3V4VA

Crystal structure of a4b7 headpiece complexed with fab act-1 and ro0505376
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
587
structure length
582
Chain Sequence
YNVDTESALLYQGPHNTLFGYSVVLHSHGANRWLLVGAPTANWLANASVINPGAIYRCRIGKNPGQTCEQLQLGSPNGEPCGKTCLEERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYIKNENKLPTGGCYGVPPDLRTELSKRIAPCYQDYVKKFGENFASCQAGISSFYTKDLIVMGAPGSSYWTGSLFVYNITTNKYKAFLDKQNQVKFGSYLGYSVGAGHFRSQHTTEVVGGAPQHEQIGKAYIFSIDEKELNILHEMKGKKLGSYFGASVCAVDLNADGFSDLLVGAPMQSTIREEGRVFVYINSGSGAVMNAMETNLVGSDKYAARFGESIVNLGDIDNDGFEDVAIGAPQEDDLQGAIYIYNGRADGISSTFSQRIEGLQISKSLSMFGQSISGQIDADNNGYVDVAVGAFRSDSAVLLRTRPVVIVDASLSHPESVNRTKFDCVENGWPSVCIDLTLCFSYKGKEVPGYIVLFYNMSLDVNRKAESPPRFYFSSNGTSDVITGSIQVSSREANCRTHQAFMRKDVRDILTPIQIEAAYHLGPHSTEEFPPLQPILQQKKEKDIMKKTINFAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-4
publication title Structural specializations of a4b7, an Integrin that Mediates Rolling Adhesion
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 126
structure length 582
sequence length 587
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1460 Mainly Beta Sandwich Immunoglobulin-like Integrin domains. Chain A, domain 2 3v4vA02
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3v4vA01
3VI4A 3K72A 1JV2A 5E6RA 3K6SA 5E6UA 4UM9A 3V4VA 4WK2A 3ZDXA 3ZDYA 4Z7QA 3FCSA 3ZE0A 2VDQA 3NIGA 1L5GA 4G1MA 3ZE2A 4O02A 2VC2A 4WK4A 4MMXA 2VDPA 4UM8A 2VDRA 2VDNA 4IRZA 4WJKA 4G1EA 4NENA 3FCUA 4Z7OA 3V4PA 3NIFA 3T3MA 3T3PA 4MMYA 4Z7NA 2VDKA 2VDOA 5HDBA 3VI3A 4WK0A 5E6SA 3ZE1A 3K71A 1TYEA 5FFGA 3IJEA 2VDLA 4MMZA 5FFOA 1U8CA 1M1XA 2VDMA 3ZDZA 3NIDA
chains in the Genus database with same CATH superfamily
4GGDA 5I8OL 1U8HB 2W9DH 4ZOVA 1AXSB 2C3WA 2XTJE 4M5ZH 2WQVA 4GW1A 5JYMA 3JZ7A 4ZUVA 1F0LA 1UXSB 4CN4A 5EO1A 3ZYOA 1IC5L 2AABH 3O2DL 4PJ8A 4U1MB 4ANWA 4FQQA 3HE6C 5I1JL 1RZJC 2ZSWB 1XF3A 4AGQA 5GZOC 1B0GA 3FYEB 2VRKA 3C08H 4FS0A 2VISA 1FG9C 5DJ6A 4F8NA 2ZKXA 4YBQC 1NIEA 5B1BB 5IROD 4HWZB 4APQA 2HH0L 4AXWA 1SN5A 2AJSH 3BQVA 2R59A 4N2MA 4XMPH 1BYOA 5EIIB 3QT2A 2E9JA 3WEXA 3U7YL 3C6SB 1WTGT 1QSFD 3ESMA 1V7MH 3Q0HA 4XHJC 4AVIA 2JCCE 4W1TA 1CD8A 3T2PA 3IT8D 4KRLB 4WIQA 1SJHB 1S3KH 4AEIL 2VR4A 4KKLD 2DM3A 1R5WB 4ZFOA 5AFAA 1UZ8B 3TBCA 5ITBH 5F7EL 3SN6B 5BRZD 2AMUA 2JV6A 1I3VA 1TTRA 3O0LA 2R83A 4NRYB 1SZNA 2MPAH 4YO0B 2OSWA 2CO6A 2WZ0A 2O5XL 1O5PA 5FC9A 1Z9SB 3BGFC 4QO1B 2C1OB 3QZWA 2X70A 1K5NB 3H9HA 4OF3A 5E9DB 5HDBA 3G5ZB 3GMNB 3SB3A 5J9PB 3W39B 5E6RA 4ZTEA 3FFDA 4YDVB 1B88A 4XP9H 1F11B 1FORH 4J2QA 1GS8A 1XGUA 4I3RH 1I9IL 3DSFL 4D0KA 1NM9A 1N0XH 2X40A 2YBAA 3MV7A 2QKSA 2XBZA 1AYOA 4GRLB 3EDDA 4AMXA 2G99A 1YECH 4WK0B 1A4JB 4PEEA 3ZWLB 4F27A 1N9PA 1IGCH 5CFAA 4N85A 1VJSA 2OQJA 4KKRA 3LRMA 1TDQA 5DHVB 1L3WA 3S5LG 1AGBA 4L4TA 4P5KB 1JGEA 4WFFD 1A7NH 1FCGA 3RU8L 1HYSD 3DGGB 2YWZA 4E9WA 4U6VL 3MYJB 2WIMA 4LSUL 4G82A 4FZEH 2WQWA 5T1DL 4KTGA 3EBAA 3VXPA 1JMZA 3T5WA 3O3AB 1S4UX 1UCBL 4QR7A 3BIAX 1KBWA 1UJTA 3AG1B 2R29H 4K55A 4RFOL 3E2HB 5GJSL 4M61A 4C4BA 1S9YB 4EEEA 1E5UI 3OLIA 3RJOA 5KSBF 4UQIM 3V10A 4I3SH 4JKLA 4LKCA 5L7XL 1VPOL 3DXAA 4J3BA 3CZFA 5FYJL 3ILPB 2NUPA 2WQAA 2JELL 1NIBA 3MA7A 1WAAE 3QHZH 1IGIL 2D03H 2E8ZA 2W92A 4NHUA 2WLLB 4KY1H 5KANI 2WXFA 4M8QB 2XN9B 1LTXA 3LQZA 4G1MB 4H2CA 1K72A 2KDYA 2OR9L 2WBXA 4DO4A 4BFNA 4E41E 5CGMA 2W8CA 2E59A 1UHVA 3NEXA 3OV6A 1T5XA 1IBZA 4ODUA 1DJIA 3D52A 2H6KA 3ZL1A 2B14A 1H3PH 1TQVA 4Y4HB 4ISVA 4U6XB 2FIRT 1NGPH 2YXWA 3V0HA 1G7HB 1VHPA 4R4NC 3FTYA 1RIUH 1T1XA 1TJHL 5T8IA 5EZPA 1IC4H 1NMCC 3CQPA 3LPPA 2XN0A 2VDPB 4NAQA 1GHFH 4EI5A 1RZFH 4NQVB 1YEJL 4F8TA 2X88A 3UROR 4NWTL 5JUEH 1Q0YL 3UBFA 1MPAH 4NZJA 1Q0XL 2VM3A 2VN7A 2HSIA 1QFOA 2WZ6A 4R4FH 5D1QB 4PB0H 3QRGH 3IWUA 2HJKB 1A9EB 2Y24A 2WTOA 4KRPB 1KCUH 4XNMA 3P11L 4G6JL 3JQOB 1JZ7A 4HIQA 3LNFA 1A2YB 5I6KA 2FSEA 4PY8I 4I13B 2VRQA 4Y2DA 2OIZA 4NKMB 4DIXA 4YJZL 1UWFA 2C9UA 1CXKA 4D8PA 3L5WA 4QYOA 5C2WB 3TN0C 5L2KA 2VN6A 2J20A 1GW0A 1CF1A 5CJQL 1JD7A 5IB1A 3FPYA 3L7EB 4OCWL 4J81A 3VXSA 4FJZA 2WXLA 4DJMA 3LD8C 3HBPA 4X5WA 1OAXL 4HFUL 4H1LH 4L9LC 1ZSDA 2EEAA 2KZKA 3Q3GB 4OLYH 1LJMA 4Y5VB 3L7FB 4FWWA 2Z91B 4HJTA 2GAZB 1J1OL 4GQ9L 4BXSV 4MD4A 5IM7B 1BZOA 1UFUA 3FXIC 1KF9B 2WKOF 1T21A 2YGPA 3UAJD 2F53D 4CN6A 1DVXA 5KTEL 2W0LA 1E4XH 3GMLA 4FA8A 5JORA 5IZ7A 1KENH 5JHDD 1JS4A 5KBMA 2NNAB 4HSCX 1D7CA 2JKWA 4RWYH 3WFHB 5I1HL 1BM7A 2BVYA 1NMAL 5EC1A 4WDIB 1EDHA 1E42A 2DIBA 5TDPA 3ARED 5B8CB 3PABA 4V1DD 1CYGA 2QKIB 3QXVA 3AT0A 5E8EA 1MCJA 2A5UA 1BIHA 3BP4B 2RHEA 4K4KA 5A2BA 2V2TB 3O4HA 3U9UA 5J6GB 1T0OA 3S35X 2L7QA 4NPYA 2D0FA 3TBTB 5B21A 3JWDH 3WEBA 1AOZA 3QIUC 1N6VA 3GJFH 1UUNA 2AW2A 2ICWI 4ODWB 3UG5A 1GZQA 1UA6L 3UYRL 1S7RB 5TQ0H 4HK0A 4KI5E 2AJUL 2WLIB 3SY0B 1UD6A 3UMTA 1VENA 3FHAA 5FYJE 4OB5L 1CS6A 1W8OA 1UWGL 4NQDA 5IGXL 5I9QB 1TPXC 2DQIH 1SRDA 3ARFD 1KN2L 2VDMH 3OKDB 1FN4A 5GS0D 1LMKA 3JYCA 3VDCA 4N9GA 1C9SA 1G84A 3KPRA 3V5HA 3D39A 3NDZE 1A6AA 1A6ZA 1V27A 1B6DA 4AGPA 1SJXA 2CXKA 2ZAIA 3ARDC 5DFVC 4YPJA 4MA3A 1PTZA 1AO7E 1NCUA 3DO3A 3FB6B 5T3ZL 2QBWA 2ZX9A 2CQVA 3PNWA 3FQXA 4MAYA 3QUZD 4YDKL 3HZMB 4FHKA 2ETWA 5C9JB 3SPHA 2DQHH 1IRAY 2CIKA 4LPYA 