4FA4D

Crystal structure of wt maug in complex with pre-methylamine dehydrogenase aged 10 days
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords Methylamine utilization protein MauG
publication title Diradical intermediate within the context of tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 90
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4fa4D00
2EBSA 1OLZA 2GC7A 3C75H 1YFQA 3RMZD 2IUPA 3IKOA 5HE2B 2IUQA 3IIWA 4BH6A 4JT6C 1PI6A 5HQGA 4A11A 4O45A 2QXVA 3C99A 4E5ZB 3MKSB 3SLED 3JZGA 5CXBA 3I2NA 1L0QA 4CI8A 5K19A 2H3XA 1K8KC 3J81g 3UVOA 5EMJB 3JRPA 4J81A 4IMMA 1GOTB 5HE3B 1GXRA 1GP2B 2J57G 5GSAA 4ZOYA 4CY5A 4U1EI 1XKSA 3L4MD 2HXCA 3MZKA 4KFMB 4OZUA 2O9KA 3ULEC 4H5IA 4BUJC 5I5IA 5HYNB 4AEZA 3VA6A 2GC4A 1JOFA 2AGYA 3MZLA 2XYIA 4J77A 3SXTD 2BCJB 4ZOVA 2CO0A 2UZXB 4J73A 3GFCA 3OKYB 1MG2A 1NEXB 3SBPA 4CI2A 3MKQA 5CXCB 4FAND 3B7FA 3SBRA 3EI3A 5FKRA 1RI6A 5C2VB 5KDOB 3VH0A 4IA9A 5EMLB 1TBGA 4JSPC 5H14A 3C9CA 5FQDA 4ERZA 2I3SA 3U4YA 4O9DA 2OVQB 5GXHA 3EWEA 4J87A 3BWSA 3OL2A 3P4FA 4YVDA 4EWRA 4A11B 1Q47A 4JSNC 1N6DA 5HE1B 4FHLA 4PSWB 5IJ7E 3EI4A 3SWSD 1MG3A 2AQ5A 4PC0A 3E0CA 4J82A 2Q7QA 4PSXB 5SXMA 3N0EA 4PBYA 4H5JA 4A0AB 2XL3A 4JSXC 3RRMC 1JMZB 4ZN4A 3IJCA 3HFQA 3UVNA 2P9SC 4GM3A 5CXCA 2AGZA 1U2VC 1N6FA 1JMXB 4CZYA 4FB1D 3PSCB 4J79A 1XIPA 4O3UB 2HYEA 1OMWB 2P9NC 3MXXA 4X60B 2H6NA 2HKRA 2PM7B 2I3TA 2Z2PA 2HJ4A 2GNQA 2OIZA 5GXIA 3EI3B 2XU7A 3I7PA 4I79A 4J0WA 2AH0A 3KRXB 2IWKA 4A0BA 2OJYA 3MMYA 5C2WB 3UKUC 4J8BA 4LGNA 1SQJA 2H6KA 1R5MA 2J56H 4A2LA 3I7OA 5IGQA 3OKWA 4A08B 4GM9A 4J0XA 3EI1A 3OL2B 3FM0A 2H47A 4J8GA 2AGXA 1QNIA 1ERJA 4QL1A 3UVMA 3DXKC 4FA9D 4A0AA 1JJUB 3RFGA 5FLXg 2AGWA 1B9YA 5FXYA 2OK4A 3EI4B 1A0RB 4J84A 3K27A 4GGDA 4CY1A 3SJLD 2P9KC 4D0KA 4XYIA 2P9PC 4GQ1A 3RFHA 4ZOZA 3IIYA 5AJAA 3CFSB 5H1MA 2H13A 4XEIC 2YNPA 4U7AA 4N14A 3JAMg 2IURA 3ODTA 4L9OA 3AL9A 3JZNA 2CE8A 4L3GD 1K32A 4Y5RD 4QT8A 4QRJA 2PM9A 2PBIB 5IT9g 4MK0B 2UZYB 1S4UX 4X3EA 4CZVA 5EM2A 3JB9L 1PEVA 4A08A 2B5LA 4GZ8A 3SFZA 3KRWB 2YBAA 2YNNA 4GQBB 4A2MA 4J78A 2CN3A 4K3ID 4ES0A 4JSVC 3EU7A 2B4EA 4A0BB 2PM6B 3CFVA 3NVQA 1TYQC 2B5MA 3GREA 4XYHA 3IJ0A 5EMKB 4E54A 3RLMD 4GQ2P 4OWRA 4A7JA 5FKTA 5TEEA 4A09B 3UKRC 3BG1A 3J80g 4PXWA 2CN2A 2H9NA 2OVPB 5EALA 3I8CA 4GGCA 5K1CC 3F3GA 3EI1B 3K26A 5CYKB 5H17A 3V7DB 2H9MA 3OKTA 4UI9R 5TDHB 4CZXA 3CIKB 5TF2A 5A2Qg 5FKQA 3UR4A 4K3JB 3C5MA 2I0SA 3L4OD 3PXWD 1MDAH 3A0FA 3PXSD 2G9AA 4JT5C 2CO0C 3RN0D 4GMBA 2J55H 5B4WA 1PGUA 1NR0A 3SMRA 4FA1D 2HKMA 3SHFA 4FA5D 2OVRB 4FA4D 3JROA 3ZWLB 1U4CA 1VYHC 1FWXA 4TZ4A 2HJBA 2PM9B 2QC5A 3SVWD 1P22A 3NVNA 5EAPA 3I7NA 2TRCB 2CNXA 5C9ZB 4CC9A 4A09A 3PVUB 3I89A 5EM2B 3OTTA 3ORVD 4O3TB 5CYKA 3DSMA 5EMMB 4X63B 4E54B 3AL8A 4CI1A 2IUVA 2H14A 4X61B 2YMUA 2IWFA 5TEFA 3F3PA 2H9LA 4L3HD 2H6QA 3DWLC 4D6VA 4FWWA 3DM0A 4Y7RA 2G99A 3W15A 3F3FA 4ESGA 2AGLA 3PXTD 2BBKH 3VGZA 4ERQA 2YNOA 5I5MA 3UVLA 2I0RA 4CY2A 3EI2B 2H9PA 3OW8A 2MTAH 5EARA 3BG0A 5EAMA 3AFCA 3V5WB 3JPXA 2Z2NA 4Z8LA 4HDJA 3N0DA 3PVWB 3FRXA 4ERYA 4GM8A 3FGBA 4PNKB 4O1QD 3SN6B 5GMKn 4NSXA 4GGAA 3I7KA 3JZHA 3DXMC 4E5ZA 2OK6A 3EMHA 5THAA 4J86A 5AFU3 4QQEA 2I0TA 4G56B 4R7AB 1B9XA 5IJ8E 2B5NA 2XL2A 4ZOXA 3I7LA 3I8EA 2W18A 1GG2B 1SHYB 4FAVD 3AL8B 2HESX 4LG8A 3IJ1A 3V9FA 3SCYA 3SBQA 1PBYB 2YB8B 3NVXA 3EI2A 5CXBB 3PE7A 5JWZA 1XHMA 4LG9A 4JD2C 5IGOA 5IC7A 4JXMA 2Z2OA 5HE0B 3PSLA 4CY3A 3OKYA 4PBZA 2H68A 2P9LC 3AH8B 2AH1A 5FA5B 3RSEC 4BL0A 3UVKA 3RN1D 3EG6A 2IAAA 4L1QD 3I7HA 2P9UC 1N6EA 5I5JA 5AMSA 2CE9A 1SQ9A 2P9IC 4CI3A 5FKSA 4AOWA
