4FA4D

Crystal structure of wt maug in complex with pre-methylamine dehydrogenase aged 10 days
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
376
structure length
376
Chain Sequence
b'QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
molecule tags Oxidoreductase/electron transport
source organism Paracoccus denitrificans
publication title Diradical intermediate within the context of tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
total genus 90
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4fa4D00
1Q47A 1PGUA 2H14A 5AFU3 1VYHC 3VA6A 1MG2A 2HYEA 2PM9A 4E54B 4QQEA 1P22A 2CO0A 3EI2A 2TRCB 2HKRA 4NSXA 2CN2A 2MTAH 2I3TA 3MXXA 4JSXC 3OL2B 2YMUA 3GFCA 2YBAA 4FA1D 3I7PA 3A0FA 3I2NA 1U2VC 1XIPA 4JD2C 2Z2NA 3SMRA 2H68A 2QC5A 2J57G 2Q7QA 5EAMA 1ERJA 2P9SC 2XU7A 5GXIA 2HKMA 3I7OA 2CNXA 2H6NA 5FKQA 3UVKA 4PC0A 2H9NA 4PNKB 4J84A 3EI4A 3SFZA 3ORVD 4O9DA 1YFQA 2HXCA 3DM0A 2W18A 4JSNC 4HDJA 4I79A 4A11A 1SQ9A 5GMKn 3SJLD 3EMHA 2GC7A 3L4MD 2XYIA 4FA5D 4A11B 1TBGA 3RLMD 3MMYA 2P9KC 5HE0B 5C9ZB 2P9IC 1QNIA 3UKUC 2PM7B 3VH0A 3MKSB 3U4YA 1XKSA 1B9YA 4J79A 5FA5B 4J86A 3C5MA 5CXCA 4JSPC 4PBZA 2QXVA 4PBYA 4CY2A 4FHLA 2J55H 1N6EA 2YB8B 3MKQA 1XHMA 2H47A 3OKYB 4D6VA 3B7FA 4CI1A 5K1CC 3C75H 3I89A 4J77A 3SBPA 4E54A 2B5NA 2PM9B 3F3PA 4O45A 3VGZA 1L0QA 3BWSA 4FA9D 4EWRA 3OKWA 4CY1A 2O9KA 2B5LA 1RI6A 2UZYB 5TEFA 5HE3B 2B5MA 1MG3A 4K3JB 1R5MA 3SXTD 4GM9A 5EM2A 2IWKA 2IWFA 3NVNA 3AH8B 2BCJB 1JOFA 4A2LA 4H5IA 4FAVD 2H9LA 3OKTA 3P4FA 3PVUB 2EBSA 5FXYA 4A2MA 4J87A 2OVRB 4XEIC 4YVDA 5TEEA 3MZLA 3OTTA 4XYHA 3E0CA 3KRXB 4FWWA 4CC9A 4BL0A 2P9PC 2IUVA 3PSLA 2IAAA 2GNQA 4ZOZA 5EALA 5FKTA 2H13A 4A0BA 5IJ7E 1GXRA 4G56B 3IIWA 5GXHA 5EMJB 1SQJA 1B9XA 1N6FA 4BH6A 3EI4B 5C2VB 4BUJC 3IJ0A 3RRMC 3MZKA 1FWXA 2GC4A 2CO0C 5FKRA 3JZNA 3F3GA 4ES0A 2PBIB 4L1QD 1SHYB 3BG1A 3UVNA 4J0WA 4XYIA 1TYQC 5H17A 3JB9L 2HJBA 4ZOVA 1PBYB 5H14A 4OZUA 5I5MA 1S4UX 3DXMC 4O1QD 4IMMA 5HE2B 3C9CA 3OL2A 5K19A 3EI2B 2HJ4A 3RSEC 4QRJA 4A0AB 3CIKB 3CFSB 3AL8B 5IT9g 1GOTB 4A0AA 4ESGA 4U7AA 3IIYA 2CN3A 3EI1A 4JSVC 1JMXB 2AH1A 3RN1D 1MDAH 4A7JA 1NEXB 3N0DA 3PXTD 2G99A 4GZ8A 4OWRA 3I7LA 2I0SA 2OVPB 5HQGA 3DWLC 1JJUB 2J56H 3BG0A 4X3EA 3JAMg 5CXBB 5I5JA 3JZHA 2Z2OA 3OW8A 3KRWB 5KDOB 4A09B 5CYKB 4CZYA 2Z2PA 4Z8LA 3JROA 4A09A 3SLED 4GQ1A 1OLZA 1GP2B 4N14A 3FM0A 5EMMB 4JT5C 2CE9A 2HESX 4TZ4A 4A0BB 4ERZA 2I3SA 4CZXA 3V7DB 5CXCB 4ZOXA 4GGAA 3RFHA 3C99A 2I0RA 4L3GD 2OK4A 2XL2A 5EARA 4ZN4A 3F3FA 5FLXg 1GG2B 3AL8A 3V5WB 4PSXB 2P9NC 4X61B 4IA9A 3N0EA 3K26A 3UVOA 5GSAA 4CY3A 5JWZA 3AL9A 3EWEA 3FGBA 3SVWD 1N6DA 3UKRC 5HYNB 2AGXA 4LGNA 4J73A 4MK0B 5EMLB 4L3HD 5CYKA 5I5IA 4GGDA 5THAA 3NVXA 3UR4A 2B4EA 4LG9A 3SCYA 3SN6B 5AMSA 5CXBA 5SXMA 4PSWB 2OJYA 2AGLA 2PM6B 4J82A 4GQ2P 2YNNA 5EAPA 3OKYA 5TF2A 3SBQA 3ZWLB 3RMZD 2AGWA 2IUQA 1A0RB 3AFCA 3CFVA 3I7NA 2YNOA 4JXMA 5TDHB 3IJCA 3EI1B 3NVQA 5EMKB 3EG6A 4J81A 4A08B 4AEZA 5A2Qg 5B4WA 2G9AA 2H9MA 4ERYA 3HFQA 4J78A 4D0KA 3K27A 2AGZA 3I7HA 4AOWA 3I8CA 4CI3A 4CY5A 4GM8A 4PXWA 3L4OD 3EI3A 5HE1B 4A08A 3RFGA 3PSCB 3JPXA 2P9UC 4GM3A 3IJ1A 2H6KA 5IJ8E 3W15A 4O3TB 4R7AB 4GMBA 4K3ID 4CI2A 5H1MA 4Y7RA 1U4CA 3UVLA 4J8BA 2AGYA 3I8EA 2CE8A 4CZVA 4X63B 4FB1D 3SWSD 2H9PA 3JZGA 2I0TA 2IUPA 3JRPA 1NR0A 4ZOYA 2P9LC 3SBRA 4J8GA 2AQ5A 2YNPA 2AH0A 3DSMA 4LG8A 4U1EI 4E5ZA 4E5ZB 4ERQA 4FAND 1PEVA 2OIZA 3J80g 1PI6A 4J0XA 3DXKC 2IURA 3ODTA 1K32A 4Y5RD 2OK6A 2BBKH 4O3UB 5FQDA 4L9OA 4QL1A 5IGOA 3PE7A 5C2WB 3SHFA 2XL3A 3ULEC 3I7KA 3FRXA 3PXWD 5FKSA 4CI8A 3V9FA 4UI9R 3PXSD 1K8KC 1OMWB 5EM2B 5IC7A 3UVMA 3GREA 4GQBB 4JT6C 4KFMB 3EU7A 3J81g 2H3XA 2UZXB 3PVWB 2OVQB 4H5JA 4QT8A 1JMZB 2H6QA 4X60B 5IGQA 4FA4D 3IKOA 4GGCA 5AJAA 3RN0D 3EI3B
