B 3C09B 3WHXA 1CXKA 3BKCL 2QFRA 3ARGD 3P9WB 5E8EB 1FRGL 4PJXE 4DF9A 2H0EA 2NXYC 4LIQH 2P8MB 5FO9B 3LY6A 5JW4R 4L4JA 3RFZB 1DE4B 1UZ6F 5DK3A 2W07B 2Y6SD 4IJ3C 4QT5B 5ITBH 2H1LM 5A6LA 3EGDB 3SCMC 2C9VA 4PBVC 3B6SA 4RFEA 4AQ8C 4R5TA 4R5XA 3WUWA 2QR0A 5DZLA 3MJ9H 2I07B 5DHDA 5MEPB 2B77A 2BSTA 4UU9A 2NW3A 4YSOA 3SWSD 2Y5TA 3GMRA 3TZVB 3ARDB 2CO0A 1YEHL 4QAMA 2ICWI 2DEYX 4ZO6A 3RFHA 1MWOA 2D0GA 4ZTOH 2XPGB 4W9CC 2V2TA 1IUZA 3PWPB 1GY2A 3TJEH 2QV2A 4HMDA 3O3DB 5TDOA 1IFHH 4LAJH 4RETB 3BESR 5HI4C 1HE7A 5LNGA 4HUVA 3D48R 1BQSA 1L0QA 1L0PA 1NL0L 1I7TA 1JHLH 3DBSA 5E4EB 1GGIH 5B1JA 5C8JB 3SGKC 2YD3A 4HSAC 3OG6B 2R2BB 4A7QA 4TULH 2XDWA 3O6FD 2DS4A 2WSPA 4AUJA 1UGKA 3ECVA 5KAQG 2HMIC 3QWQB 1SLXA 3BMVA 3O0RL 3BAEL 4QHLA 4DTGH 4OF5A 1F3RB 3DIFB 3EOBB 3B4NA 1WUNT 3S98A 1CGXA 3EJZD 4PW9A 3V0GA 4IIQB 4IRJA 3VX1A 4RMBA 2XQYK 2QKIC 2D31B 2Y7QA 1KPRA 4J12A 3MXVH 3ZR6A 5B4WA 5F6HJ 1E8ZA 3RX7A 4RA3A 5IHHA 3PAZA 4MJJA 2DQIH 1VRSA 1T2XA 1PU0A 2ADGA 1ETJA 5D9SB 3TP4A 2AMGA 1S9KC 4PMFA 2BBKH 3NP3A 2BW5A 3KXFA 2BJML 2BC4B 3UVLA 3N6YA 3PY9A 1KYUA 5CZVL 4BRVA 4Z7QE 3OAZH 1YPZE 4TVUA 3FB7A 5AW5B 3BKML 4DVRH 4WK2B 1G1YA 2LU4A 1BD2B 3ZO0A 1Q9LA 2PCPB 1RLBA 3HAEH 3MV8A 3K71A 3CZFB 4A7JA 4QRQA 2CGZA 4N1CA 3HG3A 1RK1A 1AJ7L 4PVMA 1CQKA 4A7SA 4ZOVA 2WNGA 1U8JA 3SDYH 2WLZA 4XVTL 2XN1A 1G1CA 3EI3A 5DC0A 1AXIB 1KULA 4JDZB 5LJYH 5BV7L 4FFYL 2APTA 2CXKA 3MFFA 3BVNA 3AS2A 2XRAH 3GK8L 5D1QD 1QFUL 3MI6A 5CEZH 4P59H 5CD3A 5IVXA 5EMMB 3NBNA 2OZ4H 3BWAA 5HI5D 1J7VR 4N3TA 3WEBA 1IGFH 3BKJH 2UZIH 4FLRA 4MNGE 3VFNB 1Y1UA 2VC2H 4AKQA 3BUTA 2AGLA 1HHKB 4C54A 1FZMA 3JT2A 1WIUA 4A2HA 2Z1KA 1JV2B 1LO4L 3HN3A 4UT6A 1XHHA 3ULUD 4ZMPA 5DC2A 3L5HA 1OP5K 2A9CA 2EADA 4PBYA 1T4WA 2O30A 3STZA 2W0PA 5CSGA 5SX4I 1BOGB 2VDML 2YMUA 5AZEL 4QCIA 2D03H 3V10A 2QHRL 1W0VA 4IEFB 2EH7L 3GSUA 4AYDC 2HFFA 2WQWA 2A6IA 3QJTB 4HGWB 3LEYL 4WI5A 5HDBF 3O6KL 3DECA 1KPVB 4AIOA 1BZDA 2L7EA 2CDFA 4EOWL 3GSOA 4HS6B 1WHOA 3QNXA 2P24B 5TEFA 3JQOB 4LKCB 2NRDA 4BZ2H 2EDRA 4NO0A 1N59A 4FWWA 4L2LA 1KLUB 3O6ML 1XBDA 4NHCL 2E74C 1JF6A 2CPCA 1P6WA 3AY4A 4ABUA 5L4MA 1IGTA 3RWJA 4EVNA 4MAUL 2KL6A 1BXVA 3V52L 2X2HA 4QXUH 3EO9L 3OB0H 5GGSY 2I0SA 4JPQA 4NN6B 3KGUA 1T7YA 4BFRA 2YD2A 2DIEA 3NJFA 5HHOB 2K6WA 1BF5A 1NFDF 3MRLA 1HOEA 1DQDH 3UBHA 2VDMB 3CSGA 3P4MA 5M7QA 3UGXA 4XNAA 2Y69B 4YHMH 5J6HA 4MD0B 1OB1B 4OZHF 5DMIL 3TNMA 4CAGA 4L9LB 2R9HC 2FECI 5A7EA 1SN5A 3FQXB 5HBBA 5AOKA 1ACYL 3PFQA 4W9GC 3CHOA 3FSZA 3T8VA 4QT8A 2AQ2A 1YN6A 3WKQA 5D1QE 1A4BA 4FXGA 4O9HH 3ESMA 2F5BL 2VXSH 4DN4L 1DQLH 4GRMB 4KHTH 2WCSA 2YGOA 1CDIA 3GYRA 2YO3A 1IEBA 3VFPB 2GEQA 1VLXA 1DCLA 1CGYA 4GKSB 4YSQA 3D07A 5EORH 3N43B 3FCTA 5C0AD 2RFXA 3MV9B 3VA6A 2AMUA 4NKQB 1E43A 2B5MA 1A8JH 1IC7L 1KXTB 4AQAA 5DJ8B 1J0YA 3ULUE 3KWWB 4MK0B 4Y19D 2CM6A 1XEUA 4N0UA 3ECBB 1JZFA 1P1VA 1SEBB 3BT2H 4NKOA 1JPFB 2VITA 1JGDA 4TLUA 3TO4A 2CO6B 2DKUA 4QXTB 1HE8A 2GIYA 3GBDA 4X0KA 4XRCA 4P57B 5ABAA 4HIJB 