chains in the Genus database with same CATH superfamily
2EBSA 1UTCA 1OLZA 2GC7A 3C75H 1TYEA 1YFQA 5M5UA 3RMZD 2IUPA 3IKOA 4WK2A 5HE2B 2IUQA 3IIWA 4BH6A 4JT6C 1PI6A 5HQGA 4A11A 4O45A 2QXVA 3C99A 1C9LA 4E5ZB 3MKSB 3SLED 4DNVA 3JZGA 5CXBA 3I2NA 1L0QA 4CI8A 5K19A 2H3XA 3K6SA 1K8KC 3J81g 3UVOA 5EMJB 3JRPA 4J81A 5HDBA 4IMMA 1GOTB 1I2MB 5HE3B 1GXRA 1GP2B 2J57G 1GOGA 5GSAA 4ZOYA 3ZE2A 4CY5A 4U1EI 1XKSA 4MMXA 3L4MD 2HXCA 2VDRA 3MZKA 4KFMB 2O9KA 3NIDA 4H5IA 4OZUA 3ULEC 4BUJC 1E8MA 5HYNB 4AEZA 3VA6A 2GC4A 1JOFA 2AGYA 3MZLA 2XYIA 4J77A 3SXTD 2BCJB 4ZOVA 2CO0A 2UZXB 4J73A 5C92A 2EIEA 3GFCA 3OKYB 1MG2A 1NEXB 3SBPA 1YR2A 4CI2A 3MKQA 2BKLA 5CXCB 2WQ8A 4FAND 3B7FA 3SBRA 3EI3A 5FKRA 1RI6A 4D9SA 5C2VB 2HU8A 5KDOB 3VH0A 4IA9A 5EMLB 3MVDK 1TBGA 4JSPC 5H14A 3C9CA 5FQDA 3O4IA 4AX4A 4ERZA 1H2XA 2I3SA 3U4YA 4O9DA 3DDUA 2OVQB 4Z7QA 5GXHA 3EWEA 3EQ8A 4J87A 3BWSA 3OL2A 1VZ3A 3P4FA 4YVDA 4EWRA 4A11B 4BCBA 2VDLA 1Q47A 4JSNC 1N6DA 5HE1B 4FHLA 4PSWB 1UOPA 4NC4A 3T3MA 5IJ7E 3EI4A 3KCIA 1BPOA 3SWSD 1MG3A 2AQ5A 4PC0A 3E0CA 3IUMA 4J82A 2Q7QA 4PSXB 5SXMA 3N0EA 4PBYA 4H5JA 3QHYB 4A0AB 2XL3A 4JSXC 3RRMC 1JMZB 4ZN4A 3IJCA 2VDKA 3HFQA 3UVNA 2P9SC 3NIFA 4GM3A 5CXCA 2AGZA 4DNWA 1U2VC 1N6FA 1JMXB 4RE5A 4CZYA 4NENA 4FB1D 3PSCB 4J79A 4BP9A 1XIPA 4MMZA 4O3UB 2HYEA 1OMWB 3EQ7A 3FCUA 3ZE1A 2P9NC 2VDNA 3MXXA 4X60B 2H6NA 2HKRA 5M61A 4AN1A 2PM7B 2I3TA 2Z2PA 2HJ4A 1QFMA 2GNQA 2OIZA 2QZPA 5GXIA 3EI3B 2XU7A 3I7PA 1U8CA 4I79A 4J0WA 3OF7A 3ZDZA 2AH0A 2HU7A 2IWKA 3KRXB 4A0BA 2OJYA 1UOOA 3MMYA 5C2WB 3IUQA 3UKUC 4DNUA 4J8BA 4LGNA 1SQJA 2H6KA 1R5MA 2J56H 4A2LA 1H2ZA 3ZDYA 3I7OA 5IGQA 3OKWA 4RE6A 4A08B 4GM9A 4J0XA 1M1XA 3GC3B 3O4JA 3EI1A 3OL2B 3FM0A 2EIDA 2H47A 4J8GA 2AGXA 1QNIA 1ERJA 4QL1A 3UVMA 3DXKC 4NBMA 4FA9D 4A0AA 1JJUB 3RFGA 5FLXg 4BCCA 2AGWA 1B9YA 5FXYA 2EIBA 2OK4A 3EI4B 1A0RB 4J84A 3K27A 3O4HA 4GGDA 4CY1A 3SJLD 2P9KC 4D0KA 4XYIA 2P9PC 4GQ1A 3RFHA 4WJKA 4ZOZA 3IIYA 5AJAA 1GOHA 3CFSB 3VI4A 5H1MA 2H13A 4XEIC 2YNPA 4U7AA 4N14A 2VDOA 3JAMg 3IUNA 5M5TA 2IURA 3ODTA 4L9OA 3AL9A 3JZNA 2CE8A 4L3GD 1K32A 4Y5RD 4WK0A 4QT8A 4QRJA 2PM9A 2VC2A 2PBIB 5IT9g 4MK0B 2UZYB 1S4UX 3QI0A 4X3EA 3MUNA 4CZVA 5EM2A 3JB9L 1PEVA 4A08A 3ZE0A 2B5LA 2HU5A 4GZ8A 3SFZA 3KRWB 2YBAA 2YNNA 4GQBB 4A2MA 4J78A 2CN3A 4K3ID 4ES0A 4G55A 4JSVC 5E6UA 3EU7A 2B4EA 4A0BB 2PM6B 3CFVA 3NVQA 1TYQC 1H2YA 2B5MA 3GREA 3IJ0A 3IURA 4XYHA 5EMKB 3RLMD 4E54A 4GQ2P 4OWRA 4A7JA 1VZ2A 5FKTA 3IJEA 5TEEA 4A09B 3UKRC 3BG1A 2JKXA 4UM8A 3J80g 4PXWA 2CN2A 2H9NA 2OVPB 5EALA 3I8CA 4BCDA 4GGCA 5K1CC 3F3GA 3EI1B 3K26A 5CYKB 5H17A 3V7DB 1JV2A 2H9MA 3ZDXA 3NIGA 3VI3A 3OKTA 4UI9R 5TDHB 4CZXA 3CIKB 1O6FA 4G1MA 1H2WA 5TF2A 5A2Qg 1VE7A 4JHPC 5FKQA 3UR4A 4AMYA 1A12A 4K3JB 3C5MA 2I0SA 3L4OD 3PXWD 1MDAH 3A0FA 3PXSD 2G9AA 4JT5C 1T2XA 5C86A 4MMYA 2CO0C 3FCSA 4GMBA 3RN0D 2J55H 1L5GA 1PGUA 1NR0A 5B4WA 3SMRA 4FA1D 2HKMA 3SHFA 4FA5D 2OVRB 4FA4D 3JROA 4O02A 3ZWLB 1U4CA 1VYHC 1FWXA 2XZGA 2HJBA 4O2WA 4TZ4A 2PM9B 3V4PA 2QC5A 3SVWD 1P22A 3IUJA 3NVNA 5EAPA 3I7NA 2TRCB 2CNXA 5C9ZB 4CC9A 4A09A 5FFOA 3PVUB 3I89A 5EM2B 3OTTA 4UM9A 3ORVD 4O3TB 5CYKA 3DSMA 4AMZA 5E6RA 5EMMB 4X63B 2XE4A 4E54B 3AL8A 4Z7OA 4CI1A 2IUVA 2H14A 4X61B 2YMUA 2IWFA 