3VACA 4EI6A 2X4OB 4K3EL 2DRUA 1PY9A 3QUYA 5FS5A 3L4ZA 4R4BA 1CXIA 4N22A 2P9KC 5GSAA 3DJ9A 3NA9H 2ZAHA 1AR2A 1IBFA 4M9OA 5B38B 4JDEA 3E6FB 2Y25A 4KWUA 3SGDH 4FB1D 3RWHB 4YFLF 2OMYA 1U8PB 3RTLA 1DDHA 4HHAB 4JR9H 1I8MA 1AJ7H 2QHRL 5T33L 2DQGH 1H5BA 1CYWA 2AXWA 2DLEA 5DJZB 2QMJA 3LNGA 4JAMA 1QRKA 1ICTA 1KFAH 5E4OA 1IBHA 3QDJE 4PJEA 1O7SA 2EYTB 5ETUB 1O7DC 3QJUB 3UVNA 5E1IA 3JWDC 2EIMB 1YVLA 1UH3A 3ISWA 3R1GH 5HYJB 5IGQA 1BZ7A 3DVNB 2QSQA 3OB0K 2OMBA 4Z8FL 2Z8RA 2XWBB 3C2AH 3KPSA 4HKJA 2FUTA 4OIBA 3BP5A 3IIYA 3OXSA 2EH8H 1D5IH 1M7UA 4PJBE 3QDMD 1V10A 3EWEA 2BSTB 5JR1H 3LPOA 3PSCB 1LYQA 3ALXA 4XMVA 1WC7A 3LDBB 3FUNA 4ERZA 2ADGB 1KY6A 3X11B 2XWZA 2JB5H 2X2UA 3UDWA 3V8OA 2BVPA 3TTSA 4KK8C 1OTSC 2WIIA 3E9TA 4YEEA 4A66A 1IE5A 2GUYA 1P9MC 1RZGA 4WU7B 2PR4H 3GJEA 3LKSA 4OCYL 5DJ8A 1QSEA 4F7CA 2Y7SA 1ZTMA 4IK7A 2WXIA 1TVBA 1BLIA 1KYFA 1O7DE 1VFOA 3ZHLA 2RH0A 4N8VG 5DO2C 3IDJA 5C0FA 2AXFB 3RDJA 1L0QA 3ZKXC 1AGEB 3N91A 4KQ3L 2GJRA 4NJ9H 5A2KH 3FKUS 3AY2A 5MEPB 2AH1A 3NCFB 4A37A 4JNXA 2VE6A 4ZW6A 1G7LA 1T7WA 1NCIA 3DPBB 4UIMA 4OD1H 1UD5A 3SDXF 4B7IA 3F8UB 8FABB 4WTZG 4JFSA 3JTTB 3GEWB 2CMRH 4PJ8D 2QHLA 3KGSA 2NZ9D 1CDUA 1L9RA 3NFPB 4NO5A 4B9ZA 4DW2H 5FLVA 3FN9A 3WDIA 3IKOA 5EZIL 1S4IA 1RIVL 4ZTOL 2AI0L 2NY3C 3C87A 3U46A 3DVIA 1HZLA 5G5DB 4AEEA 4LRNH 1DVQA 4APQD 1U8IA 5EF1A 4AJVA 5FYKU 3MBEC 5KVDL 2YGOA 4ICXA 2UXFA 2X7LA 2WP3O 5HHOE 2NX5E 3PAUA 1T2QH 5J11B 3ET9F 1U8KA 3GKZA 4CILA 4FHJA 4QXUL 2VQ1A 1SHXA 3QS2A 3T0XA 3SE9H 2BP8A 2D9QB 3MRBB 2X1XR 5F7DB 4ZW5A 2Q7NA 1BWMA 2JJSC 1CD1B 4ZDHB 1T20A 4L9OA 1OGAA 1I9JL 1WZ1H 2ARJB 4LLYA 4XWGL 3L4MD 1YNTF 4M5SA 5IMKA 3RL2A 3ILDA 1EFXA 2WVTA 4X7SH 4NNPH 1CICB 1SYSB 2FT6A 1IEBA 3O6KH 1YAZA 3PQYA 4HZLA 5D5MB 4PB9L 2AV1A 3DLQR 3MV7D 1FHNA 1QW9A 2QZQA 3G6JA 3S34H 4HWUA 4DZ8B 3CJJA 3BKML 1KIPA 4Z3GA 3GDBA 4O58H 2X4NB 1DJXA 5DWUH 1I1AB 4L4TD 1DR9A 4LNRA 5I26A 5DD3H 3UGEA 3RFZC 3PFQA 4BFIB 1WG3A 3MACL 4PH8A 1WF5A 1LO3L 2QGDA 4Q14A 3FTUA 4LHJB 1CLOL 5KYXA 1S7XA 3TS8A 1A12A 3FUJA 1K9TA 5IJKC 2VC2B 4YQXL 2HUHA 4GKZB 2NTFA 2WXJA 3D3VE 4LSPL 1RK7A 3GXNA 3DTUB 1NQBA 4PVMA 2Q1EA 2XX0A 4K5MA 4GINA 1R3KA 1YC7A 3DXAD 3T65A 4DT2A 4G6ML 1S7UA 4NQCE 3V7AE 3DECA 5TEEA 3VXUB 4JG5A 2YMUA 4I5BB 1I75A 1XMEB 4M7LT 2OYKA 3ZT7A 2VH5H 5FFGA 3V9CA 4ZOZA 3MROB 4E9TA 3CG8A 2KLRA 5JXAH 1UXLA 2H7WA 1BFVH 2CKBA 4UZUA 5J3HD 3T0EC 2J8OA 2E8YA 4RFNC 3WY3A 5L6YL 1FL3B 1CO1A 5FYLD 5B38G 4HDJA 3R4DA 1A4KB 2EDBA 2IF7A 1U92B 4KTEL 3H4FA 1SNRA 3FFCB 1U9KA 4KK5C 4HKBB 5JW3L 5ICYA 1QFUL 4IGBA 1DQKA 5FKRA 4EI5D 3O3UN 1YN7B 2VXTL 3ERXA 1AR1C 3IUQA 1DE4B 2KUTA 1GYAA 3FONA 4ZYKB 2ICES 3GSNA 1ACZA 4BZ1H 4GI9A 4X6DB 1M7XA 3P3SA 2X9ZA 5LAXA 1PLCA 1JZIA 2XN2A 3OGOE 3KEDA 3UJJL 2JQMA 1ORSA 1JGUH 3T77A 1LO4L 3P30H 2D3VA 2J7LA 2ZYRA 4HIJA 1P4IH 4FDWA 2QZPA 4X5XB 4F7KA 2H0PA 4Y2DD 5DSCB 1MIEH 2XKUA 5F6IB 4OJFL 5DYOB 4HS6A 2BNQB 3T0EE 4LOUD 3NUKA 5E03A 5F1IA 1F41A 5GIRA 3UGXA 5HYSB 4XP6H 2J21A 3VXSD 3AQXA 3EOTH 2C9QA 3UTSB 3NCJL 4GRMB 5IF0A 3FUMA 1LE9B 5JW4R 2X4PA 4HYTB 4U1LA 5H4ZA 4GXUM 4LLWB 4YHOH 4CVZB 1GGBH 4G7VH 3X3GH 3AMLA 4LL9A 3UG4A 4UDTA 1B2WL 1E3XA 3RN1D 4U1JA 3JV6B 2JCCA 4PGBA 3PHQA 3EADA 3P2BA 3GSOB 3CTTA 3QNYA 4TSBH 1CXHA 3QJFB 3QEUA 2DY2A 3IDYB 4FEMA 3UTQA 4ONGH 3Q5YA 3REVA 3FMGL 4AMZA 1O6TA 1MCSA 4G9DB 1Q9KB 5F9WC 4DO5A 4UTAL 5IT2L 4XPTH 1LDPH 5THAA 5DEFA 1WCBA 3CLFL 1USZA 1DUZB 4M5TA 2FL5B 5DT1H 4IKIA 1FFPA 1NBZB 3QCUH 1KYAA 2X6CA 1JJUB 1IT9L 1DQLH 4GG8A 1WFMA 1EQWA 4FXGC 5GZNA 5GZOA 3L3OC 5INCA 2XI9A 3ILQC 1D5MB 3NJJA 3BH4A 4KZEH 15C8H 4GAJL 2X2JA 4AMKL 3DX6A 5LWYL 2HJBA 4YHPA 3BMWA 2B15A 3N0PB 3OKEA 5C2BL 3FRPG 3TL5A 3VDAA 1NIDA 3TVMC 5F0JB 2PXYB 2VR9A 2GUOA 2FX7H 4B9JA 4OLXL 1XR8A 1P53A 3GNMH 5DTFB 4B41A 1IB5A 2KPNA 1IC1A 4NQDD 4OCRL 4A08A 3MJWA 2C9PA 1YN6B 1BD2D 4GKOA 1IGJA 2GTWB 1KB5H 3BUQA 3LKPB 1IGTA 3EFOB 5JLZB 2AQPA 2FX8L 2V7NB 3D39D 3KPRD 4AQ8C 3R0MA 4X6EB 2A9BA 5DRNA 4J39A 4S1DD 2QXVA 2EZ0D 3MPCA 2QC5A 2OM5A 2R2BA 3EGXB 1MWAB 3A24A 3VFOA 4DO6A 4J0WA 3IJEA 2A73B 4FFTA 3W9DB 4N0UA 4A39A 3ZDWA 4MAYD 4JFYA 5DMYA 1I1YB 1KIUA 2MKWA 1QFPA 2J8HA 4G6AC 1JERA 3NFNB 1FLRL 1WAAA 4YEFA 2J5LC 1PQZA 3L3HA 2AJZA 3CPLB 3QA3A 4XXDB 3MOBL 4DN3H 1ZA3B 3QUYD 2PNDA 4UM8A 4EF3A 1BFOA 3GJFK 2B59A 3ML9A 5DJAA 5EPMA 2HU7A 1CFNA 1BVKA 1E28A 2BOCA 2Y7QB 4N28A 4E9XA 3F6IA 1LNUB 3L3DA 4ODHL 2D7TH 3SOBL 4OCXH 4XCNA 3WUWA 2XTSA 1ES0B 4PW9A 5CEZH 3G6DL 3K1KC 2CNZA 1DBML 3OM3B 5DQ9B 2C4FT 3LSOB 5IVZA 1U95B 2HXCA 2AGJH 5AWNH 3F6JA 1OANA 4JG1H 3SQBA 1CDJA 4U1GC 3RX7A 3Q5TA 3IKCA 3LY6A 5D1ZC 4YLBA 1KULA 1KCRL 3IJYB 3KPSD 3F7KA 5DMKA 1EZSA 2R39A 4M3KB 5E0QA 2HLEB 5EB9A 3VH0A 5I2IA 2ZYSA 1K6QL 2ICWA 3SO3C 3T6VA 1W6LA 5LQBH 3ZE2E 1M3IA 1S78C 4G7RB 4FRWA 3DV4B 2AFNA 1S9XB 4Y5XA 3ARGC 1BBJB 3D4CA 4WWPA 3SGJA 4N14A 4AN1A 3CZGA 1A9BA 2GSGA 3KM2A 3ZY7A 4K7PY 1G7PB 4YSAA 4YHKL 3FPXA 3KCPB 3EI2B 4O5LL 3ULUH 3HB3B 1MWOA 3WNOA 1C7SA 2QDVA 4NQXB 2JIXA 4HWEH 5D2NA 4X2UA 3RKDC 3SKOB 4YHML 4E0RA 4BRJA 3RGBA 1R19A 3VFRA 3ZTEA 4FTVE 2DBLL 1IGFL 4ZUTB 4CU6A 4TSAH 1NGQH 2VIRA 2OTWB 3ZK0A 4EZKA 5K9JL 1WZAA 3FB5A 3DX9A 1LGVA 1P84J 3KPNA 3JWOL 5C07B 1EO8L 3BKCL 4YHMH 1JV5B 1E4JA 2SEBA 