3V4VA

Crystal structure of a4b7 headpiece complexed with fab act-1 and ro0505376
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
587
structure length
582
Chain Sequence
b'YNVDTESALLYQGPHNTLFGYSVVLHSHGANRWLLVGAPTANWLANASVINPGAIYRCRIGKNPGQTCEQLQLGSPNGEPCGKTCLEERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYIKNENKLPTGGCYGVPPDLRTELSKRIAPCYQDYVKKFGENFASCQAGISSFYTKDLIVMGAPGSSYWTGSLFVYNITTNKYKAFLDKQNQVKFGSYLGYSVGAGHFRSQHTTEVVGGAPQHEQIGKAYIFSIDEKELNILHEMKGKKLGSYFGASVCAVDLNADGFSDLLVGAPMQSTIREEGRVFVYINSGSGAVMNAMETNLVGSDKYAARFGESIVNLGDIDNDGFEDVAIGAPQEDDLQGAIYIYNGRADGISSTFSQRIEGLQISKSLSMFGQSISGQIDADNNGYVDVAVGAFRSDSAVLLRTRPVVIVDASLSHPESVNRTKFDCVENGWPSVCIDLTLCFSYKGKEVPGYIVLFYNMSLDVNRKAESPPRFYFSSNGTSDVITGSIQVSSREANCRTHQAFMRKDVRDILTPIQIEAAYHLGPHSTEEFPPLQPILQQKKEKDIMKKTINFAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-4
publication title Structural specializations of a4b7, an Integrin that Mediates Rolling Adhesion
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 126
structure length 582
sequence length 587
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1460 Mainly Beta Sandwich Immunoglobulin-like Integrin domains. Chain A, domain 2 3v4vA02
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3v4vA01
4WK4A 4O02A 4Z7NA 4Z7OA 4MMZA 3FCUA 3VI4A 4G1MA 5E6SA 3V4PA 2VDQA 3NIFA 3ZDZA 4MMXA 1U8CA 4NENA 2VDRA 3T3PA 2VC2A 2VDMA 4WK0A 4MMYA 3NIGA 3ZDYA 3K71A 3ZE2A 2VDLA 1TYEA 3IJEA 2VDNA 3NIDA 4WJKA 4Z7QA 3ZE1A 5HDBA 4G1EA 3ZE0A 5FFGA 4UM8A 2VDKA 5E6RA 3T3MA 3FCSA 3K6SA 1M1XA 3VI3A 5FFOA 3K72A 4UM9A 5E6UA 1L5GA 4IRZA 1JV2A 2VDPA 3ZDXA 4WK2A 3V4VA 2VDOA
chains in the Genus database with same CATH superfamily
2ATAA 1FVEB 1WAEA 1N2RA 3BPCA 3MYJA 4EI5B 4W9JC 4HAFA 3FQTA 4U3HA 2AKRA 3DGCR 5EIIB 4PRDB 2F5AH 4XRCA 1MHHB 1JTTA 2ZX9A 2ZCHH 5E8PA 3HAEG 5KYUA 2D3VA 2EE0A 1D5IL 4BUQA 3ZIMA 4PB0H 1A6VH 4EMZA 5AZEL 3FFOA 5KEZA 5D2LB 5LG6A 2W18A 4TOYH 2NXZD 3TN0B 4NKDA 2AEPL 3ARGD 2WVTA 2F53B 4FG6C 5D7LA 3B3IA 1ZSDA 2CBMA 1QEWB 3BFQG 4JDEB 4DVBB 1CFVL 3HBZA 5J13C 5E8OB 4KH2A 4ODTL 2BDNL 4PSXB 2P1YA 1TCMA 1WFJA 2BJML 4ESGA 1B90A 4URTB 3OKKA 4Q9CA 1GZQA 4X7FC 4XC3L 4UB0H 5AOJA 2XWCA 1JRHL 4LHQB 3WTWA 4Z77A 3IJ0A 1UFGA 4MYWB 4A11B 3ZT6A 1OP4A 3LKNB 2N0KA 1MW2A 2Y6TE 4Y89A 3VVVA 2EYTA 4H44C 5CR8A 1ICTA 2WTPA 3NSYA 4AENA 3D2UA 4H8WH 1GXEA 1TU2A 4GLRI 1ZGLA 3DSFL 4HIPA 4MHHI 3D85A 4WKZA 4NZUL 1ORQA 2EKSA 4GKSB 4YDLB 5AUMB 5FXYA 2CO3A 2E46A 5CIPA 4O02A 1YO4A 1KTJA 2C3XA 2VZTA 3DJSA 4FL4C 1BFVH 4F80A 3MOBH 5AKTA 3V10A 3ZDYB 4X2UA 4B6ZA 5SX5K 2XWTA 5JIMA 1F8TH 5E9NA 4EXPX 1YJDL 4DKEL 2ESVE 2PCFA 3O6FD 1CR9H 4ZOEA 5TH2A 3MA7A 4QAMA 4DZBA 3SGDH 5KOVC 5IVXE 2BRRH 4G43B 5HDBF 3O3EB 3AS2A 1YG9A 4PJDB 4APQD 4Z7NE 2QKIC 4KUZH 4YH6A 1JIBA 2H6PA 2NY1D 1EA9C 3GBNL 4TSBH 5DFAA 3PJNA 3GSOA 4MDJB 1BJ1H 4DZ8A 5ECJE 2Y24A 4EKJA 2EECA 3S5LB 4PSWB 5INDB 3UO8B 1RQ5A 4FQHA 3MVSA 4I5BA 2J43A 2A83A 2XQBL 4LGNA 1JDCA 5FWRA 3BAEH 4XN9A 4DGVH 2OTUB 4U1NA 1S7RB 5F1OB 4TXVB 3HR6A 3SKUD 3KPRD 3LIUA 4JXMA 4G56B 3P4OB 4Z78A 4P4KB 3ULAB 3C60A 1HSAB 2BOLA 2IANA 1A0RB 4ZTPL 2CN3A 3B9KC 1XGRA 4UQDA 3B6SA 4X8JB 3BW9A 3QHYB 2WGNB 4PY7A 2GFBB 4N86A 3KXFE 4JMNA 5CBEB 2P80A 3MXXA 3KJ4C 4LU5L 3NP4A 1WEJL 3RIAK 1NKRA 2NY0B 1CE1L 3V4PA 1L6ZA 5F21B 4YBQD 1Q4NX 3RIFF 4B9ZA 1NFDE 2DQTH 5G55A 4GXUM 4L3CB 3QJFA 2BSCA 5D4HA 1JN6A 1U93A 4GW1A 4NXKA 4HQQL 1WS8A 1GIGL 4QY8B 4DKDC 1U2HA 1KCRL 1KCLA 4LLUA 3JB9L 2I60H 2OIZA 4GXFA 4AL8C 2G9HB 2OFQA 3GO1L 1TTBA 2FQDA 3G5WA 1DQQB 3T6VA 1RJCA 5KYXB 1E5CA 3O8XA 4KZEL 5K93A 3EHBC 4MMZA 4P49A 3VG9C 4R4FL 1FRGH 5ACZA 3MU3A 2VMDA 3BP5B 3ARZA 3CN0A 4MJ6A 2WLJA 2AQNA 4X6BB 3VXNB 3ARDA 4PS7A 3X11B 1MJJB 4HOMA 2IDCA 4M43L 4WTWA 1QRKA 3BGFB 1ODUA 4X4XA 1YC8A 3UO1L 2ICCA 3F58H 2XWXA 2IFFH 3BD3A 4F7CA 1MLCA 4PJFB 4CL7A 2HMIC 3VXOA 3ZO0A 2PWFA 5EMLB 2DMHA 4Q7DA 1N68A 3UH8A 1PTZA 5K9QI 4DGWC 4MNHA 1FGVL 2BWDA 3ZKNC 2C34A 1ZIBA 3CK0H 1YNLL 1Q9OB 3ZWLB 1CDUA 1LJMA 3VJ6A 3SFZA 2BSTA 3AACA 2A74A 4JANB 5ABZA 3KGSA 3L1OL 2OMYA 3MRMB 1FIGH 3ISWA 3QEQD 1NA8A 4ICWA 4Z76B 5CEZH 1U8HA 3K26A 5F7MC 1NBYA 1X5KA 2J4WL 3EYQC 1A8ZA 3EJQA 4RDQG 5SX4I 4TN9A 1ETB1 1FFPA 3LZFH 3SDXF 4ZSOA 1K5WA 3VXTA 1KGWA 4ES0A 2NNFA 4UILH 3I2CH 4OZFH 4WI5A 3DMMD 1G9NL 3WFBL 1CXKA 3ZTNH 4ELKA 1S7TB 3HZKB 1A1OA 2DEWX 2H1PL 4JHWH 1L9NA 5DVKA 3DVFA 1OPOA 3JWDC 5LAXA 3UX9B 3SDAD 3VXMA 3GSVA 1J0IA 3HE7C 1CLYH 4XO9A 2VN5A 1KIRA 1D6EB 3DJTA 5C9ZB 2BP3A 2YAPA 1HNGA 4DEPB 1RK0B 5I1GL 1W0VA 4WI9A 1PKQB 3K71B 1M7IA 3BVXA 5JHAA 3FTXA 5DD6A 3KPLB 2OULB 5I0VA 1UWGL 3C09C 1O6VA 2FX9H 2YAMA 2XL2A 4X7SH 2Y2WA 2BIHA 3DSNB 3WE6A 1M7DA 4K7PH 4NGHH 3C99A 1NFAA 2NY5H 2GK0A 3FT9A 4AGMA 5MERA 3LTVA 5KDOB 4LIQL 2C9VA 3HUJE 3O41B 3EQ8A 4ZTOH 5CYKB 4F7TA 2I5YH 4UT9H 3D8MA 3VI4A 3ES6B 3IKCB 4LCWA 2EH7L 3JV6A 2F8OA 4OLZL 5D7KE 1IM9B 1KTDA 3MRLA 4R8WH 1NOLA 1S9VB 4MHHG 4QXUH 4U7AA 1LMIA 4A2MA 5L6YH 5GZNA 5HI3D 5FYJE 1BPOA 1JWMA 3ZE0E 2FO8A 5KOMC 2Y36H 3IVKB 4XNUH 3QJHA 3ILEA 2EE3A 3L7FB 3QPXL 4I3SH 1TZIB 4P2QD 4XNDA 1X7SA 4ORZC 2HU7A 2AJVL 4DW2L 5TJWK 3VDCA 2EEXA 3D6GA 4EEEA 4P2OB 5I30L 3I7LA 3Q5OA 4QXGL 4V1DA 1DQDH 5AOZA 