5TEFA 3F3PA 2H9LA 4L3HD 2H6QA 1E5TA 3DWLC 4D6VA 4FWWA 3DM0A 3EQ9A 4Y7RA 2VDQA 2G99A 4AN0A 2EICA 3W15A 3F3FA 4IRZA 4ESGA 2AGLA 3PXTD 2BBKH 3VGZA 4ERQA 2VZ3A 1C9IA 2YNOA 5I5MA 3UVLA 2I0RA 3K71A 4CY2A 1JTDB 3EI2B 2H9PA 4L1MA 5I5IA 3OW8A 1O6GA 2MTAH 5EARA 3BG0A 5EAMA 3AFCA 1UOQA 3IULA 3V5WB 3JPXA 2Z2NA 1QFSA 4Z8LA 4HDJA 3N0DA 3PVWB 3GD1I 4BP8A 3FRXA 4ERYA 4GM8A 3FGBA 4PNKB 4O1QD 4Z7NA 3SN6B 4NAAA 1E8NA 4NSXA 5GMKn 4GGAA 3I7KA 5FFGA 3JZHA 3DXMC 4E5ZA 2OK6A 3EMHA 5THAA 4J86A 5AFU3 4QQEA 5E6SA 2I0TA 4G56B 4R7AB 1B9XA 5IJ8E 2B5NA 2XL2A 4ZOXA 3I7LA 3MUOA 3I8EA 2W18A 1GG2B 1SHYB 4FAVD 3AL8B 2HESX 2QR5A 4LG8A 3IJ1A 3V9FA 3SCYA 3SBQA 5M5VA 1GOFA 1PBYB 2YB8B 3NVXA 3EI2A 5CXBB 3PE7A 2VDMA 5JWZA 1XHMA 5M5RA 4LG9A 4JD2C 5IGOA 5IC7A 4JXMA 2Z2OA 5HE0B 4QAMA 2XDWA 3IVMA 3T3PA 3PSLA 1K3IA 4CY3A 3OKYA 4PBZA 2H68A 2P9LC 3AH8B 3O4GA 2AH1A 2VZ1A 4G1EA 5FA5B 3RSEC 4BL0A 3UVKA 3RN1D 3EG6A 2IAAA 4L1QD 3V4VA 3I7HA 4WK4A 2P9UC 1N6EA 5I5JA 3K72A 5AMSA 2CE9A 2VDPA 4JHNA 1SQ9A 2P9IC 4CI3A 1VE6A 5FKSA 4AOWA 5M5SA
chains in the Genus database with same CATH topology
2EBSA 1OLZA 2GC7A 3C75H 1YFQA 3RMZD 2IUPA 3IKOA 5HE2B 2IUQA 3IIWA 4BH6A 4JT6C 1PI6A 5HQGA 4A11A 4O45A 2QXVA 3C99A 4E5ZB 3MKSB 3SLED 3JZGA 5CXBA 3I2NA 1L0QA 4CI8A 5K19A 2H3XA 1K8KC 3J81g 3UVOA 5EMJB 3JRPA 4J81A 4IMMA 1GOTB 5HE3B 1GXRA 1GP2B 2J57G 5GSAA 4ZOYA 4CY5A 4U1EI 1XKSA 3L4MD 2HXCA 3MZKA 4KFMB 4OZUA 2O9KA 3ULEC 4H5IA 4BUJC 5I5IA 5HYNB 4AEZA 3VA6A 2GC4A 1JOFA 2AGYA 3MZLA 2XYIA 4J77A 3SXTD 2BCJB 4ZOVA 2CO0A 2UZXB 4J73A 3GFCA 3OKYB 1MG2A 1NEXB 3SBPA 4CI2A 3MKQA 5CXCB 4FAND 3B7FA 3SBRA 3EI3A 5FKRA 1RI6A 5C2VB 5KDOB 3VH0A 4IA9A 5EMLB 1TBGA 4JSPC 5H14A 3C9CA 5FQDA 4ERZA 2I3SA 3U4YA 4O9DA 2OVQB 5GXHA 3EWEA 4J87A 3BWSA 3OL2A 3P4FA 4YVDA 4EWRA 4A11B 1Q47A 4JSNC 1N6DA 5HE1B 4FHLA 4PSWB 5IJ7E 3EI4A 3SWSD 1MG3A 2AQ5A 4PC0A 3E0CA 4J82A 2Q7QA 4PSXB 5SXMA 3N0EA 4PBYA 4H5JA 4A0AB 2XL3A 4JSXC 3RRMC 1JMZB 4ZN4A 3IJCA 3HFQA 3UVNA 2P9SC 4GM3A 5CXCA 2AGZA 1U2VC 1N6FA 1JMXB 4CZYA 4FB1D 3PSCB 4J79A 1XIPA 4O3UB 2HYEA 1OMWB 2P9NC 3MXXA 4X60B 2H6NA 2HKRA 2PM7B 2I3TA 2Z2PA 2HJ4A 2GNQA 2OIZA 5GXIA 3EI3B 2XU7A 3I7PA 4I79A 4J0WA 2AH0A 3KRXB 2IWKA 4A0BA 2OJYA 3MMYA 5C2WB 3UKUC 4J8BA 4LGNA 1SQJA 2H6KA 1R5MA 2J56H 4A2LA 3I7OA 5IGQA 3OKWA 4A08B 4GM9A 4J0XA 3EI1A 3OL2B 3FM0A 2H47A 4J8GA 2AGXA 1QNIA 1ERJA 4QL1A 3UVMA 3DXKC 4FA9D 4A0AA 1JJUB 3RFGA 5FLXg 2AGWA 1B9YA 5FXYA 2OK4A 3EI4B 1A0RB 4J84A 3K27A 4GGDA 4CY1A 3SJLD 2P9KC 4D0KA 4XYIA 2P9PC 4GQ1A 3RFHA 4ZOZA 3IIYA 5AJAA 3CFSB 5H1MA 2H13A 4XEIC 2YNPA 4U7AA 4N14A 3JAMg 2IURA 3ODTA 4L9OA 3AL9A 3JZNA 2CE8A 4L3GD 1K32A 4Y5RD 4QT8A 4QRJA 2PM9A 2PBIB 5IT9g 4MK0B 2UZYB 1S4UX 4X3EA 4CZVA 5EM2A 3JB9L 1PEVA 4A08A 2B5LA 4GZ8A 3SFZA 3KRWB 2YBAA 2YNNA 4GQBB 4A2MA 4J78A 2CN3A 4K3ID 4ES0A 4JSVC 3EU7A 2B4EA 4A0BB 2PM6B 3CFVA 3NVQA 1TYQC 2B5MA 3GREA 4XYHA 3IJ0A 5EMKB 4E54A 3RLMD 4GQ2P 4OWRA 4A7JA 5FKTA 5TEEA 4A09B 3UKRC 3BG1A 3J80g 4PXWA 2CN2A 2H9NA 2OVPB 5EALA 3I8CA 4GGCA 5K1CC 3F3GA 3EI1B 3K26A 5CYKB 5H17A 3V7DB 2H9MA 3OKTA 4UI9R 5TDHB 4CZXA 3CIKB 5TF2A 5A2Qg 5FKQA 3UR4A 4K3JB 3C5MA 2I0SA 3L4OD 3PXWD 1MDAH 3A0FA 3PXSD 2G9AA 4JT5C 2CO0C 3RN0D 4GMBA 2J55H 5B4WA 1PGUA 1NR0A 3SMRA 4FA1D 2HKMA 3SHFA 4FA5D 2OVRB 4FA4D 3JROA 3ZWLB 1U4CA 1VYHC 1FWXA 4TZ4A 2HJBA 2PM9B 2QC5A 3SVWD 1P22A 3NVNA 5EAPA 3I7NA 2TRCB 2CNXA 5C9ZB 4CC9A 