1INQB 3MR9A 5JW4Q 2P7TA 3V79C 4AC2A 1I4FA 3MQIA 4EI5D 1YEDA 2VJ8A 2DQ6A 2MSPA 3QUZD 2WYIA 3MPCA 4X6BB 1THAA 1MAJA 4E9LA 4WY7L 4ZAKD 5DD1L 1NCCH 4PJIF 2EVGA 1BPVA 3LN4B 4LPUA 2BNRE 1O9VA 4XXCC 1FL5A 2F8VA 5D2LB 1RZKC 3B5GA 1QOKA 2NY0D 4ILDA 2DQTL 3G6JE 4GQBB 3PXHA 4ZUUB 1TJGH 3REWA 4N68A 4S2SB 4DP7X 3A22A 4KI1A 4J8BA 5GS2D 4LRIA 3FN0H 3HZ3A 4ZD3L 4WJG3 1JZ2A 1A14H 1FNFA 1G9NH 4H88L 3NN8A 2UZYB 3JTSB 4N8VB 5KSAD 4G8EA 4E9QA 4BUJC 4ZUWA 1I9IH 3B43A 3HPJB 3I9GH 4J3UA 4MCZA 4IRSC 2VCOA 3EF4A 1FGVL 3US9A 2F1AA 2HJLA 3HMXL 3M45A 4JRXB 4WEBH 1QASA 5E24E 2YUXA 5C0AE 1ZE3C 3GBML 3MCYA 4G42B 5E6ID 1N64H 2LE9A 3BGFB 5AYUH 5FEBA 4HFWB 4NIYE 5LXGL 3BT0A 4ADGA 2EEBA 4U1GB 3KMDA 4Y19E 2AQNA 4LQFL 3VDCA 1NCDL 3PIQB 4LESA 2B4EA 1MLCA 3WY2A 4ZUVA 4ZUTA 4XR8C 3TC9A 4PJFF 2FTAA 1I7RA 4RCAA 4LP8A 5SXMA 4P2OA 5C6TH 4IA9A 4XHJC 5JIKA 5BQDA 3UJTL 5BS0D 3MJ6A 3E1ZA 1WFUA 2KMWA 3MRPB 1U91B 4ZPTB 5ITFB 3TTSA 4BJLA 4WWPA 4A2GA 2QSTA 4N2AA 4XMPH 3LZLA 4JRFA 4KRNA 2H6KA 2EVHA 3RBGA 3RGHA 4AOWA 1ZMYA 3FF7A 3RVVC 2H9MA 3S3DB 3X11B 5AFAA 1EV2E 3G7TA 3MU3A 3UYPA 2IMMA 2XDHA 3S3PA 5F1OB 3PHAA 5E7BA 3RTQB 3VU2A 4DKEH 3WKYA 4NKIH 5JPNC 3SN6B 3Q6FA 4H8WC 1XF5B 4WHCA 2WTRB 4GXVL 2VLJA 3UIZA 5KUMA 3DMMB 4M5ZH 3QIBA 4HG4K 4N8CH 4ZUSB 2QQNL 2YKLL 3F58H 3WCYA 3H42L 1TVBA 4L3EA 5CN3A 3ISYA 4ZOXA 3DBXB 4JQXA 4RNRB 1V7MH 1JGIA 1A4JA 3PAUA 4Q89A 3SDXF 3QG7L 1TFPA 3APMA 1A6VL 3DGGA 4G43B 4XPFH 1CL7H 2HUEA 1SDAB 2W65B 1LJMA 3PFUA 5DHXB 4MZIA 4XMLL 3EOAB 5AVWB 2OCCB 3EUUA 4BE6A 5DYOA 1RIUL 3B2VH 2NSMA 2XN9A 4LU5L 5F97E 2AERT 3BH9B 4D8PA 5LNDA 1UFUA 1NLDH 3HB3B 4JFOA 1QSEE 4ZFQA 2WO2B 3N5AA 3I85A 4NS0A 4A7VA 1JNJA 1U58A 4OCSH 1OSPL 1F6LL 1AFVL 3BP5A 2WY3B 1I85C 1SOSA 4AC4A 4L8DA 4AEIL 2X40A 2M2DA 1KN4L 3GBNH 2VUKA 4PXWA 3BPNB 3RPIB 3FQRA 3HVNA 4Y5YB 1UA7A 2LABA 1FL3A 1MJJB 1MREL 2AEQL 3FO1A 5ADPL 1OP3K 4U3SA 1HSBB 5BS0E 1B6DA 4JN1L 4XPTH 3N40P 4XTRC 2RACA 3SMRA 2BHFA 2H3NA 1H3TA 3B2MA 2JELH 5T1LA 3C5ZB 4UM8B 3T2PA 5I6PA 4YDVA 1CXIA 3MGTA 1D9KA 1NCNA 1QRKA 2A9NH 1A47A 1M3JA 1U6AL 2AKRB 4HGKC 5KVFH 3L3OC 1Z9SB 3PUCA 3Q9QA 3UEQA 3UTTD 3MLYH 4KQ4H 1VFOA 2VR9A 3FTYA 1R17A 4I18C 2AQ3A 4HJ0D 1L9MA 4L3GD 3DHPA 5AYTA 1IGIL 1IGMH 3RWDB 3HKFA 2L04A 4P46D 5EO9B 1URZA 3IJSB 3C6LC 3BGMB 2DD8L 1D6EA 3R4RA 4OSUL 1SDDA 3KWTA 1U8IB 5TFSH 5I6MA 2MCG1 3PU7A 5A16A 3PL6B 5IG7B 4YBLB 4YSRA 2APXA 4HS3A 3EOYG 1X7TA 1OD9A 2CR3A 5C3LD 1AMXA 1CGUA 3MMYA 3II1A 3ZGHA 4I4WB 4WRLA 3GSNH 5CWSA 4UUJB 3NIGF 1YMMA 3QCTL 2UV3A 2PM9A 3LZRA 3K0YA 4Z9KB 3RQ3A 4A2FA 1DEEB 1G9EA 3N55A 3HE7B 3HNTH 3NIFF 4JO4H 3P73A 1LNUB 5D1XB 4HPOL 2P9PC 32C2B 3UKRC 4WK0A 4OV5B 4LLVA 3FCBA 3OKKA 4JKLA 5LAXB 3U46A 1PL3A 1XB3A 4J73A 3SIKA 5LQBH 2RHEA 1XV8A 1Q94B 3V5KA 4B27A 2ZG3A 3IKOA 3BKYL 1AHWA 4R4FL 4P06A 3EJTA 5DEFB 4HLZG 3STLB 3INOA 3SE4A 2PW2A 5HDRA 4TPRL 5AVTB 4OT1H 2PYFA 1P4IL 2BIOA 3QR1A 4HHGA 1ZSHA 4XNXH 1ITCA 3KW8A 3WD5H 3ZDZF 1T03L 1DQTA 4JZNA 2N3JA 