1YR2A

Structural and mechanistic analysis of two prolyl endopeptidases: role of inter-domain dynamics in catalysis and specificity
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
701
structure length
680
Chain Sequence
PPYPASPQVPLVEDHFGEKVSDPWRWLEADVRTDAKVAAWVQAQSAYTAAYLKQLPERAALEKRMKALIDYERFGLPQRRGASVFYSWNSGLMNQSQLLVRPADAPVGTKGRVLLDPNTWATALDAWAASDDGRLLAYSVQDGGSDWRTVKFVGVADGKPLADELKWVKFSGLAWLGNDALLYSRFAEPLNYNQTVWLHRLGTPQSADQPVFATPELPKRGHGASVSSDGRWVVITSSEGTDPVNTVHVARVTNGKIGPVTALIPDLKAQWDFVDGVGDQLWFVSGDGAPLKKIVRVDLSGSTPRFDTVVPESKDNLESVGIAGNRLFASYIHDAKSQVLAFDLDGKPAGAVSLPGIGSASGLSGRPGDRHAYLSFSSFTQPATVLALDPATAKTTPWEPVHLTFDPADFRVEQVFYPSKDGTKVPMFIVRRKDAKGPLPTLLYGYGGFNVALTPWFSAGFMTWIDSGGAFALANLRGGGEYGDAWHDAGRRDKKQNVFDDFIAAGEWLIANGVTPRHGLAIEGGSNGGLLIGAVTNQRPDLFAAASPAVGVMDMLRFDQFTAGRYWVDDYGYPEKEADWRVLRRYSPYHNVRSGVDYPAILVTTADTDDRVVPGHSFKYTAALQTAAIGPKPHLIRIEPIDKQIEETADVQAFLAHFTGLTPRPWSSVDKLAAALEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Mechanistic Analysis of Two Prolyl Endopeptidases: Role of Interdomain Dynamics in Catalysis and Specificity
pubmed doi rcsb
source organism Novosphingobium capsulatum
molecule tags Hydrolase
molecule keywords prolyl oligopeptidase
total genus 199
structure length 680
sequence length 701
ec nomenclature ec 3.4.21.26: Prolyl oligopeptidase.
pdb deposition date 2005-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00326 Peptidase_S9 Prolyl oligopeptidase family
A PF02897 Peptidase_S9_N Prolyl oligopeptidase, N-terminal beta-propeller domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.120 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Prolyl oligopeptidase, N-terminal domain 1yr2A02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1yr2A01