4A09A 3PVUB 3I89A 5EM2B 3OTTA 3ORVD 4O3TB 5CYKA 3DSMA 5EMMB 4X63B 4E54B 3AL8A 4CI1A 2IUVA 2H14A 4X61B 2YMUA 2IWFA 5TEFA 3F3PA 2H9LA 4L3HD 2H6QA 3DWLC 4D6VA 4FWWA 3DM0A 4Y7RA 2G99A 3W15A 3F3FA 4ESGA 2AGLA 3PXTD 2BBKH 3VGZA 4ERQA 2YNOA 5I5MA 3UVLA 2I0RA 4CY2A 3EI2B 2H9PA 3OW8A 2MTAH 5EARA 3BG0A 5EAMA 3AFCA 3V5WB 3JPXA 2Z2NA 4Z8LA 4HDJA 3N0DA 3PVWB 3FRXA 4ERYA 4GM8A 3FGBA 4PNKB 4O1QD 3SN6B 5GMKn 4NSXA 4GGAA 3I7KA 3JZHA 3DXMC 4E5ZA 2OK6A 3EMHA 5THAA 4J86A 5AFU3 4QQEA 2I0TA 4G56B 4R7AB 1B9XA 5IJ8E 2B5NA 2XL2A 4ZOXA 3I7LA 3I8EA 2W18A 1GG2B 1SHYB 4FAVD 3AL8B 2HESX 4LG8A 3IJ1A 3V9FA 3SCYA 3SBQA 1PBYB 2YB8B 3NVXA 3EI2A 5CXBB 3PE7A 5JWZA 1XHMA 4LG9A 4JD2C 5IGOA 5IC7A 4JXMA 2Z2OA 5HE0B 3PSLA 4CY3A 3OKYA 4PBZA 2H68A 2P9LC 3AH8B 2AH1A 5FA5B 3RSEC 4BL0A 3UVKA 3RN1D 3EG6A 2IAAA 4L1QD 3I7HA 2P9UC 1N6EA 5I5JA 5AMSA 2CE9A 1SQ9A 2P9IC 4CI3A 5FKSA 4AOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EBS A;  1OLZ A;  2GC7 A;  3C75 H;  1YFQ A;  3RMZ D;  2IUP A;  3IKO A;  5HE2 B;  2IUQ A;  3IIW A;  4BH6 A;  4JT6 C;  1PI6 A;  5HQG A;  4A11 A;  4O45 A;  2QXV A;  3C99 A;  4E5Z B;  3MKS B;  3SLE D;  3JZG A;  5CXB A;  3I2N A;  1L0Q A;  4CI8 A;  5K19 A;  2H3X A;  1K8K C;  3J81 g;  3UVO A;  5EMJ B;  3JRP A;  4J81 A;  4IMM A;  1GOT B;  5HE3 B;  1GXR A;  1GP2 B;  2J57 G;  5GSA A;  4ZOY A;  4CY5 A;  4U1E I;  1XKS A;  3L4M D;  2HXC A;  3MZK A;  4KFM B;  4OZU A;  2O9K A;  3ULE C;  4H5I A;  4BUJ C;  5I5I A;  5HYN B;  4AEZ A;  3VA6 A;  2GC4 A;  1JOF A;  2AGY A;  3MZL A;  2XYI A;  4J77 A;  3SXT D;  2BCJ B;  4ZOV A;  2CO0 A;  2UZX B;  4J73 A;  3GFC A;  3OKY B;  1MG2 A;  1NEX B;  3SBP A;  4CI2 A;  3MKQ A;  5CXC B;  4FAN D;  3B7F A;  3SBR A;  3EI3 A;  5FKR A;  1RI6 A;  5C2V B;  5KDO B;  3VH0 A;  4IA9 A;  5EML B;  1TBG A;  4JSP C;  5H14 A;  3C9C A;  5FQD A;  4ERZ A;  2I3S A;  3U4Y A;  4O9D A;  2OVQ B;  5GXH A;  3EWE A;  4J87 A;  3BWS A;  3OL2 A;  3P4F A;  4YVD A;  4EWR A;  4A11 B;  1Q47 A;  4JSN C;  1N6D A;  5HE1 B;  4FHL A;  4PSW B;  5IJ7 E;  3EI4 A;  3SWS D;  1MG3 A;  2AQ5 A;  4PC0 A;  3E0C A;  4J82 A;  2Q7Q A;  4PSX B;  5SXM A;  3N0E A;  4PBY A;  4H5J A;  4A0A B;  2XL3 A;  4JSX C;  3RRM C;  1JMZ B;  4ZN4 A;  3IJC A;  3HFQ A;  3UVN A;  2P9S C;  4GM3 A;  5CXC A;  2AGZ A;  1U2V C;  1N6F A;  1JMX B;  4CZY A;  4FB1 D;  3PSC B;  4J79 A;  1XIP A;  4O3U B;  2HYE A;  1OMW B;  2P9N C;  3MXX A;  4X60 B;  2H6N A;  2HKR A;  2PM7 B;  2I3T A;  2Z2P A;  2HJ4 A;  2GNQ A;  2OIZ A;  5GXI A;  3EI3 B;  2XU7 A;  3I7P A;  4I79 A;  4J0W A;  2AH0 A;  3KRX B;  2IWK A;  4A0B A;  2OJY A;  3MMY A;  5C2W B;  3UKU C;  4J8B A;  4LGN A;  1SQJ A;  2H6K A;  1R5M A;  2J56 H;  4A2L A;  3I7O A;  5IGQ A;  3OKW A;  4A08 B;  4GM9 A;  4J0X A;  3EI1 A;  3OL2 B;  3FM0 A;  2H47 A;  4J8G A;  2AGX A;  1QNI A;  1ERJ A;  4QL1 A;  3UVM A;  3DXK C;  4FA9 D;  4A0A A;  1JJU B;  3RFG A;  5FLX g;  2AGW A;  1B9Y A;  5FXY A;  2OK4 A;  3EI4 B;  1A0R B;  4J84 A;  3K27 A;  4GGD A;  4CY1 A;  3SJL D;  2P9K C;  4D0K A;  4XYI A;  2P9P C;  4GQ1 A;  3RFH A;  4ZOZ A;  3IIY A;  5AJA A;  3CFS B;  5H1M A;  2H13 A;  4XEI C;  2YNP A;  4U7A A;  4N14 A;  3JAM g;  2IUR A;  3ODT A;  4L9O A;  3AL9 A;  3JZN A;  2CE8 A;  4L3G D;  1K32 A;  4Y5R D;  4QT8 A;  4QRJ A;  2PM9 A;  2PBI B;  5IT9 g;  4MK0 B;  2UZY B;  1S4U X;  4X3E A;  4CZV A;  5EM2 A;  3JB9 L;  1PEV A;  