chains in the Genus database with same CATH superfamily
1Q47A 1PGUA 2H14A 5AFU3 1VYHC 3VA6A 1MG2A 2HYEA 2PM9A 4DNVA 4E54B 4QQEA 1E5TA 1P22A 4WK2A 2CO0A 4AN1A 3K6SA 3EI2A 2TRCB 2HKRA 4NSXA 2CN2A 2MTAH 2I3TA 5C86A 3EQ7A 3MXXA 3O4GA 3FCUA 5FFGA 4JSXC 3OL2B 4JHPC 2YMUA 3GFCA 2YBAA 4FA1D 3I7PA 3A0FA 3I2NA 3VI4A 3K71A 1E8MA 1U2VC 1XIPA 4JD2C 2Z2NA 1UTCA 3SMRA 2H68A 2QC5A 5E6UA 2XDWA 4AMYA 2J57G 2Q7QA 5EAMA 1ERJA 2HU5A 2P9SC 3V4PA 2XU7A 5GXIA 1GOFA 2HKMA 3I7OA 2CNXA 2H6NA 3K72A 5FKQA 4PC0A 3IUJA 3UVKA 2H9NA 4PNKB 1VE7A 4J84A 3EI4A 3SFZA 3IVMA 3ORVD 4O9DA 1YFQA 2HXCA 3DM0A 2W18A 4JSNC 4HDJA 4I79A 4A11A 1SQ9A 5GMKn 3SJLD 2EIDA 2HU8A 2GC7A 3EMHA 2XYIA 3L4MD 4G1MA 5M61A 4FA5D 2VC2A 2WQ8A 4A11B 3MUNA 1TBGA 3RLMD 5E6RA 3MMYA 2P9KC 3ZE0A 5HE0B 5C9ZB 2P9IC 2XE4A 1VZ2A 3O4IA 1QNIA 3UKUC 2PM7B 3O4JA 3VH0A 1K3IA 3MKSB 3U4YA 1XKSA 1B9YA 4J79A 5FA5B 4J86A 3C5MA 5CXCA 4JSPC 4PBZA 2QXVA 4PBYA 4CY2A 4FHLA 3T3PA 2J55H 1N6EA 2YB8B 3NIGA 2EICA 3MKQA 4NC4A 3ZDYA 1XHMA 2H47A 3OKYB 4DNUA 4D6VA 3B7FA 4CI1A 5K1CC 3C75H 3I89A 4J77A 3SBPA 4E54A 2B5NA 2PM9B 3F3PA 4MMZA 3QI0A 4O45A 1QFMA 3VGZA 4RE6A 1L0QA 4Z7QA 3BWSA 4FA9D 2QR5A 3ZE2A 4EWRA 3MVDK 3OKWA 2VZ3A 4CY1A 2O9KA 2B5LA 3T3MA 1RI6A 2UZYB 5TEFA 5HE3B 5M5TA 2B5MA 1MG3A 4K3JB 4BCDA 2HU7A 1R5MA 3SXTD 4GM9A 5EM2A 2EIBA 2IWKA 3GD1I 2IWFA 3NVNA 3AH8B 2BCJB 1JOFA 1T2XA 4A2LA 4H5IA 4FAVD 2H9LA 3OKTA 3P4FA 3PVUB 2EBSA 3DDUA 5FXYA 4A2MA 4J87A 2OVRB 4XEIC 4YVDA 5TEEA 3MZLA 3OTTA 4XYHA 3E0CA 3KRXB 4FWWA 4CC9A 4BL0A 2P9PC 2IUVA 3PSLA 2IAAA 2GNQA 4ZOZA 5EALA 3MUOA 5FKTA 2H13A 4A0BA 5IJ7E 1GXRA 4RE5A 1H2YA 1UOQA 4G56B 3IIWA 5GXHA 4NBMA 5EMJB 1SQJA 1B9XA 3IJEA 1N6FA 3NIDA 2XZGA 3O4HA 4BH6A 3EI4B 5C2VB 3IUMA 4BUJC 3IJ0A 3IULA 3RRMC 4UM9A 3V4VA 3MZKA 1FWXA 2GC4A 1M1XA 2CO0C 5FKRA 3JZNA 3KCIA 3F3GA 4ES0A 2PBIB 4L1QD 1TYEA 1SHYB 3BG1A 3UVNA 4J0WA 4XYIA 1TYQC 4MMXA 5H17A 2HJBA 4ZOVA 3JB9L 5E6SA 1PBYB 5H14A 4OZUA 5I5MA 1S4UX 3DXMC 4O1QD 4IMMA 5HE2B 3C9CA 1BPOA 1VE6A 3OL2A 3OF7A 4WK0A 5K19A 1I2MB 3IUQA 4AN0A 3EI2B 2HJ4A 3ZDXA 3RSEC 1UOOA 4QRJA 4A0AB 3CIKB 5HDBA 3CFSB 3AL8B 5M5SA 5IT9g 4NAAA 1GOTB 2VDOA 4A0AA 4ESGA 4U7AA 2VDRA 3IIYA 2CN3A 3EI1A 4D9SA 4JSVC 1JMXB 3NIFA 2AH1A 3RN1D 1MDAH 4A7JA 1NEXB 4DNWA 1H2WA 3N0DA 2G99A 3PXTD 4GZ8A 1UOPA 4OWRA 3I7LA 2I0SA 2OVPB 5HQGA 3DWLC 1JJUB 2J56H 3BG0A 4X3EA 3ZE1A 4G55A 3JAMg 5CXBB 5I5JA 3JZHA 2Z2OA 3OW8A 4L1MA 3KRWB 5KDOB 4A09B 5CYKB 2VDNA 4CZYA 2Z2PA 4Z8LA 1VZ3A 5C92A 3JROA 4A09A 3SLED 4BCCA 2BKLA 4GQ1A 1OLZA 1GP2B 4WJKA 4N14A 3FM0A 5EMMB 4BCBA 4JT5C 2CE9A 2HESX 4IRZA 4TZ4A 4A0BB 4ERZA 4QAMA 2I3SA 4WK4A 4CZXA 3GC3B 2VDLA 3V7DB 5CXCB 1C9IA 4ZOXA 4GGAA 1JV2A 3RFHA 3C99A 5FFOA 2I0RA 4L3GD 2OK4A 2XL2A 5EARA 4ZN4A 3F3FA 5FLXg 1GG2B 3AL8A 3V5WB 4PSXB 4MMYA 2P9NC 4X61B 4IA9A 3N0EA 3K26A 3UVOA 5GSAA 4CY3A 5JWZA 3AL9A 3EWEA 3FGBA 3SVWD 1N6DA 3UKRC 5HYNB 2AGXA 4UM8A 4LGNA 2VZ1A 4J73A 4MK0B 5EMLB 2EIEA 4L3HD 5CYKA 5I5IA 1E8NA 4GGDA 5THAA 3NVXA 3VI3A 3UR4A 2B4EA 4LG9A 3SCYA 3SN6B 5AMSA 5CXBA 5SXMA 4PSWB 2OJYA 2AGLA 2PM6B 4J82A 3QHYB 4GQ2P 2VDMA 