5EPMB 1SUJA 4YGAB 4OZIF 2DJ4A 5TDPA 2NUPA 5JOPD 1PX3A 2CALA 3LYRA 2Y07H 1U30A 3VWJC 3VYOA 1QW8A 5EUKA 1A4KB 3PVUB 3UYRH 2BNQB 2EAEA 5C0NC 1T0OA 1JWSA 5GGSA 1FVDA 3AT8A 3W11C 4ELME 5CBEB 1ADQH 2YBGA 3S2CA 1NICA 3MCKB 1N10A 1S5HB 2X38A 1X4XA 3INUH 1A6AB 1SYSA 1CE6A 3IXAB 2KS0A 3K74B 4V1DB 4OD2A 1QHQA 3QULA 3CCHB 5FDYA 4YHZL 1EH9A 3QFDA 4PRPB 1DQKA 2Z31B 2VLRA 3QQ4B 3IXTB 4PJXB 4CN6A 4B7IA 3IJ8A 4DP5X 4HKJB 1M9WA 4LSUH 2OS7A 2ZX6A 5EH1A 3DVGB 4FA6A 4YHYC 3MUOA 3Q5OA 2YS4A 1D3CA 3EBIA 5DFVD 2XETA 3FMGH 4OCMC 4AQZA 1PS3A 4BGLA 4WJKA 4DJMA 5CP7B 4RMUA 5AL8A 3HJ0A 1OK0A 3WLWD 1R3HA 2EXWD 3AMKA 2ICWA 4GUCA 4JO3H 4JFHD 3BLKA 1D5RA 3CFKA 3ULAB 4P2RB 3PUUA 4G8IB 2D3JA 1GZQA 1PY4A 5DLML 4CILA 2XQBL 1AQDA 2APSA 1B2WH 4Q7DA 3GLDA 5GJTH 2P47B 3MZTA 4JM2B 2H41A 1KJMB 1EUUA 3BN3B 1DO5A 1FORH 3T0WA 1U3NA 1OM3L 2P9IC 1IKFL 1GPOL 1FYTD 1NH6A 3PXJA 1ZD6A 1KZYA 5D1ZC 3CIQA 3ZTNH 1DN0A 3KH4A 1EJOH 3F7YB 1RUAH 3PV7A 1P6FA 3G08B 1KB9J 2QGDA 3BPCA 3NJNA 3MX0A 3VGAC 1D2PA 1R24B 1YNKH 4U05A 1TENA 3RWEA 3UKUC 2VL5A 2B20A 2V8LA 5DZNA 2LLLA 4NJAH 5I71C 1A9EB 3B7RL 4Q9QH 4JFVA 1FNSL 4M7KL 2Q3ZA 1MG3A 2EYSB 2LLNA 4BINA 4ZDHB 2IAMD 4M7ZC 4OQTH 1QACA 1SM3L 4OZFH 1A64A 1Z3GH 4PM1A 1FO0A 5LDUA 3CLFL 3M88A 3QG6B 1L6ZA 1QFPA 4UI2A 3SEPA 3NJHA 2WGNB 4MCYA 3K27A 3ARGB 3QARA 5ALBH 5EO0B 5DJZA 4OM0H 2P45B 3KPNB 4ODTL 4OF8A 1MCBA 3T6XA 2C5DC 3WNLA 1EEZA 1ET8A 3ZBMA 4AYSA 4EN3D 3UCQA 2XTJE 1NMBL 3OKDA 3CVHB 4GKZA 5FYJU 4ANUA 4IOIB 4N0UE 1Z7JA 4PI0A 3IYLW 1PI6A 3VI4E 5KVMC 5CMAA 4ONFL 2WM0A 4QR7A 1YY9D 1BF2A 1GRWA 4JAMA 4TUOA 4C4KO 1E9PB 1GL4B 5CXBB 3U7WL 3WIHA 2EUXA 1JZ3A 4JFHE 2IADB 1A25A 2WWNA 3MCG1 4JLRB 4ZO9A 4HKZB 4FG2A 1FH2A 5MERB 3FUMA 2EIDA 4X6CF 2PO6A 3U0PB 4X63B 2G3MA 2QADD 3O4LD 5HPMA 3SVWD 1HVXA 2G75A 4AQ1B 1CDGA 1RFDH 3DTUB 3U1SH 1K5NA 1LO3H 5DVLA 3H9HA 1T2QL 4JY6A 1KELL 1OQXA 1P5UC 3PP4L 2HJFA 4AMKL 4PBWD 1DSFH 1Y6MR 4QHKJ 2A2QT 2DV6A 4KI5D 5F6IC 3EBAA 4NC0B 2ZOUA 4KO9A 4PUBH 5BJTA 4R0LB 4GSDH 1FYTE 5ACZA 1ZGLM 3FU7A 2WVTA 5CINH 1A5FL 4LCUA 4R3SB 4GUQA 3LNDA 3LNGA 4BFOA 2IPUG 1ZWIA 3IS1X 5I1EH 3QHZH 2AJXH 3ZR5A 4N2GA 1VACB 5DQJB 3EUDA 4BFIB 4K3EH 4R4ND 4DN3H 1CS6A 2V5YA 4G1MA 2X4RB 1RUML 3CPLA 3PPEA 4PRDB 3P9LB 5HJDA 3KPMB 3ZDYB 1C08B 2R8SL 1IM3A 5AKRA 2BSSA 4PWKA 4YDLB 1A12A 5B1BB 2EIBA 4PJGB 5DXWA 4GG6B 1ULVA 5E8DL 2GC4A 3H0TB 1X5KA 1LK2B 2EEAA 3QI0A 3W0WD 5CEZD 4K94H 3T1FB 3UCRA 4PGBB 1KXHA 3KLAA 3GC3A 4G8FB 3U0TB 4CI3A 1KXVA 1FPTH 2YARA 2Z8VC 1OTTD 4OGQC 3F7VB 5C08A 2VAAA 4I3SH 4NGHH 4CC4C 3UVMA 1EJ6A 1SJEA 2DB8A 5FLXg 5IFAL 3RG1C 3AJ7A 1AGDB 1BQHA 3RIFF 3I50H 3TGXA 3LSOA 3GREA 4DW2L 3BIKA 5EU5A 4DFHA 4MJ5B 3QZLA 2LR4A 2CSPA 2VRQA 2YGNA 5FA3A 4O9DA 1M3IA 3ULUL 1V3LA 2C1OB 3THML 3QUYC 5AALA 4PBZA 1T89C 1ZA3B 4ZNCD 4O2CA 3D05A 4KK9C 1CICC 2C1PA 2FBJL 5D8JH 1UUSA 4NYLB 4OLWH 5D1QB 1PYWA 1IQWL 3MNVB 3NFSH 1NGZA 2IGFH 1AC6A 1LQSR 2IDFA 1AO7A 3BP4A 1TPXC 2APVA 3CN3A 2J6EA 3GLEA 4JN2A 3FB5A 