1GY2A 3L7EA 3D0VB 1DLHB 4GSQA 4ALAC 4QLWA 4ZOXA 1HQ4B 1FLTX 1U8PB 4XCCL 3ULUL 3VRLE 1K4CA 4D94A 3IDUA 3TWCH 3L4UA 3QEUA 5IV2A 3S88H 3O6LL 5HDBB 1CFBA 4IHBA 1PKOA 4PJ5E 4DOHE 5EU7E 3VXUE 3QQDA 1T5XA 4HLEA 2OZ4L 1A1NB 5HE2B 1ZK9A 3EO0B 4X4ZA 1KBVA 5ESAA 4XPGH 2Z8VC 3RFZB 4PRPE 4U0QB 2ZXDA 3FMGH 4Z7WA 3ZL2A 1SYVB 3QI9A 1Z5YD 3H9YA 1TQBB 3SD2A 3DHPA 1ASOA 5C0BE 3QUMA 4PJGB 3P77B 1ZVNA 4Y7MA 5IJCC 1QABA 1UACH 3PREA 3CVCA 4MGXA 4RRPG 2WBJA 5C70A 3MRQB 1KXTA 1E5BA 2BHZA 2VISA 3E2HB 3IJCA 5LNEA 1XZ0B 3EADA 3C8HA 3KL5A 5BZDB 3C5SB 2WOYA 4B9JA 4BZYA 4HWBH 1U3NA 5DD3H 5LCVL 2JB5L 4P2CG 3C8KA 3GGWB 4YZWA 2ZQKA 2YUVA 1LHZA 3WHXA 3UPRA 1BXXA 4ZO6A 4A0AB 3OAUL 3O6KH 1A3ZA 2V37A 1KBPA 5JXAL 1K8IB 4GAGH 2HRLA 5E9AA 3ZRCC 1WUNT 2ATKB 2LVEA 1F3DH 4QRSB 5DURD 5F7FA 4ZUTA 2ZCZA 1BZ7A 2NNXA 4KQ4L 1HI6A 5IB4A 1MW3A 3KGUA 3ZL4H 5GS2H 3VXRB 2ZXQA 1A4BA 5T1MA 2PWDA 3CX5K 4P3DB 3GBDA 3H9SE 2V17L 3ZMEA 3NVXA 1NGZB 4PS4L 4X4YB 4U7MA 3QHZL 3P40A 1Q94B 2PP8A 3GJFK 4OQTL 5IHUH 3REWA 3WXWL 5K9JL 4TZ4A 2FJHA 3VFRB 5IW6A 1S3KL 1MG3A 3QJXA 1RU9L 4U6XB 1EZVX 5IIEA 1D9KA 2FR4A 4NPYB 3CBKB 2DTML 3FB8A 3SDDB 2GJ6A 5JHDD 1K8KC 4WNSA 3EYOA 4IU3A 4L0PB 5KANI 5GRUH 1QSEE 4OZFB 1GAFL 2PTTA 4OCXH 1TT6A 5K9QG 1JYVA 1EAPA 4JKMA 4UTBA 1N0XH 3A47A 4M7KH 2B4CH 2UZIH 3H9HB 5KN5B 2CDEB 2QLYA 2W0FA 2XV0A 4R96A 4BSJA 1WCQA 4PLKC 1CL7L 4OKVB 1HN1A 1MCBA 3NZ8A 5F7YC 2FUTA 2CCWA 1HYRC 5AOIA 1JGLH 1U92A 2XYCA 4Y19B 2FTAA 2CWRA 1AHWA 2ADIA 1WZKA 2OMVB 2XZCL 3GKWL 5DF0A 5ACMA 2X3CA 3GIVB 4ZYKB 3RX8A 4WK4A 1S7QA 4R26L 4ZW3A 5IQ7H 3KM1A 2C9QA 2H14A 3FHEA 1T20B 3WFCH 5JUEL 3ZSSA 1NCBL 3SBRA 4C83A 3NCJH 2IH3B 1MG2A 4QLRA 3NVNA 2FSDA 4XP5H 4CY3A 1A5FL 2QT6A 3BH9B 4X9HA 3HFQA 4GSUA 4JGJA 3PYCA 1DANT 3V0GA 1PD1A 4NC1E 5C0GB 1A9VA 3PPSA 1CC3A 2MJWA 3VM5A 4G83A 1QFOA 4LNRA 4Y9EA 5A2BA 5J1TC 2H1LM 1OD9A 4G8GA 2X6CA 3TVMB 1HXYA 1QLRB 2AQSA 3B2PA 5E9DA 4LSDA 4HF5L 1MVFA 1KF9B 1MCJA 3E8VA 2FJFB 2YMXH 3O0RL 5EN2A 4C4BA 4MJ5A 3L17A 2ZG2A 4F27A 2FGWL 1OTTC 1J5CA 5CJBA 4R7LA 3QFJD 1NCNA 2OR9H 4QRRD 5DVPA 4AW4A 1NOFA 2WMPA 2EIKB 1OAUL 4U7KA 4UMSA 4JD2C 4N28A 3ARTA 2OMTB 1PY9A 4N2HA 3ZLQC 3AMKA 3VXSD 4JHVA 4Y4FA 3M8OH 4KVPA 4OZIF 1A7PL 4L4TE 3NIDF 4I0PA 3DYMA 4F57H 4XMWA 2CUHA 3FU7B 3DJZA 1CFNB 3LCYA 2XBDA 3QJQB 4ZFOA 2G75B 1MY5A 3C6LB 3NIFB 2Y1YA 4NKIL 5JHLL 1AQHA 2P44B 5FYKD 15C8H 4D0CB 3S36H 1UYWL 5EC2A 1QQDA 2DDQH 2X4QA 3SE3C 3U9PH 2CRZA 4JKLA 3BE1H 5EEUA 2P9UC 4WCYL 4Y1AD 3TV3H 1ZD6A 3QQ3A 4JPKL 4PCSA 2R7EB 4M62H 4XMXA 3L3KB 3MRIA 4N1HB 3BO8B 3DK0A 2QMJA 2YMOA 1DQLH 2MQGA 5SV3A 3AB0B 5EUOA 2AQ1A 4KDTA 1KLUA 5FM5M 4QF1B 3FHAA 5F6HJ 1JPGA 2GW5A 5TQ0L 3RPKA 3CQQA 5BXFA 1LXMA 4FMKA 4JDVB 3PAYA 1EVUA 4F8QA 5IUCA 1BA9A 5EBGA 1WWBX 3GMOA 5IVXF 4Z7IA 2ZTBA 4J3TA 1NUNB 2BCMA 2R1XA 5ELIA 4Z7NF 1F5WA 5FO8B 1P5VB 1XXFC 4NO3B 4YAQB 1SY6L 5FIEA 2BIOA 5I6XC 1OM3H 2QPSA 2VDRH 3A0FA 1S7WA 3CFVA 1NR0A 4TRPH 4K3JH 2PETA 5E24E 2H9MA 2AF2A 3FTVA 4G80A 4RGOL 2WQ8A 2IAAC 2NW2B 4GP5B 4L23A 1ZHLA 1QSFA 2VM4A 3IN2A 4OSUH 3VDAA 3WJJA 2DBLL 3T77A 1Q47A 5I9QB 5FF6A 2CJTA 2X38A 3ULSA 3LSOB 1ACYL 4HU2A 2BIQA 1O6SB 1SQ9A 4HCGA 3SMRA 3I7NA 3FTGB 4LBEB 3EYFB 4CN4A 1KZYA 5DVNA 2N1KA 5TD4A 2VDPL 4AX4A 3UMTA 4M1CD 5D1XC 4G6AD 2X70B 4URKA 5DHYA 4A6YA 2I9TB 3T5WA 3IDGA 3JV5A 3V6BR 2AERT 4NQDA 3BVVA 4UNTA 4AWJC 5ES4B 3O3DB 4KK5D 1JDAA 1BEXA 1I1FA 5SWQA 2X40A 1ET5A 3PE9A 1ZHKB 5F0PB 1IC4H 4HHWA 2DL9A 4CKQA 2PR9A 3ESPA 4JN2B 3V0EA 5DUBB 1NMCB 3RVUD 4A37A 1HJBC 1IVLA 3LHAA 1H9VA 4KK6D 4LF3A 4MCZA 5CJQL 4X5XA 1P4UA 5D1QC 1QR4A 3FU8A 5MEOA 3EZJB 1ZLWH 4WI4A 1KGIA 5I15H 8FABA 3ULVF 3LN9A 5KANG 4QHMB 3SE4C 4YDMA 4QUOA 2BVQB 2ZUXA 2JTDA 3GS0A 1EJ8A 2WIMA 4JHUA 4W6XB 5C7XL 1R3KB 5H37G 3BAXA 1HL8A 1IGTA 5CSZB 4W9IC 4I89A 4Y5XB 4OJFH 2OSLB 3IU3A 3ALWA 5F1NA 2QV4A 1BZ8A 4AXWB 4OV5A 1ZTMA 4JFEA 2CKNA 3S3SA 1AXSA 1BEYL 3LB6C 2YXWA 1SRDA 2YXVA 4D3CH 4FKEA 4YHYB 5KJRH 2WWOA 3DUSA 3DTXA 2VB5A 4Z0XA 4YDKL 3IGFA 1JI2A 3ULVH 1T3FA 3RI5F 4E42A 4MX7A 4XBPB 5T5FH 3UTOA 4JCLA 4U6YB 2X4TA 3QIUB 4JRYE 2FO1A 3VH8G 1T1ZA 4AGLA 4N9GB 4FYTA 3MCLL 2PXYA 1KN2H 1OMWB 2CZNA 2QELA 4UTAH 4HX1B 4XX1G 1FL3B 3DOIA 4N6QA 2C8NA 1C9SA 4XMLH 1S9YA 3KLAB 3HNTL 4J3OG 5EO9A 1RL1A 5KVGE 4ECNA 1LE9B 5HGAA 3OSKA 2NY4C 1P22A 3STLB 3EWEA 1OQXA 1ACCA 5EOCL 4DPBX 3D48R 4RAVA 1ETZB 1U4CA 5E8EB 3JROA 2EUWA 4YSCA 4IU2B 3X1GA 3N0EA 2DF3A 2NXYC 3VB9A 2Q87A 2NDFA 4X6FB 1VKXA 2OAAA 2Z8WC 5GZOA 4A7GA 1CGTA 3HEIB 2JELL 2EYSA 4JFXB 3ZDZE 3HRZC 4U0RB 3DJRA 4FQXA 4JVUA 4N2LA 4E9VA 4Y5YA 3TZVB 3BPOB 4N8VG 2HB0A 5LN4A 3DRQB 2AABL 2D7MA 2WXIA 3HUJF 3L6FB 5FCUH 3S5ZA 1KLGB 3ZZLA 3VD5A 4LZKA 1KYFA 1GCFA 3SN6B 5F93C 4PWKA 5I75B 1S5HA 3VFPA 4I9XA 2G4GA 3AC0A 3O2VH 1TZGH 4FG4A 2R0KL 4AJYV 3OQRA 2AGLA 2YFNA 1GP2B 4PV8A 1PJ9A 5F9OH 1P7KA 3GMPA 1RIHH 2RJMA 5HY9B 3ZE0F 4AX3A 1EO8L 3L4MD 5GS3A 2GJJA 5F89A 4OGAD 3QUYD 4AIEA 5IVNA 3GXFA 2AK4B 3GMQA 1J9SA 2VDRB 3FCGA 2OSYA 3F7VA 5T3XL 1S46A 2HU8A 4K3JB 4OM1L 3FBQA 4MAUH 2PPCA 4O5LH 2APVA 2QVKA 3IFNL 4OLUH 3CFSB 2MTAA 3F83A 3EO9L 5IMKA 4FEIA 2KDYA 4JB9H 2L8AA 1DQVA 3BP6A 1A1MB 3SD5A 3R06A 2VR6A 1UOWA 2F53E 3L3JB 1INDL 3L3OA 2YOCA 5D7SL 4BFKA 1DE4A 4ZMXA 5JLZA 