4BK5C 2V5MA 3T8XA 2IV9A 1XF5B 2GEEA 3FF7A 3LKQB 3ARBB 1V8HA 3V4LA 1JCKA 4IRJC 3TT1H 1A66A 3WMSA 1A5FH 2ZG3A 5E6IA 5B7FA 5IK3B 5HYSG 2AJXH 3CX5J 2AKRA 3FTZA 3IDNB 3F3FA 3RY6C 2J72A 1L7IL 4P23B 43C9A 2R29A 4NYLA 2AGXA 4ZO8A 3GINA 2G5BA 2C3HA 3W0WE 1YEEL 1ZHNB 1XGTB 4ZOAA 1EMTH 1NC4B 3H4HA 2HLFD 4UBDD 3V0JA 1GCFA 5DJ0B 2IH3A 4L9LA 2DQFA 3I8CA 4XMTA 4YBHA 3RNKB 3IDXL 5IW6A 4JJ5A 2ZICA 1SBBA 3HI5L 3CU1A 1OAUH 5F7HA 2BP5M 2QADB 4F93B 3E0CA 1JE6A 4PJCE 5AW0B 4DP1X 2R0WH 5FB8B 5IB4B 1OAQL 3C8KA 3VQ2C 4YDLB 4I7ZC 3KLHD 5JQ6L 3BZEA 5EEVA 2ZCZA 4I9WE 4MD0A 2PF6A 1JHKL 2B5MA 1T22B 4N1EA 1EFXD 1C8PA 2JLPA 2B5IC 3VXNB 5CEZE 5E00A 3ULUC 3C5ZD 1VF5C 2BP3A 3L4CA 3TNNB 2C9AA 5I8EA 3CLWA 4XGZB 1ACXA 3LKRB 3MTRA 1T0PB 5IJCC 2GIMA 1PDKA 2OAAA 1MDAH 4QXTA 3C60B 1HILA 4NZRL 4P9MH 2YRPA 4I1NB 4R0LA 2OSXA 1LEGB 3LB6C 1DDTA 4M1GH 1CGYA 4HMEA 2DW5A 3CVHB 5EF0A 3WIFB 2EXWD 1BZEA 1F2XK 4TQEL 4YHIB 5KBLA 3LV3B 5HXMA 2NYYC 5DEZA 1ZT7B 3NEOA 3PU7A 5HDLA 5KSAC 4GSDL 2P9PC 1J8HB 2LR4A 5C8JB 2UVEA 4JQVC 1HH9B 3JWOC 2C3VA 2ITCA 3DJZA 3KR3H 5JW4M 4C4KO 1JWMA 2GHWB 2B1HL 3D08A 5D70H 1AC0A 1AH1A 2P9IC 2IANB 3L8QA 3IJ9A 3J2PA 2YD0A 1I9EA 3L2NA 3TBBA 1YUHA 1J05B 4H0HB 4N86A 2AJ3A 1OF2A 1PFOA 1FP5A 3QDJA 3D8MA 5I75C 1BA9A 1QR1A 3WL9A 1H9DA 2E7HA 3ULUE 1MCEA 1NCTA 2BY3A 3UZEC 4H1LA 3ZE0E 3WFCH 3RWEA 1KJ2B 1WBZB 4W9DC 3ARDA 5EM2A 2P8MB 4LPWA 3RVXC 1DQJB 2FQFA 3VRIB 4PJ5E 3TZVB 4YXHH 5K9QG 1KGCE 3K3QA 3L5JA 1QPXA 5AAMA 2I69A 3UCQA 4Z7WB 4GG6F 3Q2CA 3ES6A 1HL9A 2FWSA 2EIJB 3FQRB 4M03A 3WHE1 1L0YA 3IXTB 3SGKA 4AE1A 4YSUA 2VSMB 3C99A 2KPWA 4J79A 4LCVA 1S9WB 2Z7ZA 3TJEL 3O41B 5DD6B 2CBTA 4MA1C 4ZZFA 4PGDB 4Z23A 5ID1A 3QH3B 2Z34A 4R7DA 2EDOA 4XBPA 3BG1A 4IGBD 3PGCA 4KHXL 3J07A 2BCJB 2NYZA 5IV2B 4NEHB 2GKIA 1OAKH 4QMEA 3EFFA 4POZC 3PV6A 3T2LA 5FA3A 4LT7A 3QE5A 3BZFB 1MQKL 4XNUL 4XH2A 2X4SA 3U7WH 3IXAB 1ZRUA 4H8VA 5D7JB 2DH3A 3IBOA 3IDMA 4IK6A 2BFVH 3S88L 3NIFB 3GJFA 1C08A 3HNTL 2G2PA 5MI0B 5JTWA 2VWEC 3BPOB 1PG7H 4X0KB 2HVJA 2LOEA 4GAGL 3T6QC 2EECA 4JSPC 1BJ8A 3EYQD 3L9RB 3NQIA 5D7IA 3QG6B 3BSZL 5I30H 1E5ZA 2XTJD 3MFFA 1FC1A 4RBPH 3PXLA 4F9LC 1AI1H 2W95A 4PD4J 2XCMC 4GQPH 5FKTA 4WEEA 2I60L 3LJ3A 4AUUA 5HD8C 3TA3A 4D7BA 5BO1H 1TOXA 1MCOL 4GKSB 5CJ5A 2COVD 3WHXB 3HS8A 4ZFGL 2ITFA 2VDMA 4FFVC 5ACZA 3TF7C 5T1KA 2XJKA 4YDNA 3H6JA 3GSVB 4A2GA 1EHAA 1K2DA 2Y4SA 5BRQA 4D9LH 3RDTB 3JPXA 4JO2H 2WNWA 3IN2A 2XBTA 4PTTB 2JB6B 3VH8B 3MUZ1 1NFIB 2P9SC 2JKNA 3HPJB 1LO5B 5LNDA 2WLKA 2GTQA 1BXUA 4K3DH 5GXIA 2Z92B 3DK0A 1P9MA 4OFPA 4L5FH 5I8CA 1EEYB 1X9RA 1K8DA 2OMWB 4LIQH 1YDPB 2HTLD 2VLRB 2NX5A 2EO9A 2E4FA 3RL1B 1D9KB 2VLJB 2CM6A 3QUMB 1KLGB 3WS6C 5CJOH 1JNHB 2VWEE 4YL4A 1NDMA 1MG3A 1A6VH 2FO1A 2DZEA 1B9XA 5D5MF 2RFXA 2CR6A 3MRHB 5DS8A 1OM3L 2BVQB 3LEVL 4PRPA 3QQDA 1K4CB 3VSUA 1HQ4A 3FT3B 3BUDA 4JB9H 2YA0A 1WT5A 2R56L 1VGEH 2N01B 5DHVH 4HUXB 3TEYA 4NFCA 3WKML 4MNHB 5GZND 5GZOD 3KXFE 1P4BL 4CJ1A 1AMYA 4WSJA 5DZVA 4OFVA 1PSKH 1XBDA 3DSNB 3Q2NA 4YBQD 5DUPH 4ICWA 3DIDA 3U4BL 1IUZA 2Z7WA 3D12B 1BPVA 2Y7MA 3FU9A 1U8LB 3MBEA 4WK4B 1NCDH 4XHJD 3PP3K 1KPRB 3OJMB 5FYKL 2DJUA 4HEPG 3N55A 5CKAA 4JHVA 2CO7A 1WEJH 4FP8H 4HAKA 1UD2A 2FJFB 3GRGA 5FWRA 1EZUA 3N1GC 5B4MD 4QAMA 4B9CA 3N0AA 4TOYH 4ES0A 4LCCB 2XQBL 3KYKH 1ZK5A 3RZCB 4CKQA 3D3VA 3E6HB 1FZOA 3HC0A 1U93A 2LU4A 4MX7B 5EZJB 4K5PA 5AD0B 2XPGA 2HLAB 2RB8A 3ZJAA 3GZOA 4JUTA 1G9EA 4NQCA 2HMID 2AEQH 3TBYB 3IUMA 1YEIH 5DMJB 2HAZA 3WO4B 3UFIA 2IMNA 2X0WA 2I9TB 4QRJA 1A6WH 1MAMH 2VDPH 3GZPA 4E41D 5IQ9A 2IBZY 1S7WB 1JGVL 3MO1B 4TUUA 2MCG1 5FO9A 3WNLA 4XPGL 4X80L 3K72B 4GRLC 2HJLB 1JZDC 4K7FB 4UQ3B 4J86A 1XVSA 1ZMYA 5IJKA 5EEYA 1FC2D 3Q1SH 1JI1A 3ELAT 4MMXB 2VMFA 4CVXB 2YC1B 3WS3B 2WBJB 2F7QA 2VW7A 4KMTL 3WTYA 1HKFA 1WA2X 4NJAH 4JCWA 1E0OB 3UJTL 4MD5B 3AXLA 4TRPL 2Y5QA 4BZYA 2YPKB 3E2HC 4ZTPH 1COBA 4LSSL 2BP0B 5IFHL 4LIQE 4ERSH 5E9DE 4XNQA 5TJWK 3ZTDC 2OMZA 2OTPA 4WO4A 1GJIA 4RX4A 4HJEA 1J10A 3AS0A 4G5ZH 4XZ4A 1UUSA 1CI3M 3QI0A 3KYAA 3WXVH 4Q4EA 4HUKB 3N50A 1RVFL 2IG2H 5DCCA 3Q9QA 2L4OA 3T3MF 3GUTB 1X5FA 2ZAGA 5A2IH 1GYUA 3OKLA 2X87A 3SE3C 4K2UH 3VE0A 1T7VA 2J6EH 2LU5A 2CM5A 1L3NA 4FE9A 4XMKL 5HI5C 5JW5B 2FECI 5KYYA 1HTYA 4YFDB 1A21A 1U3HB 2OS7A 1KCSL 2MRYA 3S3PA 2CUAA 2IPTL 2JIXD 5BQ7A 4AVJA 4NSKB 5E5RB 2AF2A 4Y4HC 1JRHL 2C5DC 3FU5A 2F6AA 3U9PH 2CE8A 5CMAA 5TK4A 1E4HA 5GSRA 2AQRA 5FFLA 1ACYL 1S8DB 4JRYA 4QPEA 3D2TA 4X9HA 4RVBA 3CVBA 5A3ID 2R2EA 3M1CA 4QOKA 3TNMB 3LRGA 4DVRL 4JMNA 5FA5B 5GRYA 1KTLB 3FH7A 3MXVL 4F15B 5TDOA 2P7TB 5JMOC 4Z8LA 2VLLA 4YSOA 3CUPB 3HAEG 5TFSH 5EMMB 4KTYA 3QEHB 1HKLL 3BQUB 5E6ID 5D1QC 1F90H 4DERA 3GIVB 2IOMA 4C54A 4KRPC 1C5BL 1BFTA 4HIEA 2I27N 2YPLB 3ABZA 4IBYA 3VMPA 4L8BB 3TN0D 2XN9E 4J3TA 3LNHA 5CLTA 1ND0A 1HOCA 2RTTA 3II1A 1U30A 1I7UB 1ONQB 4LVEA 5DJCA 4GW5B 1XGRB 4YGVA 3VG9B 4EJ1C 2XT1B 2AS5M 2EE9A 1RULL 1ZIBA 4XP5L 3FL7A 2CD0A 1DVTA 4PVBA 4K3JB 4KI5D 4S11A 2QQLL 1Q0EA 2VDLB 3EH5B 3S2AA 4OV5A 4CKVX 1E6OL 4Y5VC 2ZCKL 3T8VA 2Y2TA 4HHGA 4U6TA 3LKNA 5EEZA 2BRRH 5GRZA 1PNCA 3EI1B 1R3IL 4R8WL 5J1TC 4U31A 1I1FA 4TNEA 5GHWL 2J88L 5D1QE 4DEPB 4J3XA 2CUHA 3HC2A 2HYMA 4Y2OB 3L1OH 2H14A 4D0DB 5DYFA 4M48H 4OT1L 4G70B 2CGYA 5CHNA 4UANA 4BZ1A 