3VFMA 4OGXH 4M8RA 2BSED 1G0YR 2ESVB 1G7IB 4TLTA 4NC4A 1KG0B 2K45A 1UA3A 4KRPB 5KSVA 2ZWNA 2VLLB 3CHXA 4TSCH 2G60L 1HQ4A 1MOEA 2D3NA 3WKPA 4CGTA 1KBPA 3QJUB 4W9KC 4ZMNA 2JJSC 4WHYH 5BZDB 4J8GA 1UACL 2P5PA 3BSGA 4XYIA 1LL1A 4J8RA 1YNLH 4YPGA 3VWKA 2EJ1A 4QLRA 4OV6F 4NCC1 2XWEA 3EG9A 4R97C 4HPYL 3MBXL 1SQJA 2EYRB 2FL5A 4MA8H 3DX1A 5JLZB 4U6VH 4JFEB 4OLYL 3ABMB 2XN9E 1YMMD 4OFVA 2IFGA 2K6YA 3GHBL 4B50A 3LHPL 3UIYA 3NFPB 2H6PB 5FC9A 3W0WE 2MMXA 3I75B 1MW2A 2IANA 1OARH 3RTLA 1LYQA 4DUVA 4PJ9C 5CIPB 3ZT5A 2FX7L 3WO4B 3GXDA 1QLFB 1F3JB 1OO2A 3ZLQC 4E41B 4CVWA 3KPTA 4GY4A 2XC8A 3L4XA 2DLFH 3G6JB 4CMHB 4IMMA 1KTBA 1WCQA 3MMEB 1USZA 4HQQL 4HX1A 1XH3B 1UM6L 4Y1AD 1BREA 1SVBA 4K7PL 1EZLA 1U8OA 1TO4A 4X8GA 2QMJA 3OAUH 4BZ1A 1JWMA 2X9ZA 2ZXAA 4BA8A 5HXMA 4MSWA 2X2YA 3ETBJ 2W94A 2FB4L 1J0HA 5TF0A 1AP2B 3IU3A 5E2VH 3TBBA 5FR3A 4G82A 2FYYA 4NCC2 1HKFA 3PP3K 1U3ZA 1R3IH 3FT3B 5JPNB 3S5LA 1IC5L 2A73B 3H3PL 1TYEB 3KL0A 3Q1SH 2C3VB 4MCNA 3TVMA 3TX4A 2OFQA 3IFLH 4I9WD 4DGYH 2X0VA 2B3IA 1F1DA 4FMKA 1ANUA 4YXLH 4BKLA 3M1BA 3O9WD 1CI3M 2BOBB 5C0AB 4YC2C 3EFDH 2ICEB 4LNRA 3S8WA 3B9KC 3QIWD 2I9LA 1WZLA 3T0BA 3UPCA 3ASWA 4DZBA 4Y19B 4KDWA 2R0WL 2WBXA 1IIIA 1JHTB 1E4XL 1ET5A 2NSXA 3V6OC 3CMOH 5JHDA 1WP6A 3L1EA 4M5YL 1U95B 1KJ2B 4UILL 1ZT4A 4DETA 4RESB 3FQNB 4DQOH 3D87B 1YCSA 2AJVL 5TPWH 4RWYH 5BCAA 7PAZA 1S2EA 2FO4A 1KLGB 1YMME 1WC7A 4LO9A 3Q8EA 4EI5B 2HRPH 1RZPA 3QI9A 3O4IA 1XFPA 1ZHNA 1F5WA 1JRHL 1F4YL 2VL4A 3KLHD 2DZEA 2IFFL 2YAMA 3H9SA 4XWOD 1DANT 1X7QB 4PJAB 2NNXA 4ZAKB 1BYPA 3ZWLB 4O5LL 4P5RA 1K8DB 2BWDA 4U1LB 3TCLA 3IETB 2FO1A 2R4RL 3U4BL 4WV1C 3DXKC 1AI1L 1N19A 5A2KH 3TIEB 5EB9A 4XXWA 5LUMA 2NY0B 4K07A 5ERWA 1RZJH 3NPSC 3DSNB 4U6TA 4UV4H 3RY4A 1B0RB 2YAOA 4Y1AE 5E95B 4NNXB 5DO8A 2A9DA 3PQYD 4AYBA 4M9OA 1NKOA 2N0KA 2X4NB 3EI1A 3GB7B 4Y89A 5ICZB 1XEDA 4FTDA 3ZQXA 4ALAL 3SKJL 1NGXB 2AANA 3JTTB 1FZOA 3F5WB 5KSAB 1EVUA 3ZZ1A 1IARB 2P9UC 1WZMA 2WNXA 5IR1B 1JXGA 2XWTB 3ATBA 4Z7UA 3ZZLA 4GMTL 5D72L 3GJFK 1J48A 5CP3H 4ELDA 4AKOA 2IC2A 2MPAL 1T6WA 5A2BA 5D7LA 1O5PA 4NZTL 2C4FU 4I9WE 1ZKAA 2L3BA 2PUQT 3K5SA 3UG3A 2F8OA 4Z7OB 3KNBB 3S37L 2YPKB 2D2OA 4JDEA 5CXCA 2VLRE 4NQDA 2BOCA 5L4FA 3F7RA 3U36A 3NVXA 1W16A 2O72A 2NZ9D 3X3FH 1QSFD 5TDNA 4RAVB 5KG9A 3MLTB 1OCWH 1AKJD 1QP1A 5D2NE 2MKWA 3KWXA 3L2LA 4X9FA 4X50A 2GI7A 2G4EA 3T1WA 3KWUA 1M7DA 3ZTCC 3FU9A 5BS0B 4Z0XB 2YZ8A 1M57B 1A3LH 3H54A 2VSKB 4HEPA 1GYAA 1H3XA 2FIKA 3OZ9L 4I2XE 2Z9TA 1J9CT 3MNZB 5C0JB 3EGSA 4MNQD 1FFOA 3C8KB 4ATWA 2V7HB 3DX9A 3IJYB 2JKIS 5E70A 3RKDD 2F18A 1HZKA 2VUYA 1KENL 3AM8A 1F4HA 2CN3A 1KTDA 5BW7A 3ETSA 3I7HA 3CFTA 3RIAK 2WVVB 3NGBC 5C0IA 2ARJQ 2AJSL 3BQUC 4N2MA 4JM4H 1TEYA 1EZUA 5B1AB 2H4EA 4OCWL 1CZ8H 4LSPL 5GGQL 2A77H 3QYMA 1BCIA 1X4ZA 3K2UL 5KSBE 4Z76A 5JXAH 1MEXL 5IQ9B 3VFWB 4BK5C 4EZJA 2PW1A 3SQOL 5CJQL 1DDHB 4N85A 4BCYA 3ECUA 5C7ZA 4YFEA 4JY5H 5BV7C 4GKNB 3MLRH 4K3JB 3PVWB 5C07A 3VXTA 1B4LA 1F11B 3KYNA 1I1YA 