4A08 A;  2B5L A;  4GZ8 A;  3SFZ A;  3KRW B;  2YBA A;  2YNN A;  4GQB B;  4A2M A;  4J78 A;  2CN3 A;  4K3I D;  4ES0 A;  4JSV C;  3EU7 A;  2B4E A;  4A0B B;  2PM6 B;  3CFV A;  3NVQ A;  1TYQ C;  2B5M A;  3GRE A;  4XYH A;  3IJ0 A;  5EMK B;  4E54 A;  3RLM D;  4GQ2 P;  4OWR A;  4A7J A;  5FKT A;  5TEE A;  4A09 B;  3UKR C;  3BG1 A;  3J80 g;  4PXW A;  2CN2 A;  2H9N A;  2OVP B;  5EAL A;  3I8C A;  4GGC A;  5K1C C;  3F3G A;  3EI1 B;  3K26 A;  5CYK B;  5H17 A;  3V7D B;  2H9M A;  3OKT A;  4UI9 R;  5TDH B;  4CZX A;  3CIK B;  5TF2 A;  5A2Q g;  5FKQ A;  3UR4 A;  4K3J B;  3C5M A;  2I0S A;  3L4O D;  3PXW D;  1MDA H;  3A0F A;  3PXS D;  2G9A A;  4JT5 C;  2CO0 C;  3RN0 D;  4GMB A;  2J55 H;  5B4W A;  1PGU A;  1NR0 A;  3SMR A;  4FA1 D;  2HKM A;  3SHF A;  4FA5 D;  2OVR B;  4FA4 D;  3JRO A;  3ZWL B;  1U4C A;  1VYH C;  1FWX A;  4TZ4 A;  2HJB A;  2PM9 B;  2QC5 A;  3SVW D;  1P22 A;  3NVN A;  5EAP A;  3I7N A;  2TRC B;  2CNX A;  5C9Z B;  4CC9 A;  4A09 A;  3PVU B;  3I89 A;  5EM2 B;  3OTT A;  3ORV D;  4O3T B;  5CYK A;  3DSM A;  5EMM B;  4X63 B;  4E54 B;  3AL8 A;  4CI1 A;  2IUV A;  2H14 A;  4X61 B;  2YMU A;  2IWF A;  5TEF A;  3F3P A;  2H9L A;  4L3H D;  2H6Q A;  3DWL C;  4D6V A;  4FWW A;  3DM0 A;  4Y7R A;  2G99 A;  3W15 A;  3F3F A;  4ESG A;  2AGL A;  3PXT D;  2BBK H;  3VGZ A;  4ERQ A;  2YNO A;  5I5M A;  3UVL A;  2I0R A;  4CY2 A;  3EI2 B;  2H9P A;  3OW8 A;  2MTA H;  5EAR A;  3BG0 A;  5EAM A;  3AFC A;  3V5W B;  3JPX A;  2Z2N A;  4Z8L A;  4HDJ A;  3N0D A;  3PVW B;  3FRX A;  4ERY A;  4GM8 A;  3FGB A;  4PNK B;  4O1Q D;  3SN6 B;  5GMK n;  4NSX A;  4GGA A;  3I7K A;  3JZH A;  3DXM C;  4E5Z A;  2OK6 A;  3EMH A;  5THA A;  4J86 A;  5AFU 3;  4QQE A;  2I0T A;  4G56 B;  4R7A B;  1B9X A;  5IJ8 E;  2B5N A;  2XL2 A;  4ZOX A;  3I7L A;  3I8E A;  2W18 A;  1GG2 B;  1SHY B;  4FAV D;  3AL8 B;  2HES X;  4LG8 A;  3IJ1 A;  3V9F A;  3SCY A;  3SBQ A;  1PBY B;  2YB8 B;  3NVX A;  3EI2 A;  5CXB B;  3PE7 A;  5JWZ A;  1XHM A;  4LG9 A;  4JD2 C;  5IGO A;  5IC7 A;  4JXM A;  2Z2O A;  5HE0 B;  3PSL A;  4CY3 A;  3OKY A;  4PBZ A;  2H68 A;  2P9L C;  3AH8 B;  2AH1 A;  5FA5 B;  3RSE C;  4BL0 A;  3UVK A;  3RN1 D;  3EG6 A;  2IAA A;  4L1Q D;  3I7H A;  2P9U C;  1N6E A;  5I5J A;  5AMS A;  2CE9 A;  1SQ9 A;  2P9I C;  4CI3 A;  5FKS A;  4AOW A; 
#chains in the Genus database with same CATH topology
 2EBS A;  1UTC A;  1OLZ A;  2GC7 A;  3C75 H;  1TYE A;  1YFQ A;  5M5U A;  3RMZ D;  2IUP A;  3IKO A;  4WK2 A;  5HE2 B;  2IUQ A;  3IIW A;  4BH6 A;  4JT6 C;  1PI6 A;  5HQG A;  4A11 A;  4O45 A;  2QXV A;  3C99 A;  1C9L A;  4E5Z B;  3MKS B;  3SLE D;  4DNV A;  3JZG A;  5CXB A;  3I2N A;  1L0Q A;  4CI8 A;  5K19 A;  2H3X A;  3K6S A;  1K8K C;  3J81 g;  3UVO A;  5EMJ B;  3JRP A;  4J81 A;  5HDB A;  4IMM A;  1GOT B;  1I2M B;  5HE3 B;  1GXR A;  1GP2 B;  2J57 G;  1GOG A;  5GSA A;  4ZOY A;  3ZE2 A;  4CY5 A;  4U1E I;  1XKS A;  4MMX A;  3L4M D;  2HXC A;  2VDR A;  3MZK A;  4KFM B;  2O9K A;  3NID A;  4H5I A;  4OZU A;  3ULE C;  4BUJ C;  1E8M A;  5HYN B;  4AEZ A;  3VA6 A;  2GC4 A;  1JOF A;  2AGY A;  3MZL A;  2XYI A;  4J77 A;  3SXT D;  2BCJ B;  4ZOV A;  2CO0 A;  2UZX B;  4J73 A;  5C92 A;  2EIE A;  3GFC A;  3OKY B;  1MG2 A;  1NEX B;  3SBP A;  1YR2 A;  4CI2 A;  3MKQ A;  2BKL A;  5CXC B;  2WQ8 A;  4FAN D;  3B7F A;  3SBR A;  3EI3 A;  5FKR A;  1RI6 A;  4D9S A;  5C2V B;  2HU8 