5B8CC 3PWJB 2QKIC 4F8OA 1JPTL 2Z31B 3DX7A 3CFCH 2M2DA 4LEXL 4LLUB 4OGYH 2WXNA 5DEGA 2NRDA 2I26N 2BW5A 3ARXA 1HCZA 5EBLA 1KEMH 4X98A 1PZCA 3ESOA 3GSQB 1A7OH 2A1WH 2QV2A 1UJ3A 1UACH 3EDKA 4QGYA 3W3BA 4JT6C 1TKWB 1L6ZA 4NQUA 3VD1A 3TH3T 3RVUC 1FJ1B 2RQ8A 5HGHA 3UAEA 4J23A 2XV6B 4ZXBB 3NVXA 3QDJD 2H1XA 3GC3A 4GP8B 4CC0A 4NRXA 5I9QC 4PV8A 5C3IA 1DTUA 1K8IA 4PXWA 4EUPB 3ARDD 3VG0H 4AJ0A 4TNWF 3B2UC 4G80A 3WELA 4MASA 1P1ZA 3SDDA 5GGRA 5F7AA 2C4XA 2X05A 4UT6H 1R17A 1CFTB 4PS7A 2F58H 3KPOB 4MNGA 4HHWA 5HHVH 3UACA 1YMHA 2CK2A 4J3UA 4EDWH 2F7RA 4IOIA 4TVSa 2RCSL 3HZKA 3WBDA 5DVNA 3MRIB 1HIML 4L1BA 3D06A 4MQ7A 1GOGA 1W15A 4ALAL 3TT3H 4DZBA 2EYRA 3DJTA 1WBXB 2R7EB 3D2UA 1DUYA 4F37F 1T0MB 1IFHL 2P28B 3FTWA 4XVOA 2D7QA 3B2VH 2H26B 1RZKH 3LAFA 2E27L 4H7VA 3FNKA 2WYIA 3MUGB 4FQJH 3U6RA 5CXBB 5H4YA 1EAOA 5TQ2H 2DLFL 1SY6H 1VRSA 5HYEA 4GM8A 2IXQB 5EEUA 4DK6A 3DX0A 1XD0A 4ZO7A 2G9AA 2F68X 3ARUA 2Q76A 1VZGA 1KLUB 4WFEE 1JXKA 1U8OB 3Q8CA 4PTUA 1H0DB 2CBQA 5SWSB 3H9SA 2OK0L 1JNNL 2EILB 3OC5A 3SPGA 4XNYL 4HPYH 5DZPA 1AXIB 3RWCA 4ERQA 5LGHL 2OL3H 4JGJA 3P0VH 4ZMLA 3THML 1C16A 5T1KD 3RWIA 1KB5A 2KH2B 2XYCA 1CG9A 2A7BA 3O6MH 3BEVA 4ZOXA 4ACTA 2W80C 4NN6B 2LT9A 2WUCH 1ZPUA 4NC1E 4P2AA 5MERA 4N0YH 4CC9A 2CIIA 1OTSD 3WY4A 3CH1A 1PD6A 3L45A 3LDBC 4FD0A 4HF5H 1A3QA 4BQ6A 2FJGB 3ECVA 2WJ5A 2P8PA 2YQ3A 1GR7A 1W0YT 2NX5D 2ZNWA 3D30A 5TE4L 4OFDA 1H3XA 5DO2D 1DVSA 2Q3XA 1VE7A 3BT2H 1J8RA 1WWWX 3BZ5A 4H20H 4OZHF 4ZMZA 1GGIL 1AGFB 1FI8C 2MCPH 3ARWA 2EKSB 2WLYA 3MREA 4JRFA 4ORGA 5FDYA 3VXTA 2XV0A 3DROA 5KYUB 1N6FA 4QRBA 3RVVD 4PRNA 4HALA 4AV4A 2F8IA 4PRPD 4BK5A 5HYJE 1X5HA 1B3JA 3ZO9A 1GJWA 4M00A 5HDRA 2FGWL 1MFDH 1QLEH 1I3RB 4IRJA 4C55A 3B6SA 4JPSA 5C0JB 1RURH 1IAKA 1MHCA 4ALAC 4BSVB 1YEHL 4IKKA 4E5ZA 2AJVH 1VESA 1KV7A 4G9FA 4W9IC 5HHQB 1N5AB 4ODXA 3O6FB 4O1QD 1F4WL 3AC0A 2NY3D 1MJ8L 3AABA 4V2CB 2X4RB 1ZLWK 1NBVH 1JGIA 2VC2H 1D5BB 12E8H 4ONHA 1S7QA 3V4PH 3MBED 3BCFA 3REWA 4BEIA 1AKJB 4KNSA 2V17H 3MU3A 3DVGB 1JXFA 2G5UA 4NUJB 4DP5X 1AQMA 2OW6A 3F00A 1FGNH 3T2NH 1UOQA 2D3NA 4PJAB 4FFYH 1YQVL 4Q2ZA 5DQJA 4M6MH 1HSAA 5J11C 3H2QA 3HBQA 3IDUA 3WD5L 3D3VD 1QKZL 1XGYL 2ZX8A 2NMSA 5K1JA 1X4ZA 1G5AA 1Q90A 3NJNA 1SQJA 3ZZQA 2W0FB 4G8IB 5F89B 1MH5A 1BECA 4PUBL 1EANA 2W07B 4NQCD 1XBRA 1WD9A 3PGDB 2AXJA 4EQ3A 4PRIA 2WGNB 5EMLB 1J12A 4KO9A 4PJ5A 3UMNA 3VFUB 1CICC 4B6ZA 4ERYA 2YD4A 5BCAA 2W0KA 4RDQG 1MREH 4HUWA 5IUCA 4AYEC 2E7LC 3A6BH 3FSOA 1ACCA 1WH0A 2LAGB 3DARA 1GSMA 1LEIB 1MW3A 3IURA 4FLRA 1JHTB 2I32A 4A7UA 1G7JB 4L0ZA 3MLVL 2HG0A 5KSAA 5CBEA 1I1AC 5FF6A 2W18A 1WFIA 2XBDA 3TWCL 2P45B 5AKSA 3VTTA 4FABL 3MRKB 3NIFF 3TLRA 5BRZB 3S5LA 3N1MC 2BS8A 3I3DA 3UTPE 4PY7A 4FF9A 4QY8A 3HJ0A 5GRWA 3WFEH 5DJDA 3TEUA 5T1LA 5CEXB 1JTDB 4N2LA 1G9MH 2CLRA 2DJMA 4JMXA 4UQEA 4W4OA 4ENEC 5EWIL 3Q6FB 1HNYA 5EUOF 3O3BA 3NIGF 1TTCA 4B0MB 1R47A 4MDIA 2PCYA 1CZ8L 1VZIA 1JHLH 4RX4D 3ROLB 4M4RB 4XO8A 1ZTXH 2MQ3A 4QTIH 2XWDA 4R83A 2G0KA 4UDUA 4DQOH 1IAMA 1M9WA 3KPLA 5D5ME 3BAJA 4KDWA 2XUWA 2IAAC 2ROYA 2XQ0A 4RFEA 3K80A 2H9GB 4L9DA 5I66B 1T4KB 5ICZA 3SLED 4N5ED 2WO4A 1PIFA 1YEFL 5IMOA 1E7VA 4KK5D 5EZLA 1FVDA 1QNIA 2VABA 3CVIH 5IVOA 4U7AA 1A4CA 2F61A 2I9LA 2IWEA 4ZZKA 1Z5YD 4TPRH 1MDAA 2IDUA 2EUZA 4FFZH 4L0PB 5CCKH 4OZGF 1CFVH 2XWEA 1L5GB 1BYPA 1D5ZB 4S1RL 2FYVA 1XO8A 5KYNA 3F58H 1TJIL 5C0EA 5EN2B 4OI8A 4WJ5B 4C83B 1L9SA 2WVSA 2DI8A 3WEMA 2XIIA 5CILL 1GTFA 3KJ6L 2Y1ZA 2VR3A 4N2KA 5F9AC 2A83A 4WRLA 1HINL 3OL2B 2K4AA 3CFDA 3LS4H 4HIPA 4UCFA 3VXUE 3ZDXF 1RJCA 3WNPA 4ODSH 5EOTA 5HYFA 3ZZSA 1SM3L 4RESB 3IAGC 3G5YA 3PRZA 1QHQA 1QBLH 3EHBB 3EJUA 3WENA 4XVTL 3DTXA 5F6IC 3O3DB 1G7IB 2IUPA 1YEKL 5CJBA 2FGZA 1W8NA 2DMKA 5JQHC 2DDQL 2ROXA 1YYLL 4H2AA 1JD9A 3QDAA 5AYTA 4FOMA 3QWNA 4WNJA 3AWGA 1LO2L 1NJ9A 3BYTA 4GSUA 4M7JL 2B5NA 5FHBH 3L08A 3RJDA 4GQZA 1IM9A 4LCUA 4QXVA 4N4YB 1MWAH 4XTRC 4L8DB 1YHPA 3CDZB 3HNVH 3Q9PA 4APXB 3V6FB 2WTPA 3GKWL 2HFFA 4QHLB 4B0MM 3WS6A 4KDVA 3BLPX 4JM2F 2AQ2A 1SMOA 1ZE3H 2PO6B 4WCYH 3SIKA 1IC7L 4X6DE 4CI8A 3MRPB 2JKIS 2ZUWA 1C5DA 4R3SB 5LDUA 4XN4A 4DOHE 3IDYC 2G3XA 3I7PA 1JG9A 2G60H 3BIKB 3TV3H 3UX9B 2DQEH 2OSYA 2VM9A 2DQJL 2VOTA 4G59C 4HOXA 3VA6A 4YZWA 2X6VA 3UYPA 1DBBH 1VFBB 3BVNB 1FZKB 1UXSA 2BNQE 2BNUA 3ILQD 1EJ6A 5GSVA 5DUML 4A6YH 2AV7A 4U1MA 5KAQF 2BIIA 2AZUA 2OXHB 2R2HA 3GRWH 3HFMH 2IH9A 4OIIH 4CU7A 3VD2A 3UTSE 43CAB 2JMRA 1HZHL 5LG6A 5EU6E 2JKSA 4BFRA 4F7PB 4AYGA 5ERWB 4OCLC 1XQ4A 4WKZA 5F3BB 4UV7H 3S36L 4YOKA 4MB4A 3CC5A 4IKLA 2WSPA 4XB7A 2CLVA 2PXYC 4AC2A 4HAGA 5IHHA 2H6NA 4A0AA 1ZANH 4X9BA 4TVPH 3S3JA 4RMRA 1I8IB 4MJIB 4OLUL 2X41A 5FKPB 4G1EA 4F8LA 5JHDB 5KVGL 1SJHA 1WSST 5DZLA 2BOBA 2HT3D 2P26A 4R96B 4FQCL 2CRZA 4BKSC 4YO0A 4NRYA 2OMTB 4F80A 3MR9A 4MRCA 2AQ5A 4ELMA 3FH8A 3WDHA 3SDDD 1LE5B 1TFPA 1L7TH 1O9WA 2YD6A 4V1DB 5I5MA 2R0ZH 5M95B 4G6AD 2C1OA 2CHXA 1K5NA 5E9DA 1M71B 3G5ZA 3GMNA 3STZB 1KV3A 5C0GB 1A7RH 3MRGA 3HHRB 1KN4L 1F11A 1ASPA 1ZE3C 4ZMQA 4KX8A 1ZLSL 3I6GA 1F86A 2P49B 3GF8A 4NKOB 3D2UD 3D0VB 1UTDA 5EOCH 2WUBL 2W65A 4FQ1L 3AG4B 1A4JA 3D69A 3AITA 4FAVD 1MCHA 2ID5A 4ANXA 1QRNB 4JFEA 5DHVA 3IJ1A 4NT6A 4UYPA 4P5KA 3RI5F 1YCSA 1D2OA 3KYNB 5KBNC 4RSVA 9CGTA 3MYJA 4ZMVA 