3ENEA 3PS6A 4F3FB 3FU8A 4OIIH 4XMKL 5HHNA 5CJ5A 1T21A 1OTUD 4HBCH 3V0VB 3OJDB 1QTSA 1QSFE 2DYPA 4ENEC 5DT1H 4KO7A 4OF7A 5L4IA 3RPBA 3JTBA 1ZTXH 4TQEH 4M29A 2CBMA 5FUCE 1WO2A 2A9MH 1RUPH 2B4CL 4ANXA 3L3KA 1TYRA 2DMBA 4X9HA 1S7SB 3SOBL 3QC5X 4PWHA 5GSAA 3O81A 4CJ1A 4TNFA 3FH8A 4K3ID 3C75H 4DKFL 2GCYA 1VF5C 2PXYA 3UTTB 5F0PB 3V0JA 4S1DD 4RFOH 2FHBA 5IVZB 2FATH 4YHKL 2OL3B 4ELMB 4BEIA 2EXYC 1F1AA 1IGCH 1L7TH 5AAWC 2NLJB 2H3XA 2ERJC 3QUML 5EC2B 4GLRH 4P46B 4HK0B 5ANMA 5GS3A 5JO5A 4JANB 2BP8A 3VGAB 4OAWB 3U83A 3O4OC 4HJSA 4FJYA 4X4KA 5H2BB 1GZPB 2NNCA 1FV1A 1S8DA 3K7UA 5F9OL 4U4IA 3IJHA 3CFBA 3UAJA 2EQDA 5EF3A 1JVOA 4PJ7A 4OLVL 2WOYA 3VWKD 1CCZA 2DWDB 2L7QA 1FG2A 1SY6A 5INCA 4DEWA 1NCBL 2R0ZH 1GC1H 3N3EA 4F20A 5KVFE 3BRFA 1D7FA 1H3WM 4LCCB 4P4KD 3WLBB 4CBZA 4DHLA 1TR7A 4ZS7L 4GQZA 3QUMB 1SHWA 1N7MH 3TF7C 1A9VA 4NPJA 4AM0Q 1IGYA 5ABZA 1C5BL 3OKMA 1GH7A 2EVIA 5IUCA 1R0AH 1OAUH 3S3JA 3SQRA 12E8H 3RU8L 5AW6B 3GSRB 3P4OB 3X3GH 4HLEA 5AD0B 4Z8FH 1LO2H 4YLBA 1N0LB 1MVYA 1VSCA 4M02A 4CUCA 2IUQA 4KJYA 4X7FC 4KGJA 5IW1A 4GO9A 1CFTB 4HXAH 3EYOB 4NUPA 4XX1E 4XPAL 3IU4L 4ZSOB 2NNAB 2H1PL 1AVAA 3EDKA 4A11B 3NQIA 1CK0L 4HIXH 4MQXC 1JI1A 3RLSA 4JSVC 5IJ7E 3HRZC 3VH8A 5G4OA 3RDTA 1I3RA 3L4VA 3QH3A 1VFAA 1Y18B 4ODSL 5CHNB 5AKSA 4APXB 3EJCA 2MH4A 2FQGA 3SDDD 5C0DB 3CDZB 1C16B 4Z7QF 5DDHB 5EM2B 1YPZF 4JJHA 4Y9GA 1NDTA 3TV3L 2V3DA 1XGYL 4U1HB 4MB1A 4Z7NA 4BP9A 2WXLA 3MDJA 1HOCA 4GAJH 4O1QD 5IREA 3UBFA 2WBJA 4MWFA 2GVYA 2FQFA 3LX9A 2BNUB 5ETUB 4GRWH 4F15C 3NOIA 3VI4B 2YJQA 3S36H 1SXNA 2Z7ZA 3QEUA 4JW3A 3WE1A 4I0PC 1RJCA 1CB4A 4LPWA 4JKNA 4Q0XL 5GQBA 3DXMC 3OC5A 2CRIA 2GY7B 1ED3B 3C5XA 2Z4TA 3A6BL 3S8GB 2EC8A 4XNZC 4M1DH 2IEPA 4J4PC 5HHVH 3CFMA 5IMOB 3P0YL 4XZ4A 1G5GA 4FG6D 4WI8A 3ZE2B 2IANE 4BSVB 3F62A 4IYKA 2YRZA 1DVQA 4ZTOL 1IVLA 3CXDL 2ISDA 2H2SD 1GW0A 5IB3A 4YHPA 3TJEL 4Q6IA 2VXVL 5FK9B 5KYWA 1FYTB 4WTZA 1FFNB 1IFHL 2E59A 4CZYA 1FP5A 5ANHA 2FJFB 2NDGA 3L1FA 2QPUA 4F7MB 3DYMA 1B0WA 4FNRA 1SN0A 1JHLL 1GGIL 2PTTB 4WUUD 4MS8C 4PJHA 2NXZD 4V11A 3CC5B 2OMTA 5AW9B 4FB1D 1XD1A 4CADB 4BCXA 1MFBH 2GHZA 2XXMB 3MJGX 3OMNB 4J23A 4MAZA 4KROD 4HULB 2GTQA 1WFNA 3BW9B 3CDCA 4FFWC 5HGGS 5K9OB 4XNQA 3V4PA 2IAMB 4IHOB 4E9WA 3I7KA 5LDSA 1B90A 2WINA 1FI8C 2D4FA 3AXIA 2VISA 4YDJB 4JHZA 1BXUA 3II3A 4ZMQA 4XGZB 3MLUH 3MXVL 2AC0A 1UXWA 1MCJA 4UIMA 2CBQA 2AEIT 2NR6C 4KVNH 4D94A 4QY8A 4QTIH 3HFMH 4YFLF 5EUOF 4MJ6A 1F45A 4ZMXA 2NYZA 2FBRA 4XHQA 3D18A 1HHHA 2C9XA 2XUWA 4N2CA 5E2TH 1CIDA 1JF5A 3ARXA 1MCOL 2OCJA 1DQJA 1ZT7A 3DYPA 1CYWA 2EE2A 1RZGB 4PRAA 3HI5H 3RWIB 2F58H 3SDYL 2QADB 3AT9A 3O4LB 5F0LB 5F96H 2XFXA 3N85L 3H9SE 4C8XA 3CZNA 4MCMA 4X98A 4IMKA 1GGTA 4G8GD 1ES0B 2DQEL 2XWJA 2FX8H 4KK8C 2VDQH 4CN1A 2F68X 5MI0B 2NPLX 2XRAL 4B9JA 2BZ7A 2YD7A 2J57A 3P0GB 4FQQB 4P59L 5JYMA 1S7UA 5JPMA 1J5OL 1VGEL 2CRYA 2OZ4L 3BE1L 3E7JA 5FFGA 4EXKA 5K19A 4ADJA 3HMWL 4L37B 1MH5B 1IGFL 4OCRH 4WUUE 3X14B 4WO4C 3HAEB 3AB0C 3DROA 