4N8EA 3O95A 3W9UA 3FWHA 1SC9A 2VA9A 4DSAA 5LKRA 3ZV7A 4QWMA 1QIKA 1Z68A 2XQJA 4RNCA 1FFBA 4I19A 3CCBA 5AI9A 1RP1A 1U4NA 1UOOA 2XQGA 1R88A 2QR5A 2PSDA 3VJKA 1MTZA 1G66A 2ORYA 2O2GA 3ZLUA 1ZJ5A 1AC5A 4X95A 5CT8A 1ZD2P 4TVKA 5ALWA 3I28A 1B41A 5A7GA 4CG3A 2Y2VA 4JH0A 5T4EA 2ZSIA 1AKNA 1BN7A 1UK7A 1N5MA 5HK8A 3FLBA 5FOQA 5C8XA 3MUOA 2QT9A 1GKLA 3DEAA 5AKHA 4KYVA 4QE3A 5LZ2A 1K8QA 1JJBA 2XLBA 1UKCA 3BJMA 1N1MA 1QIMA 1BEZA 5D3KA 3G9UA 2GYVA 4UBLA 1HPLA 3AZOA 1XKTA 3R3YA 3F96A 4B81A 3AFIA 3H04A 5AKJA 3C43A 3H2KA 4BVKA 4MQMA 5CRIA 5HF5A 1CLEA 2XMRA 3R40A 4G8CA 3G0GA 5JASA 1R50A 5K3AA 3ZWQA 3RK4A 3PICA 1YASA 3EBLA 2QM0A 1XQXA 2ZJ7A 1AURA 5JAUA 4HXEB 4H7IA 1HQDA 4H7FA 2K2QB 2HHAA 1S8OA 4EB0A 1CUWA 3QMMA 5LLSA 1E8NA 3QZUA 3BIXA 2ONCA 4QDTA 5AKYA 3DNMA 5ALMA 5EI5A 4BZWA 3WWOA 4JUIA 3QYJA 2HA0A 5K3CA 3WL6A 4EY5A 1HLGA 2ZYSA 1DX6A 4FNGA 2GYWA 2C0QA 3M3DA 4PQEA 1QO7A 4C89A 1VOTA 3BJRA 4WJLA 5FPPA 1DQYA 4CI9A 2G63A 1N8SA 5AIBA 3DKKA 2RGUA 5AKXA 1P0MA 1WPXA 3ESBA 2WUDA 3OG9A 2Y2UA 4BRSA 1QIHA 4BDSA 2HM7A 4Q3OA 1KEZA 1QTIA 2GBIA 4LIPD 2OLEA 1K6EA 3F67A 3H17A 5JALA 4CCYA 3L1JA 2CMFA 4FWBA 1XZFA 2BFNA 1C4XA 2V98A 1DX4A 5ALLA 3WK8A 4L0CA 3WKBA 5AM3A 1ZIXA 2HL6A 1ACJA 4QDOA 4MYSA 3H1BA 4KAJA 3M82A 3AJAA 3F9CA 4PW0A 3HI4A 3MVEA 4J03A 5JD5A 3DCNA 5T4FA 1OXMA 4PSUA 1ACLA 5C7YA 2ACKA 2EEPA 3S8YA 4UHDA 3G02A 3T52A 3EF3A 3QPAA 4BBZA 4N8SA 1LBTA 3W06A 2QUAA 2JIDA 1R1DA 3G0BA 1MNQA 3HC7A 1LNSA 3OPMA 3D2CA 4Y2YA 5HF6A 4CG1A 1UOPA 3ED1A 1XRNA 4BVLA 3F8SA 3OTQA 1R9MA 4J0DA 5AM1A 1TRHA 3I6ZA 3EQ8A 4KRYA 2ZJ6A 1W75A 3W9BA 3SX4A 4W1RA 5AK5A 5AHXA 4BP9A 4C4ZA 1KU0A 2WUEA 1Q0RA 1Q83A 1NX9A 2H7YA 1FFEA 4FBMA 5ALJA 1LPOA 5DYYA 3QPCA 3PF8A 2WFLA 5ALVA 5FV4A 3ZLTA 5LP1A 1IZ8A 5AM4A 3X3HA 3JW8A 2WHQA 3S2ZA 4I4CA 3BF8A 4KR0A 1J2EA 4L9AA 3I6YA 4KACA 2JF0A 5LZ4A 2XMSA 3ESCA 2X76A 4ZRDA 4JYMA 2B20A 3STVA 1BS9A 3VJLA 3QH4A 5DNUA 2QJRA 2GZSA 3O4IA 3WYNA 4OCZA 1GPNA 1VXOA 4UBOA 4Q1VA 4JNCA 1YS1X 4NZZA 3I2FA 4B6GA 1CUHA 5ALNA 4ZXFA 4B85A 5C8VA 2H7XA 4MEBA 2QOEA 2QKYA 1ORVA 5HKAA 4G4GA 3DYIA 2OPHA 3WKAA 2WLSA 4RE6A 4ZV7A 4PV7A 5CT6A 