2NY7L 2Z4QB 1FBIH 4FTVD 1MCDA 3TPKA 4CZXA 4X3EA 4Y5YC 5AOZA 5D1ZD 1SJMA 2LU3A 3O3AA 3U48A 1EZVX 2Z4TA 1BJMA 5D4IA 3MV9E 3QXAB 4MZ3A 4DGVH 3IFNH 5EU3A 3WNIA 4J0XA 5FV1L 4MXVE 4BL0A 3NZUA 3BWSA 3WSQH 1V3KA 1N59B 2X1OA 2WYZA 4JY6A 1HL8A 3QUZB 3AACA 3P4MA 3JXAA 4LCIL 4YHLL 1S78D 4PNKB 3EO0B 1P5VA 1R24B 4JFXB 3DJSA 2QELA 1I9RH 4QRRB 1A7QL 3GO1L 4Z7OB 1JGLL 2XN9A 4LARH 3ULVF 1QBMH 2VXQL 4X5PA 4QNPF 1B9ZA 1HHHB 2OI9B 2I07A 4DP2X 1AQ8A 4ORZC 3O4GA 1J8KA 3RKDD 2X9WA 2CUMA 1TYQC 1NGWB 3FQ2A 3QXTA 3ABKB 2J2ZA 3HB3C 2VDPA 5L88H 2OBGA 3NCBB 1X9UA 5GGVH 5HHPA 4FI6A 4PCKA 5JDSB 2Q8BL 3GSUB 1DVYA 1T7YA 3L5XL 3TJHD 4N8VA 2UZXB 4HBQA 4K7PH 5F1NB 1CBVL 1U58B 3KBPA 4IRJD 1VSCA 1H6FA 3CVHH 1HK6A 2J4WH 5CEZD 2I5YL 4P5TA 1G7MA 4TVPE 5D1QA 5AW3B 1Q9WA 4JQIL 3RRQA 2YQ2A 3KVPA 2D8KA 4H0GA 4U1NA 5KJ4A 3V5DB 1OM9A 3ARBC 3FU7B 5ALBL 2GY5A 3M88A 3DGDA 2VKXA 3MCLL 5A2LH 4IRZH 4LFHG 3BXNB 4LAJH 2WK2A 1I8UA 3BLKA 1I3GH 3WKNA 3LEXB 1TO4A 3WXWL 3ME0B 1Y6MR 4ZSOB 3LMJH 1KUMA 1KJ2H 2D7PA 3GLAA 4Y5VA 2RGSA 1MCLA 3P9MB 2GAZA 3ZDZB 2OVRB 4N2AA 3M1OA 4KV5E 3ZZ1A 3RFRA 2QADC 1DCLA 4GW1B 4J8RB 4X7EC 1OSEA 2J6EA 4J1UA 5CWSA 3ZUCA 5EO1B 1HEHC 5C07E 2YMTA 3ULUD 4YDLC 4OLEA 5ILTH 2ZG1A 4AOFA 5I73B 4FQQB 2OX5B 4F2EA 2NNAA 2DMCA 1MG2C 3F65A 3L5HA 1MFAL 4GBXA 1B0GB 4MKTA 4PRID 4PJ5D 5FIEA 4UQCA 3WFHA 1KGCD 3MMEA 1ZPLA 4ZMAT 2GHZA 4HZAA 5DJ6B 4Y5RD 2FIKB 2C26A 3O2WL 4APQB 5LNEA 4AXWB 3C60C 1CDIA 1SFHA 3VD5A 2JJTA 2YSSA 4LU5H 3AW5A 2EDFA 2J43A 1VEMA 4P9HL 5A40E 1C8QA 4A2EA 5KSAD 2B4CH 1YFQA 4M8UA 1YMMB 1UOWA 2KZBA 1T7XA 3AGWA 3HMWH 4OF7A 4ZFOB 3VFVA 5HP5A 2E3VA 4FQXA 4KFMA 2PR9A 2CO6B 5ES4B 3UBXI 3MVDK 1S7RA 5F6HJ 3MHZA 2WLIA 3HAEH 2UZIH 3GBML 1P5UA 1Z5LA 3QDGE 5T1LD 3CMOL 1NPJA 1BG1A 1IE4A 3BVTA 2X70B 3A3YB 3MRRB 3QZWB 3H9HB 3FB7A 3HPLB 5HDBB 3MJ7A 5DHXB 3FO2A 5I19L 4L3CB 3FN0H 3OKDA 1CE1L 4RMBA 3EG6A 3FFDB 4AVKA 3SKJL 5E4EB 4NNYB 5M5UA 3RVXD 1XGUB 4QXWA 4R7AB 3KM1A 1MJ7L 2GC4C 1P22A 4LBAA 3EU7A 4DAGH 5KYWA 2Y23A 1OAYH 5DGRA 4PQXA 5AVVB 4WWNA 3FB6A 2IDTA 2MOQA 2X89A 4K15A 3P4FA 2ZP8A 1AGBB 4L4TB 4YUEL 5J5EA 2Z65C 5EOQL 4KXDA 1JGEB 1VFAA 4FQ2H 1R5IB 2ZKMX 3SDAB 3QUMH 2WLHA 5AL0A 3IU4H 4P5SA 2R4SL 4H8PA 3VXPB 4IM8A 1BCIA 2XV2A 2YA2A 4U3SB 1QOKA 4AYDC 5B38A 1J8HE 1EDYA 5FUCC 3SBQA 4FKKA 4ZNEA 3GM0A 3CFIC 3RWHA 4M61B 5JWZA 5F9JA 4HHAA 1U8NA 1TU2A 4DGIL 2O5ZL 3V6BR 3PE7A 1SEQL 2IANE 1KTRL 4XRCB 4GIPD 3DXAB 3UVMA 4U0RB 3CZFB 2EDTA 2NUPB 4HUMB 1MLCA 4C56A 3U2SB 3NH7L 4LAQH 5ETUA 1Z66A 1F58H 1I7TA 1CPUA 2CJSA 4NHUB 5D7JC 3NJVA 1E40A 4Y9BA 3KLKA 1I3UA 2GYSA 1S2EA 4DKFL 5HYJA 4NAAA 5MI0C 4MFHA 3U0TB 3BPOC 1CJYA 5HD8D 5CP7A 3UO1H 1T5XB 4P9HC 2XWBA 4Z7WE 5IWLC 4FFVD 1P6AB 4Y1AB 3KXFD 4FA7B 4ISVB 4FLOA 2B4EA 1BWWA 2HKFL 32C2B 3D34A 4EI5B 3ISYA 5GS2H 1YY9D 5I0YA 3RDTC 1IM9D 5HHMD 1D6EB 3NRFA 4UT6A 1VFMA 4AVHA 1CIDA 1ZOXA 1HC1A 1NAKH 4CZVA 1XAUA 2N4IA 2YK1L 3VM5A 5FKAA 2AEPL 5I5IA 1RSFA 4WU7A 1XCTB 2X44D 1EGJH 3PWUA 4FNSA 3MKGA 4XNMB 3NYKA 4BXVA 2X5PA 5TF0A 1LO0H 4KX7A 1H8LA 4EBQL 3G3LA 1D9KC 1PEWA 1NKOA 3N41F 3V0AC 1RUKL 3E1F1 3EUDA 2JWYA 2R1XA 3MNWA 2FSEB 2WCSA 3ASOB 1TTFA 3F84A 4Y2DB 4BV1A 5TF1L 5FHAL 3D09A 1CXLA 4HJIA 3L5WB 4QYOB 1NUGA 1E4KA 3K6NA 3NQKA 5L2KB 4XNAA 4XVUC 4UTBH 1ADQL 3JTTA 5HYIA 1SY6A 1U21A 4X5WB 1DO6A 4JO3L 3Q06A 4KJYA 3NZHL 1ZSDB 2YIHA 3CSYA 3INOA 3WIHH 2Y1AA 1H8NA 1AXTL 1KBPA 2OJEB 1NCNA 5FUOL 4CC4C 3NTCH 2ADYA 4ZUWA 4PREB 1T21B 4PJIA 2VL4A 3D51A 4K23H 4P05A 2OL3A 1F5WA 4BBWA 1CXFA 3FRPA 3KH4A 3GMLB 4L8SA 5AEAA 2VLRE 2DD8L 1MNUL 2QQNL 2UY6B 4OZIB 1YJDL 1RFDH 3EH2A 1VGKA 1RP8A 2VLJE 3UEQA 5AB0A 1RZIA 3P77A 2HG5B 1TQUA 5EC1B 1EA9C 3S3BB 2VZOA 3WJMB 4XWOC 1TYEA 5TDPB 3X13B 4LCCC 3PABB 5CD3A 3RZCC 2R9HC 1T4WA 2WXKA 1FYTB 5CU9A 4ZDHA 3K6SA 4DGUA 2ARJA 4FYTA 3QJXA 3EQ9A 2EXTA 2ZOTA 3H55A 3NSJA 4XPAH 5E9DD 3V5WB 5L4MA 2BVOA 3U9UB 1UM5H 1INDH 2XKNA 5EV7A 2G0LA 4NPYB 2QFRA 4LP4A 4Q52A 3U1PA 2VDRL 3N85H 4M4PA 2KL6A 4L2LA 5CZVH 4WEBH 1DBAH 1GZQB 1CU4H 4CGUB 4XODA 3WO4C 3FBQA 2APXA 2YD1A 1F13A 1QUPA 1YNKL 3AB0B 4ENZA 4FHLA 4DZ8A 1NGXB 3IULA 3QZLA 2GABA 2DQTH 5L9DH 3WN5A 1X44A 3LXCA 4JFED 3TPUB 1RZPA 3QHFL 4NQDB 1GC1H 4FQIH 2ENYA 3ARQA 4DGYL 4QKTA 4YNYA 2J8UA 2FHCA 3QAQA 1FN4B 1EX0A 2ADIA 1INEH 2EACA 1XH0A 3G5WA 4N3UA 4TYUA 4N9GB 2HT2C 3V5HB 1RU9H 3D39B 4U2ZA 1U4EA 1A6AB 3U9WA 3ZYJA 1A6ZB 1KJVA 2C3GA 2VC2A 2EE6A 1OWWA 4MMXC 3SBWC 4GKZA 4ZQTA 1NLBH 3QUKA 2WBJC 4XAWH 4K5NA 3V4PA 4MA3B 3NJMA 4JM0A 5FGCB 1NDTA 2AQSA 2F7OA 3K4ZA 1HFUA 4YLQT 3PNWB 2GIXA 1B9KA 3BLBA 3FQXB 4GXVL 4K3JL 4L3EA 3I7LA 3ULVL 5EARA 1KIQA 2V7HA 2VDLL 2QLVB 4QJ5B 3FCSB 3VD9A 2ENPA 4EI6B 4FFYA 4MS8C 4NBYB 4LQFH 2FYYA 4KMQA 1JK9B 3VXUA 3IPBA 2IEPA 4R4BB 2IAAA 4O51A 1MCQA 5BOPA 2XN9D 1GGUA 3QQ3B 4O9HH 1FAKT 4TXVB 2ZUSA 4J73A 2J5WA 2OMYB 5F7LB 1PG7X 3GD1C 1FO0H 1I8MB 1RY7B 4DWHA 5J56B 4PMFA 1H5BB 1YJDC 4PBZA 4JAMB 4Y4HD 2FNBA 5B22A 2H2SD 4PJEB 4JKPL 1WA0X 1PZ5A 1U92A 1KWGA 4ZUUA 2BJMH 4FYQA 1U3HC 3R18A 4N0FB 4HKBA 4Q9QL 4Y4FA 2XIDA 4P0DA 4QYAA 2XQYG 1H6EA 4TUJA 1Z1WA 3FCGA 3QQ9C 3HJEA 2RAMA 2ODIA 2PW1A 4DTGH 4LOVA 5T3XH 2WBKA 5JHLH 5KVFL 3KPSB 1N70A 4HKJB 2GBVA 4KK6C 5GPRA 3EDJA 3N43B 3BP5B 1OT1A 4P5MB 3ZIMA 4DFIA 