5M5RA 2YNNA 5EAPA 3OKYA 5TF2A 1H2ZA 3SBQA 5M5VA 4NENA 3ZWLB 3RMZD 2AGWA 2IUQA 1A12A 1JTDB 1A0RB 3AFCA 3CFVA 3FCSA 2YNOA 3I7NA 4JXMA 5TDHB 3IJCA 3EI1B 3NVQA 5EMKB 3EG6A 4J81A 4A08B 4AEZA 5A2Qg 5B4WA 2G9AA 2H9MA 4ERYA 3HFQA 4J78A 4D0KA 3K27A 2AGZA 3I7HA 4AOWA 3I8CA 4CI3A 4CY5A 4GM8A 4Z7OA 4PXWA 3L4OD 4Z7NA 3EI3A 5HE1B 4A08A 3ZDZA 3RFGA 3PSCB 4AMZA 3JPXA 2P9UC 1GOGA 4GM3A 3IJ1A 3IUNA 2H6KA 5IJ8E 3W15A 4O3TB 4R7AB 4GMBA 4K3ID 4CI2A 5H1MA 4Y7RA 1U4CA 3UVLA 3EQ9A 4J8BA 2AGYA 3I8EA 2CE8A 4CZVA 4X63B 4FB1D 3SWSD 2H9PA 3JZGA 2I0TA 2IUPA 3JRPA 4AX4A 4BP9A 1NR0A 4ZOYA 1C9LA 2P9LC 3SBRA 4J8GA 5M5UA 1QFSA 2AQ5A 2YNPA 2VDQA 2AH0A 1O6FA 3DSMA 4LG8A 4U1EI 4E5ZA 4BP8A 4G1EA 4E5ZB 4ERQA 4FAND 1PEVA 2OIZA 3J80g 2JKXA 2VDPA 1PI6A 4J0XA 4JHNA 3DXKC 2IURA 3ODTA 1L5GA 1K32A 2OK6A 4Y5RD 2BBKH 4O3UB 5FQDA 4L9OA 4QL1A 5IGOA 3PE7A 5C2WB 3SHFA 2XL3A 3ULEC 3I7KA 3FRXA 3PXWD 2QZPA 5FKSA 4CI8A 1U8CA 3V9FA 1YR2A 4UI9R 4O02A 3PXSD 1K8KC 1OMWB 5EM2B 5IC7A 3UVMA 3GREA 4GQBB 4JT6C 3IURA 4O2WA 4KFMB 3EU7A 3J81g 2H3XA 2UZXB 3PVWB 2OVQB 4H5JA 4QT8A 1JMZB 2H6QA 4X60B 3EQ8A 5IGQA 4FA4D 1H2XA 3IKOA 4GGCA 5AJAA 3RN0D 3EI3B 2VDKA 1GOHA 1O6GA
chains in the Genus database with same CATH topology
1Q47A 1PGUA 2H14A 5AFU3 1VYHC 3VA6A 1MG2A 2HYEA 2PM9A 4E54B 4QQEA 1P22A 2CO0A 3EI2A 2TRCB 2HKRA 4NSXA 2CN2A 2MTAH 2I3TA 3MXXA 4JSXC 3OL2B 2YMUA 3GFCA 2YBAA 4FA1D 3I7PA 3A0FA 3I2NA 1U2VC 1XIPA 4JD2C 2Z2NA 3SMRA 2H68A 2QC5A 2J57G 2Q7QA 5EAMA 1ERJA 2P9SC 2XU7A 5GXIA 2HKMA 3I7OA 2CNXA 2H6NA 5FKQA 3UVKA 4PC0A 2H9NA 4PNKB 4J84A 3EI4A 3SFZA 3ORVD 4O9DA 1YFQA 2HXCA 3DM0A 2W18A 4JSNC 4HDJA 4I79A 4A11A 1SQ9A 5GMKn 3SJLD 3EMHA 2GC7A 3L4MD 2XYIA 4FA5D 4A11B 1TBGA 3RLMD 3MMYA 2P9KC 5HE0B 5C9ZB 2P9IC 1QNIA 3UKUC 2PM7B 3VH0A 3MKSB 3U4YA 1XKSA 1B9YA 4J79A 5FA5B 4J86A 3C5MA 5CXCA 4JSPC 4PBZA 2QXVA 4PBYA 4CY2A 4FHLA 2J55H 1N6EA 2YB8B 3MKQA 1XHMA 2H47A 3OKYB 4D6VA 3B7FA 4CI1A 5K1CC 3C75H 3I89A 4J77A 3SBPA 4E54A 2B5NA 2PM9B 3F3PA 4O45A 3VGZA 1L0QA 3BWSA 4FA9D 4EWRA 3OKWA 4CY1A 2O9KA 2B5LA 1RI6A 2UZYB 5TEFA 5HE3B 2B5MA 1MG3A 4K3JB 1R5MA 3SXTD 4GM9A 5EM2A 2IWKA 2IWFA 3NVNA 3AH8B 2BCJB 1JOFA 4A2LA 4H5IA 4FAVD 2H9LA 3OKTA 3P4FA 3PVUB 2EBSA 5FXYA 4A2MA 4J87A 2OVRB 4XEIC 4YVDA 5TEEA 3MZLA 3OTTA 4XYHA 3E0CA 3KRXB 4FWWA 4CC9A 4BL0A 2P9PC 2IUVA 3PSLA 2IAAA 2GNQA 4ZOZA 5EALA 5FKTA 2H13A 4A0BA 5IJ7E 1GXRA 4G56B 3IIWA 5GXHA 5EMJB 1SQJA 1B9XA 1N6FA 4BH6A 3EI4B 5C2VB 4BUJC 3IJ0A 3RRMC 3MZKA 1FWXA 2GC4A 2CO0C 5FKRA 3JZNA 3F3GA 4ES0A 2PBIB 4L1QD 1SHYB 3BG1A 3UVNA 4J0WA 4XYIA 1TYQC 5H17A 3JB9L 2HJBA 4ZOVA 1PBYB 5H14A 4OZUA 5I5MA 1S4UX 3DXMC 4O1QD 4IMMA 5HE2B 3C9CA 3OL2A 5K19A 3EI2B 2HJ4A 3RSEC 4QRJA 4A0AB 3CIKB 3CFSB 3AL8B 5IT9g 1GOTB 4A0AA 4ESGA 4U7AA 3IIYA 2CN3A 3EI1A 4JSVC 1JMXB 2AH1A 3RN1D 1MDAH 4A7JA 1NEXB 3N0DA 3PXTD 2G99A 4GZ8A 4OWRA 3I7LA 2I0SA 2OVPB 5HQGA 3DWLC 1JJUB 2J56H 3BG0A 4X3EA 3JAMg 5CXBB 5I5JA 3JZHA 2Z2OA 3OW8A 3KRWB 5KDOB 4A09B 5CYKB 4CZYA 2Z2PA 4Z8LA 3JROA 4A09A 3SLED 4GQ1A 1OLZA 1GP2B 4N14A 3FM0A 5EMMB 4JT5C 2CE9A 2HESX 4TZ4A 4A0BB 4ERZA 2I3SA 4CZXA 3V7DB 5CXCB 4ZOXA 4GGAA 3RFHA 3C99A 2I0RA 4L3GD 2OK4A 2XL2A 5EARA 4ZN4A 3F3FA 5FLXg 1GG2B 3AL8A 3V5WB 4PSXB 2P9NC 4X61B 4IA9A 3N0EA 3K26A 3UVOA 5GSAA 4CY3A 5JWZA 3AL9A 3EWEA 3FGBA 3SVWD 1N6DA 3UKRC 5HYNB 2AGXA 4LGNA 4J73A 4MK0B 5EMLB 4L3HD 5CYKA 5I5IA 4GGDA 5THAA 3NVXA 3UR4A 2B4EA 4LG9A 3SCYA 3SN6B 