4M0EA 4U2GA 1CRLA 3WWDA 3WWCA 5IVKA 3OOSA 5JARA 1YAJA 4DNPA 4EY8A 2PSEA 1H2ZA 4PF1A 4FMPA 1YB6A 5A6VA 4N5HX 1IUNA 1WB6A 4UBKA 4J3JA 2HA3A 3SWWA 4GECA 4QEKA 2WUGA 3HSSA 2OQIA 1L7QA 1ODCA 3R3XA 5AK6A 3QITA 3NGMA 5DYWA 3WWPA 4RGYA 3HXKA 3D7RA 5CURA 5IVHA 3MUNA 1CVLA 3GBSA 4HAIA 1XZMA 2PL5A 4IO0A 2Y6UA 4FFVA 2GBFA 3DYVA 3O9VA 3IVMA 1CUSA 4K2AA 2ZVDA 4DSZA 4IH1A 2OXEA 2HA4A 1XZGA 2DHEA 2YASA 1QZ3A 3W05A 5ALPA 1EB9A 5AKKA 4HZGA 1JU3A 3G8YA 5AI0A 3PUHA 4X6UA 4G8DA 3FSGA 5E2IA 1USWA 1M33A 5JD6A 5FKJA 3C5WP 4B83A 4J0JA 4H7KA 4HS9A 5EHQA 4E11A 4W1QA 1GZ7A 2OAGA 4EBBA 5ALOA 1VA5A 4J0HA 5CH3A 3V1LA 3STXA 4AO6A 1JT2A 4BAZA 1OCEA 1K4YA 2JGIA 2WJ4A 1G42A 2GZRA 1MX5A 2XUJA 1XRMA 4BRZA 3FVTA 4DMKA 2WUFA 3ESAA 1JMKC 4W1SA 5A71A 4C6HA 1TCCA 4B84A 1JI3A 4ARAA 1O6GA 4G5XA 1WHSA 4FLFA 5CT5A 4DGQA 1HBJA 4CFSA 4WY8A 5DWDA 5BV7A 1XZDA 2XUOA 3D0KA 3FOBA 2WU4A 3PE6A 4FHZA 4F0JA 5D7BA 1FFCA 5ALDA 1WHTA 3WK9A 1UOQA 5D6OA 1IMJA 4G9EA 4AB1A 4BE9A 3YASA 3A70A 4BC1A 3DOHA 2QZPA 2J4FA 1P0QA 5T4HA 2C5GA 3WA7A 3WZMA 2WQZA 4BC0A 3IURA 2XUKA 4IH4A 1XZLA 3WI7A 2OCGA 1DQZA 5FLKA 1JJIA 1EDEA 3WK4A 4CIAA 3D2BA 2BUBA 4H7HA 1BEEA 1SCQA 2YYSA 2H1IA 3U0VA 4U2DA 5IKXA 1Q84A 3DL7A 1T2NA 1LLFA 1CUGA 5AKZA 1GPKA 5HF9A 1W6RA 2WHPA 1LGYA 1MAHA 4C88A 5AOAA 1X70A 2WFMA 1MX9A 1Y37A 2WKWA 3UMJA 4BCCA 1J06A 2CJPA 1D07A 1MO2A 3KOOA 4KJXA 1XLUA 1UK6A 1QONA 1ZJ4A 2C5FA 4ZV9A 3FYUC 2WFZA 1AUOA 4FBLA 3R41A 5BWBA 1QJ4A 3R3WA 1CUDA 1H22A 4G4JA 3DD5A 4FLEA 1WB4A 2WHPB 1XZBA 3GFFA 4LHEA 3Q8WA 1ETHA 2VJAA 3FNBA 1ZGCA 4AMZA 4QDUA 4WDQA 2VJCA 1CIJA 2HIHA 3V9AA 3QVMA 4CCWA 4IHAA 2Z8XA 3TRDA 3V1KA 3D3NA 5AKGA 2OCKA 3CN7A 1VKHA 1TCBA 5JZ9A 3WMRA 5FPQA 1AQLA 2ZJFA 1XLVA 2D5LA 1TQHA 1PV1A 4Y2PA 2C7BA 2VEOA 2YH2A 2ES4A 4OU5A 2VT7A 3IB3A 4LXGA 1AGYA 1YS2X 4F60A 4Y2VA 1QIIA 6YASA 2R8BA 2O2HA 2HA2A 1YCDA 3BIWA 1H23A 1SCIA 4F21A 1U8EA 4DMFA 1VJ5A 1SCKA 3G9XA 4Y2UA 1HKHA 4QZVA 3IUQA 4EHBA 1VXRA 2NW6A 2FX5A 1DTEA 4KEAA 