1I8AA 1A12A 3LXBA 2IG2L 4OUOA 1ERNA 2GBTA 3RTQD 2PW1B 4HIEA 1BQHB 1CLVA 2F58L 3MNZA 3CCHA 3E7JA 1S9KC 4HKXA 5HGBB 3PWPD 3QWRD 1UJ3B 3LQZB 3TT1H 4BXVA 2F7OA 4A0BA 3LNIA 3MNMA 3QCVL 1T4KB 2CGRL 2XZQH 4JZJB 3SQBB 2ALWA 2H2PC 3ECBB 4LLVB 1E3FA 3IDXH 1FAIH 3KS0J 3CLFL 1QLEH 4ES9A 1H3PL 1TJHL 4M48L 3KL0A 5IBUG 4CU8A 4RFNB 3WTXA 5FO9A 3CX2A 4NZRH 4HK0B 1W72L 3CG8A 4FMFA 1BAWA 1MNUH 2MCMA 4YWGL 3GEWB 4MDIB 4GKNB 3SPCA 2GIMA 4RMBA 4OIFA 3GLDA 3BP7A 2E6JA 5LAPA 2ZXGA 2A9CA 1YEFH 3DX6A 3P0VH 3ZDYE 4B7IA 4WK0A 3VWKB 4YJZL 1NFDA 3RKDD 2FQFA 3DUUA 2WJ5A 4JR9H 3QZWB 2JV6A 1C5CL 4GM3A 4KKBC 3QBTB 5F70A 3WUZA 2Y72A 3F85A 4KFMA 3QB7C 4LNVA 3IAGC 1J5OH 4ZJ9A 3O4OC 2R2HB 2AJ3B 3GXMA 5DVMA 3SDCB 5FAAA 1SEQL 4LSQL 1SDYA 3VG0L 3U0TB 1LL1A 1T5WB 4XNMB 4HS6B 1YEGL 4ABWA 5KVEH 3IDJB 4GBXA 2VDNL 3VFVA 1FAKT 4AN1A 1ZHNB 4FYSA 2IGLA 2BNUB 5EMYA 2C9PA 1S3RA 2AXFA 2YR3A 3GFUA 3NH7L 2O6CA 4Q9QL 1GS6X 1IGIH 4LDLB 3FQ2A 4NKOA 1U4EA 4C54A 1P4LB 1TEGA 2W9EL 3JV0A 3OPZL 4NEHB 4DEUA 2E7LA 4GUOA 1OCOB 5JQHC 5I1JH 4AIZB 1U8IB 4JM2A 3UJIH 3J07A 4UQ3A 1YR2A 4QOKB 1BFOB 3LN5B 2UXTA 4O3UB 3JYCA 2X0VA 2Y25A 1WAAE 3BN3B 1IGCL 4TL5A 2XKUA 1ZOXA 4NQUA 2CLRA 1SUJA 3OC5A 5BMFH 3RWIA 1G1YA 1ZV9A 2B1AL 4JO3L 3G6JF 4W9EC 1IQDA 5DJAA 4E41E 1JNLL 2XJKA 4I3RH 5EBWB 4L8DB 5B4MD 3KPSE 2Q2LA 1Q0XH 3QIBD 2N3JA 4RWYL 4ZG1A 4KI5C 4HIQA 3TURA 1G7PB 3W39B 1P6WA 2P5WB 4HC1H 1DBAL 2BIPA 5B7FA 4O58H 2L3BA 4X6DE 1YMMB 2JJSA 1G5GA 2C9SA 1S9XA 2DQHL 3PJSB 4LSPH 4OIIH 4JDTL 5FB8A 3QG6B 2Z2OA 4I1RA 1PZSA 1QA9B 3OHXB 4NSKA 3FQRB 1A0QH 4OFDA 3DOSB 3FTYA 3IFLL 3Q8EA 5IB1B 3JUZA 1OB1B 3G5VA 4FA4D 1RZJL 4PHXA 4ZMNA 3CMGA 5E6RB 1CDCA 4UYQA 3U7YL 3S37X 1DQKA 3PAVA 4MJID 2QC5A 2XJLA 4WK2B 3FH8A 1IKNC 1CT8B 4KU1A 4FI6A 3FRPB 1SN0A 3MLSH 3NRFA 1RLBA 4YDJA 2I0RA 4AEHH 3OM3B 3QR0A 1W91A 4XP1L 3WFHA 4C47A 3I9PA 4KROD 1ECYA 2J1ZA 4Z3HA 4CI1A 3TM6A 2NY2C 1TBGA 1XBDA 5DSCB 4L3HD 4EVNA 3C60C 1BXUA 3Q6GH 1UD2A 3V9EA 1I3UA 5KS9E 1LO0L 1B4LA 2CRMA 3HC0B 3OKEA 2BRQA 5AD0A 2Z4QB 1KCUH 4ZODA 2OYLA 1O0VA 3KL3A 5FKPB 4Z6AT 3JV4A 4RQQB 3UYRH 4E5XB 2HWZL 2XACC 4K9EC 3HW7A 1X5JA 4NBYB 5IBTH 1FORH 3EDJA 5TF2A 2BC4A 4LOFA 1DLFH 4FJYA 2NQDA 4G5ZH 1QLEB 1Q9LA 1U0QA 5JDJA 4CUCA 5F9DC 4HW6A 2YO3A 4XMPH 4PJBE 1QSZA 1AHMA 5I6KA 4YDIL 1W0WB 1W8OA 1DBBH 4E5ZA 4PJ5A 1GZPA 3O8XC 4LMQI 4DKTA 3VXUA 4H26A 1R4XA 1RV6X 2XZAH 4MMZC 1B4JH 3O6FB 1Z7JA 4KGLA 3ARDC 1NJ9B 3GZQA 5K1VA 3HZMA 4EIUA 2VLLA 3OXSA 3OLIA 4APQB 5F9JA 1JPTH 3TNMB 3U4EA 3TBTB 2NY1B 2YD1A 4MD0B 1NPUA 2CR3A 2DQJL 4GKZA 4AEZA 5CKAA 3JPXA 2VZ3A 3Q3GB 5EN3A 4I0CC 4FHLA 2DQIL 4PJ7E 1F3JB 4FTVA 4BDVA 4U2YA 1PBYA 1OTUD 4PB9H 4ZAKD 2A74C 3O3BB 1CWVA 4PTUB 4Z0BL 1GL4B 3L45A 3U79A 1HZHL 1EAJA 4HJ1A 4ZMZA 5IFJA 3NZHH 5E4EB 2FE0A 4PRNB 1U8JB 2XI9A 3QWOB 4PG2A 5BS0E 2YRBA 5I6MA 1BOYA 5T1DH 5C0FA 1RP9A 1SZNA 5GSRA 3BD4A 1LO5A 3PXHA 2CU9A 1NAMA 2VDQA 2CO1A 1NMAH 3VGAB 3NFPB 5ADPL 4YBLC 5KVFL 4BUHA 3K7UA 2ZOKB 4XPTH 4TTDC 3O9WD 4F15B 2FB4L 4NLAA 4HFUH 4IKNA 4R5TA 4XN4A 1KPRB 1PZUB 1KB5B 4YFLI 5G4OA 4KTEL 4PJXF 2JWYA 2G60L 4PJ8C 2HFEA 2Y5TB 5FW7A 2D9CA 4R4BA 1IX2A 3DV6A 4BZ2H 1LQSR 2Z64C 2NY3B 2A6KA 3PHOB 4PJGE 2YQBA 3ZZSA 5I16A 3OJ2C 1QEXA 1BVNT 3LZNA 2SEBA 5GGTL 1EFXD 1WWCA 1KJ2A 1P6AB 5DT1H 3MBEA 3L4ZA 2Y1AA 4EWRA 5IOPA 3HI1B 3T3MB 2GSMB 4HUWA 1X5XA 1BVZA 4C58B 3UBXB 3V7MA 2AQTA 4F1SA 4YC2C 2VR5A 4BCDA 3LMJL 3MLTA 2YKKA 2XTSA 2XWBB 4PI2A 3CN3A 4MZ3A 5CGMA 4Z5RA 1R3LB 5DCCA 1KULA 1SN5A 3HLAA 4TQ8A 3E6HA 4HEME 5GZNC 1GGUA 4G1MA 3QO0B 4A7UA 2ZWYA 3PWLB 3MA9H 3WUWA 3ZTJH 3ROOB 1TYJA 3KCPA 3D39D 4R4ND 5IREA 2PCPB 1U8KA 1T2QL 4KXCA 4NKMA 4LLDB 4PRAB 3SSGA 2DQEL 4KVNH 1AZVA 5IKCB 1Z9NA 5EU6D 3CZFA 4JHAH 1XKSA 3SPIA 4KAQH 3DMMB 3QH3A 4AYDC 1UQSA 3JSSA 4KKNA 5KSAB 1RFDL 3KBEA 3BIBX 4Q6IB 3AMLA 3SPVB 2X10A 4HAGA 1M2VA 1YQ2A 4HFWA 2BS9A 1SJEA 2B08A 1X7TA 1N8ZA 2E7DA 3LV3A 3SDAB 4A2GA 3N41B 5D71H 3MRHA 2VDMA 4J3OD 3CIKB 3I89A 4GUPA 3DPBB 3MUHL 2V2XB 4GG8A 3ZDZF 3QI9C 4GFXA 2EZ0D 4H20L 1YEDA 5H94B 1Q0YL 2JCWA 5I5JA 3TYGL 2P8PA 1WV7T 1F1DA 2ZUQB 1GVIA 3B7YA 3V0FA 4KQ3H 1CZ8L 4Y19E 4JPWH 4AE0A 2WBJC 5T3ZL 3RGVD 4HEPA 2H41A 1J8KA 3HPJA 3QS3A 2IXQA 3FCTA 3L48A 4I0KA 3KW7A 2R1YB 2AXGA 3QFGA 4KTDL 4NUGH 3U2JA 1E9OB 3EBIA 1XF1A 2H2SD 1F1GA 5EG6C 3U2SA 2AGJH 4RSYA 5FQDA 1YEJL 5FS5A 1R47A 4Y4KD 1MQKH 3Q2LA 4MXVE 4PJ9B 2UV3A 3LKPA 5D70H 3VQ2C 1Y1DA 3PWJA 3CN1A 4JM4H 3RRQA 4ODXB 3QO1A 4Y2OA 4BQCA 4XN5A 3V79C 2W38A 1TZOA 4XMKH 1ZLSH 3D50A 3IJ8A 2Q86B 4NJ9L 3UTPD 2NUPA 4J78A 2VC2L 3D9AH 3MBWA 4TNWF 2K8QA 1RK1A 2J12B 4XPBL 3HG1B 4XVUC 2IWFA 2O5ZL 1UM5H 1JK8B 2DD8H 1BZQK 4AMXA 5K19A 4EN3A 1JJUA 1HT6A 1BQSA 4ODBD 3ZUCA 4Q4IA 3QQXA 1PZ2A 2CO6A 1MG3C 2WNXA 4I77L 1JNNL 1XEUA 3HRPA 1C5DA 2GUOA 4LT7A 3B9DA 5T5NG 3WY2A 5FYKH 4Z3JA 2PBIB 3GS4A 1OP3K 3PABB 1RMFH 5C0CD 3HE6A 4RAUB 5F9AC 2IALB 3NIFE 1X44A 4A09B 1INQA 2W65A 1CBJA 3G5XA 2YKLH 2FGZA 5E6ZA 3P9MB 3AT8A 2IQ9L 4JY4A 4OQ1A 2ZOWA 1L0PA 1X7QB 2F5BL 3IMRA 1AHWC 4F3FA 2QGDA 2C1PA 3H56A 3PP3H 3V6ZB 3MRKA 5E08H 2WNGA 3SJLD 1SHMA 5E56A 4AGNA 4BFJA 1MWAA 2EDNA 2YEZA 4G6KH 4XC1H 1MG2C 3WHE0 5IHZA 5KSBE 4B97A 4YHKL 1WD8A 2GQHA 2DPKA 4RH4A 1MCEA 5FKAA 4YSAA 5HVFB 1L6PA 4PC0A 