A;  5KDO B;  3VH0 A;  4IA9 A;  5EML B;  3MVD K;  1TBG A;  4JSP C;  5H14 A;  3C9C A;  5FQD A;  3O4I A;  4AX4 A;  4ERZ A;  1H2X A;  2I3S A;  3U4Y A;  4O9D A;  3DDU A;  2OVQ B;  4Z7Q A;  5GXH A;  3EWE A;  3EQ8 A;  4J87 A;  3BWS A;  3OL2 A;  1VZ3 A;  3P4F A;  4YVD A;  4EWR A;  4A11 B;  4BCB A;  2VDL A;  1Q47 A;  4JSN C;  1N6D A;  5HE1 B;  4FHL A;  4PSW B;  1UOP A;  4NC4 A;  3T3M A;  5IJ7 E;  3EI4 A;  3KCI A;  1BPO A;  3SWS D;  1MG3 A;  2AQ5 A;  4PC0 A;  3E0C A;  3IUM A;  4J82 A;  2Q7Q A;  4PSX B;  5SXM A;  3N0E A;  4PBY A;  4H5J A;  3QHY B;  4A0A B;  2XL3 A;  4JSX C;  3RRM C;  1JMZ B;  4ZN4 A;  3IJC A;  2VDK A;  3HFQ A;  3UVN A;  2P9S C;  3NIF A;  4GM3 A;  5CXC A;  2AGZ A;  4DNW A;  1U2V C;  1N6F A;  1JMX B;  4RE5 A;  4CZY A;  4NEN A;  4FB1 D;  3PSC B;  4J79 A;  4BP9 A;  1XIP A;  4MMZ A;  4O3U B;  2HYE A;  1OMW B;  3EQ7 A;  3FCU A;  3ZE1 A;  2P9N C;  2VDN A;  3MXX A;  4X60 B;  2H6N A;  2HKR A;  5M61 A;  4AN1 A;  2PM7 B;  2I3T A;  2Z2P A;  2HJ4 A;  1QFM A;  2GNQ A;  2OIZ A;  2QZP A;  5GXI A;  3EI3 B;  2XU7 A;  3I7P A;  1U8C A;  4I79 A;  4J0W A;  3OF7 A;  3ZDZ A;  2AH0 A;  2HU7 A;  2IWK A;  3KRX B;  4A0B A;  2OJY A;  1UOO A;  3MMY A;  5C2W B;  3IUQ A;  3UKU C;  4DNU A;  4J8B A;  4LGN A;  1SQJ A;  2H6K A;  1R5M A;  2J56 H;  4A2L A;  1H2Z A;  3ZDY A;  3I7O A;  5IGQ A;  3OKW A;  4RE6 A;  4A08 B;  4GM9 A;  4J0X A;  1M1X A;  3GC3 B;  3O4J A;  3EI1 A;  3OL2 B;  3FM0 A;  2EID A;  2H47 A;  4J8G A;  2AGX A;  1QNI A;  1ERJ A;  4QL1 A;  3UVM A;  3DXK C;  4NBM A;  4FA9 D;  4A0A A;  1JJU B;  3RFG A;  5FLX g;  4BCC A;  2AGW A;  1B9Y A;  5FXY A;  2EIB A;  2OK4 A;  3EI4 B;  1A0R B;  4J84 A;  3K27 A;  3O4H A;  4GGD A;  4CY1 A;  3SJL D;  2P9K C;  4D0K A;  4XYI A;  2P9P C;  4GQ1 A;  3RFH A;  4WJK A;  4ZOZ A;  3IIY A;  5AJA A;  1GOH A;  3CFS B;  3VI4 A;  5H1M A;  2H13 A;  4XEI C;  2YNP A;  4U7A A;  4N14 A;  2VDO A;  3JAM g;  3IUN A;  5M5T A;  2IUR A;  3ODT A;  4L9O A;  3AL9 A;  3JZN A;  2CE8 A;  4L3G D;  1K32 A;  4Y5R D;  4WK0 A;  4QT8 A;  4QRJ A;  2PM9 A;  2VC2 A;  2PBI B;  5IT9 g;  4MK0 B;  2UZY B;  1S4U X;  3QI0 A;  4X3E A;  3MUN A;  4CZV A;  5EM2 A;  3JB9 L;  1PEV A;  4A08 A;  3ZE0 A;  2B5L A;  2HU5 A;  4GZ8 A;  3SFZ A;  3KRW B;  2YBA A;  2YNN A;  4GQB B;  4A2M A;  4J78 A;  2CN3 A;  4K3I D;  4ES0 A;  4G55 A;  4JSV C;  5E6U A;  3EU7 A;  2B4E A;  4A0B B;  2PM6 B;  3CFV A;  3NVQ A;  1TYQ C;  1H2Y A;  2B5M A;  3GRE A;  3IJ0 A;  3IUR A;  4XYH A;  5EMK B;  3RLM D;  4E54 A;  4GQ2 P;  4OWR A;  4A7J A;  1VZ2 A;  5FKT A;  3IJE A;  5TEE A;  4A09 B;  3UKR C;  3BG1 A;  2JKX A;  4UM8 A;  3J80 g;  4PXW A;  2CN2 A;  2H9N A;  2OVP B;  5EAL A;  3I8C A;  4BCD A;  4GGC A;  5K1C C;  3F3G A;  3EI1 B;  3K26 A;  5CYK B;  5H17 A;  3V7D B;  1JV2 A;  2H9M A;  3ZDX A;  3NIG A;  3VI3 A;  3OKT A;  4UI9 R;  5TDH B;  4CZX A;  3CIK B;  1O6F A;  4G1M A;  1H2W A;  5TF2 A;  5A2Q g;  1VE7 A;  4JHP C;  5FKQ A;  3UR4 A;  4AMY A;  1A12 A;  4K3J B;  3C5M A;  2I0S A;  3L4O D;  3PXW D;  1MDA H;  3A0F A;  3PXS D;  2G9A A;  4JT5 C;  1T2X A;  5C86 A;  4MMY A;  2CO0 C;  3FCS A;  4GMB A;  3RN0 D;  2J55 H;  1L5G A;  1PGU A;  1NR0 A;  5B4W A;  3SMR A;  4FA1 D;  2HKM A;  3SHF A;  4FA5 D;  2OVR B;  4FA4 D;  3JRO A;  4O02 A;  3ZWL B;  1U4C A;  1VYH C;  1FWX A;  2XZG A;  2HJB A;  4O2W A;  4TZ4 A;  2PM9 B;  3V4P A;  2QC5 A;  3SVW