4Q34A 5AOCA 4A23A 2VJBA 3QBJA 4AMYA 2Z3ZA 1MJ5A 4CIBA 2H7CA 2JGJA 4B9EA 2JEZA 4BAGA 5ESRA 3VVLA 4WFIA 2HFJA 1LZKA 1QO9A 2XUQA 1THGA 2WM2A 3HLKA 5CMLA 4AN1A 1XZEA 2LIPA 2PU5A 2PSFA 2P8SA 2VATA 3IUMA 5JAPA 1ZI6A 3AINA 5LZ8A 2J4CA 4J0GA 5IVDA 3FYTA 1W76A 1IVYA 3C6YA 3PUIA 3HACA 1EI9A 4QLOA 3K9BA 1VE6A 1CUFA 1DT3A 4ZWNA 4AN0A 4H7JA 3JWEA 1XFDA 4S0XA 3SK0A 2XQIA 5JYCA 1GQRA 4NVRA 4FLMA 2XMDA 1LPBB 2BJHA 1XQVA 3AILA 2ZYIA 4B7ZA 4DTCA 4I3FA 2RONA 1LPMA 4OB8A 3I6MA 3GUUA 1UXOA 3KWJA 3WJ1A 1GGVA 2VT6A 4OYYA 5LZ5A 4Q82A 5ALHA 4MXDA 2XB6A 4ZREA 2QS9A 3ICWA 1DWPA 1SFRA 4C87A 5ALEA 4GXNA 4UBIA 3FBWA 4AXBA 3H1AA 4Y2SA 3WK5A 1BCRA 4Q3LA 1XRQA 3IUNA 4AO8A 1DWOA 2UZ0A 4FKBA 4UUQA 3ZLVA 5K3EA 3IA2A 2XMZA 4MWSA 1Q0ZA 3OM8A 2VSQA 3STWA 2PSHA 1UWCA 4G1FA 2PVSA 1CQZA 1ODSA 5ALGA 3DQZA 5DNVA 1CUAA 5K3BA 2QTBA 4H7EA 5JZBA 4O08A 2XUIA 3E0XA 3QMWA 5SYNA 4X92A 1JFRA 1CV2A 2JGKA 4DIUA 1L7AA 1XZIA 4M0MA 2W22A 4XJVA 5DTIA 1F8UA 2WIDA 3G7NA 2BCEA 2Z8ZA 3E4DA 2VAXA 1IUPA 4HXGA 4KE6A 2G4LA 1ZGBA 2AXEA 3K6KA 2WSLA 2B4KA 1YB7A 4UFOA 3OC0A 4X97A 4DMCA 5JIBA 3G0DA 5CW2A 4X7BA 4TPKA 4IQ4A 4MEAA 4YPVA 4GHWA 2XUGA 5CT4A 4MYDA 4LXIA 4QA9A 1ORWA 2QMQA 2DQZA 2PUJA 1XZKA 5AP9A 3N2ZB 4PO3X 4GBGA 2HDWA 3I1IA 4AZ3A 2QXUA 3N0TA 5HFAA 1DT5A 3A6ZA 5AO9A 1J07A 4Y2XA 5AKIA 5KBYA 4LYEA 2PUHA 4X6YA 5LKAA 1U65A 4UBMA 3SC2A 1H2XA 1C7JA 5EHXA 2O7VA 2PX6A 3VDXA 2C58A 3U1TA 2J3DA 4Q3KA 1BU8A 2FUKA 1X2EA 3UUFA 5C8ZA 2JGFA 2VTVA 3WWEA 4G8BA 4L3WA 4BP8A 4KE7A 5FDFA 5FP0A 5HQ3B 1SOMA 3CXUA 3WQHA 4J0CA 1CPYA 5D3ZA 2WIJA 1O6FA 4X93A 5DTJA 4XIIA 4H77A 3E1GA 1AMNA 2PKYX 3FCXA 5ISMA 1R3DA 2PM8A 4K5QA 4QWWA 4QDXA 3KD2A 3EQ7A 3GZJA 2O2IA 4NS4A 1T4MA 2V96A 4FTWA 4OPMA 3LCRA 1PJAA 5E4TA 2Z5GA 2CUTA 1AZWA 4H7DA 1MU0A 3O4HA 1IUOA 3L1HA 1Y7HA 1YR2A 1JMYA 4FOLA 4W9RA 4U2CA 3I2GA 1J1IA 2PU7A 1H2WA 1MN6A 5CXUA 2WIFA 2OQVA 4LXHA 2B9VA 4OU4A 5F4ZA 2VJDA 2G5PA 2GBCA 4UHEA 3ZI7A 2OCIA 1EH5A 5IH7A 2WJ6A 4P08A 1XRRA 