1RJYB 4M8VA 2PP9A 2RGSA 3AROA 3ZHNA 4B7LA 2OMZA 3G04A 3F7RA 5DRZA 4LVHC 4YHLL 5IP4A 2H4EA 4ERSL 3R1GH 5LQBL 4ZX6A 3S34H 1MCPL 4Y88A 1RXLA 1JVLA 2XYBA 3C2AH 5AAWA 2DRUA 3BRFA 5DVLA 5E5MB 1LYQA 1BVLB 4Y4HD 1ZTXL 2DKSA 3SKNA 5C08E 4Y7RA 3VH0A 1J86A 1NSNH 1T1YA 4HAKA 2DBJA 1RUQL 4G8EB 4PWEA 1W80A 1XMWA 3BZEA 1F42A 1Z1WA 1BPLB 1EFQA 2F6AA 3SKMA 3V5DB 1T6WA 3DARA 4Z95H 3BG0A 5EO1B 2OV0A 4YHNB 3MNWB 4DKAA 1XZWA 4YDZA 1L7IL 4XO8A 3QISA 4Y4FC 1NCHA 2X4OA 3TO2A 5JHDB 3P2DA 3WYRA 2GSIA 4MQXC 3TCLA 4I0PC 5FCSH 2BBKH 3GPSA 4M9OA 4N22A 1KV7A 1FL5A 1YNTA 2EO1A 4XVTL 2DLEA 3MACL 3T8XA 3FYIB 4JY6B 4ZO8A 4YPJA 3X13A 5FA4B 2ADFL 3SE8H 4QKTA 5BRZA 3WEBA 1RPQA 3EO1B 4ZUSB 3O4HA 3DBSA 1QNZH 4K4KA 2OTWB 4YHIB 3BDXA 4J79A 3LZRA 3LRSA 4FFVC 1IGFL 3PCYA 2RTTA 4DCQB 4EZLA 1R1CA 2XRAH 3BP4B 2CXGA 4W9CC 1YDPB 1K8DB 3IBOA 4X6DF 4KDTC 1HWGB 43C9B 3HMWH 2P43B 3BCDA 4Q2ZA 3I7HA 1R24A 1N19A 3DKHA 4OCSL 2WVVB 5DMJB 1SHWA 3APMA 1GW0A 4LARH 4RDQF 3BJLA 1GTNA 1X4XA 1QFWH 4C56D 4MJ2A 1FJ1A 4XBGA 4QRUA 3WIIH 1IE5A 2PTUA 2AJZA 3VD7A 3ARXA 3NJIA 2JI2A 3CVHA 1JNJA 3FSWA 2VLJA 3RWCA 2EKJA 3IGUA 4KZCA 3VQMA 4Z7QB 4WI7A 1CLZL 1I85A 4OLEA 4HUVA 5IW1A 2F7QA 2QEJA 5A2CA 4CJ0A 4XE0A 5M5RA 3WKML 3UP6A 4QRRB 1IARB 3MV11 2HVJB 1J8HB 3BEWA 2ZKYA 4XBEH 2JKNA 5GGSB 4JCMA 3WJJC 1FZMA 4NRZB 4D2NA 5JPNB 1TJXA 3L3IA 1Y6NR 4JGUA 5KS9F 2AGXA 1Q9KB 4L3EB 5I23A 2KHAA 3ISRA 4JAMA 1KENL 2BK8A 4KKLC 2TSAA 1NCJA 1FVEA 3EZ8A 4EI5A 4WWID 4U2ZA 3M1CA 5CGYC 1JXGA 3ULUC 4P99A 4FYQA 3BRDA 5DD1H 5C2UB 5EIIA 2DZEA 4PRDA 5HJDA 1MHHA 2VITB 4AM0B 4JFOB 4K8RC 1MREH 3FU3A 3MX0B 3MUGB 2ODHA 4YLCA 5C6TL 4KKZA 3BYTA 5HYSG 3QCTL 2WXPA 1KUMA 2YGQA 3EGXB 4UOJA 5E7FA 2X1WL 4FQJL 1DJSA 1RIUH 5D2LA 1X6NA 3TN0A 1Z9SB 4K5LA 2WQAA 4MJJA 3KGRA 2F53A 1GGBH 3MZGB 4PP2B 1NL0H 1E3ZA 2J5LC 1JFQH 1QEWA 1JZ5A 4JDEA 3LIZH 4DVBA 5DD5L 4JO2H 5E8OA 3OQ3B 2YBGA 1ETA1 1HHGB 4CMHC 2WO2B 2L04A 3TTSA 4A11A 2FATL 3LKNA 2I7OA 2RBLA 4CADB 2WQWA 3ASOB 4L1LA 4UAOB 5L4IA 4OGYH 5FO7B 1I8KB 2YPKB 2DICA 2DM3A 3L8QA 4N87A 4YIQB 3GSNL 4YHZL 2YPLE 5KBKA 3LEXB 1RD6A 4KX8A 5KVMC 4GKSA 3WN5B 1MRCL 2X7LB 5AUMA 3V0WH 2E0PA 4CSZA 2E9BA 3GM8A 4F8PA 3HG3A 3MBXL 3TFKC 4NJAL 4M56A 2FVNA 3QPKA 1IGJB 4I7ZC 3ZDYA 2R56L 1HEZB 3BGMB 1H0DB 1Z32X 3ZOAA 3OF6D 1T83A 2NX5E 3K8KA 4IOSD 5T33H 4XNXL 3OLEA 1G87A 1JV2B 3VD2A 1A47A 3ME0B 6FABH 3JVGA 2PTVA 2PXYC 1U3ZA 4C59B 2OZNA 2PO6D 4G43A 3O3EA 4PJDA 4JRXD 1TCRB 1WCBB 2YD6A 3BH4A 2WK2A 3WNOA 3W38A 2J1KA 5BUAA 1NUDA 2MPAH 1I9IL 4MDJA 4WTXA 1MPAH 3VG9B 1OZUA 5EORH 3S5LA 3OKLB 2VH5L 5E0FA 5INDA 4IK6A 3CHRA 4WHCA 2K1MA 3BUTA 5CM1A 4DJMA 4ZXBD 3RN0D 3KVDD 4XPFL 1BAFH 3UROR 3MC0A 1OO2A 2OTUA 2UY6B 5EOQL 5BZZA 1S7RA 3T6QC 3N6YA 5GZOC 2EXYC 5TF0A 4NO5B 1G9HA 5MP6L 3P4OA 4P4KA 4FQXC 3V6OE 5I5RA 1HSAA 2JNZA 4Y5YC 2VQUA 4HOWA 1SMDA 3F3HA 3IGAB 4X8JA 2MOQA 3VGDA 2I32A 5I17B 3NABL 2LLGA 1TTRA 1FBIH 2GFBA 4LK4A 4OZHF 1HZKA 2UWEB 5CBEA 2KT6A 1F4WH 4N0YH 5FK9B 1KGCE 5F0JB 1FYTB 4EQ3A 3WV0A 3JWOH 2KYIA 1N5AB 1YMHB 1S5IH 5KTEH 2NZIA 3UGXA 1CD0A 4KOBA 3QRFM 1MIEH 1UJTA 4L3CA 5CD3B 5J3HD 3KJ6L 1PY4A 4B3EA 2UZXB 2CCLA 5HHXL 4OF5A 4P5SA 1HHIB 3JBG7 5HGDB 4YXLL 5CJ5A 5FHAL 4QY8A 2Z9TA 2J6EL 3I8CA 1DDTA 4N8PA 3M86A 5CSGA 2DWSA 3WLBB 4M7ZC 2G9HA 1KOAA 4U1KB 4U3XA 1OW0A 4MVBD 5KYXA 2OTPA 1DQQA 3EYVB 3MUUA 1NFKA 5DC0A 3O2DA 2OSWA 2OJEB 2B9AA 1QYGL 1T66C 3BP5A 4FQIL 3P3YA 3VXNA 4X6BA 4WI8A 2WKLA 3X11A 4B53A 1MJJA 4LEXH 1BD2B 5MEPB 5I8EB 1DJZA 3GMNB 5H35B 3AG2B 4PJFA 2OJZH 2VR3A 4XP6H 4HIXL 4ESKA 4TULH 1NLDL 3LS4L 2AQ3A 1UA7A 3AT9A 4KXBA 4Y5RD 1Q9OA 4RGNE 3I6LE 2VDOH 1SXNA 4JANA 3A4FA 3FTSA 5JHBA 1HU8A 4EOWH 3MRMA 4IS6B 4WFHE 3R4RA 4Z76A 1XSKA 1BG1A 2YPVH 1A4JB 3IGKA 3O11B 4NLHA 3B7TA 5GGQL 1J05B 4ORGB 1MFDL 2X12A 4ZFGH 1M57B 2YARA 5F3HB 3LRGA 2H9GB 4UUJB 1A6WL 1XBRA 3RZWA 2OK0H 2P5WE 4BGDA 1S7TA 4RMTA 3HZKA 4W9GC 3OKOB 1G4RA 4FFTA 3EFDH 3D69B 1OIOA 2DS4A 3KLSA 1JHLL 5IB5B 1JPSL 3B83A 4NM8L 3PXJA 1CFSB 3AU0A 1D6EA 3FU0A 1IAOB 2EP6A 1RK0A 4Z7VF 4BH7B 1PKQA 4XN8A 2F1EA 4FHKA 5M94B 3OG6B 3K71A 1I1RA 3KPLA 5DO2C 5FUCE 3WLWC 3IAQA 3D3VB 4BFIB 3EF7A 4ZMLA 4IGBD 3SPHA 3DSNA 2UX6A 3FZUC 4UAHA 4JSPC 1TPXB 4KJYB 2VMJA 5I1EH 35C8L 4LSTL 4MNGB 4LCVA 4QRPE 2WZ6A 1O5PA 1A4KB 3KRXB 4Y9GA 2I24N 1XD0A 4M1DH 3O41A 5CYKA 1JV5B 2ERJC 4IIZA 3RTQB 3NUKA 4XI5C 1PZCA 2WP3T 3RG1C 5F96L 5I73B 4NFCA 3ES6A 3IKCA 5D93C 3BQVA 5AVTB 1A8JH 3N0PB 4GUCA 4OH2A 1UXMA 4DKFL 2E7LC 3PWPB 3UAJA 1IM9A 1IILE 3TJEL 3ZMNA 1EWHA 2C4XA 1S9VA 4JM2C 2QJDA 3AS0A 4RMVA 2OSXA 1Z2KA 2Y5EA 1HXMB 2OYKA 1J1XH 2KZKA 1VZHA 3QG7L 1OEZW 4U05A 2RALA 3LRHA 5BOZG 4ZMWA 4J5VA 3IVKA 4KNQA 3L7FA 5DJZB 4GGAA 1VPOH 1JE6A 1TZIA 1OZTG 2EIZB 1ZEAL 4GKOA 3T09A 1UH3A 2MHAB 3SOTA 4P2OA 5IQNA 4QTFA 1WDAA 1JD7A 4RISL 3D0VA 5CGTA 1DLHA 5KSBF 4W1TA 1HQ4A 1U8PA 1E5ZA 4QAWA 3NCXA 5D96C 5TK4A 1QFHA 2ZXEB 1XSIA 3ZSTA 4FQCL 3N1QC 1LO2L 3VSVA 3MV9E 2VXUL 3BQUD 2AHIA 5HDBA 1MY7A 3KBPA 5DYFA 2JJSC 1GJIA 3ZKMD 1PSKL 2AH0A 1A1NA 4YXKH 1MFNA 3EO0A 4WTZG 3LZOA 4TSCH 1RK7A 2VO5A 3RFZA 4X98B 5AVXB 1WFTA 1SYVA 1ZLEA 3FUIA 1E5TA 4TNVF 5F0LB 1ID2A 4ZQTA 1VSCA 2P52A 5C07D 4PJGA 3SYQA 2B8OT 3P77A 1R0AL 3VGEA 5MENB 5C09D 5IEHB 2IOOA 