D;  1P22 A;  3IUJ A;  3NVN A;  5EAP A;  3I7N A;  2TRC B;  2CNX A;  5C9Z B;  4CC9 A;  4A09 A;  5FFO A;  3PVU B;  3I89 A;  5EM2 B;  3OTT A;  4UM9 A;  3ORV D;  4O3T B;  5CYK A;  3DSM A;  4AMZ A;  5E6R A;  5EMM B;  4X63 B;  2XE4 A;  4E54 B;  3AL8 A;  4Z7O A;  4CI1 A;  2IUV A;  2H14 A;  4X61 B;  2YMU A;  2IWF A;  5TEF A;  3F3P A;  2H9L A;  4L3H D;  2H6Q A;  1E5T A;  3DWL C;  4D6V A;  4FWW A;  3DM0 A;  3EQ9 A;  4Y7R A;  2VDQ A;  2G99 A;  4AN0 A;  2EIC A;  3W15 A;  3F3F A;  4IRZ A;  4ESG A;  2AGL A;  3PXT D;  2BBK H;  3VGZ A;  4ERQ A;  2VZ3 A;  1C9I A;  2YNO A;  5I5M A;  3UVL A;  2I0R A;  3K71 A;  4CY2 A;  1JTD B;  3EI2 B;  2H9P A;  4L1M A;  5I5I A;  3OW8 A;  1O6G A;  2MTA H;  5EAR A;  3BG0 A;  5EAM A;  3AFC A;  1UOQ A;  3IUL A;  3V5W B;  3JPX A;  2Z2N A;  1QFS A;  4Z8L A;  4HDJ A;  3N0D A;  3PVW B;  3GD1 I;  4BP8 A;  3FRX A;  4ERY A;  4GM8 A;  3FGB A;  4PNK B;  4O1Q D;  4Z7N A;  3SN6 B;  4NAA A;  1E8N A;  4NSX A;  5GMK n;  4GGA A;  3I7K A;  5FFG A;  3JZH A;  3DXM C;  4E5Z A;  2OK6 A;  3EMH A;  5THA A;  4J86 A;  5AFU 3;  4QQE A;  5E6S A;  2I0T A;  4G56 B;  4R7A B;  1B9X A;  5IJ8 E;  2B5N A;  2XL2 A;  4ZOX A;  3I7L A;  3MUO A;  3I8E A;  2W18 A;  1GG2 B;  1SHY B;  4FAV D;  3AL8 B;  2HES X;  2QR5 A;  4LG8 A;  3IJ1 A;  3V9F A;  3SCY A;  3SBQ A;  5M5V A;  1GOF A;  1PBY B;  2YB8 B;  3NVX A;  3EI2 A;  5CXB B;  3PE7 A;  2VDM A;  5JWZ A;  1XHM A;  5M5R A;  4LG9 A;  4JD2 C;  5IGO A;  5IC7 A;  4JXM A;  2Z2O A;  5HE0 B;  4QAM A;  2XDW A;  3IVM A;  3T3P A;  3PSL A;  1K3I A;  4CY3 A;  3OKY A;  4PBZ A;  2H68 A;  2P9L C;  3AH8 B;  3O4G A;  2AH1 A;  2VZ1 A;  4G1E A;  5FA5 B;  3RSE C;  4BL0 A;  3UVK A;  3RN1 D;  3EG6 A;  2IAA A;  4L1Q D;  3V4V A;  3I7H A;  4WK4 A;  2P9U C;  1N6E A;  5I5J A;  3K72 A;  5AMS A;  2CE9 A;  2VDP A;  4JHN A;  1SQ9 A;  2P9I C;  4CI3 A;  1VE6 A;  5FKS A;  4AOW A;  5M5S A; 
#chains in the Genus database with same CATH homology
 2EBS A;  1OLZ A;  2GC7 A;  3C75 H;  1YFQ A;  3RMZ D;  2IUP A;  3IKO A;  5HE2 B;  2IUQ A;  3IIW A;  4BH6 A;  4JT6 C;  1PI6 A;  5HQG A;  4A11 A;  4O45 A;  2QXV A;  3C99 A;  4E5Z B;  3MKS B;  3SLE D;  3JZG A;  5CXB A;  3I2N A;  1L0Q A;  4CI8 A;  5K19 A;  2H3X A;  1K8K C;  3J81 g;  3UVO A;  5EMJ B;  3JRP A;  4J81 A;  4IMM A;  1GOT B;  5HE3 B;  1GXR A;  1GP2 B;  2J57 G;  5GSA A;  4ZOY A;  4CY5 A;  4U1E I;  1XKS A;  3L4M D;  2HXC A;  3MZK A;  4KFM B;  4OZU A;  2O9K A;  3ULE C;  4H5I A;  4BUJ C;  5I5I A;  5HYN B;  4AEZ A;  3VA6 A;  2GC4 A;  1JOF A;  2AGY A;  3MZL A;  2XYI A;  4J77 A;  3SXT D;  2BCJ B;  4ZOV A;  2CO0 A;  2UZX B;  4J73 A;  3GFC A;  3OKY B;  1MG2 A;  1NEX B;  3SBP A;  4CI2 A;  3MKQ A;  5CXC B;  4FAN D;  3B7F A;  3SBR A;  3EI3 A;  5FKR A;  1RI6 A;  5C2V B;  5KDO B;  3VH0 A;  4IA9 A;  5EML B;  1TBG A;  4JSP C;  5H14 A;  3C9C A;  5FQD A;  4ERZ A;  2I3S A;  3U4Y A;  4O9D A;  2OVQ B;  5GXH A;  3EWE A;  4J87 A;  3BWS A;  3OL2 A;  3P4F A;  4YVD A;  4EWR A;  4A11 B;  1Q47 A;  4JSN C;  1N6D A;  5HE1 B;  4FHL A;  4PSW B;  5IJ7 E;  3EI4 A;  3SWS D;  1MG3 A;  2AQ5 A;  4PC0 A;  3E0C A;  4J82 A;  2Q7Q A;  4PSX B;  5SXM A;  3N0E A;  4PBY A;  4H5J A;  4A0A B;  2XL3 A;  4JSX C;  3RRM C;  1JMZ B;  4ZN4 A;  3IJC A;  3HFQ A;  3UVN A;  2P9S C;  4GM3 A;  5CXC A;  2AGZ A;  1U2V C;  1N6F A;  1JMX B;  4CZY A;  4FB1 D;  3PSC B;  4J79 A;  1XIP A;  