4KAQH 3GI8H 4NOFA 5F44A 5FF6B 1UJ3C 3MXWH 4HOMA 2Z0BA 3ISWA 1R34A 2NTFB 4LCYB 5HHPB 3SDAA 4NQVB 4UT7L 4I48B 3WFHB 3WXWH 4G6AD 5C0CD 2Z4QB 4PTTB 2E47A 3PGCA 2DQUH 2B39A 2YA2A 2VQ4A 3DXAA 3KPOA 2YPLB 3QR0A 4YC2B 5ESQB 4N14A 4HUUB 3SYCA 3NYKA 4MDJB 3W0WB 4GKOA 3PNRB 5DZOA 4FQCL 3GSVB 2E76C 1A9BA 1EO7A 2F19L 4N2KA 4X5PA 4MLIA 4URTB 2WIMA 4HCRH 3NH7H 1DJZA 2C7UA 3NABH 3MJ7A 1MI5D 2VC2B 3ME0A 5F7LB 4AYGA 4FABL 2DYPD 3KPPA 4MBRA 1EANA 3QNZA 4BH7A 4TLSA 2ADFL 2F8IA 4FQ2L 4QXUL 2AGJL 5E9AA 1JZHA 1T6BX 4BL0A 2VYRE 5C09D 1HEZB 2EIKB 2CLVB 1YEEH 1M2OA 3FRPB 2F53D 4IRZH 4FFTA 5LWYH 1JGEA 2R69H 4JGUA 3UG4A 1XL6A 4XC1H 1I8KA 1CFQB 1O6SA 4ERZA 4Z7WA 1T1XA 2GB2A 4XE5B 3K1DA 1RJLA 3QZNA 1I3VA 3LKQB 2LVEA 1B4JH 2FEEL 1ML0A 4WHTB 3LD8C 1DLHB 2YD0A 4G8GE 2IAAC 4YVUA 5TQ0H 4NN7B 5CS7A 5E56A 1SRDA 4LVHC 4ERQA 4WVRA 2P5EA 1QUPA 4CVZA 3L81A 4AWJC 2VXSL 5ECJE 2X4SB 1S3KH 3EFOB 2BOLA 4KHTL 4LLMA 3SXTD 2V37A 3HNSL 2Z8WC 3UC0H 1N5YH 1KTJA 3IDNB 4L1MA 1C8PA 4QF1B 3HG1A 1YMHA 4H1LH 1BVNT 2KQMA 3F7LA 3FQ2A 4JFZH 4UB0L 1CPUA 4O58H 3ATAA 5GS1B 5K33A 2DN7A 1UOKA 3PWVB 5IQ7L 2CUMA 3OR6B 1WZ1H 4FTVD 5C0CE 2GJ6D 2Y22A 2GBTA 5E2WL 2CK0H 1K4CB 1QBBA 2YUZA 4P2QA 3CE1A 4RAUA 1U8NB 1QHPA 5C07E 4LPTA 2OI9C 3L1OL 5C9ZB 3P9MB 3KPQA 3G04A 4NI6A 1YQ2A 1MFEH 3JVGC 2AK1L 3FUDA 4CC1A 1JN6B 3ASOB 3AG3B 3CVIL 1NCCL 1MI5E 1JPGB 2G9KA 2FWOB 1AGCB 2SEBA 4TOYL 5JHLA 1ROCA 2OJEA 1GOGA 5I0XA 5DD3H 4A68A 5EFIB 1RHHB 4Y1AB 1EAPA 3I7NA 5DRXA 2BRRL 2VKXA 5ICXA 1H5BB 1N8ZB 1DQMH 4YK4C 3L2NA 1HNGA 2PYED 2F53E 4KU1A 4NZFA 5L4JA 3W5NA 3MKSB 3MHZA 1WAAA 2CD0A 3ZSTA 2BVEA 3FUEA 4X5WB 4HOZA 3QAZB 4J3OF 2VLMD 4ACTA 1GIGH 2XICA 4U3HA 2DQGH 1A14L 2W60A 2DTSA 1G9NL 3MA7B 5I1GL 2DWEB 5I6XC 3ORJA 3IB4A 4H5SB 1IBGH 3VXQA 2B5NA 1ZLWK 1TSHA 5CCHE 5JORB 1INEH 3M17B 3O9WB 1NMAL 4GG8B 4RQQB 3X1EA 1B0GB 5KYUA 4FDWA 3QFJA 4BUGA 1OGTB 3C12A 5DO2C 3QIWB 4UYPA 1HTYA 2OSLA 4WEBL 2IBZY 4O51A 4RAHA 3WJLC 3EYVA 1AZNA 4A2MA 4B5EA 5FECB 5IMLB 3IURA 4P4RA 1E67A 5AYUL 1N5AB 1PDKA 4PJ5D 3DNKA 2FSEA 2LU3A 3RWCA 4PJ7E 5D2NB 2UXGA 3VJ6A 5DRNA 1QTPA 1WIOA 2FIRT 4X3EA 3EYQD 4MAYC 3SPCA 3MRQB 3HHMA 5D4QA 2CKBH 1N2RB 3F3FA 4ZMYA 2GJ6E 5KDOB 3HE6A 2EDMA 1HL5A 4PB0H 4Y7MA 5FO2A 4I2XB 2QLYA 1PD6A 2GFBB 1QBLH 2XKNB 4LHUA 4FEIA 4F7CB 5I17B 4NQEA 5E5RB 2CLZB 1NPUA 4UDUB 1A3RH 4OM1H 1NANI 2MWCA 5F7FA 5AENA 5KUKA 3RFRA 1HL8A 5I6OA 1NBZB 3VFRA 1LWJA 4F5CA 5CGBA 3SYPA 3E9TA 1Q9WA 2OMWB 5EAMA 5E23A 3U9WA 1P6AB 3RNQA 4XXDB 4HCIA 2CPUA 5FYLH 3RGVA 4JRYA 4DKEL 1ZK5A 4W4OA 5BZWB 3PQYB 2ITCA 1YDPA 1IAIL 4GS7B 4FQLH 4GXUM 4AI7A 3SE6A 4YEFA 3CU7A 1M05A 3NPZB 4N8CL 1PTZA 3IVKB 3F58L 2VLME 2NW2A 1QBML 2ZCHH 5KSBB 3O6FC 3O6LL 3NVNA 4ZQKB 1YQVH 4BXSV 1BIIA 4XPFL 4M61B 1CL7L 1JVLA 4O02H 2ERJB 2W9EH 1CD1B 3FT4A 4W6XB 4YZWA 1EZVX 1YEGH 3II2A 4JO1L 4LL1A 3BAJA 4NWTH 1FNGB 4C83A 2AXFB 1BBDH 2AAVA 1Y1DA 2MQ0A 1NLDL 2G9HA 4OBSA 1USQA 3HLKA 3NIDA 1HAWA 2XBZA 4YSUA 4YWGL 1BLNB 5GJSH 