1PLAA 3OXSB 3EKCA 4WLCA 4X6DA 5KBKA 3SQOH 2XZQL 3OPUA 4XMUA 3ZTJG 3GB7B 4P5TD 5D1QD 3W2DL 5ALCH 3RVWC 5F1KC 4XMXA 1U4FA 3CFBA 4G5AA 3RB5A 3HC3L 4KO6A 4F15C 2F19H 3K2UL 2KZWA 1WC7B 1SDAB 2VDQH 1OO2A 2H45A 4PAZA 1C5CH 4B95C 5MEOA 3L1EA 3BQUC 2BKLA 1IAIL 2WIIB 2BNQA 4NP9A 5HYSA 2WOBA 4X9YA 3QYNA 5B3JF 1G0XA 3EGDB 4F7CB 4UOJA 3LKSB 5DJ8B 1QSEB 2GG1A 4HLJA 2WSDA 4Q56A 1TVBB 3DX4A 5KOMC 3ZE1F 3ZT6A 1J48A 3MODH 5EU6A 4YWGL 4D7PA 3IDJB 2V8LA 3S0PA 5C0FB 1CC3A 4PJGB 4ZBJA 2YUWA 3TCLA 2IFFL 5IW3A 1NCAL 3IMSA 4I2XB 5HJ3A 3ULVC 4NZTL 1G7LB 4JRXA 2BS9A 2MMXA 2Y06H 1HEZB 3HG2A 3PWNA 4UIMB 4X6FB 3JV6A 2YFOA 3EI3A 4KKZA 2VZSA 4AJYV 2YMXH 3QJFA 5I1KL 2DBJA 4ONFL 2P80A 2PETA 1JCVA 3FSZA 4IMKC 3DYMA 3IEAA 4NO5B 4GBXD 3IFLH 3CBJB 4G9DA 2QLYA 1X7QA 4GMSH 4FFZA 4DEPC 1NKRA 3UKUC 1NM4A 1WWBX 4P59H 3U46B 1QZNA 3Q2VA 4TQ8A 2FL5A 2YPLE 4HIIB 5TE7L 2F8OA 2DN7A 4ANUA 1JJUA 4HS3A 5ECJE 3FQUB 3WGUB 5FPIA 2HKHL 5FM5M 1U8KB 1D5XA 3BAEH 1YC8A 2VQ1B 2Z31C 4FQXD 4L18A 3JAMg 1YO4A 4LESA 2LV4A 1B2YA 1U2HA 2BP8B 3NJLA 2E6QA 3B9VA 4W9HC 2PXYA 1WP6A 3M45A 4JGUA 4YFLI 3RVUD 2DMBA 2ZTBA 1T20B 2XA3A 2Y2YA 3A0OA 5IBTL 1JZ8A 1S9VA 1OGAB 2F54B 3K6DA 5HYQB 5IMKB 1EFXB 3NACH 4L3FA 2WPGA 2ZXCA 4ZQKB 3A21A 3CN2A 1DQML 4ZXBC 1JZ5A 3B2UD 1IEBB 1JWUA 2V2XA 3PQYB 4HZLB 1JGDB 1N19A 3MV9A 4WFED 5JLZA 4X6EA 1EHLL 2OVQB 3VVVA 4XVSL 2AV1B 4Z7OF 5HTSA 5A16A 1IGMH 3EGXA 3G6JB 1MWAA 1YA5A 3FN3A 4FNRA 2YO3A 3W9DA 1T5KA 3VUAA 1E8XA 5T3XE 3ALPA 4LNRB 3B3IB 4ZMWA 3WMPA 1JK8A 5D2LB 3RX9A 4W9GC 1OCWL 3QFDB 5E2VL 5E8DL 5KYXB 1KSRA 4LLMB 3V0EA 2UZPA 1G5GA 2UVFA 3RB7A 4XOBA 4GLRI 4F92B 1DLFL 5CUSH 4DH2A 2W5PA 3PXTD 2W0PA 3FQNB 5GGTH 2DQCL 4HEME 2AQ1A 5H2BB 4CRPA 5HVWA 2K3TA 3MRCA 3SDCA 4NWUL 3GS7A 3DUSB 2ICEA 4RISH 1ES0A 3Q5OA 3JROA 1R3KB 3MOAL 5D8JH 1OSPH 3FB8B 4A6YA 4ZN4A 1S7UB 8PAZA 3O81A 3GRWA 4C56D 1MFUA 4RMWA 4ZPVB 5IJ8E 3SN6N 1NCCL 2XZGA 4FTDA 2PPAA 1JPGA 4RGND 2CZNA 3B9KA 3CSTA 5HYJD 3GWJA 3MDJA 1U8CB 4NO2A 5E5MA 4LMQE 4NFBA 3C9NA 5E6UB 3MA9H 1PZUB 1VAHA 4J87A 3LIZL 1G7QA 1JF1B 4F5CE 3L4VA 4LNVA 5I1GH 4PJFF 1OGSA 3BJLA 3FYIB 5JDJA 4WJG3 2XG4A 1UWEL 5E08H 1AZRA 1NGYB 3UBXA 2XRAL 4G7YH 5ICYB 2H13A 1NFDB 3TCTA 5C1MB 4QDGA 1KTCA 2XA8L 4LHUG 3HUJF 4NN6C 2CR3A 3MNMA 1YNLL 1I1RA 4J6IA 3SMRA 3FONB 3ZR6A 1G7PA 4N2DA 3GSNB 4RIRB 3LZFH 1CLZL 2OJZH 1CE6A 4LOEA 1E5CA 3LYRA 1VDGA 3S9DB 3C09B 3QWOA 4O02H 1AQHA 5BUGA 4HA1A 4GGAA 3SKOA 3JT0A 2X6BA 4HUUB 3B34A 2ORBH 3BJ91 3H2PA 5IY5B 3A5VA 4HIJB 1Q8MA 3POHA 4ZUTA 2OTWA 3QCVH 4K8RH 3TURA 1RZ8B 5E2WH 4MJ4A 4OJCA 5SWSE 4LGRB 5F1IB 3FT1A 5GIRB 2JQZA 1JV5A 1IQDA 4JFHE 3O4OB 5HDQH 1XF5A 5TPWH 1IGYB 3ATAA 2R8SL 3LKQA 3ARBA 1KGWA 4JY4A 1HI6A 3L17A 2NNFA 3QI9A 1JYWA 4IQHA 2HRPL 5IF0B 4NN7B 3CSFA 1DSYA 3WJJA 1MHPH 2X4PB 2EVFA 4UT9L 1M1XA 1CYXA 3UC2A 4IMMA 2YGQA 3OMIB 3O6FC 2VUYA 1YPZB 4P23A 1UEYA 1ZAGA 25C8L 4JQXC 5I5JA 4BK8A 4Z7NF 4UDTB 4QF1B 4XBEH 2G2RA 4LMQI 3CFQA 4QT5B 5CAYB 1XGTA 4PGBB 2JCCB 4PJDB 3PHQB 2X10A 3B2MA 3VAEA 4F9PA 5D1XA 3CX2A 2GC7C 4ODVH 4TM9A 3V4UH 4OF5A 3QEUB 3SO5A 3PCYA 3LQAH 2GJZA 4IIZA 4EOWL 2B08A 1N64H 5H37G 3REVB 5ACMA 5F8RC 2HJ4A 3UTPD 1ODUA 3KNBA 1Z9MA 4S1QL 4YHYB 4AX4A 3KW8A 1BW8A 4HEPA 1QFWH 3QDGA 1FRGH 4F58H 5BW7C 2XZCH 2NW3A 2Z7UA 2V3EA 3CZSA 2ZXGA 1KJ3H 3V6OC 4HS8H 3X12A 4P2QA 5CCGE 2EDNA 4GG8B 2I7OA 1T22A 3PXSD 4GY4A 3EGSA 4RZCB 1MG2A 5F44A 4LGSB 5INCB 1FIGH 3VXNA 1NIAA 2ZUQB 1QX1A 2E9IA 2EH7H 4XN5A 3SE4C 2Q6WA 3TNNA 4WJKA 3OKEB 3B2PA 4XOCA 2Y22A 3C60A 2VXUL 2GUOB 1IKFL 3ISRA 3RVTD 1LEGA 1XH2A 1XR8B 3EFDL 3QEGL 1MXGA 1I1AD 2CSPA 3CVHA 3WDJA 3GQFA 4A08B 3DO7A 4PRHE 2XFXA 1IGJB 4KGJA 1VKXA 1ZT7A 3S35L 1MCFA 5CO1A 5FCUH 1IGTB 5LXGH 4YXKH 1KZYA 4PJAE 3KLLA 5DRNB 4HH9A 5B39B 1AGCA 1O5DT 2QR0B 1HH9A 2R2BB 35C8H 3BUIA 4L4VB 5DD5H 5FW7A 2ATPA 4I4WA 4IRZA 1DBKL 3IJEB 1HL4A 1BEXA 1CFQB 5DRXA 2IANA 3V6OE 2OK6A 4PC0A 4N0UB 1UWYA 3HI6L 4L3ED 5KW9H 5KJRL 3KG5A 4QKXB 2ZXEB 1ORQB 3WFBL 4ZFFA 3BC9A 4IU2A 2B2XH 2V37A 2DWEA 1UXWB 2VR7A 3EJZD 1NDGA 2X0VA 3L3HB 4WI0A 3LQAC 3VXUD 5I16A 2GC4A 1KJ2A 4K94H 4UM8B 1BFOB 4UILL 5DJAB 4U4IA 3VU2A 1BVKB 4GW4A 2BOCB 1KGJA 3TZVA 3UL4A 2DI9A 3OF6A 2CDEA 2BMKB 3LEYH 3N9GH 4Z7WA 5I1DA 4W9LC 1PGUA 4KQ4H 3L3DB 4CY5A 2Q3AA 2DM7A 1ZV9A 4XCNB 3WUWB 5IREA 1Z9OA 4Q9BA 4XPFL 5GMKn 3MYZA 2HTKD 4GQBB 2WO2B 1S9WA 3JVGA 3O0RL 5C70A 4AGLA 3AG2B 4YR6B 1CF8L 4NZUL 1G6RB 2OXGA 5IVZB 3TO4A 4Y4FD 4Q0XL 2LGNA 5DHDA 5BRZE 1F1DA 4PRBB 3SQBB 5IV2A 3RLMD 4MJ5B 2BBKH 3IKCB 2DIAA 4HT1L 2JLLA 5DC9B 4EIBA 3O4IA 4OLVL 1GAFL 4HWBH 1CDCA 1HQRA 1IBGL 3RWDA 3IFOA 4S0HA 1RUQH 4UZSA 1KXVA 2ICWB 4WWID 1M2VB 3FHQA 4KTDL 4JFOA 5AB2A 1ADWA 4Y5XB 4X0KA 4UV4H 4RMSA 1F4XH 4XO3A 5BOZG 3QR1A 4OLWH 4JZJA 3HAEA 4L1HA 4TQHA 4E54A 2GSGB 3M46A 3NJGA 2BNQD 4KTDH 3OHXB 4DK5A 3AGVA 3RTQB 5GRVK 3SQRA 5I1CH 3BN9D 4GKSA 1DFBL 3EJRA 3VD4A 1EK3A 4XN2A 3KLAB 5GS3A 1J0KA 3EHBC 2R4RH 5E2UH 2D31A 3UTSD 5D2NB 3GSVA 5EU6D 3A4DA 4PCSA 2AEIT 4XTRD 4JFQB 4BH8A 2JB6A 2VIRB 1NFIA 2A9MH 3HPJA 2OMXA 3KDMA 1RJYB 4M1DL 4RZKA 1Z3RA 3COOA 2Z92A 4JRXD 3KWVA 4WKXA 2NT1A 2ZCHL 4NKDA 1CGWA 4GS7B 2BHYA 4JO1L 2OMWA 1SOKA 2SEBB 5FUZH 5AENA 5IBUB 1MCBA 2B77A 2VLRA 4TULL 1NBCA 3UOAB 4H5JA 