5AMSA 5CXBA 5SXMA 4PSWB 2OJYA 2AGLA 2PM6B 4J82A 4GQ2P 2YNNA 5EAPA 3OKYA 5TF2A 3SBQA 3ZWLB 3RMZD 2AGWA 2IUQA 1A0RB 3AFCA 3CFVA 3I7NA 2YNOA 4JXMA 5TDHB 3IJCA 3EI1B 3NVQA 5EMKB 3EG6A 4J81A 4A08B 4AEZA 5A2Qg 5B4WA 2G9AA 2H9MA 4ERYA 3HFQA 4J78A 4D0KA 3K27A 2AGZA 3I7HA 4AOWA 3I8CA 4CI3A 4CY5A 4GM8A 4PXWA 3L4OD 3EI3A 5HE1B 4A08A 3RFGA 3PSCB 3JPXA 2P9UC 4GM3A 3IJ1A 2H6KA 5IJ8E 3W15A 4O3TB 4R7AB 4GMBA 4K3ID 4CI2A 5H1MA 4Y7RA 1U4CA 3UVLA 4J8BA 2AGYA 3I8EA 2CE8A 4CZVA 4X63B 4FB1D 3SWSD 2H9PA 3JZGA 2I0TA 2IUPA 3JRPA 1NR0A 4ZOYA 2P9LC 3SBRA 4J8GA 2AQ5A 2YNPA 2AH0A 3DSMA 4LG8A 4U1EI 4E5ZA 4E5ZB 4ERQA 4FAND 1PEVA 2OIZA 3J80g 1PI6A 4J0XA 3DXKC 2IURA 3ODTA 1K32A 4Y5RD 2OK6A 2BBKH 4O3UB 5FQDA 4L9OA 4QL1A 5IGOA 3PE7A 5C2WB 3SHFA 2XL3A 3ULEC 3I7KA 3FRXA 3PXWD 5FKSA 4CI8A 3V9FA 4UI9R 3PXSD 1K8KC 1OMWB 5EM2B 5IC7A 3UVMA 3GREA 4GQBB 4JT6C 4KFMB 3EU7A 3J81g 2H3XA 2UZXB 3PVWB 2OVQB 4H5JA 4QT8A 1JMZB 2H6QA 4X60B 5IGQA 4FA4D 3IKOA 4GGCA 5AJAA 3RN0D 3EI3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q47 A;  1PGU A;  2H14 A;  5AFU 3;  1VYH C;  3VA6 A;  1MG2 A;  2HYE A;  2PM9 A;  4E54 B;  4QQE A;  1P22 A;  2CO0 A;  3EI2 A;  2TRC B;  2HKR A;  4NSX A;  2CN2 A;  2MTA H;  2I3T A;  3MXX A;  4JSX C;  3OL2 B;  2YMU A;  3GFC A;  2YBA A;  4FA1 D;  3I7P A;  3A0F A;  3I2N A;  1U2V C;  1XIP A;  4JD2 C;  2Z2N A;  3SMR A;  2H68 A;  2QC5 A;  2J57 G;  2Q7Q A;  5EAM A;  1ERJ A;  2P9S C;  2XU7 A;  5GXI A;  2HKM A;  3I7O A;  2CNX A;  2H6N A;  5FKQ A;  3UVK A;  4PC0 A;  2H9N A;  4PNK B;  4J84 A;  3EI4 A;  3SFZ A;  3ORV D;  4O9D A;  1YFQ A;  2HXC A;  3DM0 A;  2W18 A;  4JSN C;  4HDJ A;  4I79 A;  4A11 A;  1SQ9 A;  5GMK n;  3SJL D;  3EMH A;  2GC7 A;  3L4M D;  2XYI A;  4FA5 D;  4A11 B;  1TBG A;  3RLM D;  3MMY A;  2P9K C;  5HE0 B;  5C9Z B;  2P9I C;  1QNI A;  3UKU C;  2PM7 B;  3VH0 A;  3MKS B;  3U4Y A;  1XKS A;  1B9Y A;  4J79 A;  5FA5 B;  4J86 A;  3C5M A;  5CXC A;  4JSP C;  4PBZ A;  2QXV A;  4PBY A;  4CY2 A;  4FHL A;  2J55 H;  1N6E A;  2YB8 B;  3MKQ A;  1XHM A;  2H47 A;  3OKY B;  4D6V A;  3B7F A;  4CI1 A;  5K1C C;  3C75 H;  3I89 A;  4J77 A;  3SBP A;  4E54 A;  2B5N A;  2PM9 B;  3F3P A;  4O45 A;  3VGZ A;  1L0Q A;  3BWS A;  4FA9 D;  4EWR A;  3OKW A;  4CY1 A;  2O9K A;  2B5L A;  1RI6 A;  2UZY B;  5TEF A;  5HE3 B;  2B5M A;  1MG3 A;  4K3J B;  1R5M A;  3SXT D;  4GM9 A;  5EM2 A;  2IWK A;  2IWF A;  3NVN A;  3AH8 B;  2BCJ B;  1JOF A;  4A2L A;  4H5I A;  4FAV D;  2H9L A;  3OKT A;  3P4F A;  3PVU B;  2EBS A;  5FXY A;  4A2M A;  4J87 A;  2OVR B;  4XEI C;  4YVD A;  5TEE A;  3MZL A;  3OTT A;  4XYH A;  3E0C A;  3KRX B;  4FWW A;  4CC9 A;  4BL0 A;  2P9P C;  2IUV A;  3PSL A;  2IAA A;  2GNQ A;  4ZOZ A;  5EAL A;  5FKT A;  2H13 A;  4A0B A;  5IJ7 E;  1GXR A;  4G56 B;  3IIW A;  5GXH A;  5EMJ B;  1SQJ A;  1B9X A;  1N6F A;  4BH6 A;  3EI4 B;  5C2V B;  4BUJ C;  3IJ0 A;  3RRM C;  3MZK A;  1FWX A;  2GC4 A;  2CO0 C;  5FKR A;  3JZN A;  3F3G A;  4ES0 A;  2PBI B;  4L1Q D;  1SHY B;  3BG1 A;  3UVN A;  4J0W A;  4XYI A;  1TYQ C;  5H17 A;  3JB9 L;  2HJB A;  4ZOV A;  1PBY B;  5H14 A;  4OZU A;  5I5M A;  1S4U X;  3DXM C;  4O1Q D;  4IMM A;  5HE2 B;  3C9C A;  3OL2 A;  5K19 A;  3EI2 B;  2HJ4 A;  3RSE C;  4QRJ A;  4A0A B;  3CIK B;  3CFS B;  3AL8 B;  5IT9 g;  1GOT B;  4A0A A;  4ESG A;  4U7A A;  3IIY A;  2CN3 A;  3EI1 A;  4JSV C;  1JMX B;  2AH1 A;  3RN1 D;  1MDA H;  4A7J