2XN9B 1A7RL 3MRQA 4ZZKA 3FQYA 2CQVA 2BXZA 4FKKA 1U8QB 4HKBB 2D0HA 5AVYB 1KCVL 2PYEE 1XZ0A 7FABL 4U1GB 2FD6L 5BZDA 3GHEL 3N40F 2Q8AL 3C5SA 1BQLL 4DP6X 4GAJL 4YDNA 1CUOA 3GTTA 1V7MH 1NLBH 4RMQA 3GGWA 3ARYA 5GISL 5I1KL 4OFIA 2WWMC 5I8OL 4MD4B 2CE6A 4HDJA 4A0AA 2OCCB 4PY8J 1FGNH 2G2RB 3QARA 1K8IA 4KKAC 1SQ2N 1DQTA 2ATKA 5E94B 1IFHH 4QRSA 2BVEA 2W9DH 1QFWM 2YC1B 3LYRA 3MMEB 3ODTA 3VXRA 1F18A 1WZLA 3OSVA 4P3DA 1FZJB 3L95B 4I2XB 5DK2B 1NGZA 4X4YA 5C0DB 1TIUA 1KWKA 2GJZB 3TA4D 2VDOB 4RIRB 5TK2A 2Z7ZA 1Q94A 3GQFA 5L2KD 1C1EL 3MLWH 1AD0B 2V7NB 3ABMB 3WKPA 1FIEA 4P46C 3VFRA 2JB6B 1UTDA 1YEWA 4OCMC 2IMMA 2XOTA 4U6XA 1OAYL 1Z3GL 4NPYA 3SDDA 3INUL 1J9QA 3JWNC 4YDVB 4OZFA 4W93A 4UOQA 1U91B 1PX8A 2X9ZA 5IHBA 1KT2B 4PTTB 4TV3A 3CFBB 4IRZL 3H9HA 2ZUTA 5KN5A 2CDEA 2DQUH 5FLUA 4BYHA 3JZHA 5TPWL 4OKVA 2ZCKL 3U30C 3RIKA 1WJ3A 5CXPA 5JQ6H 4TVPE 4MJIB 3EAKA 4WIQA 2EXSA 4J3OF 4Y19A 5ALBL 3QI0A 2XN2A 4Z3EA 2OMVA 1HAUA 1E0OB 2F8IA 4EI6B 5AVWB 1J11A 1NOAA 3GIVA 4LHUG 2WNKA 4ZYKA 4HG4J 1YPZB 4NT6B 5EU5B 3I6KB 3NCBB 1AQ8A 2IBGA 1T20A 4M03A 5TQ2L 4GFTB 4OF7A 3UEZA 2IH3A 3BPNB 1AD9B 1E6OH 4AV5A 3RJDA 4P3CL 1P1ZB 3BH9A 1G1OA 1JWUB 4XXWA 4KRPC 4K3DH 3X12B 2KUTA 4PG2C 1KBGL 4PJHF 5HHVH 5K1JA 5C0GA 5E95B 3NQIA 4AG4L 4UT9A 1N18A 3MXWL 3N0DA 3FBKA 2C9RA 3TVMA 1QLRA 3GBEA 4Z7VB 4H8UA 3RL2B 1HOCB 3CXDL 4DO5A 4CN6A 2FJFA 4KZDH 3NA4A 3P4LA 2DI9A 4DN4L 3ZE2E 3EGSB 2DTSA 3DXAB 4IBQA 1T1XB 2ICEB 2ZJSL 4FZ8H 1CTMA 5CUSL 5FGRA 1IAIH 5DJ8B 1HHHB 2OMTA 5DWUH 5GXHA 4M3KB 4HUNB 3MR9B 1SDAB 3GRGA 3WNPA 5IFAL 2EXWC 3VB8A 3OX8B 1MFCH 5FV1L 1THAA 3GZKA 3MBEC 1TJGH 3FU7A 5EZJB 1CFNA 2X2HA 3BC9A 2GIYA 3OZ9L 2G75A 3S5YA 4L29B 1KC5L 3C6LA 5K33A 4XN2A 4DO6A 4F37K 3NIFA 3DURB 3FUHA 5IQ9B 2AAAA 4CY5A 3CDCA 5CN3A 4AMKL 1V5JA 3VYOA 4D0CA 1BF2A 2JLPA 4KJPC 3MODH 4GW5B 1GPOH 4Q56A 3HHSB 2YJLA 4PRIB 3H3BC 2R7EA 3L3KA 3BO8A 4NDMB 2OL3H 3MLPA 4AV4A 3NCMA 2B16A 5AYQA 1R3IH 3DVNB 3EG9B 4AUUA 5EDSA 4OLVL 2E7HA 3QA3B 4MA7L 4QF1A 4YX2H 1EJOL 1I4FB 4JFPB 3U82B 5EAMA 1RVFL 1A7NH 4NM4H 4RRPM 5C3LD 4LRNH 5BPPA 5J12C 4JDVA 3HG1E 5KG9B 4HWBA 1ET7A 1S78C 1NFIB 4WW1B 3THML 2AVFA 5FO8A 3QJOA 1H3GA 1P5VA 4NO3A 4OV6F 4YAQA 5SWSE 1AO7D 3O9WB 5D1QB 2FK9A 2V3DA 2AEOA 4A7SA 1Q9WB 1VDGA 2D3JA 3AXIA 4PG9B 4LLMB 3T0BA 4DGIH 3HN5A 2P9LC 1KTBA 3EJZD 2B39A 2V5TA 3B9KD 4X6CB 4JJ5B 3W82A 3MV8D 4ODVL 4TNVK 2NW2A 2GY7B 5FYLE 1EEYB 4DP7X 4LG8A 2P9PC 5J5EA 3CC5B 3LRKA 1NTDA 1TEYA 3VTTA 2O6PA 1SN2A 2OKMA 1TQUA 2RQEA 2M1KA 3LSOA 4HUUB 4PJIB 1IE4A 1O6SA 2QQKH 4HH9B 1QBBA 1WFMA 3QDMB 1EFXB 1FFQA 3B2UC 4GI6A 5CD5D 3TIDB 3FTGA 4W81A 3WEXB 3PV7A 2CJ3A 3MQIA 1MZZA 3EYFA 3NPSB 3QXVA 3K8LA 4LBEA 5HE1B 3HJ0A 4J2XA 4BCYA 1AR1D 1ZE3C 2VLKB 2XDHA 3FH7A 2CHZA 2X70A 4QNPE 3RZCD 3WIAA 2H6KA 4NN6C 4PJEE 2I9TA 3RUGF 3L9RB 3O4GA 2KLSA 2R51A 4M5SA 5DO8A 4XCFL 3FT1A 3GPEA 3O3DA 4JFQB 5TDOB 3TNNB 2YK1L 1ZHKA 2J8UE 2YXFA 1NANH 4JN2A 5LGHH 5DUBA 3WD5H 2R15A 1T89A 4RMRA 5AWNH 1R9FA 2FNWA 5EIQA 3D39B 2P26A 3LDBB 2CHNA 1TXKA 2WKOF 3BT0A 3Q8BA 2K6WA 4BWTA 4PY8I 4TPRH 5EU6B 4Y9BA 4OR1A 4QHMA 2WW8A 3AWGA 1RLWA 4JNXA 2BVQA 3DI3B 2NYYD 4JG1H 1R3KA 3L5HA 5CSZA 1B9KA 3ARFD 4Y5XA 1CYWA 4U1MB 4KXZI 4W4OA 4XNYL 3ZW3A 3PDOB 2OSLA 4LASH 5JHDE 3MVDK 1E8ZA 3TX4A 1U8OB 3UR4A 5C2BH 4AXWA 1MJ8L 2ZONA 5KZCD 2YA0A 2XFGB 4FNLL 1U9KA 2BZCA 3BKJL 4ZUWB 3D33A 4KTYA 3HE6C 4KNUA 2Q7YB 4N2DA 4IHOB 5KWYC 3Q8AA 4UI2A 4G8AC 4XBPA 4MZ2A 3IETB 2QR0B 4UOW0 4OW6A 1T0MB 4U6YA 5F7HA 3QIUA 1MFBL 3T4YB 4N9GA 1UM4H 4HU8A 2ZCLL 1UH2A 3H6JA 2YGVA 4UNIA 3W0WD 1O6FA 2YA2A 2R9HD 5M5UA 3IK2A 4HX1A 4DVRH 1CGSH 2ZOLB 2VXQH 1FL3A 1TETH 4YVUA 3MRDB 3WNIA 2YD7A 3K4AA 3RX9A 3PJLA 3MJ9L 2EVGA 1EJ6A 3KLAA 4PRHD 1LE9A 1NC4B 4Y4KB 4K5MA 1MEXH 4HT1L 5M5VA 3STLA 1T0OA 2O5NA 2VR7A 2G4EA 2IH1B 2XQYA 4MXQD 5IJDC 1RUAH 1YEKH 2Z92B 3SHSA 1ETZA 4CJ1A 4RLDA 5E8EA 1MCRA 4IU2A 4HGMA 2OCJA 3ML8A 4X6FA 1J0ZA 5EWIL 1HYSD 4OU3A 4JFXA 2Z0UA 5AAWC 2OL3B 2GAZB 3DX3A 3TZVA 3QNYB 4WW2F 4P5RA 4Z7QE 3DRQA 3L6FA 5DHDA 3HNVL 1IBBA 1KLGA 1SJMA 4BHUA 4AM0Q 1MFAL 1V7NL 4KXDA 4HCRL 1CD8A 1J8HE 5K1NA 1MRFH 2FBOJ 3QJZA 3UPAA 3WFDH 4Z7UF 5A3ID 2KMWA 3W9EB 5LVEA 5B39G 1CO1A 1N59B 3P1VA 5I26A 4BCZA 2VYRE 4JFFD 4KK8D 4L3EE 5HY9A 1E4HA 3MLYH 4HXBL 4AMWA 2FO4B 2F7PA 5DFVC 5HDQL 2AK4A 5C0CB 2VDRA 1IKFL 5F7NC 1BQUA 1MZYA 3EJPA 4OI8A 3MGAA 4R97C 1PPIA 3GI8H 1LP9E 4PGJA 3OKWA 2KBGA 1PQZB 3MOAL 4UBDD 5IBUB 3KZ8A 4CILA 2IOMA 4ZOVA 5FW8A 1A1MA 1YFQA 3QXWA 3L3JA 2H5UA 1E8WA 3LH2L 2PW1A 1AG0A 1MKFA 1BQHA 3R8BB 2DMCA 3RU8H 1FP5A 3LNEA 2CDGB 5HGBA 2ZWSA 3V4UH 1UJ3A 3LQZA 1JZHA 2FEEL 2ZOTA 5DMIH 3ZHFA 1T4KA 2BNRE 4JZJA 3SO3B 1W6WA 2ZSVB 3SQBA 3ECBA 4LLVA 5LBSH 3VI3E 4KDVA 1A6PA 1KBWA 3BI9X 3VFMB 2HXCA 5D55A 3BT2L 2WZ5A 4NFBA 1JPEA 1FVCB 4X5QA 3TF7C 2EEDA 5ESQB 3Q2CA 4Y4HB 4HK0A 1FSKC 5DZOA 4OCYH 1I85C 1N64L 4MDIA 2KPNA 4GKNA 1JGUH 1AIZA 4FB1D 3T0ED 2IUPA 4TUOB 4HBCL 2BFVH 4WGKA 1OPGH 1ZXKA 4FLQA 4M7LL 2J21A 5AG8A 2VSCA 3D0LB 3VFNB 1AJ7H 3VWKA 2VDKB 3LKQB 4GXVL 4U31A 3GK8L 4IKJA 1BAGA 1EDYA 4HIJB 3QZWA 3EXJA 4OAWB 4EI5C 3EUUA 2G9KA 2NY7L 3LH8A 3L5XH 1UT1A 4XX5A 4DK6A 4E9TA 5J56B 1EHNA 1HX0A 2HJLB 2R2HA 2AJ3A 3SDCA 5HYJD 4DN3H 4F20A 4FXGB 2PR4L 3U0TA 