4G43A 1I1CA 4NQEA 3X17A 1D9KA 4BZ2H 3OKWA 3QUMA 1JVOA 4ELKA 1KWKA 1XXDC 3IYLW 4JKKA 5E6IB 4YSQA 3VA2C 1PNDA 1UOLA 2AKRB 1R46A 3TIDA 1PD1A 4GYBA 43C9B 4NYLB 2LLGA 5ABAA 4CVWA 3QO1A 5G55A 2G5BB 4OFYA 1K4CA 4XC3L 1UZ6E 1CDYA 3NIDE 3I85A 4XHQA 3E0GA 2EDQA 3ZMRA 2FX9L 2CGRL 2H1PL 4HUXA 4PGJA 5JA9A 4P46B 2IH3B 3P4LA 1R3LB 2DQFB 5AZEL 4MNHA 2NCEA 2DQDH 4AIZA 4N0RA 4FQLH 2EKJA 5CFHA 5IW6B 2EEBA 2MQCA 3ARYA 4XC3H 4JJ5B 5ESQA 5C9ZB 4CC4A 4U6HB 3DSNA 1IBBA 2HRGA 1A14H 2WKOA 4JPVH 1HXMA 4OQTH 2PXYD 1H3WM 3QXDA 1U8LA 2XKSA 5KANG 1QFWI 3RBGA 5L8LB 2NCMA 5LHDA 4YVDA 3BZEB 1E5BA 5CINH 4BQ8A 2ZKHL 5C0DA 3UAJC 1ULVA 4YSPA 4K3GA 4Z3FA 4HJJL 2GK2A 5E00B 3ARSA 2P5WA 5AVUB 5I8EB 3MV9D 2IADA 2AK4A 2C8NA 2QSCL 4QXTB 3BWUC 1I2MB 2Q7AA 4R0LB 4LBEA 4P3CL 5F7FA 3TWYA 2BLFA 2FHFA 1X4XA 2K0RA 4X7TB 4DVBA 1QLFA 1SOSA 2VQ4A 2QSCH 3MXWL 4OU3A 1EGJA 3FUIA 2H3NA 4OD3L 1CLYL 4PJEF 1SXSA 5GRJL 1BSIA 3AQDA 1KT2B 3VFMA 2GBAA 4FNLH 1XXFC 1F4AA 2C3VB 2ITCB 2VRAA 3A67L 4A09B 3DSMA 5IEKA 4R90L 1PY4A 3U1SH 1YUHB 3UVOA 5B39G 4UTBA 4FZ8H 4AQ1A 2V9RA 3CWGA 3QDJB 4K7FA 5IHBA 3GHBH 5EF3A 2WOYA 3SKUD 1N4XH 1D7DA 3EI4A 4MJIE 4H1LB 5JHDE 1L9PA 3DA0A 1IILE 4MMXA 3TESA 3RWEB 1TVHB 3VI4F 3VB9A 3WIHA 3WS3A 2WBJA 4ZK8A 2XNAA 4Q7DA 3V0WH 5BXFB 4YIQB 5EM2B 3B9KD 4JM4H 5HHNA 4L1MA 1BAFH 1AIZA 1TCRA 3D9AL 1BLNA 4Y0GA 4MD5A 3ES6B 1MI5E 4MA7H 1Y6KR 2VZTA 2FAUA 4YMPA 4V1DE 3RFHA 2BIPA 4TVPD 4BA0A 2DJ4A 1H3TA 2BP0A 4ODTH 3GXMA 1I7RB 5ID1B 3QUZC 4XBPB 1A3RH 2NXZB 4FKHA 1RUML 4A11A 5DR5H 2C1PB 3EFFB 2WANA 5FA3B 4MXWL 3FH5A 3LIUA 4PS3A 1SXZA 4XH2B 5DI8A 3D25A 5J1AB 2BW4A 5B1KA 2X4SB 1QRNE 4M43H 1JYNA 3MV8B 3UTZA 2FRGP 3BKYH 5C0IA 1QWHA 3ZDYB 2Y7OA 3IDMB 3SPVA 3C2SA 1C08B 2E9GA 1UM4L 3NAAH 5FKSA 2HVJB 4LLDB 2YN5A 4N87A 4GPVA 4JPQA 5D7IB 4QHPA 3SZKC 4A2HA 5E99H 1E9OA 1W2KT 3MFFB 4ZFOL 2CLZA 1L9MA 5C07D 2G4GA 1A1OB 2ARJQ 4POUB 3OB8A 2NQDA 4LE8A 2BZ7A 3TA3B 3VFGH 1KTLA 2VDMB 4WTWA 5CGBA 4JL1A 3ARBD 1T83C 5ACZB 2WLNA 1O75A 3QI9D 3B83A 4BE6A 1K2DB 3QEHA 3PWVA 3BQUA 1WS7A 2P48B 2A74A 5EA0L 4BELD 2N56A 3GBNL 1GIGH 3EYUL 4QRRE 3FT9A 2YGVA 3DM0A 2YD7A 4P23D 3QUXB 5MENB 3T0DA 4BCCA 4LSVH 1OPGL 3AVEA 4CY3A 4MNQE 5I8CB 2YAFA 2LFGA 3OAUH 1D5RA 4EXPX 1K8DB 1I7UA 5EA0H 2NX5B 1MFBH 1T2XA 3FJTA 2ZPKL 1WFUA 1NKGA 2ZQKA 2XY1A 3OQRA 3W38A 1OPGH 1NDMB 3FSWA 1JUFA 3WKQA 3KBFA 4YN3A 3QIWA 5IBUG 3IUNA 1XX9C 5F9OH 3QDGD 4RGOL 4XXWA 3O11A 5FGBC 3SDXA 1N6DA 4NHCH 4MAUL 4PRPB 1OZUA 3QQDB 2R69H 4IIQA 1FO0A 5IFAL 1BMZA 5M94B 4IMKA 1AY1H 3OKYA 4N8CH 5IJ7E 5KEZA 1D2PA 3H8NA 2CRYA 2AJYL 3NDYE 1ZVYA 3DOSA 1NBYB 3OPZH 1DQTA 3NZ8A 5I73C 4ZMTA 4D0DA 3ZGHA 3C60D 1GL4B 3GHEL 4GQRA 4HCFA 2I0RA 4R97B 2NLJA 2J55H 4DP0X 4RA0C 5JHLA 1PZDA 1WD8A 5J8OA 4A2MA 3E3QC 1XCQA 3EXLA 3NCYP 3PWJA 4APQC 1M2OA 5IVXB 3STBA 5A2CA 4KUCD 4LLUA 3NSCA 2W81C 3BD5A 1E6JH 4NKQB 2R1WA 4Z77B 2Y5EA 4QAMB 3IWVA 2VDQA 3GSQA 2EVHA 4PIBA 2CCLA 4IKNA 1CI5A 4HUNB 4ZSOE 5FYLL 1FZOB 3HC0B 4CJ0A 2D7NA 2YARA 1YNTA 1M4KA 1EVUA 1UCTA 2JSFA 1XDTT 3ZDZE 4BH7B 3UJIH 2IAND 5J0BA 2VAJA 4V2BA 2XPGB 3CLEL 1FJ1A 3MRMB 1EJOH 5C6TL 2E6JA 4LEEA 4NQCB 1SUHA 1KELL 4HGKC 4U49A 3BSGA 1RIHH 3PGFH 1JFQL 3MRNA 2V9UA 1MIMH 1GZHC 4KNUA 2UXTA 1SBSH 4KROB 3U30B 2LHAA 5E4EC 1PLGL 2C7FA 2WQSA 3TZVD 1WYJA 3OF6D 4ZODA 1IBDA 3FTVA 2QFPA 5FO9B 1WWCA 3TC9A 4XO5A 4FXLA 4KVNL 1CFTA 3E3QE 4F5CA 2YNPA 2YBRA 3KPOA 4NIKB 2MOGA 1P7QA 4NUMA 4GQQA 5I0VA 5L4IA 4N2GA 2ZYIA 4QTFA 1TJGL 5D72L 2X6AA 4ABQA 1YMME 3SDAC 4MA8H 3TO4D 1A1NA 3NJXA 3TCXA 1CVRA 1RD6A 2KHAA 1QFSA 1J1PL 4LCWE 1T0MA 1XF2A 3HI1A 1FGVH 4H1LG 3P02A 3AXLB 1N5YL 3EO9H 3NEEA 4DGWC 4PG9A 1IKNC 1BVNT 4WY7L 2X0UA 3IF1A 3T0VA 4XNQB 1EZVY 1T5WA 5HDBE 2NDGA 4WO4B 2L7UA 5FYJU 5JPMA 2N1TE 2Y36H 4L1LA 4J6RH 4HQQL 3LKOB 4U0RC 4GI6A 4MB5A 4K5OA 4B5ZA 3EH4B 3T1FB 2WJ7A 3T6WA 1RZ7L 1FSKB 4MRBA 1XT5A 3JVFC 3V4VB 1N26A 2GI7A 1QWUA 3OKLB 2FUQA 2AK1H 4O3UB 3VE0B 3BVDB 1DLHB 4FG0A 3O6LH 1ZVNA 2JCCF 1MVUB 4KAQH 5KYYB 5J3HC 4L4TE 2YLHA 2G3MA 3GXTA 4XE0A 5BQ7B 1GJUA 1KC5H 2WHVA 3SOTA 4GGCA 1TJXA 2EO1A 4Q6KA 5I1EL 3BPCA 3S6CA 5FO8B 4EI5C 4C4UA 4JRYB 4ZMYA 4S0TD 3FSAA 2FJGA 3BVUA 1NSNH 2R2EB 4OV6F 4QOKB 4DF9A 4P4RA 3FU3A 4U1EI 2VLRD 5TDOB 1D9KD 4FC3E 5D4JA 3PV7A 1N6QL 3DXAE 4PJ6A 3EYOA 3S37H 2EABA 4H88H 4X7FC 3CFMA 1LP9E 1LVEA 1WIPA 4KVCL 3UAFA 4HIEB 5GGTA 2QV4A 4OIFA 4IEFA 1ND0B 4OFYD 4NENA 1HOCB 2YAHA 4Y2DC 5DJCB 4OCSH 4LOUC 1U91A 4XMLH 2CN3A 3E8VA 1VZHA 4Y1AE 1NL0H 2C7UB 3GBLA 3QPXH 5AKTA 4XCCH 3VWJA 3HG5A 1NPNA 3CFKA 3RBSA 1N5AA 3RQ3A 4MCYB 3NABL 2ZZUT 4HKXA 4YXLL 4JQXA 3GHPA 1BBDH 1IIIA 2X4RA 3H9YA 4UM9A 1GKEA 2I24N 3Q01A 2DWSA 4OV5B 5GRUL 4Z95L 5ACLA 3FRUB 5AB9A 2VUKA 4MB3A 3JT2A 1HJCA 1K3ZA 3LKNB 3H42H 4MDJA 1CTOA 4PRHA 5H8DA 3SDYL 1JZ3A 5LBSH 1J5CA 2F7PA 3DVGA 4NPKA 4NUJA 1DQQB 1RJLA 4TQPA 3O8XA 1WAAF 3H85A 4PJAA 5GGQL 2QGEA 2P5WD 4XWOD 1GCYA 2Z93A 2AK4D 4JPWL 2R9HD 5GS2D 5IQ7L 1KOAA 1MRCL 4YL9A 5T5FH 4WFGE 2DEYX 5D7SH 3V6OA 3IDIB 4OZUA 1KXQE 3P2TA 3CGTA 5CHNB 1BQKA 5CJ8A 5HHXH 1A7PH 3NESA 4AITA 5JQIB 1MZYA 2PWDA 3BAWA 3X3FH 4GUQA 4WI6A 2W07A 5L2KE 1HE7A 3DX7B 4O02A 3SFZA 4QTHA 4AG4H 1MCPL 1A6PA 3CDGA 4AQAA 5DZJA 4NRZB 3MJ9H 3B56A 2NY1B 5DEJA 1UJ3B 1PS3A 