A;  1NEX B;  3N0D A;  3PXT D;  2G99 A;  4GZ8 A;  4OWR A;  3I7L A;  2I0S A;  2OVP B;  5HQG A;  3DWL C;  1JJU B;  2J56 H;  3BG0 A;  4X3E A;  3JAM g;  5CXB B;  5I5J A;  3JZH A;  2Z2O A;  3OW8 A;  3KRW B;  5KDO B;  4A09 B;  5CYK B;  4CZY A;  2Z2P A;  4Z8L A;  3JRO A;  4A09 A;  3SLE D;  4GQ1 A;  1OLZ A;  1GP2 B;  4N14 A;  3FM0 A;  5EMM B;  4JT5 C;  2CE9 A;  2HES X;  4TZ4 A;  4A0B B;  4ERZ A;  2I3S A;  4CZX A;  3V7D B;  5CXC B;  4ZOX A;  4GGA A;  3RFH A;  3C99 A;  2I0R A;  4L3G D;  2OK4 A;  2XL2 A;  5EAR A;  4ZN4 A;  3F3F A;  5FLX g;  1GG2 B;  3AL8 A;  3V5W B;  4PSX B;  2P9N C;  4X61 B;  4IA9 A;  3N0E A;  3K26 A;  3UVO A;  5GSA A;  4CY3 A;  5JWZ A;  3AL9 A;  3EWE A;  3FGB A;  3SVW D;  1N6D A;  3UKR C;  5HYN B;  2AGX A;  4LGN A;  4J73 A;  4MK0 B;  5EML B;  4L3H D;  5CYK A;  5I5I A;  4GGD A;  5THA A;  3NVX A;  3UR4 A;  2B4E A;  4LG9 A;  3SCY A;  3SN6 B;  5AMS A;  5CXB A;  5SXM A;  4PSW B;  2OJY A;  2AGL A;  2PM6 B;  4J82 A;  4GQ2 P;  2YNN A;  5EAP A;  3OKY A;  5TF2 A;  3SBQ A;  3ZWL B;  3RMZ D;  2AGW A;  2IUQ A;  1A0R B;  3AFC A;  3CFV A;  3I7N A;  2YNO A;  4JXM A;  5TDH B;  3IJC A;  3EI1 B;  3NVQ A;  5EMK B;  3EG6 A;  4J81 A;  4A08 B;  4AEZ A;  5A2Q g;  5B4W A;  2G9A A;  2H9M A;  4ERY A;  3HFQ A;  4J78 A;  4D0K A;  3K27 A;  2AGZ A;  3I7H A;  4AOW A;  3I8C A;  4CI3 A;  4CY5 A;  4GM8 A;  4PXW A;  3L4O D;  3EI3 A;  5HE1 B;  4A08 A;  3RFG A;  3PSC B;  3JPX A;  2P9U C;  4GM3 A;  3IJ1 A;  2H6K A;  5IJ8 E;  3W15 A;  4O3T B;  4R7A B;  4GMB A;  4K3I D;  4CI2 A;  5H1M A;  4Y7R A;  1U4C A;  3UVL A;  4J8B A;  2AGY A;  3I8E A;  2CE8 A;  4CZV A;  4X63 B;  4FB1 D;  3SWS D;  2H9P A;  3JZG A;  2I0T A;  2IUP A;  3JRP A;  1NR0 A;  4ZOY A;  2P9L C;  3SBR A;  4J8G A;  2AQ5 A;  2YNP A;  2AH0 A;  3DSM A;  4LG8 A;  4U1E I;  4E5Z A;  4E5Z B;  4ERQ A;  4FAN D;  1PEV A;  2OIZ A;  3J80 g;  1PI6 A;  4J0X A;  3DXK C;  2IUR A;  3ODT A;  1K32 A;  4Y5R D;  2OK6 A;  2BBK H;  4O3U B;  5FQD A;  4L9O A;  4QL1 A;  5IGO A;  3PE7 A;  5C2W B;  3SHF A;  2XL3 A;  3ULE C;  3I7K A;  3FRX A;  3PXW D;  5FKS A;  4CI8 A;  3V9F A;  4UI9 R;  3PXS D;  1K8K C;  1OMW B;  5EM2 B;  5IC7 A;  3UVM A;  3GRE A;  4GQB B;  4JT6 C;  4KFM B;  3EU7 A;  3J81 g;  2H3X A;  2UZX B;  3PVW B;  2OVQ B;  4H5J A;  4QT8 A;  1JMZ B;  2H6Q A;  4X60 B;  5IGQ A;  4FA4 D;  3IKO A;  4GGC A;  5AJA A;  3RN0 D;  3EI3 B; 
#chains in the Genus database with same CATH topology
 1Q47 A;  1PGU A;  2H14 A;  5AFU 3;  1VYH C;  3VA6 A;  1MG2 A;  2HYE A;  2PM9 A;  4DNV A;  4E54 B;  4QQE A;  1E5T A;  1P22 A;  4WK2 A;  2CO0 A;  4AN1 A;  3K6S A;  3EI2 A;  2TRC B;  2HKR A;  4NSX A;  2CN2 A;  2MTA H;  2I3T A;  5C86 A;  3EQ7 A;  3MXX A;  3O4G A;  3FCU A;  5FFG A;  4JSX C;  3OL2 B;  4JHP C;  2YMU A;  3GFC A;  2YBA A;  4FA1 D;  3I7P A;  3A0F A;  3I2N A;  3VI4 A;  3K71 A;  1E8M A;  1U2V C;  1XIP A;  4JD2 C;  2Z2N A;  1UTC A;  3SMR A;  2H68 A;  2QC5 A;  5E6U A;  2XDW A;  4AMY A;  2J57 G;  2Q7Q A;  5EAM A;  1ERJ A;  2HU5 A;  2P9S C;  3V4P A;  2XU7 A;  5GXI A;  1GOF A;  2HKM A;  3I7O A;  2CNX A;  2H6N A;  3K72 A;  5FKQ A;  4PC0 A;  3IUJ A;  3UVK A;  2H9N A;  4PNK B;  1VE7 A;  4J84 A;  3EI4 A;  3SFZ A;  3IVM A;  3ORV D;  4O9D A;  1YFQ A;  2HXC A;  3DM0 A;  2W18 A;  4JSN C;  4HDJ A;  4I79 A;  4A11 A;  1SQ9 A;  5GMK n;  3SJL D;  2EID A;  2HU8 A;  2GC7 A;  3EMH A;  2XYI A;  3L4M D;  