5FUMA 4JEIA 3WZLA 1TIBA 3C70A 2E3JA 2O7RA 1DINA 3PF9A 4Y7DA 1HL7A 1MPXA 2D0DA 2ROQA 4W1PA 4J0IA 5ALTA 4HRXA 2H9YA 3H2JA 3B12A 3TEJA 4TGLA 4ETWA 2EDCA 4ARBA 4MJ3A 5CH5A 2AJDA 3FCYA 4DM7A 2I78A 4IH9A 1G5FA 2PSJA 3C6XA 3V48A 2EDAA 4Y2TA 1CR6A 3C87A 3P2MA 1A7UA 4BB0A 2HU8A 1A88A 4GDMA 4KAAA 2OGZA 2DQYA 2XMBA 1CUEA 4X94A 5HCUA 4PNZA 3EQ9A 2QXTA 4EY6A 4ITVA 4J0KA 3DKRA 3WK6A 4PSDA 5AI4A 5JATA 1TK3A 2CEKA 3OURA 4XVCA 3IBTA 1F0PA 4Z49A 3GROA 1WB5A 4BZZA 3KDAA 5K3FA 3FVRA 3QM1A 5C81A 4EY7A 1FSSA 5HZGA 1XQYA 7YASA 2CBGA 3CN9A 2RAUA 4BVJA 3BL8A 4RE5A 3LS2A 4F5ZA 4WFJA 3LIPA 1EDBA 1YA8A 3RARA 2BAGA 1A8SA 3ANSA 1LPNA 2I3ZA 2HU7A 3DDUA 2VQ6A 1K5PA 1XROA 1QE3A 4LKOA 3WL5A 2RHTA 3VVMA 2RI6A 1ZD5A 2QVBA 2HRRA 3A2NA 3C6BA 1QGED 1CEXA 1CUIA 3H19A 4EY4A 2XUHA 1F0NA 2V97A 3WYDA 1UFOA 2JGLA 5ALQA 1F6WA 4M0FA 4WY5A 4YASA 4U2FA 1DU4A 3WL8A 5ALIA 2HFKA 3VJMA 1NU6A 2Y1KA 5AIAA 4GI1A 2I3DA 5BWCA 3BE8A 1XRLA 1EB8A 4UBNA 1MT3A 3PFCA 4HXFB 5AK3A 4B9AA 4BYMA 4EUSA 1VZ3A 2XLCA 2CKMA 3PFBA 3BDVA 1LPPA 3RM3A 3R3ZA 1UK8A 3D5EA 3AZPA 1BCSA 4OD0A 4YX9A 5ALUA 2HA6A 5AM5A 1QTRA 4Y2QA 5I8PA 1QFMA 4BAUA 5JD4A 4WFKA 4ROTA 1I6WA 3C8DA 4MWTA 3F98A 1TCAA 4CCYB 1E3QA 1WPRA 4DYHA 4X85A 2ZYRA 1ZD4A 2J3QA 4PSCA 1E89A 4B0PA 2ZYHA 3TGLA 4Y9SA 1DWQA 1UK9A 4UHCA 4XWGA 3FAKA 3R3VA 3STUA 2JGMA 3LLCA 4A16A 1EVEA 3I2IA 1E66A 3AUKA 3IULA 1CQWA 1UKBA 5ALRA 4UHBA 1CUYA 5AKLA 2XDWA 1ISPA 2BGNA 4YK7A 3WLAA 4RPCA 5AH0A 1QIJA 2XI4A 4UFPA 5CXXA 2QRUA 4AO7A 1XRPA 3QPDA 3RKSA 1XZAA 1CUCA 1N5RA 3BF7A 3FYUA 4C4XA 3T4UA 3C8HA 2WHRA 4BE4A 2IX9A 4K6KA 4LYDA 3WJ2A 4P92A 3I2HA 2V9ZA 5HQ3A 4B0OA 3G0CA 3FSGD 1EA5A 1IZ7A 3Q0TA 3AIMA 3I2KA 3BDIA 3WL7A 5E4YA 5AKEA 4OSEA 5AOBA 3E3AA 4OB7A 5FXMA 5ALZA 3DS8A 4X3CA 1EINA 3DLTA 1X2BA 4X71A 1YA4A 2DFPA 2WJ3A 1CUXA 1GPLA 2CZQA 2HRQA 5DYTA 5EGNA 4BTVA 3ANTA 3NOXA 2B61A 3WIOA 3WKDA 5A7FA 3M81A 5IVIA 5AICA 5KWJA 4W63A 3VKFA 1VE7A 2XUPA 4DNQA 2AJCA 2YXPX 1BE0A 2DHCA 3H2GA 3RLIA 