3DUHA 4OCSL 5DMYA 2PCXA 3DGCR 1WBZB 4PJ5E 3J80g 4PWEA 5ABDE 3QJZA 4F58H 1FN4B 2VTFA 1AKJB 4L3FA 4FX5A 3UP6A 1UQSB 4R96B 2O61A 3GXIA 1T80A 3KRXB 2YD1A 3J8F7 4NC1C 3CFQA 3HS8A 4JX0A 1U8PA 4D0CA 4OY9A 2QPSA 2UVEA 5HP5A 5HYFA 5I1AB 2K1MA 1T7WA 2ZOTA 1NWPA 4OF0A 4G5ZH 4J3BA 5E1GA 5DQ9B 3X2QB 2R29A 4ZG1A 1QFOA 2XFGB 4XPTL 5EMYA 3TPUB 2PTUA 4MNQB 2CRZA 1PNCA 5C2UB 2JELL 5DK2B 3VD4A 1I9JH 1ZTMA 2F74B 2A9NL 1P7QA 3LS4L 2FSDA 5KVFL 1EX0A 1MIEH 5IVXF 1U0QA 4NLAA 5EBLA 4BFNA 2B8OT 4NO2B 4PLKD 4UQ2B 3SPVB 4ODUA 1OT4A 4KQ4L 1OMWB 2ZKXA 5B4MD 3HC3H 5FYJE 1J8HD 2BHZA 4GBXC 4GW4B 3LKNA 1OW0A 3EO0A 4GW5B 3QORA 1IGML 3AWGA 2O5ZH 4QAWA 1NCWL 3L95B 4PJHE 5I74C 4GQ9H 1KIUB 2NQDA 3GSXA 2YNNA 4J81A 3T4YA 3LPPA 3UABA 2IBZX 4XT1C 2V2WB 2YGQA 5AVVB 4HWEL 5JW5B 4BH8B 5IROC 5BVPH 2LQRA 4IW4C 3QPQC 1U3HB 3IBOA 2DWTA 4KKLD 4U1NA 5DUML 1I7UB 3DXAD 1QR4A 1KYDA 3ATDA 1CF8H 3CFDB 5BRZA 1QI4A 4XNYH 3NMEA 1UOLA 2AHIA 2FUTA 3HNTL 4JO4L 4KUCF 3APCA 4FL4C 2OVQB 1DVFA 4PRHA 1S9XB 3ZL4H 2JJTA 3IFPA 3JYCA 5E9DD 3V0WH 3KAAA 4GIOA 4YQXL 2B0SH 4JSNC 2JKNA 5AZUA 1MSPA 1RUQL 5LQBL 3KG5A 3LRHA 4LNVA 4WI3A 4A0AB 1IE5A 1J86A 5K9JL 2AEPH 1KY7A 4NP9A 1JZ6A 4JUTA 1AQHA 3LRLA 3D2TA 3GSNB 1O7SA 4XNXL 5I6LA 4JPVL 3QUXD 3MODL 3QDJA 3VFTB 3NT0A 2V2XA 5DJ6B 2EUVA 5DD5H 3MREB 2Y07L 4X4XB 4P48A 3DJ9A 4WGKA 2O5XH 4U33A 4OI7A 3UYRL 4MZRA 2CIIA 4G9FA 4K23H 3BZ4B 1KPUB 3U7AA 4XN5A 1X9RA 3MA9H 1ADQL 1J8HE 3N1PC 3WDHA 3D51A 5B38A 3PDOB 5THAA 2VMJA 3QPKA 4JFDA 3ZDXA 3INUL 1PSKH 1WFMA 5J6SA 4LLQA 1CGSH 5LKNA 1JZ8A 1GZHC 2CO2A 3MKGA 1DQQB 4JFYA 1ETA1 4XMTA 3W9DB 1OPOA 4GRLD 3JPXA 3O11B 2XU9A 2ZJSH 3OMIB 1VIWA 15C8H 2PTVA 3S5ZA 1JJUB 1WFJA 2C3GA 3HN5A 4WNQB 5EBGA 3EGXB 1WISA 4P4KB 1OTSC 4RFNC 3DXAE 3AFCA 3FN9A 1TZIB 4PC0A 4JVUA 1OAXH 3PWLA 3AU1A 4C57C 4CVXA 2ENJA 3CFIC 3HA0A 2IQ9H 4I85A 3L9RA 1TBGA 1GG2B 1Q9KA 2IV8A 5I0VA 1E5AA 5K59E 5GXIA 2DTML 4Y88A 5E9DE 5BO0D 3AY2A 4JZOA 2ZWYA 1YUHA 3UO1L 4E54A 4Y2OA 3ZKSD 4EBQH 2ZWZA 4N1EA 3QGVA 2Z8SA 1UOOA 3ETTA 2AK4D 3QT2A 3VRJB 4W68A 1MFNA 2NQCA 2A6KA 1FORL 2DQDH 5SX4H 4LPXA 1T04A 4FQXD 3V4VA 3EO1A 4LDEB 3ZTNL 1XGQB 2XV2A 4AGLA 5FKSA 1EJOL 1MCFA 1RUAL 3MZLA 1WA2X 4Z7WE 4KY1L 3TA3D 4EKXA 1YNKL 5DS1A 4OFDA 4FHJA 5F1IA 3D25B 4LLYA 1TTGA 2WKGA 4W70A 4EQ2A 1ZHKB 4WSJA 2WZ0A 3WSQH 5I0DA 4NJAL 3DJZA 5K9KA 4GO6B 3T4AC 5KYNA 4Q9QL 5H37H 4YR6A 3T8XB 4J3OC 4KZDL 3MBEC 3H2WA 4PJDE 3IKCB 1Z3GL 3S9DB 1HINH 4TVPH 2XTLA 5LLIC 2PPAA 1SNRA 1WWAX 4JFPA 2JNZA 1F58L 3MRNB 5I5JA 3HG1E 1H3VA 1I53A 3N0PB 4DVBA 5ALBL 4OM0L 3KM1A 3NZ8B 4N8VG 5E6IC 1KCWA 4XOEA 8CGTA 1BMGA 2B1OA 3FO0L 4Z3JA 5F1NB 3F7QA 1DL7H 2IOIA 3C2SA 4LOUD 2EH8H 3QA3A 4OLXL 4ALAC 4P3CH 1JFHA 3K4AA 3W2DH 2HYEA 3FTSA 5JQ6H 2B7DT 3IGUA 2G5BA 1IQDA 2VN6A 2YLHA 2LOEA 4P2QE 4OF6A 4TNEA 4X0NA 4B60A 4F57L 4UV7H 2CMRL 1MCWW 4LHUD 1E9OB 1XTLA 2YSSB 3ZKMC 3O4HA 4FRWA 1U41A 4KZEH 1JD9A 2BSRB 4OZFB 1JERA 2VABB 3MYZA 4R4BA 4LSSH 4PV1C 1AHKA 1DVYA 4NRXA 