4G1M A;  5M61 A;  4FA5 D;  2VC2 A;  2WQ8 A;  4A11 B;  3MUN A;  1TBG A;  3RLM D;  5E6R A;  3MMY A;  2P9K C;  3ZE0 A;  5HE0 B;  5C9Z B;  2P9I C;  2XE4 A;  1VZ2 A;  3O4I A;  1QNI A;  3UKU C;  2PM7 B;  3O4J A;  3VH0 A;  1K3I A;  3MKS B;  3U4Y A;  1XKS A;  1B9Y A;  4J79 A;  5FA5 B;  4J86 A;  3C5M A;  5CXC A;  4JSP C;  4PBZ A;  2QXV A;  4PBY A;  4CY2 A;  4FHL A;  3T3P A;  2J55 H;  1N6E A;  2YB8 B;  3NIG A;  2EIC A;  3MKQ A;  4NC4 A;  3ZDY A;  1XHM A;  2H47 A;  3OKY B;  4DNU A;  4D6V A;  3B7F A;  4CI1 A;  5K1C C;  3C75 H;  3I89 A;  4J77 A;  3SBP A;  4E54 A;  2B5N A;  2PM9 B;  3F3P A;  4MMZ A;  3QI0 A;  4O45 A;  1QFM A;  3VGZ A;  4RE6 A;  1L0Q A;  4Z7Q A;  3BWS A;  4FA9 D;  2QR5 A;  3ZE2 A;  4EWR A;  3MVD K;  3OKW A;  2VZ3 A;  4CY1 A;  2O9K A;  2B5L A;  3T3M A;  1RI6 A;  2UZY B;  5TEF A;  5HE3 B;  5M5T A;  2B5M A;  1MG3 A;  4K3J B;  4BCD A;  2HU7 A;  1R5M A;  3SXT D;  4GM9 A;  5EM2 A;  2EIB A;  2IWK A;  3GD1 I;  2IWF A;  3NVN A;  3AH8 B;  2BCJ B;  1JOF A;  1T2X A;  4A2L A;  4H5I A;  4FAV D;  2H9L A;  3OKT A;  3P4F A;  3PVU B;  2EBS A;  3DDU A;  5FXY A;  4A2M A;  4J87 A;  2OVR B;  4XEI C;  4YVD A;  5TEE A;  3MZL A;  3OTT A;  4XYH A;  3E0C A;  3KRX B;  4FWW A;  4CC9 A;  4BL0 A;  2P9P C;  2IUV A;  3PSL A;  2IAA A;  2GNQ A;  4ZOZ A;  5EAL A;  3MUO A;  5FKT A;  2H13 A;  4A0B A;  5IJ7 E;  1GXR A;  4RE5 A;  1H2Y A;  1UOQ A;  4G56 B;  3IIW A;  5GXH A;  4NBM A;  5EMJ B;  1SQJ A;  1B9X A;  3IJE A;  1N6F A;  3NID A;  2XZG A;  3O4H A;  4BH6 A;  3EI4 B;  5C2V B;  3IUM A;  4BUJ C;  3IJ0 A;  3IUL A;  3RRM C;  4UM9 A;  3V4V A;  3MZK A;  1FWX A;  2GC4 A;  1M1X A;  2CO0 C;  5FKR A;  3JZN A;  3KCI A;  3F3G A;  4ES0 A;  2PBI B;  4L1Q D;  1TYE A;  1SHY B;  3BG1 A;  3UVN A;  4J0W A;  4XYI A;  1TYQ C;  4MMX A;  5H17 A;  2HJB A;  4ZOV A;  3JB9 L;  5E6S A;  1PBY B;  5H14 A;  4OZU A;  5I5M A;  1S4U X;  3DXM C;  4O1Q D;  4IMM A;  5HE2 B;  3C9C A;  1BPO A;  1VE6 A;  3OL2 A;  3OF7 A;  4WK0 A;  5K19 A;  1I2M B;  3IUQ A;  4AN0 A;  3EI2 B;  2HJ4 A;  3ZDX A;  3RSE C;  1UOO A;  4QRJ A;  4A0A B;  3CIK B;  5HDB A;  3CFS B;  3AL8 B;  5M5S A;  5IT9 g;  4NAA A;  1GOT B;  2VDO A;  4A0A A;  4ESG A;  4U7A A;  2VDR A;  3IIY A;  2CN3 A;  3EI1 A;  4D9S A;  4JSV C;  1JMX B;  3NIF A;  2AH1 A;  3RN1 D;  1MDA H;  4A7J A;  1NEX B;  4DNW A;  1H2W A;  3N0D A;  2G99 A;  3PXT D;  4GZ8 A;  1UOP A;  4OWR A;  3I7L A;  2I0S A;  2OVP B;  5HQG A;  3DWL C;  1JJU B;  2J56 H;  3BG0 A;  4X3E A;  3ZE1 A;  4G55 A;  3JAM g;  5CXB B;  5I5J A;  3JZH A;  2Z2O A;  3OW8 A;  4L1M A;  3KRW B;  5KDO B;  4A09 B;  5CYK B;  2VDN A;  4CZY A;  2Z2P A;  4Z8L A;  1VZ3 A;  5C92 A;  3JRO A;  4A09 A;  3SLE D;  4BCC A;  2BKL A;  4GQ1 A;  1OLZ A;  1GP2 B;  4WJK A;  4N14 A;  3FM0 A;  5EMM B;  4BCB A;  4JT5 C;  2CE9 A;  2HES X;  4IRZ A;  4TZ4 A;  4A0B B;  4ERZ A;  4QAM A;  2I3S A;  4WK4 A;  4CZX A;  3GC3 B;  2VDL A;  3V7D B;  5CXC B;  1C9I A;  4ZOX A;  4GGA A;  1JV2 A;  3RFH A;  3C99 A;  5FFO A;  2I0R A;  4L3G D;  2OK4 A;  2XL2 A;  5EAR A;  4ZN4 A;  3F3F A;  5FLX g;  1GG2 B;  3AL8 A;  3V5W B;  4PSX B;  4MMY A;  2P9N C;  4X61 B;  4IA9 A;  3N0E A;  3K26 A;  3UVO A;  5GSA A;  4CY3 A;  5JWZ A;  3AL9 A;  3EWE A;  3FGB A;  3SVW D;  1N6D A;  3UKR C;  5HYN B;  2AGX A;  4UM8 A;  4LGN A;  2VZ1 A;  4J73 A;  4MK0 B;  5EML B;  2EIE A;  4L3H D;  5CYK A;  5I5I A;  1E8N A;  4GGD A;  