1B6GA 1LPSA 4D9JA 4UBJA 5ALKA 3CCCA 1ODTC 4FNMA 1H2YA 4OB6A 1PFQA 3I2JA 4UHHA 2BGRA 1QFSA 2DCMA 1FJ2A 1R4ZA 5LYYA 3IUJA 5LZ7A 3WIBA 2OGSA 1FFDA 4EA6A 3AIOA 1BROA 1W1IA 3NWOA 1GQSA 1TKRA 1QOZA 2IIVA 1ZIYA 2WG0A 2WFLB 3LIIA 5KREA 4HVTA 4P93A 1E8DA 4KAFA 1W52X 5K3DA 4GW3A 4QDZA 1R9NA 1A8UA 2QUBA 3MGAA 3C45A 2OAEA 5E4JA 3O9MA 1VZ2A 1RWQA 4GWLA 3JYHA 2AJLI 3O0DA 3GELA 2C0PA 1MX1A 3ESDA 4A5SA 2HU5A 3WK7A 2XT0A 1BRTA 5A7HA 3R0VA 5ALFA 4K6HA 1TAHA 1CUUA 1GKKA 4EZIA 3B5EA 5CT9A 5HFNA 3QMVA 2VF2A 1WM1A 2QJWA 2PPLA 5HF8A 4KRXA 1EK2A 2WTMA 5DNWA 3LP5A 2ACEA 5EFZA 1FFAA 4X00A 2OG1A 4BATA 3IDAA 4MQLA 2DHDA 4X91A 3HRHA 3HJUA 1XZCA 3H2HA 1CUZA 4DNOA 2WIKA 3DOIA 5JADA 3WKEA 4E46A 5AM2A 3R3UA 2XUDA 4AZ0A 4DLNA 1ZD3A 3C5VA 1K63A 5EIHA 3O4GA 3L1IA 5T4BA 5JAHA 1CUJA 4E14A 4G4IA 1E8MA 1Y7IA 1LBSA 3FLEA 4DMHA 2JBWA 3H0CA 4CG2A 1UT6A 1XZHA 4AX4A 5DLPA 1YAHA 4ZI5A 3W2TA 2X8BA 1VLQA 2RIPA 4C4YA 3KWFA 3K2IA 4H0CA 2W6CX 3G0IA 2XQKA 3PDCA 2WIGA 1ZOIA 4ZGBA 3I1YA 4N8DA 3ICVA 2ZSHA 1RYYA 3B3QA 2GBGA 4G9GA 5ALXA 2WG1A 2JEYA 1WOMA 3F97A 5LZ9A 4C01A 5CBKA 1ZI9A 5AI5A 3HABA 4V2IA 3TJMA 5KWIA 4UFNA 3O4JA 4X90A 4GEGA 5CTAA 2I03A 4B82A 1QIFA 3EIOA 2OGTA 3A2LA 4HTAA 5I7UA 4J7AA 5J3JA 4AQDA 1UKAA 1XZJA 2AJ8A 1P0PA 2OCLA 3AIKA 3IIIA 5FRDA 5JZSA 1QIEA 2GYUA 1CUBA 3G9ZA 3G9TA 5HKBA 2R11A 5ALYA 2X5XA 2WTNA 1P0IA 5A62A 1C7IA 4BCBA 2FJ0A 2HA5A 2XE4A 2XMGA 4FDMA 1E5TA 4NMWA 1EK1A 4JYPA 5H3HA 4Y2JA 2RHWA 2BKLA 4KE9A 1BN6A 1WCYA 2C4HA 3GA7A 4QNNA 5HK9A 5AJHA 3BWXA 4WCVA 2Q0XA 5K3FB 1KU6A 2G5TA 4Q05A 4Y2RA 3HYSA 1EDDA 1JJFA 3V1MA 4DNFA 4E15A 4OUKX 4K6GA 2DR0A 5EHNA 1MNAA 3ILSA 5I9IA 4P9NA 5DJ5A 1LPAB 3STYA 2XQFA 4BDTA 3H18A 1OILA 3M83A 5AI6A 4N5IX 1QIGA 2JGEA 2WILA 4UHFA 1LZLA 1CUVA 1AX9A 5K5EA 2WG2A 2XMQA 3NUZA 5EHZA 3C6ZA 5A2GA 4FFWA 1XQWA 4QLAA 1MAAA 2IITA 4H18A 2BUAA 3VISA 4HRYA 2WU3A 1CFJA 4OYLA 1QLWA 5AM0A 1EXWA 1NU8A 3D2AA 5SYMA 5BOVA 2Y6VA 4BTLA 5YASA 2XUFA 3WA6A 5AI8A 3UUEA 