1T5WA 4XNMA 4HS6A 4PWHA 2HFFB 4R2GB 1PG7L 2J8HA 2DQGL 5DRWB 3IDJA 2Y1ZA 1ZHNA 2VN6A 4KVCL 2BNUA 3TN0C 2AJYH 2R23B 2HTKC 3LNHA 2IAMD 1DVQA 2IF7A 4M1GL 3UIZA 9CGTA 4PLKD 5T5FA 5LNGA 3WMPA 1T7XA 3FYEB 5B38B 2AANA 1QBML 1EJFA 1KJVB 2H32H 3P9WB 2ARJQ 1P4LA 3MZLA 1X5ZA 1I7RB 3H7BB 2O61B 2CO2A 3UC0H 3CFNA 4G6ML 1D5IH 4AIZA 3DROB 1U8IA 4NQCE 1SXBA 4UTAA 4BK8A 5AZEH 3PLYA 4QOKA 3POHA 3TPUB 1JAEA 1BFOA 2DL2A 3LN5A 3CSGA 4X3EA 2UWEE 5AKSA 2DWDB 5T3XD 4A2DA 2Q0ZX 2AEPH 3LEYL 3SHFA 1FYTE 1FWXA 4UV4L 3DXMC 3RVWD 4WEBL 2KZBA 1TTGA 3LHPL 1CFVH 4ODTH 2BDNH 5FFGA 4JFHD 3UZQB 1FC1A 3AG3B 2GNQA 4YDLC 5EBWA 2BJMH 4L8DA 3TGXA 1MFMA 4XC3H 1NWPA 1JRHH 1AYOA 5GGVL 1G7PA 3W39A 2P5WA 5I8CB 2EEAA 2PCXA 1M1SA 3OR7B 3RTLA 1IAIM 1UD5A 3ATEA 4FGMA 4YE4L 4E9XA 1MNNA 1YMMA 4HUCA 2YNPA 2W0KA 3PJSA 3D4GA 1T83C 3KR3L 3VGGA 4PIBA 1M7XA 1G84A 3DSFH 2VT0A 3QG6A 1A3LL 2ZOUA 2NSQA 4NZUH 1QA9A 3OHXA 1L0QA 3FQRA 2GY5A 1FG9C 1GOHA 3DOSA 2VWEC 3JVGC 5GGRY 1BD2E 5IB1A 4XH2B 2CE8A 2J56H 4XWOD 1OB1A 1M1XB 1NM4A 5E6RA 1TJIL 3W57A 2WUCL 4JRLA 4H0GA 5E8DL 3UABA 2DJSA 3AY4C 4WK2A 1CT8A 3BSZL 4S1DC 3FRPA 2VXTL 3L1EA 1IUZA 1YJDH 4DKEH 3PHAA 1BMWA 4JQVA 3G08B 4BQ9A 5ERWB 2NLJB 4ZOYA 2ICWB 1VFMA 2E6PA 5DSCA 4Z7UB 3SXTD 1GS7A 3GBNH 5DEFB 1AOZA 3ZYIA 2B1HL 3VMOA 3HC0A 3HN8A 4K7PY 4U3SB 3U0PB 5KYYB 2Z4QA 1K5NB 2Q3ZA 1IIKA 4GG6B 5CEXB 4ZK8A 4MRCA 3OV6A 4MS8C 2XQBH 1RZ8B 3S3CB 3KBFA 5FKPA 3W2DL 3VUAA 2D8KA 2NY0C 2ZXWB 4RQQA 2C9XA 2UYLB 3L13A 4E5XA 2Z7UA 3LQAL 3PE7A 3IEAA 5T5NF 4E36A 2D4FA 2V33A 5E6ID 4FI7A 5K59E 4FNPA 4ZTPH 1SOSA 3KD4A 2COVD 4HETA 3FT2B 4Z8FL 1VERA 2Y7OA 4GRWE 5CHNB 3HBGA 1JZ3A 3ELQA 5FDWB 3ZX1A 4FXKB 5HYEA 3CE1A 3K74B 1OF2B 4KV5E 4LU5H 1W0WA 1WEJH 3D3VE 3SYOA 1TYRA 3ECUA 1CE1H 2EDWA 2PN5A 2A0LD 2F74B 3DECA 3O6FA 4PJ8B 4NZJA 2BNQE 4ODWB 1NJ9A 3RL1B 3HC3L 3M6DA 2P8MB 2PO6B 4AH2B 4HQQH 1HK6A 3BGFC 2EDYA 4APQA 4JRXB 1GIGH 3TNMA 3ETTA 4MB4A 3TBTA 4H1LH 1TLMA 4MD0A 3PF2A 3ZQXA 5CKGA 1CDGA 1EPFA 2AJSL 3GO1H 3NSXA 3ZE1B 3QHFL 3Q3GA 3A4DA 4HCFA 4PUBL 1KCWA 4KZEH 4ZXBB 4XO3A 3MKQA 1MOEA 5IEKB 4R4FH 5E00B 3NVQA 1T03L 1F3JA 4YFLF 3QRGL 1NDMB 4J1UB 5AFU3 3DI2B 2K0RA 3O3BA 4PTUA 4M43H 3UO1H 5MHSD 1KIQB 4CVXB 1CDIA 1USQA 3PV6B 4PRNA 1L9RA 1U8JA 3QWOA 4ERQA 4P59L 4WDIB 2VN4A 2P48B 1HCZA 2H32B 3Q2VA 1JYNA 1FGVH 1S7SB 5IJ7E 1OAKL 3NFPA 1AE6L 4K5NA 1YNLH 2IWGA 5A2AA 3HC4L 2JJTA 2VSDA 3TCXA 2ZOKA 5DFTA 2IDFA 2ENSA 1BIIB 3L1OH 5IT2L 2Y7SA 3OZLA 1J9TA 4AE1A 4FE9A 5FWQA 5MI0B 4XMTA 1KPRA 1L9OA 1KB5A 4TF4A 4RMWA 4OZUA 4AGQA 2J4WH 4Q6YA 2Y5TA 2AQPA 4DEPC 1AHKA 5C71A 2WXLA 4H8WC 4J28A 4ZS7L 5HHMD 3ATFA 2G9AA 5JW5B 1FZKB 2KH2B 3PHOA 3KE0A 1G9NH 3WFBH 5MENE 2FQGA 4KBPA 1OANA 2XN9E 3GSXB 1RZGB 2H1PH 2VLRB 3TH4T 2UUDH 1BZOA 5KVDE 1XIPA 1HL9A 3MAWA 5KYWB 3C6SB 3WKYA 3AXLB 4RMUA 1I7TB 5SWZD 5J6GB 2H8PB 3HI1A 3SLED 3T3MA 1UWFA 5CJXC 3ZDXB 1QP1A 3FQWB 4KNSA 5I1GH 3UBXA 5T1LB 4XNAA 3CU1A 2UXFA 4Q14A 2X6MA 2XWBA 5EBLB 1U3JA 3GZOA 1UWGH 4N2MA 4A38A 3CHOA 3Q5TA 3UAJC 3D52A 3CV5A 1MVUB 3QIWD 5B7EA 4BFFA 1R3LA 5B1AB 1Q90A 1W2KT 1NBVL 5C0AE 3QO0A 5F7EL 1E8NA 2FEJA 2WB1A 3PWLA 2IUQA 2E9GA 2EDQA 3ROOA 5BUGA 5HP5A 4DERA 4LIQH 4HZLB 2PCPA 3K6IA 2NY4D 2I9LB 4LLDA 4PRAA 1OWWA 5G5DB 2D31B 2EH7H 1QPPA 4PGDB 5IKCA 4OLZH 4KK9C 4Q9RL 3B1TA 3U9UB 4F7PA 3DMMA 1EZLA 3MXVL 5KSAA 5HHOD 1E42A 4Q58C 4MASA 4Q6IA 3SPVA 1CF1A 2FLMA 4WRLA 1XB6A 1B0GB 3CZNA 4JKWA 1EX0A 3QEGL 1DYZA 1MCLA 3L9EA 3QPXH 4JM0A 3SDAA 1F4XL 2FJGB 2AJVH 3MJGX 4DW2H 5A2KH 5IQOA 5AVZB 4JGMA 4F5CA 5I30H 1KGJA 5D6CB 5ENWB 2YAQA 4QXGH 3DPBA 1UOVA 1H6EA 2V2XA 3V9CA 2DLIA 4M61B 1QOKA 7PAZA 1TQBC 5H94A 3NTCL 2JKWA 4XCCH 3ULUH 1ADQL 1YA5A 4K7PX 1FPTL 4OF0A 4GRLD 2XFXB 4MJIE 3TBWB 3SJVE 3O6LH 3G5ZB 2FQEA 3H54A 3E2HC 4KWUA 2R39A 3MUZ1 1YPZE 4AK1A 1PZDA 2OZ4H 1E65A 2R1YA 3T71A 2C1OB 3WN6A 4OZ4B 1E9OA 3RY4A 2FH6A 2AZUA 5E4IA 5I74B 5BCAA 2YUXA 2VXVL 6TAAA 5C3TA 2XTJD 3DO7B 3I50L 2B5NA 2YMUA 4PJ9A 2ZXCA 2WXOA 3LKRB 4HS8L 3DX1A 4NUJB 1G6RL 2CPUA 1SOQA 3IB4A 4ODXA 1NEUA 2BOCB 1CF8L 4H1LB 3HI5L 5L2JB 1XL6A 2Q86A 4AGPA 3QCUL 1QX1A 2JB5H 5LCVH 1LK3L 4FJZA 4PEEA 1MW1A 4PP1C 1JZIA 5M5TA 3HG1A 3T0DA 2EBSA 4L18A 3OAUH 4PJCB 1JK8A 1MWOA 1OK0A 3DXAE 3LKSB 4HJGB 4U6HB 4CVUA 4H8HA 2XKNB 3NAAL 2A9BA 5JXAH 1MCNA 4N20A 3KWWB 5EA0L 3CFKB 3EJYD 4H0LC 1M3IA 4AQAB 1KN4L 3BQUB 1KV3A 4KQ4H 2QVIA 4GJTB 4D8PB 1TYQC 3VI3F 2KDGA 1XO8A 2V17H 1MI5E 4PS4H 2RQ8A 4G55A 4X7CC 1AMXA 1TEFA 3PABA 3QHZH 1TQWA 4RAUA 1WICA 3ISYA 2ZUVA 4XPAL 2IALA 4YSOA 4OQTH 1ASQA 3WXWH 5K9JH 4A09A 4I13B 2Q7NA 2X4RB 3CN2A 1R5WB 1ZDSA 5C09B 1S3KH 1SBSL 4AQEB 3PIQB 3P9MA 1RU9H 4W9KC 1X7QA 1VHPA 1NEZB 2DTMH 4PRIE 1IJ9A 3GHPA 4BSVB 4BZ2A 4MB5A 3V6ZA 4XGZB 5J6SA 1GAFH 5F3BB 5FLXg 5D1XE 4FP8H 4PHZA 5D72L 1HSBB 4NHUB 4J81A 3EQ7A 4DGYL 1BCIA 4GQZA 1WFUA 4K2UL 1HC1A 2BVPB 1CL7H 2VQTA 2WBWB 4N5ED 3A21A 1YNKL 4GAYB 1VCBC 4HXAL 5DRNB 3FUFA 4KJQC 2CIIB 3BWSA 1F11B 4XVOA 4GGDA 3CVIL 1RJYA 4YHOL 1ZLUK 1P4BL 2XZCH 1C5BL 3GKWH 4I4WB 4JHZA 1JUFB 2XETA 4R26H 1XH1A 1PLBA 3TVMC 3PGFL 5TDPB 1ZV5A 3FN3A 1ZCRA 1NCBH 5JUEH 1AZCA 2GIXA 5D1QE 2R0LH 2WO3B 1E5UI 4RVBA 1UKTA 3NACL 5EOTB 5T3ZD 1BVLA 2XA8L 5AOMA 1A5FH 2B1OA 4LP5A 4G8EA 3RVVC 4DEWA 