4O3U B;  2HYE A;  1OMW B;  2P9N C;  3MXX A;  4X60 B;  2H6N A;  2HKR A;  2PM7 B;  2I3T A;  2Z2P A;  2HJ4 A;  2GNQ A;  2OIZ A;  5GXI A;  3EI3 B;  2XU7 A;  3I7P A;  4I79 A;  4J0W A;  2AH0 A;  3KRX B;  2IWK A;  4A0B A;  2OJY A;  3MMY A;  5C2W B;  3UKU C;  4J8B A;  4LGN A;  1SQJ A;  2H6K A;  1R5M A;  2J56 H;  4A2L A;  3I7O A;  5IGQ A;  3OKW A;  4A08 B;  4GM9 A;  4J0X A;  3EI1 A;  3OL2 B;  3FM0 A;  2H47 A;  4J8G A;  2AGX A;  1QNI A;  1ERJ A;  4QL1 A;  3UVM A;  3DXK C;  4FA9 D;  4A0A A;  1JJU B;  3RFG A;  5FLX g;  2AGW A;  1B9Y A;  5FXY A;  2OK4 A;  3EI4 B;  1A0R B;  4J84 A;  3K27 A;  4GGD A;  4CY1 A;  3SJL D;  2P9K C;  4D0K A;  4XYI A;  2P9P C;  4GQ1 A;  3RFH A;  4ZOZ A;  3IIY A;  5AJA A;  3CFS B;  5H1M A;  2H13 A;  4XEI C;  2YNP A;  4U7A A;  4N14 A;  3JAM g;  2IUR A;  3ODT A;  4L9O A;  3AL9 A;  3JZN A;  2CE8 A;  4L3G D;  1K32 A;  4Y5R D;  4QT8 A;  4QRJ A;  2PM9 A;  2PBI B;  5IT9 g;  4MK0 B;  2UZY B;  1S4U X;  4X3E A;  4CZV A;  5EM2 A;  3JB9 L;  1PEV A;  4A08 A;  2B5L A;  4GZ8 A;  3SFZ A;  3KRW B;  2YBA A;  2YNN A;  4GQB B;  4A2M A;  4J78 A;  2CN3 A;  4K3I D;  4ES0 A;  4JSV C;  3EU7 A;  2B4E A;  4A0B B;  2PM6 B;  3CFV A;  3NVQ A;  1TYQ C;  2B5M A;  3GRE A;  4XYH A;  3IJ0 A;  5EMK B;  4E54 A;  3RLM D;  4GQ2 P;  4OWR A;  4A7J A;  5FKT A;  5TEE A;  4A09 B;  3UKR C;  3BG1 A;  3J80 g;  4PXW A;  2CN2 A;  2H9N A;  2OVP B;  5EAL A;  3I8C A;  4GGC A;  5K1C C;  3F3G A;  3EI1 B;  3K26 A;  5CYK B;  5H17 A;  3V7D B;  2H9M A;  3OKT A;  4UI9 R;  5TDH B;  4CZX A;  3CIK B;  5TF2 A;  5A2Q g;  5FKQ A;  3UR4 A;  4K3J B;  3C5M A;  2I0S A;  3L4O D;  3PXW D;  1MDA H;  3A0F A;  3PXS D;  2G9A A;  4JT5 C;  2CO0 C;  3RN0 D;  4GMB A;  2J55 H;  5B4W A;  1PGU A;  1NR0 A;  3SMR A;  4FA1 D;  2HKM A;  3SHF A;  4FA5 D;  2OVR B;  4FA4 D;  3JRO A;  3ZWL B;  1U4C A;  1VYH C;  1FWX A;  4TZ4 A;  2HJB A;  2PM9 B;  2QC5 A;  3SVW D;  1P22 A;  3NVN A;  5EAP A;  3I7N A;  2TRC B;  2CNX A;  5C9Z B;  4CC9 A;  4A09 A;  3PVU B;  3I89 A;  5EM2 B;  3OTT A;  3ORV D;  4O3T B;  5CYK A;  3DSM A;  5EMM B;  4X63 B;  4E54 B;  3AL8 A;  4CI1 A;  2IUV A;  2H14 A;  4X61 B;  2YMU A;  2IWF A;  5TEF A;  3F3P A;  2H9L A;  4L3H D;  2H6Q A;  3DWL C;  4D6V A;  4FWW A;  3DM0 A;  4Y7R A;  2G99 A;  3W15 A;  3F3F A;  4ESG A;  2AGL A;  3PXT D;  2BBK H;  3VGZ A;  4ERQ A;  2YNO A;  5I5M A;  3UVL A;  2I0R A;  4CY2 A;  3EI2 B;  2H9P A;  3OW8 A;  2MTA H;  5EAR A;  3BG0 A;  5EAM A;  3AFC A;  3V5W B;  3JPX A;  2Z2N A;  4Z8L A;  4HDJ A;  3N0D A;  3PVW B;  3FRX A;  4ERY A;  4GM8 A;  3FGB A;  4PNK B;  4O1Q D;  3SN6 B;  5GMK n;  4NSX A;  4GGA A;  3I7K A;  3JZH A;  3DXM C;  4E5Z A;  2OK6 A;  3EMH A;  5THA A;  4J86 A;  5AFU 3;  4QQE A;  2I0T A;  4G56 B;  4R7A B;  1B9X A;  5IJ8 E;  2B5N A;  2XL2 A;  4ZOX A;  3I7L A;  3I8E A;  2W18 A;  1GG2 B;  1SHY B;  4FAV D;  3AL8 B;  2HES X;  4LG8 A;  3IJ1 A;  3V9F A;  3SCY A;  3SBQ A;  1PBY B;  2YB8 B;  3NVX A;  3EI2 A;  5CXB B;  3PE7 A;  5JWZ A;  1XHM A;  4LG9 A;  4JD2 C;  5IGO A;  5IC7 A;  4JXM A;  2Z2O A;  5HE0 B;  3PSL A;  4CY3 A;  3OKY A;  4PBZ A;  2H68 A;  2P9L C;  3AH8 B;  2AH1 A;  5FA5 B;  3RSE C;  4BL0 A;  3UVK A;  3RN1 D;  3EG6 A;  2IAA A;  4L1Q D;  3I7H A;  2P9U C;  1N6E A;  5I5J A;  5AMS A;  2CE9 A;  1SQ9 A;  2P9I C;  4CI3 A;  5FKS A;  4AOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...