4OLZL 4AJWA 1U42A 3UIYA 1P1VA 4MMZA 4M5YH 3RIFK 4TLUA 3ZKQD 3BPNB 3AB0C 5HGHB 1NCJA 4XYIA 3M1BA 4G7QB 1N10A 1G7JA 1SQ2N 1FL6A 3GC3B 5I8KH 1CL7H 2COQA 4NRXB 5BS0E 2V4LA 4PV8B 4J84A 4OZIE 1K8IB 2WBJD 4UT7L 1JZ2A 4X63B 1IVTA 3FTGA 4LLAA 3GK8H 1P1ZB 3SDDB 5C71A 3AWFA 5I6NA 3VGAB 4S1DC 2EZ0C 5CEXA 5IQLA 2JJUA 3EOBA 4MNGB 3E38A 4LSQH 1FYTE 2L04A 3Q6FA 1WIOA 3K5RA 3P3UA 4IOIB 4X6BB 2APWA 3HZKB 4MS8D 5FO2A 1HESA 2ZCLH 1ZLEA 1CR9H 1KBKA 3CBKB 3H7BA 4IBSA 1T3FA 1N68A 4O2CA 4DZBB 1RMFL 2EYRB 4JHAH 3L4TA 4J4PA 4WHYG 3D2UB 4J5VA 1AAJA 5MP6H 4PGEA 1DUYB 4GRWH 5T5NG 1ZEAH 1MW0A 1DHKA 5H37H 3ZTNL 2X4TA 3MLXH 4KJQD 5DQDL 5AYUL 5I66A 4DUWA 4YGAB 1FFOB 4L8CA 1WUZA 5SV3A 1N8ZB 4NQDE 4HCGA 1DN2A 1H5BC 2N59A 3MLRL 5CSZB 2Q76B 5BO0D 4WV1B 3B7FA 3D39E 3RLSA 4PTUB 4G3YL 2O72A 4KK6D 3AFLA 3L3KA 4BFBD 3H9SB 1MEXH 4KK9C 2A6KB 2HWZL 2ENJA 3RWCB 2CHZA 2Q8AL 4WJ5A 2YEVB 5GGUA 3V9FA 2OULB 2YRZA 1BQLL 3PHAA 5G4OA 5DVLA 2RA1A 1C16B 3RWIB 1KB5B 1TLMA 1CG9B 3BEVB 1ZGLB 3BQUD 4PWHA 3H2WA 3HVDA 3N1PC 1PGRB 3GBEA 3PF2A 4H8WL 2CIIB 1YAIA 2FZ3A 4JKNA 3MSPA 2EVGA 4KI5F 1UYWH 4EAEA 3AADB 5EALA 3CH1B 3NIDA 2OVPB 3V55A 4R26L 4DEUA 1KCVH 3F04A 5CZXC 4NUGL 4ZRGA 3UDWC 3U0WH 2XPYA 1F6LL 2BHFA 5CKGA 2P8PB 3L5IA 3VSVA 3O3DA 1BGXL 3OAZH 3MZTA 3F7QA 5I0XA 1A8ZA 1V7NH 2O6PA 3HC4L 3F5WB 2OA9A 3RGVA 1HOEA 3VXTB 3MREB 4ORGB 2F5BL 3C5MA 3DROB 3QIWD 4HBCL 4CI2A 4HJUA 3ABMB 4AX3A 1WK0A 1RH8A 3ETTA 2AGYA 4L8DA 1EUUA 1G0DA 3MNZA 3VNZA 1C12B 1MVFA 2NPLX 4FXKB 4QHLA 4Q9RL 1KTDA 2CJUL 4AGNA 1TT6A 2F5BH 4RRPG 4QRPA 4AYFA 4GNKB 1IAKB 2PO6A 4HIHA 4ACPA 4E5ZB 4G9FB 2PPEA 4ODXB 1C1EH 4WHDA 3DC0A 3DV6A 5EORL 1RUPL 5TGBB 5E2TL 3UADA 4ONHB 2EXYD 2EDWA 4QEGA 1TETL 4X4XA 5TDHB 1UM6H 1S7QB 5T3XD 3TM6A 3REWB 3LN9A 2R23B 4HWBA 1M53A 3VTMA 2HPTA 1FZKA 1E5AA 1LQBC 4AZUA 1G4RA 2F1AA 3KRXB 4M7KL 2ADJA 3B8SA 4JD2C 4UBDC 4WI9A 2CKBL 3SJLD 2DM2A 3B5GA 3AXHA 1J18A 1QSEE 4UI2A 5DQJB 4D3CL 5BVPL 4YE4H 1V05A 2DICA 1JDDA 2FB4L 2M26A 4YX2L 3ZVVA 4JN2A 5ERWA 4HD5A 4PJGE 5F3BA 2Q0ZX 1I31A 2EDMA 1HVXA 4B27A 4I2XE 1MH5B 1CVSC 4PJBF 3BSHA 1E4WL 2HN7B 4MJIA 3GTVA 5FKPA 4G6FD 4XVJL 5B3SB 6PCYA 1ZGLM 4H8WC 3O4LA 5BRPA 4PRIB 1CGTA 4R96A 4A67A 3GSNL 2N7AA 2OMTA 2YQBA 3FCBA 4TUKH 1VACB 1MI5A 4JEGB 3QISA 4HUWB 4OGXL 5GISH 3MFGB 1LE5A 4XEIC 5BV7H 3LVEA 3LRSB 2F5AH 1W8EA 1PZBA 3TH4T 2GJ6B 3H53A 3UBHA 2IBZX 4XP4H 1P7QD 2DTMH 4R7LA 5EBGA 2W94A 1NCWL 1HCVA 2YKLL 2XQYK 2PW2A 3HE7B 3P9LA 3TYGL 4BZ2A 2DEXX 5FF6B 3O2VL 4W81A 3L9BA 3QC5X 1CL7I 3S5LB 4JRLA 3MZGB 4TSCH 4KRNA 4PY7B 3WLWC 3D0VA 4AH2A 5DJDB 5DK2A 4H8QA 5T1LB 3N5AA 4LL4A 5IQNA 3OMZA 4WTQA 2CLRB 1QRNA 3EYSH 4OY9A 4JL2A 4GXFA 5INDA 1MRFL 3QNZA 1OGAE 2F54E 3O3BB 2ZWKA 3US9A 1CK0H 3EG9A 3I74A 4MDIB 3E9UA 4U1SB 5HQGA 1KXTA 3QNXB 4XMWA 3WNKA 3WTTA 2DMGA 4GG6A 1F4YL 2IMMA 3NRPA 3PQYE 3KPLB 1A3LL 1J86A 1KIRA 3QXAA 4FKEA 4OQTA 5ADOL 4FGMA 2NYKA 3ML8A 3MNVA 5DD0L 4LSTL 4U05A 2E74C 3G6JE 4JO4L 1OARL 4JFHD 2TSBA 3QUGA 5ICZB 4N8UA 5C7XH 4AC4A 4WHCA 2FH8A 3I9AA 1UZGA 5EZLB 5LBVA 2VLMD 1FVDB 5IT9g 2NQ3A 3CVDA 4JFXA 1DVFB 1SVBA 4HSQA 5B3NA 1JZ6A 1XD1A 2I9LB 5D2LE 3T4AA 4PS4H 3FUFA 3J81g 4QAWA 1E27B 2D4DA 3ECUA 1TEGA 1RZJL 4L05A 4YHZH 2PWGA 5HE2B 2YSTA 3D5OF 3PUUA 4MNQA 1HHHA 4UB0L 1Z0MA 5C0EB 4NFDA 3UTTA 4DP8X 4OM1L 4N20A 5F1OB 3GSRB 5IFJA 4D8OA 1QTSA 3EOAA 1AFVL 2IBBA 5CZKA 4PCTA 2EO7A 1BEYH 1SJEA 3FO0L 3I75A 4XNXH 2A83B 3C09C 2FBJL 3NMEA 4JGNA 2ZJSL 3INUH 4UIKL 4N6RA 3DVFA 4DK3A 3N42F 5EOTB 1AFVH 3KPPB 3G5YB 2VXSH 3EYQC 5IHUH 3GSUA 4N2EA 2P1YA 5FLXg 3HG0A 1H6TA 1T83A 3DTXB 4Z76A 2JCWA 3VFPB 3TBWB 4GFXA 2LTQB 4QJ4B 4WGKA 1TG8A 2IGTA 2FD6L 3O4OC 2WXQA 4ETYA 1EPFA 5EG6C 1U33A 4WGWB 3MBXH 3DX8A 3OSVA 4B7LA 4S1SH 1X7SA 3FU7A 4UM9D 4LGNA 4QIRA 1NFDE 4LCUB 1QNZH 4NN7C 5HHMB 4BKTC 5KSUA 2VAAA 2YJLA 2I85A 3IPFA 3BXNA 4CMHB 4ZS7L 3T0WA 2HFFB 1MFCL 4PRHD 5I18L 4P2OA 5AZ2L 4MVBC 2AEOA 3MCKA 2UXVA 3LEXA 4DP6X 2E4TA 2W9DL 1E8MA 1C9LA 2HTLC 4M5ZL 1TZIA 4W9FC 3KL3A 4ZSOA 1XGZA 1ZWIB 1BVOA 3KHOA 1P2CB 5EEWA 3S3DB 1Z3GH 2CA3A 2YS4A 2KBGA 2AABL 5FFOA 1Q9LA 3GMMA 4J77A 3ZDZA 2J12B 4YHYC 5JO5A 5AVTB 1UGNA 2WQ8A 1NMBH 5AB1A 4J8RA 3WTWA 3UYPB 1TF4A 2BNUB 3C08L 4NQSA 4JN1H 4XOAA 3SKNB 1X5YA 5GSVB 2DWDA 3QNFA 5HYNB 1R6VA 4CSPA 1Q9OB 2AV7B 3BAIA 2DYSB 3G6AB 2OX5A 4XMPL 2AJSL 5DVOA 1JTTA 1G6RH 2R2HB 5GZNC 3CE1A 1DCEA 1V7ML 1MFEH 5LGJA 1NWOA 2A77H 2ZUQC 4Z7AA 2ED8A 3QO0B 2R0LH 1EVTC 4QLRA 2FIKA 1S3KL 1OAZH 3ETBF 4W9EC 4WKZB 3RAJH 2EXSA 5DJ2A 5ITBL 1YPZE 3CC5B 2BPBA 3RWFA 2CLVB 2MPAL 4A0AB 4PJDE 1T89C 4G1EB 5K93A 1YMMA 5I23A 5JZ7C 2BOBB 3CHSA 3WIAA 4JLRB 3KS0J 4E9QA 2ZE0A 3MR9B 2JKTM 4LCWA 2V5RA 4HW6A 4MGXA 4ELMB 5B4MC 2NDFA 3NJHA 3PP4H 4XP9L 1FORL 5DHEA 4I3RL 4DKDC 1N0XL 4A0BA 3MRRA 2BC4B 1OLLA 4AMWA 4OF0A 3HPLA 1YECL 4L3CA 3FS9A 1GZHA 5EAPA 2QQKH 3MRGB 1IGCL 4YPGA 5DVMA 4GIAA 4NNYA 3EXJA 4H5SA 2HMIC 4O4YH 2P5EB 3I6GB 4DHLA 4G8AC 1A7NL 4J4PD 4CU8A 3UERA 2BIOA 2C9RA 4JCLA 2GT9B 2W65B 1RHHA 4AW7A 3M7OA 3D69B 2R69A 2EVJA 5I1AA 5EN3A 1ZSHA 3QULA 4JDTH 4FZEL 4JFEB 1JZEA 4NT6B 2Y0SA 1KG0A 3GFCA 1B9YA 1V3LA 3QCTH 1AS6A 5EU4B 1R5IA 2R29L 4ZFZA 2BDNH 3SDAA 4B60A 4IHOA 3PDOB 4X0NA 2HYEA 3VGHA 2Y9RT 3W37A 3APFA 3AH8B 3IAQA