5THA A;  3NVX A;  3VI3 A;  3UR4 A;  2B4E A;  4LG9 A;  3SCY A;  3SN6 B;  5AMS A;  5CXB A;  5SXM A;  4PSW B;  2OJY A;  2AGL A;  2PM6 B;  4J82 A;  3QHY B;  4GQ2 P;  2VDM A;  5M5R A;  2YNN A;  5EAP A;  3OKY A;  5TF2 A;  1H2Z A;  3SBQ A;  5M5V A;  4NEN A;  3ZWL B;  3RMZ D;  2AGW A;  2IUQ A;  1A12 A;  1JTD B;  1A0R B;  3AFC A;  3CFV A;  3FCS A;  2YNO A;  3I7N A;  4JXM A;  5TDH B;  3IJC A;  3EI1 B;  3NVQ A;  5EMK B;  3EG6 A;  4J81 A;  4A08 B;  4AEZ A;  5A2Q g;  5B4W A;  2G9A A;  2H9M A;  4ERY A;  3HFQ A;  4J78 A;  4D0K A;  3K27 A;  2AGZ A;  3I7H A;  4AOW A;  3I8C A;  4CI3 A;  4CY5 A;  4GM8 A;  4Z7O A;  4PXW A;  3L4O D;  4Z7N A;  3EI3 A;  5HE1 B;  4A08 A;  3ZDZ A;  3RFG A;  3PSC B;  4AMZ A;  3JPX A;  2P9U C;  1GOG A;  4GM3 A;  3IJ1 A;  3IUN A;  2H6K A;  5IJ8 E;  3W15 A;  4O3T B;  4R7A B;  4GMB A;  4K3I D;  4CI2 A;  5H1M A;  4Y7R A;  1U4C A;  3UVL A;  3EQ9 A;  4J8B A;  2AGY A;  3I8E A;  2CE8 A;  4CZV A;  4X63 B;  4FB1 D;  3SWS D;  2H9P A;  3JZG A;  2I0T A;  2IUP A;  3JRP A;  4AX4 A;  4BP9 A;  1NR0 A;  4ZOY A;  1C9L A;  2P9L C;  3SBR A;  4J8G A;  5M5U A;  1QFS A;  2AQ5 A;  2YNP A;  2VDQ A;  2AH0 A;  1O6F A;  3DSM A;  4LG8 A;  4U1E I;  4E5Z A;  4BP8 A;  4G1E A;  4E5Z B;  4ERQ A;  4FAN D;  1PEV A;  2OIZ A;  3J80 g;  2JKX A;  2VDP A;  1PI6 A;  4J0X A;  4JHN A;  3DXK C;  2IUR A;  3ODT A;  1L5G A;  1K32 A;  2OK6 A;  4Y5R D;  2BBK H;  4O3U B;  5FQD A;  4L9O A;  4QL1 A;  5IGO A;  3PE7 A;  5C2W B;  3SHF A;  2XL3 A;  3ULE C;  3I7K A;  3FRX A;  3PXW D;  2QZP A;  5FKS A;  4CI8 A;  1U8C A;  3V9F A;  1YR2 A;  4UI9 R;  4O02 A;  3PXS D;  1K8K C;  1OMW B;  5EM2 B;  5IC7 A;  3UVM A;  3GRE A;  4GQB B;  4JT6 C;  3IUR A;  4O2W A;  4KFM B;  3EU7 A;  3J81 g;  2H3X A;  2UZX B;  3PVW B;  2OVQ B;  4H5J A;  4QT8 A;  1JMZ B;  2H6Q A;  4X60 B;  3EQ8 A;  5IGQ A;  4FA4 D;  1H2X A;  3IKO A;  4GGC A;  5AJA A;  3RN0 D;  3EI3 B;  2VDK A;  1GOH A;  1O6G A; 
#chains in the Genus database with same CATH homology
 1Q47 A;  1PGU A;  2H14 A;  5AFU 3;  1VYH C;  3VA6 A;  1MG2 A;  2HYE A;  2PM9 A;  4E54 B;  4QQE A;  1P22 A;  2CO0 A;  3EI2 A;  2TRC B;  2HKR A;  4NSX A;  2CN2 A;  2MTA H;  2I3T A;  3MXX A;  4JSX C;  3OL2 B;  2YMU A;  3GFC A;  2YBA A;  4FA1 D;  3I7P A;  3A0F A;  3I2N A;  1U2V C;  1XIP A;  4JD2 C;  2Z2N A;  3SMR A;  2H68 A;  2QC5 A;  2J57 G;  2Q7Q A;  5EAM A;  1ERJ A;  2P9S C;  2XU7 A;  5GXI A;  2HKM A;  3I7O A;  2CNX A;  2H6N A;  5FKQ A;  3UVK A;  4PC0 A;  2H9N A;  4PNK B;  4J84 A;  3EI4 A;  3SFZ A;  3ORV D;  4O9D A;  1YFQ A;  2HXC A;  3DM0 A;  2W18 A;  4JSN C;  4HDJ A;  4I79 A;  4A11 A;  1SQ9 A;  5GMK n;  3SJL D;  3EMH A;  2GC7 A;  3L4M D;  2XYI A;  4FA5 D;  4A11 B;  1TBG A;  3RLM D;  3MMY A;  2P9K C;  5HE0 B;  5C9Z B;  2P9I C;  1QNI A;  3UKU C;  2PM7 B;  3VH0 A;  3MKS B;  3U4Y A;  1XKS A;  1B9Y A;  4J79 A;  5FA5 B;  4J86 A;  3C5M A;  5CXC A;  4JSP C;  4PBZ A;  2QXV A;  4PBY A;  4CY2 A;  4FHL A;  2J55 H;  1N6E A;  2YB8 B;  3MKQ A;  1XHM A;  2H47 A;  3OKY B;  4D6V A;  3B7F A;  4CI1 A;  5K1C C;  3C75 H;  3I89 A;  4J77 A;  3SBP A;  4E54 A;  2B5N A;  2PM9 B;  3F3P A;  4O45 A;  3VGZ A;  1L0Q A;  3BWS A;  4FA9 D;  4EWR A;  3OKW A;  4CY1 A;  2O9K A;  2B5L A;  1RI6 A;  2UZY B;  5TEF A;  5HE3 B;  2B5M A;  1MG3 A;  4K3J B;  1R5M A;  3SXT D;  4GM9 A;  5EM2 A;  2IWK A;  2IWF A;  3NVN A;  3AH8 B;  2BCJ B;  1JOF A;  4A2L A;  