4FXTA 5I5MA 5L2KB 3VDBA 5FUOL 2H45A 4IMKA 3UEQA 3T08A 2BLFA 4FHJA 3V5DA 5EO1A 3FSOA 5CN2A 3MNWA 4YHNA 2H3KA 4PJIE 4JL1A 1AZZC 3EI2B 4B9CA 5JHDA 1CIDA 1R17A 5E03A 1T6VN 3QDME 1RZIB 2BP8B 3D85D 4HF5H 3WDJA 4YVNA 3NGBB 4DT2A 2FGWH 2P42B 1SNRA 4JY6A 2VLKE 5FA4A 4JY5L 2EDMA 3C6LC 4R90L 4JFUA 3EJTA 1XGUB 3VSQA 1ESOA 4NSXA 1OAUH 1TKWB 2GITB 3EO1A 5BQ7B 4ZUSA 2OTWA 4YHIA 1F45A 1QI4A 2QVTA 3RWDB 1VLXA 2AGYA 3FONB 1A7PH 4YPGB 3BKYL 4DCQA 3UTSE 3BP4A 3RFRA 3AB0C 3B7RL 1YDPA 2AC0A 1K8DA 3SGJC 4XXCA 4DESA 43C9A 3S6CA 5LXGL 1SF3A 1TUPA 4CBZA 1TO4A 1DJYA 4NKIH 3U83A 5JHLH 1A6AB 4IKKA 1TTAA 3HKZA 3HJEA 4PSPA 1CDBA 2H68A 1UYWH 3V7DB 3EI1B 3MJ6A 4OLWL 2WVVA 5IHWA 1MHEB 1JWSB 4WCYH 5HHPB 4JPKH 2QTVA 2VZUA 2X4SB 5DQ9B 1E40A 4J3SA 1DBJL 4L2LA 1LWJA 5FECB 4ZOZA 5C6PB 3L5JA 2BXYA 3QUHA 3UAEA 1KXHA 5TQ0H 1NH6A 4Z7QA 3KWVA 3KLDA 5ADOL 1CFQB 2DH3A 4GZ8A 2APTA 2EEBA 2J7LA 4QRRA 1GG2B 2HVJA 1J8HA 2P80D 3HBQA 4LE8A 5GGSA 5CP3H 1IVTA 4LCCC 5I9QC 3H0TB 1CDYA 4NRZA 4WGVB 5JPNA 1K4DB 1SY6H 3BUQA 1OSEA 2FYYB 3WGUB 1CGVA 1FNSL 5BOJA 1Q9KA 4L3EA 1S2EA 1P69B 4HJTA 1B9ZA 1S6NA 1HHKB 2YRPA 4X5RA 3H1ZA 1H3VA 1I7ZB 4RGOH 4YR6B 3S36X 2X6UA 4X63B 2VITA 4AM0A 3NJJA 4F58L 4JFOA 3OLDA 3MX0A 2JCCF 3MUGA 3QDJD 2X89A 2Z31D 1Z5LB 3EGXA 1ACYH 1YEIL 3UKRC 3U36B 2B4CC 1ZY9A 2MWCA 3MRGB 1Z9SA 3M17B 4LLAA 3GMLB 5FDYA 3IDYB 3RQ3A 5C0EB 4KV5F 4PP2A 2CM5A 1UFUA 1NMCC 2VDPH 4F2FA 3ZJAA 3EGDB 1IGYB 2DIAA 4YHML 3VFWB 2E59A 1XB3A 1ZXQA 1LQBC 5I0XA 3WTTA 2I3TA 3EU7A 3PWUB 1MFVA 3ORVD 1HHGA 1CFMA 4MQ7B 5JR1L 2EVIA 3UGEA 1DUYB 4XHJD 5C0ND 4CADA 3BVUA 3IDMB 4PLOB 5FO7A 1I8KA 2YPKA 2FH8A 3NN8B 4YIQA 5HJBA 4Y5XC 4CAGA 1F2XK 4W4OC 1B0RB 5CJQH 3KYAA 3UTZB 1HL5A 3LEXA 3V95A 2YHGA 2Y6SC 3QJUB 3WN5A 3MV8B 2X7LA 2WLZA 4YZFE 4EDWL 1EXHA 4QGYA 2JJWA 4BBWA 4JPIB 5JORB 4YHYC 5I28A 3AG1B 4TTDD 3IMTA 5C7XH 1IGJA 2N7AA 4FLSA 1JXDA 4AC2A 1HEZA 3BGMA 1UTCA 1H0DA 4L48A 5L0QB 2K9UA 4YGAB 4K94L 2ED7A 2R29L 1CXHA 2WXFA 3B2VL 3DX9B 2C26A 3UG4A 1JD9A 1N70A 3QIUC 4LESA 1JV2A 2EE2A 3ME0A 1AR1B 2BSSB 3QXDA 3RZCB 3T9WA 4IKLA 1BEYH 3QQ9D 4XYIA 4M7ZB 4UQEA 1K3ZA 1TCRA 1WCBA 4NNXB 1D7DA 3T4AB 5ISZB 4YDKH 1YEEL 2BMKB 2JIXB 3F6LA 5DC2A 2YGNA 3UMNA 3HG2A 3FRUB 3OKLA 5IVOA 2CCVA 2CR6A 3NJVA 4U6VL 1T1WB 5D7LE 3MCLH 2UY6A 4L8BB 3NFSL 2UVFA 3TFBA 1GR7A 2WVUA 4ZX3A 4LCWD 1ZLVH 4NO5A 3IU4L 4IBLT 4U0RC 4P2RD 2H1XA 2DH2A 1CXLA 5CWSB 1X9QA 3HNTH 4N6RB 1Q8MA 3BPOC 4OFQA 3TZVC 5JOPE 4MMXB 3IGAA 5I17A 1AGBB 1KPUB 5EOCH 2UWEA 4ETYA 5FK9A 4WU5B 5I75C 5DC4B 1RZKL 1FYTA 3S4SG 3ARFB 5JOEA 1EMTL 4I1NB 1JPFB 1N5AA 1YMHA 5FC9A 3JAMg 2ITCB 5IJ8E 2JELH 5F1KC 3P11L 5CD3A 3E8UL 4OD3L 2VLME 5KZCB 4V1DD 3I84A 3QJVB 2UZXA 3F7PC 5B22A 5C0RL 3ZRSA 4ELMF 1HHIA 2AABH 4WAFA 4KI5E 5HGDA 1C9LA 4ONOA 4KRMB 4LKCA 3VD0A 1RSFA 4KKCD 3WLBA 4U1KA 1P5UB 4BD4A 1WIOA 3EYVA 1IEHA 1RI8A 3FH5A 3OC8A 2DWTA 2JJUA 5AW5B 2OJEA 5CXBB 2R0KH 4H7VA 4U4BA 3UADA 4RE6A 1K72A 1QRND 1JOFA 1E2WA 2EAEA 1TQTA 2AV1B 2X4UB 3CLEL 4UDUB 3F05A 1EO8H 1BD2A 3QI9D 4M6ML 4W68A 1TNNA 5I8EA 5MEPA 3N44F 5AAMA 2X53A 3GMNA 2IUVA 5T3XH 5H35A 2FX8L 3BH8B 2G0KA 4Q97A 4OM1H 5C92A 1WWWX 2G99A 2OBGA 3IFNH 4QRJA 4X80L 4WZ9A 3EO9H 4D9RD 3CZKA 3HB3D 5DLML 3MCG1 2RH0A 4HSQA 2AVGA 5EAPA 3L08A 1AGCB 5AL8A 5C97A 1TZ8A 2WTRB 3NSFA 5D7SH 1INDH 5D93B 4IS6A 3QDGD 2XPGB 1HFUA 4RFNC 2IG2H 5DS8B 5E5UB 4YFEA 2IANE 1A4JA 2ID5A 2F58H 3SQRA 3O11A 1OP5H 1AY1L 1J05A 2VDPB 4ORGA 5CJOL 4BUJC 1UENA 4OFYD 1RCYA 3LIZA 1LNUB 5F3HA 3QCVH 2CGRH 2H9GA 2WC7A 4UUJA 3OKOA 4TVUA 2K3TA 2NZ9D 2G3XA 4ABVA 3CLFH 3GSRB 2VO8A 3D69A 1H3PH 1TJHH 4M48H 4N0CD 3VWKC 4JFFB 3DBXB 3RURA 5IB5A 4G7VL 3BFWA 4W6WB 1CFSA 1W72H 1IAOA 1YYLL 1DJXA 1KYOK 4WKXA 4YWGH 2R1WB 4BH7A 4AMYA 1NQBA 2Z4TA 1FHGA 3BZFB 3SDCC 1D9KD 1XCQB 3D3VA 1RPKA 2GJ6D 3GT6A 5EZOL 1K9TA 4BFIA 3P02A 4A7JA 4J7RA 5CZXC 4N1CA 4KJYA 1XD1A 4MNGA 4WF7A 4NQTA 1A4KA 1C5CH 3ULVC 1AFVL 4MSWB 3EH4B 4BL0A 1JV5A 3K2UL 2H3XA 3RTQA 1IMHC 5DHMC 1OGAD 4MA1B 4FWWA 3FJTA 4Y16D 1SEQH 4LSQH 3VG0H 3PWPA 3QWRA 3WAKA 4L8SB 4CRPA 4R9HA 1YEGH 4GS7C 4P4RB 3BAJA 1HXMA 2VDNH 1KELL 4PMEA 1A64A 4NO2B 4GG6E 1WZMA 1HTYA 5E0QA 2YNOA 3FQNB 3NH7H 25C8L 4O2WA 5DJZA 4Q9QH 2EIZA 3RSEC 4G9FD 2MHAA 1UOPA 1QBAA 4WFGD 4W9ZA 1AC0A 2W9EH 1AKPA 3OPZH 4GQPH 4U33A 1QNIA 1G5AA 5CU5A 43CAB 1KEGL 4G8GD 4RFEB 2OK4A 1OY3B 2BOBB 3V4VL 3K6SB 2WXQA 3PWNB 5IUSA 5E1AB 4I88A 1IGCH 2CJSA 1ODAA 4I8DA 2XG5B 1IO4C 4G72B 3R8QA 4QYAA 1RUPL 4Y8AA 4JO4L 5EF0A 3MI6A 1DN0B 1NIFA 3DIFB 4PU2A 2B1AH 3QPQD 1V05A 4JO3H 4NP9A 1JGIA 1ILUA 3ZGIA 3VCLA 1JNLH 3OHXC 4X98A 4P46B 4ZPTB 4FA1D 5HYJB 4RWYH 2VM9A 4GM9A 5BVJB 1IL1B 3QGVA 2A1WL 5MENA 1DBAH 1YY9D 2F7IA 4XVSL 1ZA3B 5IEHA 2XN9A 1QI5A 1XXDC 3KBHE 4JREC 4MQXD 5B3SB 2F18A 3ZE1E 3ZQWA 3FOMB 4KMTL 1U8QA 2WGXA 4HKBA 5I1HL 4GQQA 3FNKA 3N3EA 2DQHH 4ZZFA 2QZPA 4PMFA 5I71B 2IAMB 1KMGA 3ARGC 4JDTH 1SMAA 4JQVC 3FU5A 4ZUUB 2VXSL 3U30B 1Q1JL 3IFLH 3VI4E 2UZYB 1OHZA 3RPIB 2Y1VA 2P47B 3NCCB 4MD4A 1E7UA 1RZJH 2YIHA 3U7YH 2X1OA 1JTOA 1D7BA 2G2RA 3E1ZA 5IMOB 5AW9B 3ARED 4PH8A 4HISA 5E94A 5JIHA 2YS4A 4TQIA 2YC1A 3RKPA 1O7VA 4XP1H 4M5TA 4ELMB 3MMEA 5IB3B 2HT3D 1UUSA 4TLKA 3OZKA 5GRZA 1F3RB 3ARWA 3HFML 1FZJA 2R0WL 1HCVA 