3WKCA 1ZI8A 1EHYA 4GLBA 4XX1A 2FJPA 2DSNA 3FYUB 5EIAA 3AZQA 3A2MA 3KSRA 3BXPA 1L7RA 3H2IA 4KE8A 3DL4A 4X6XA 1W4LA 3ZPXA 5JAOA 5ALSA 1A8QA 1XKLA 2CB9A 4U2EA 2VAVA 1EX9A 2ECFA 3D59A 3VXKA 5CH8A 1U2EA 1YSCA 2XMCA 1VA4A 2Z3WA 1GT6A 2XUAA 1EVQA 2HADA 4BCDA 3HZOA 1QIDA 3W04A 3D4LA 1ZICA 1JKMA 5AK4A 5LIPA 1UZAA 3PI6A 3KXPA 1G4HA 3STTA 5EIEA 5JANA 2PBLA 1XLWA 4WDRA 4INZA 4U2BA 1GXSA 4H35A 2AJBA 3HEAA 1JU4A 1THTA 2HA7A 3FLAA 2BUCA 4UPDA 3DJYA 1HDEA 4B80A 4L72A 3V1NA
chains in the Genus database with same CATH superfamily
4WLOA 4CL0A 1IN1A 4MV0A 3L4JA 1C3XA 4MR7B 3HVHA 2VA9A 2AKYA 1DC5A 1WPQA 2FLVA 3RQIA 5B2FA 1XMOB 4JI7B 2I6UA 1Z5UA 5T6BA 5EWLB 3V4FA 3M6AA 2HWKA 5EMKB 3B51X 4YNBA 4HWTA 5E6UB 4UTRA 3NORA 3QE0A 4HB0A 2Y71A 5JCJA 2VHVA 3EVBA 3PNQA 4TLBA 5J4HA 1Q11A 3KE8A 1KMNA 3KZNA 2PZLA 4I4IA 3IJ5A 4KMOA 3OP1A 3FW1A 2Y27A 3QBDA 4LQ4A 4NBMA 1CZNA 1DG1G 5KTNA 1R88A 2OO5A 4QFDA 3E2PA 4XZ3A 1GPBA 3SYKA 2FI1A 4FE3A 1L5WA 1K1EA 4DV7B 3VJKA 1RWWA 5T7BA 3Q6MA 5C5CA 3LBHA 1G66A 4F6RB 3OEWA 5U1PA 3O84A 2J6CA 2ORYA 5KTMA 4EENA 1VG9B 2FWIA 1XVUA 3MXOA 1S7GA 2I4TA 1ZJ5A 2P9CA 4FFBB 4JWTA 4ZGGA 4EAAA 1GNTA 3ZTYA 5LJIA 3OKYB 2NV6A 2XCRB 3ZDEA 5JC8A 1VCHA 1XF9A 3DAOA 4JLAA 5G4KA 2IKQA 2P62A 1NYRA 4OO3A 1JG4A 5LDGA 2G6BA 4TMKA 1NJSA 5A7GA 2WSMA 1XCPA 5H7XA 3R8FA 1E63A 1YE3A 2GN2A 5HK9A 4HGPA 3WHIA 2GXUA 4XUDA 2ZSUA 1N5MA 2JS7A 2HWWA 2ZWAA 3FLBA 4RM3A 5C4IA 5CDTA 3D8HA 3LDUA 1XCGB 2XW6A 4G81A 2YJ4A 4MUHA 4UNNA 3TR0A 3CZ9A 3KKZA 3MUOA 3BSFA 2V54A 4WCFA 3TINA 5LZ2A 2UYQA 1CB7A 4DUYB 1B0PA 3PYMA 2VEDA 3H83A 2VDPA 1K9VF 1ZOLA 2AD5A 4MAMA 4PBSA 3IDOA 2DKOA 1S2LA 1JG2A 3V8QA 4C0XA 2C99A 3ELDA 1QIMA 4JBGA 5AHRA 2WF7A 1E1QA 4DPLA 5IJ7E 2GHIA 3G2IA 3O8QB 1X13A 1P9LA 2APJA 4MR8A 3OBIA 1SR8A 1XKTA 3ND9A 1ID8A 2GPWA 3ROKA 3L2OB 3DOCA 4K6OA 3KTAA 4WZ6A 3CQ9A 3CLTC 1WMBA 3CNEA 3L0SA 3N5CA 1VYUA 3U26A 3SQXA 1G8AA 4Y1EA 4CNQA 2BONA 2I71A 4MQMA 3RKRA 3FSRA 2XTZA 3CIFA 3OIUA 3SYMA 