4H5I A;  4FAV D;  2H9L A;  3OKT A;  3P4F A;  3PVU B;  2EBS A;  5FXY A;  4A2M A;  4J87 A;  2OVR B;  4XEI C;  4YVD A;  5TEE A;  3MZL A;  3OTT A;  4XYH A;  3E0C A;  3KRX B;  4FWW A;  4CC9 A;  4BL0 A;  2P9P C;  2IUV A;  3PSL A;  2IAA A;  2GNQ A;  4ZOZ A;  5EAL A;  5FKT A;  2H13 A;  4A0B A;  5IJ7 E;  1GXR A;  4G56 B;  3IIW A;  5GXH A;  5EMJ B;  1SQJ A;  1B9X A;  1N6F A;  4BH6 A;  3EI4 B;  5C2V B;  4BUJ C;  3IJ0 A;  3RRM C;  3MZK A;  1FWX A;  2GC4 A;  2CO0 C;  5FKR A;  3JZN A;  3F3G A;  4ES0 A;  2PBI B;  4L1Q D;  1SHY B;  3BG1 A;  3UVN A;  4J0W A;  4XYI A;  1TYQ C;  5H17 A;  3JB9 L;  2HJB A;  4ZOV A;  1PBY B;  5H14 A;  4OZU A;  5I5M A;  1S4U X;  3DXM C;  4O1Q D;  4IMM A;  5HE2 B;  3C9C A;  3OL2 A;  5K19 A;  3EI2 B;  2HJ4 A;  3RSE C;  4QRJ A;  4A0A B;  3CIK B;  3CFS B;  3AL8 B;  5IT9 g;  1GOT B;  4A0A A;  4ESG A;  4U7A A;  3IIY A;  2CN3 A;  3EI1 A;  4JSV C;  1JMX B;  2AH1 A;  3RN1 D;  1MDA H;  4A7J A;  1NEX B;  3N0D A;  3PXT D;  2G99 A;  4GZ8 A;  4OWR A;  3I7L A;  2I0S A;  2OVP B;  5HQG A;  3DWL C;  1JJU B;  2J56 H;  3BG0 A;  4X3E A;  3JAM g;  5CXB B;  5I5J A;  3JZH A;  2Z2O A;  3OW8 A;  3KRW B;  5KDO B;  4A09 B;  5CYK B;  4CZY A;  2Z2P A;  4Z8L A;  3JRO A;  4A09 A;  3SLE D;  4GQ1 A;  1OLZ A;  1GP2 B;  4N14 A;  3FM0 A;  5EMM B;  4JT5 C;  2CE9 A;  2HES X;  4TZ4 A;  4A0B B;  4ERZ A;  2I3S A;  4CZX A;  3V7D B;  5CXC B;  4ZOX A;  4GGA A;  3RFH A;  3C99 A;  2I0R A;  4L3G D;  2OK4 A;  2XL2 A;  5EAR A;  4ZN4 A;  3F3F A;  5FLX g;  1GG2 B;  3AL8 A;  3V5W B;  4PSX B;  2P9N C;  4X61 B;  4IA9 A;  3N0E A;  3K26 A;  3UVO A;  5GSA A;  4CY3 A;  5JWZ A;  3AL9 A;  3EWE A;  3FGB A;  3SVW D;  1N6D A;  3UKR C;  5HYN B;  2AGX A;  4LGN A;  4J73 A;  4MK0 B;  5EML B;  4L3H D;  5CYK A;  5I5I A;  4GGD A;  5THA A;  3NVX A;  3UR4 A;  2B4E A;  4LG9 A;  3SCY A;  3SN6 B;  5AMS A;  5CXB A;  5SXM A;  4PSW B;  2OJY A;  2AGL A;  2PM6 B;  4J82 A;  4GQ2 P;  2YNN A;  5EAP A;  3OKY A;  5TF2 A;  3SBQ A;  3ZWL B;  3RMZ D;  2AGW A;  2IUQ A;  1A0R B;  3AFC A;  3CFV A;  3I7N A;  2YNO A;  4JXM A;  5TDH B;  3IJC A;  3EI1 B;  3NVQ A;  5EMK B;  3EG6 A;  4J81 A;  4A08 B;  4AEZ A;  5A2Q g;  5B4W A;  2G9A A;  2H9M A;  4ERY A;  3HFQ A;  4J78 A;  4D0K A;  3K27 A;  2AGZ A;  3I7H A;  4AOW A;  3I8C A;  4CI3 A;  4CY5 A;  4GM8 A;  4PXW A;  3L4O D;  3EI3 A;  5HE1 B;  4A08 A;  3RFG A;  3PSC B;  3JPX A;  2P9U C;  4GM3 A;  3IJ1 A;  2H6K A;  5IJ8 E;  3W15 A;  4O3T B;  4R7A B;  4GMB A;  4K3I D;  4CI2 A;  5H1M A;  4Y7R A;  1U4C A;  3UVL A;  4J8B A;  2AGY A;  3I8E A;  2CE8 A;  4CZV A;  4X63 B;  4FB1 D;  3SWS D;  2H9P A;  3JZG A;  2I0T A;  2IUP A;  3JRP A;  1NR0 A;  4ZOY A;  2P9L C;  3SBR A;  4J8G A;  2AQ5 A;  2YNP A;  2AH0 A;  3DSM A;  4LG8 A;  4U1E I;  4E5Z A;  4E5Z B;  4ERQ A;  4FAN D;  1PEV A;  2OIZ A;  3J80 g;  1PI6 A;  4J0X A;  3DXK C;  2IUR A;  3ODT A;  1K32 A;  4Y5R D;  2OK6 A;  2BBK H;  4O3U B;  5FQD A;  4L9O A;  4QL1 A;  5IGO A;  3PE7 A;  5C2W B;  3SHF A;  2XL3 A;  3ULE C;  3I7K A;  3FRX A;  3PXW D;  5FKS A;  4CI8 A;  3V9F A;  4UI9 R;  3PXS D;  1K8K C;  1OMW B;  5EM2 B;  5IC7 A;  3UVM A;  3GRE A;  4GQB B;  4JT6 C;  4KFM B;  3EU7 A;  3J81 g;  2H3X A;  2UZX B;  3PVW B;  2OVQ B;  4H5J A;  4QT8 A;  1JMZ B;  2H6Q A;  4X60 B;  5IGQ A;  4FA4 D;  3IKO A;  4GGC A;  5AJA A;  3RN0 D;  3EI3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...