3L95A 3BLBA 4I2XA 5DK2A 4HS3B 4ENZA 1RJZB 5C0DA 2GJZA 2VDOA 4RIRA 3INOA 3ZT7A 2C3WA 3OMAB 4CU7A 1AD0A 2V7NA 1LO0H 2JB6A 3KDPB 2YPVA 1RSYA 1HHJB 1MN4A 4XAWL 3N44B 3RWGB 4YDVA 3MKKA 2Q7QA 4X99B 4YS4A 2VLRE 2HWZH 4S0SD 3TONA 3GC3B 1U91A 4WU7B 3O6FC 1DO6A 1KT2A 4O4YL 4PTTA 3CFBA 2FZ3B 4M6AA 4Z7WE 3N2JA 5J0BA 3WAJA 2Y4SA 1XF5B 3ZDXE 4APQC 3ARQA 3W5NA 4LDEB 3QXUA 4PPTA 2NY1C 3F65A 1W72B 4MJIA 4YDIH 5A40E 2ZUUA 4CDHA 5A6LA 4EI6A 1YPZA 1UKQA 4NT6A 5EU5A 3BJ91 1O5DT 3I6KA 4FTDA 2AP2A 4GRMB 4YEFA 3KPOB 3PVWB 2IDQA 5AKRA 3FGBA 4HOXA 1AD9A 2X2IA 4GY4A 5AW3B 4ILDA 1P1ZA 4PI0A 4EN2A 1JWUA 4AJ0A 5E4EC 1U8LB 3UKUC 3HMXL 4ZS6D 1MW0A 1A6ZB 3X12A 2DQJH 4NBMA 1NCDL 5DJXB 3QFDB 1E4XI 3GI9L 1UOQA 3PUUA 2DQIH 5FV2A 2IV8A 4L1MA 3I9IA 1GC1L 2JJTC 4Z7VA 3RL2A 1QFSA 2WWKO 32C2B 1JGEB 1HOCA 2WJ7A 4YBQC 4F15C 4Z0BH 4M3JA 3MLUL 1HZHH 5GMKn 3EGSA 3RPBA 5E6IB 4QRFA 3DXAA 2Z3FA 2P49B 3MRCB 3NK4A 3OJMB 6PCYA 1T1XA 2ICEA 3BAYA 2ZKMX 2YQGA 3SQOL 4GH7B 4WEEA 2OXHB 5D1ZD 3LXCA 2I3SA 5DJ8A 1HHHA 1IKOP 2XVBA 2E7BA 4CW1B 5E1QA 4DK5A 1FH5L 2ZUYA 5ADPH 3MR9A 2P7TB 5KVFH 2XQ0A 4QKXB 5D7JB 1I1AD 2YFOA 1G7JB 4RFOL 5I1IL 3KDMB 2DAVA 3SE9L 2FB4H 2DB8A 3OX8A 1VJSA 4XPHL 1FCCA 3PWVB 5GSVB 5EZJA 3HS0B 5DXWA 3UG3A 2KL6A 4KTEH 3OB0H 4L29A 1O9ZA 1FVDB 2G60H 1JPST 3AQDA 2JXMB 3DURA 5IQ9A 3TA3D 4O45A 2A77L 3A6BL 2GBUA 3E0CA 4BE5A 1D6VL 4GW5A 5DUPL 4JFDB 4YZFF 5LDSA 5CFAA 3HHSA 2J5WA 4NQSB 2E4TA 1FO0L 3Q6FB 2VTFA 3FTUA 4PRIA 4NDMA 5GGTH 4U1LB 3CWGA 2IXQB 5C9JB 3UJJL 3DVNA 3IJ9A 1M6UA 3EG9A 1T4WA 4NN6B 3MTRA 3QA3A 1MLBB 5TEFA 4N2NA 1I4FA 4JFPA 3RY6A 1DVTA 2MQ3A 2A5UA 1KTRL 4FQQB 2IMNA 3BISA 3LMJH 1P1VA 5KG9A 4PJCE 4LOVA 1NFIA 2VJ0A 1FNHA 2MTPA 4FLRA 4KGJA 1FNAA 4W9FC 4WW1A 3AGVA 1W8NA 4WV1B 2A4ZA 4OZGB 5DMGD 1N7ML 3DMMC 1PCXA 3BVDB 5KSAC 5CCKL 2GTWB 4FFYL 5E9DE 2ZYIA 1KTKE 3O9WA 5D1QA 5HI5D 4ZFQA 2R8SL 1Q9WA 3PHSA 4PG9A 4LLMA 4P07A 1UXWB 3SDAC 1G9MC 4X6CA 1T2QH 4JJ5A 1NWOA 4UT6L 5AB0A 5DZAA 1H2YA 4OD1L 2DQEH 1FE8L 1EEYA 3QUZD 5ACLA 1KXVA 5HHMB 5HVGB 1UZ6E 3CC5A 1ZRUA 1HJCA 2M8XA 3ARVA 3FFCB 3WIHA 4TLUA 4HUUA 3IGLA 4PJIA 1RFDH 2ZUQC 3C6EA 4HH9A 3CGTA 3ARSA 3QDMA 1EFXA 3K1KC 3T0VA 1JGDB 3TIDA 3WEXA 4JZNB 4I9WE 1JFHA 4ODUB 5JA8B 4HULB 3QORD 2VLKA 4FMVA 1GY1A 5F6IB 2E47A 2JKTM 3UACA 3U1SL 3L9RA 4H20H 1LEKB 1Q0YH 4WHDA 5EEYA 3TYGH 2QQNL 5D7IB 1AVAA 1BJ1J 4JFQA 1K85A 1A9EB 5TDOA 2FL5B 3QIWB 3TNNA 2ESVD 3MLRL 1CZ8H 4QHPA 5GHWL 5T3ZH 3L5IA 5HI3C 4ZBJA 2V9TA 4ADIA 4XT1C 5EUOE 5E6UB 5ICXB 4Z7AA 1KIUB 3AVEA 4LRIA 3D39A 4WTQA 3S35X 4OCRL 4KTDH 5ESVB 2BZDA 1PYWB 2O5YL 4LLWB 1YEJH 4KC3B 5EU6A 1H3TA 1OCWL 4KHTL 4WWKD 1CDHA 5I0YA 3RHWK 2IGFL 4D8OA 3F84A 1QWUA 5DC9B 5SX5H 1KXQA 4E54B 3WO4B 3KLHC 4U1MA 4QYOB 3PDOA 2VR9A 4JO1L 4NJ9H 3KW8A 4LBAA 2VC2H 5GSAA 1U8OA 4BIKA 4XPBH 3CHQA 4F8NA 5DJ2B 3KXFD 3DTUB 3O81A 1DCEA 2O5ZH 2V5RA 1QSFE 4ZUWA 4PXWA 3RJQB 2Z6FA 4J39A 2EH8L 2Q7YA 1KIPB 4IHOA 1ZJAA 3L9YA 4BQ8A 4KXAA 3UOAB 1KPVB 2QR0A 3IETA 3RIAF 3WY4A 1T0MA 4OCLC 4I77H 4PS3A 4F9PA 1JNNH 2HG0A 2PABA 3T4YA 5JW3L 2BIIA 4QIRA 4PGCB 3STBA 4P9HL 3ULUE 2CBPA 2J71A 4X5LA 2QQLL 3CIAA 3F7QA 3G6DL 3N43F 3O4LB 2E56A 1OE2A 2ZOLA 4P2YA 3MRDA 4BFRA 3CX5J 2AXJA 1L5GB 2DJUA 2XTJB 4NQDE 2V0AA 1NC4A 4Y4KA 1LO3L 3UTTB 3M7FB 3H6AA 3L4VA 4GBXD 2GABA 1E8MA 2IH1A 1KDJA 1SBBA 2EO9A 2IQ9H 1GYAA 2Z92A 3V2AR 1FFRA 2F5BH 1XGQB 4ZUVB 4L8CB 4GEJA 1HEJC 2W88A 2X87A 3KG5A 3F3GA 5M5SA 1OAQL 2H0JA 1SFHA 5D5MB 2OL3A 2GAZA 2HRPL 2PMZA 3WU1A 3EOAB 2X1QA 4YHKH 3QNYA 5CZVL 2EQDA 2PKDA 4OWRA 4WUUD 2AQ2A 3G5YB 2MKLC 5JZ7D 3GSQB 2DWEB 1O7SA 1I3GL 1QUNB 3IF1B 3X1EA 3GREA 4NNPL 1G6VK 4IMKC 3IPFA 2V9QA 3RVXD 4PJAB 4YHLH 2D7QA 4ERSH 3W9EA 5LQBH 4PWGA 1N59A 1MCPH 1G7IB 3G7TA 1FCGA 2A38A 3BIAX 4OLYL 3T3PB 3APDA 4JPQA 4JFEE 2FO4A 1ZTXH 3SKOB 3AITA 1OHQA 4GQBB 5C0CA 5DTFB 1RUQH 2A3TA 5E2JA 1YYML 1ZS8B 3JTBA 2P5EB 2ADJB 3PNRB 1DO5A 1EHAA 1WF5A 2B9BA 1KEML 4QXVA 1PQZA 4F7EB 3CZUB 3GXNA 2EUXA 3PXLA 1L7IH 1HCFX 3NQKA 3D08A 2LHAA 1I9RL 3FB7B 3QZPA 4QXWA 5HD8D 5AB2A 3FUMA 1IGIL 5JOFB 2JKRM 3IMUA 4LPTA 4XVTH 4XXCC 2HYMA 3MACH 2H9PA 4K07A 2ADFH 2B59B 4QHKI 1FLRL 4G6JL 2VZSA 2CDGA 3RA7L 3M46A 1KB5L 3FCSB 4NBZB 5TFSL 4Y9CA 1QKZL 4PBVC 3ZZQA 2GK2A 1IGFH 2ZSVA 4S1SL 3TCTA 1K3IA 2Q76B 4XB8A 3VFMA 1MF2L 2OYPA 3AFCA 4L4VB 5TGBB 1FVCA 5ESQA 5D7KD 4HSCX 3WL9B 2KERA 4Y4HA 4F33B 1A3RL 4A08B 5BVPL 2YWZA 4HJEA 4KKAD 4WY7L 3DYOA 5FYJD 2WLYA 1WHPA 4OCSH 1JBJA 4FRWA 4AYBA 3FHQA 1EO5A 4HK3J 4TUOA 1NCWL 3M88A 1WG3A 4X61B 5JPNC 5F7DB 3D0LA 3VFNA 4TVPL 1CD9B 2VDKA 3LKQA 5DHVH 3NSCA 3L2LA 4HIJA 2P9IC 4S1QL 3W37A 5J7CC 2OI9B 4OAWA 5HGHB 4H13C 1CLZH 3ZIYA 3ABKB 5GS0L 3IFPB 3O4IA 3WKMH 2COQA 2HJLA 2MOVA 1E4KA 3VFGL 2LFEA 2VC2B 4FXGA 1QTPA 3MNVB 4PVBA 5ISZE 2ZWNA 4AMZA 2HFFA 1U3YA 5DRWA 3VXUD 3F5WB 1XSOA 2P3YA 1D5XB 3I9AA 4XWGL 1UT2A 2HT2D 1AR2A 4Z9KB 4PRPD 2R23A 1KENH 2EINB 4ZOCA 3RWEB 4HJJL 5C0BD 5B38A 1KJVA 4RGMB 3SGKC 4L1DA 3UJTL 3VTAA 1EZUA 4R5VA 1J5IA 1I7RA 1KB3A 3H7BA 2O61A 1GHFH 1IKNA 5C6TH 1JZ4A 4KI1A 2AZAA 2HXAA 1WYJA 2ZX8A 3DROA 3QCTH 4DPRA 2WSKA 5DR5L 2XLLA 2VXQA 4Y5VB 5AVRB 1EXGA 1SXAA 4FQJH 1E2ZA 2ZPKL 3TPUA 5BNXD 1KY7A 3SVWD 1IZKA 2DWDA 1F3DJ 3EH1A 5AW8B 1ZT4B 4IMLB 4UAOC