3A24A 5BQ7B 3AREA 5EF1A 3FO9B 1URIA 2CO0C 3HZVA 1RSYA 1LO3L 3UJJH 3PE7A 5H14A 4ABVA 3FBQA 1KBVA 2AK4E 5D7EA 5DK0A 2BCKA 2WWMD 3ZOAA 5DVOA 4ODXB 4PUBL 4L3AA 5F7EH 3D4ZA 1EWHA 1R5WA 4GSDL 3D39B 4GRWE 5LO7A 4F93B 4WUUB 2FJHA 5CINL 2PABA 2Q20A 5KJRH 2E4TA 4NBMA 4R7AB 1A7OL 5DJYA 5GGVY 2MOVA 3DPBA 3QHZL 4G6MH 5B1JC 3FRUA 2MOQA 4AIZA 1VFUA 1BZ9B 3JWDH 2GJJA 1S7RA 3O0LA 4KROB 3FCUB 1KCVH 4WW1B 4QLWA 1BAWA 2ATAA 3RJDA 3MLZL 3BYTA 2R0KL 4HIPA 4DN3L 1QABA 3O2DA 4PIRF 1GOFA 4GKLA 5CKAA 3UGUA 2AI0H 3DTDA 3L5JA 3RY5A 1KWKA 4PVBA 1JPTH 4E36A 4IRJC 1CXHA 1UKQA 4UM9A 5MHSD 3JUYA 5SWZA 3VSVA 4PCSA 3QFJE 1Q0XL 1ODAA 1QFWI 2YD9A 1UFGA 1A66A 1KFAL 4K94L 1GS7A 1N6VA 5HYIA 2I27N 4OCNC 1DJYA 2BS8A 2FEJA 2J1KA 3S5YA 3JWNC 3HZKA 5EO1A 3F3GA 2E6QA 2X70B 5C0FB 2YNPA 3CFEB 3QNYA 4I3SL 2OYKA 4BZ1H 4FZ8H 1JMZA 1NEUA 2DQCH 4X5XB 2E9BA 5HYSG 2ZCKL 1M7XA 2HTLC 2NX5D 3I50L 4LASH 5M5UA 1F8TL 2RQEA 4N0YH 1T1YA 4NQCB 4HH9B 2OMYA 5KS9B 3SY6A 3H4HA 1ZJAA 5ESVB 3T6VA 2OK0H 3OLIA 2ARJB 4G8GB 3V6ZB 5J13C 4EZKA 2VLKD 4A08A 1UZ8A 2HX7A 4F5CE 3OQ3B 4N0CC 2XOTA 4OLWL 5DHVA 4HV8A 2RCSL 3HG0A 1HYSD 3MRDA 4LDOB 5GGVH 5ALCL 1HHGB 3EJYC 4NUJB 3VXRB 5HVFB 2KLSA 4LP5A 3RZCA 2EE6A 4M7LT 2FT7A 1OIOA 5J4MA 1E2WA 1FQ9C 1KEGH 2XZQH 3RX5A 1N6EA 4FA9D 1G0XA 3G6AA 3BPLB 4WGVB 4D9LL 1NBCA 1MWAH 1B9XA 1NIEA 3IFOB 3WIIL 2HH0L 1XKSA 5CFHA 1A1NA 1EJ8A 4B3EA 5GRYA 4NFCA 2FQDA 3P0VH 5KYYB 1JWUB 4JMXA 3U9PH 2BPBA 1HK6A 4GI8A 4MA8L 3HG4A 5DZ9A 3A0FA 1TQCC 1TTAA 3R8BB 3MNMA 2HWZH 5FV1L 3LRSA 2CHDA 2B9BA 2ADIB 3UZVB 1FUNA 1H9DA 4ODVH 4ICXA 5D7JA 3NIDE 1S5IL 3QFGA 4L29A 4LAQL 2HPTA 4R7DB 1WRFA 4MKMA 5EZIH 1CG9B 1MI5B 3ZKND 1S7VA 1OARL 2Y7OA 4GIAA 5C86A 1UENA 1Z5LB 2BWIA 3OB8A 2BLFA 4Z7VA 3FUFA 1C1EL 3DO3A 2NY1C 3LS5L 3AY4C 4F91B 5JR1H 5C09B 1D5MB 3L9YA 5FO8A 2GTZB 2F53B 4PR5A 4Y2DA 2NX5E 3LQAH 5L2JA 5IJDC 1NDMA 3US0A 3BH8B 2XXFA 4MMYB 5EIQA 3QQDB 2XN2A 2VJ0A 3LPGA 4XBEH 4OZ4B 3LKRA 3U4EA 1KBGL 4EUPH 3IDIA 2G3XA 1Q38A 4PJEB 3CK0L 3ZGIA 4ZMZA 3NZUA 2FLMA 1QW9A 4JGMA 5E2VL 1TU2A 5E8OB 1TZGH 4X5RA 5DS8B 2ODIA 3VXMA 1XF3B 3GINA 1MVFA 2E9JA 4L4TD 4P07A 5FW8A 1QSVA 2R7EB 4HK3J 2PPCA 2XG4B 3Q1SL 4H26B 1XR9B 4FXGC 4ZOCA 4DGYL 1RZ8A 5JW3H 5TF1L 1EMTH 4UBDD 5DJXA 4BKSC 4NX0A 3Q44A 4YXLL 1B4TA 2PN5A 1PGUA 3OG4B 3EFDL 1TZ8A 4FEMA 4Q6KA 5IEHA 5I66A 2ENQA 3DOIA 4F8LA 3ES6A 2ZAGA 1VAHA 1JGLH 3L7EB 3OV6A 4G80A 4H0GA 4YUEH 1KGIA 5KTEH 3ZT6A 1RD6A 1NFIA 7FABH 5HYJD 4NT6A 3B2XA 2WXKA 3K6IA 4FTVB 2XTJC 3DV6A 2GJ6B 3BEWB 3ARYA 1DTUA 4NM8L 1C5DB 4QI3A 4WNJA 1UVQB 2IXQB 4AM0B 1Z0MA 3UTZB 5AAPA 1YR2A 1TQSA 3QUHA 3ML9A 4DSYA 5LGKA 4AQEA 3TO4C 4RMSA 3BVXA 3QRLA 2EXWC 2ZPKL 3DX8A 1O7VA 3MOAH 4JSXC 2HRPL 5BRZE 3D12B 3QIUB 3FTZA 5JOFA 4U1KA 5GISL 2VDOH 4MA7L 3JV4B 1LO5B 4TF4A 3D85D 1AIZA 2XBTA 3LXBA 3T5WA 3TL5A 1DCEA 1LHZA 2YEZB 3ZMNA 5T1JA 1NM4A 4HCFA 2ZZUT 4JR9H 2MHAA 1CYGA 5SWQA 3L3IA 1J1PH 2NYYC 2J25A 3RA7H 4J5VA 2PYEB 4XCNB 4R7LA 3VD3A 4YBQD 3PJNA 2X4TB