1N6FA 1IJFA 1D4AA 2ZJZA 4UC0A 4V0ME 2H2DA 3NYIA 5JVDB 4P2GA 13PKA 3FBTA 4J79A 3H75A 3VNUA 1TK9A 1TGVA 1EFAA 4YV1A 3H8SA 3N53A 4K1XA 3EASA 3RK4A 4XPZA 1PEKE 2QY6A 2TMKA 4QPNA 5DRTA 3QLEA 3G6WA 5HIJA 4TL7A 1M6EX 1PZMA 3JATB 1GRQA 1A2OA 1TEXA 2HNAA 4L0QA 2QM0A 2FP4B 3GJ7A 3E4CA 3MAAC 2B5VA 4HL6A 2C88A 5LDHA 3CE6A 4DCCA 5FTWA 1FUEA 2K2QB 3C39A 5EGSA 1VLVA 4FFBA 1XTRA 2FP3A 2ZIGA 4XWAA 5LLSA 3QZUA 1UBLS 1NFRA 3HU2A 4P3XA 3PSAA 3EDQA 5CYOA 1Y9EA 2GN8A 3A3KA 4LYYA 1VJDA 1L9KA 2JIMA 5AKYA 2AOWA 2NSLA 3OLXA 3IEMA 5EI5A 2WOOA 4L78A 3F6SA 1L5OA 3DCJA 3RS2A 2IP4A 4B5KA 1GKYA 2P75A 1MAVA 1U0JA 4LV6A 5K3CA 3L0DA 2H59A 3PSLA 3U3XA 3WL6A 5JXWA 3D4BA 1RYNA 1TM3E 5C86A 1DJPA 5HZHA 5LD2C 1W5SA 2ZYSA 4JZKA 4MQ6A 2WC1A 3WGLA 1RP7A 2O54A 2RBGA 3ZJ4A 1KPGA 2DQ4A 1OMWB 1REQB 2J9XB 3GLSA 3GIWA 3SIWA 2X8WA 3T0FA 2X8JB 3NVNA 1AQUA 1NV8A 3T3IA 1NWHA 5KYTA 1W59A 1PBNA 2OB1A 3RVRA 4YMIA 4D4JA 2ECKA 2ZWMA 3INTA 5JO0A 1BJRE 3E22A 3EPKA 5DXAA 1C4WA 1RRMA 2Y4OA 3AY3A 1V35A 2JH9A 3IIJA 3LDAA 3NAZA 1VDZA 2FV8A 3UV6A 5D84A 2OCDA 3V7FA 3EVZA 5E8RA 2AFRA 3ODPA 3UTCA 2PA0A 4MO9A 1OZ0A 4URVR 3IV7A 2QL5A 3LLVA 4JQSA 2GVDC 1ZUD1 1J22A 3ZU5A 2R6R1 1N8SA 2Y1GA 4KQJA 5AIBA 4MUMA 1NLYA 3ZNPA 2RGUA 2B99A 2WUDA 1M1YA 1LTQA 3P9XA 3OWHA 3ME5A 3QLUA 2MR6A 1UDBA 2JFGA 3QVGB 3IPLA 3TM4A 1BXRB 2ESRA 4YRAA 5JVDA 3IEVA 2FY8A 3CMCO 4TWJA 3RIGA 3CF4G 3B3FA 4JFRA 4BRSA 5IG2A 5EWMB 2XD4A 3Q87B 4L9WA 1U7OA 4J94A 3RE1A 1P2SA 1JAHA 4YCJA 4C0KA 1NONA 2Z4SA 2X8LA 3Q3EA 3SY8A 1Z7EA 3ZCVA 4EUHA 3KPVA 2A5LA 4YHBA 1GITA 5BW4A 4QXOA 4EGCB 2H9AA 4MS3A 4GQIA 3HA5A 4Q9JA 3L7DA 4MP3A 3ZY4A 1IHUA 4XVUA 3W6UA 3EVDA 4EYSA 1NDHA 2EX1A 4ZCLA 2NVUA 2R751 3F67A 2WM9B 3QRWA 3D8RA 3L1JA 4PXWA 1SKUA 2H08A 4EGJA 3O38A 2ET6A 4FWBA 1R8XA 5K8UA 3K6RA 1C4XA 5ARCA 4HX5A 1DX4A 1DNPA 4GSYA 5DSZA 2EFDB 4MUIA 5FADA 1C1YA 3VYTB 1K2WA 4C7VA 1ML3A 5H1YA 3A6FA 3CRMA 3S68A 1WSWA 2PH3A 3N6XA 4QUKA 5KVAA 1AGXA 1YRYE 1P1FA 1BGWA 2PXHA 5F1KA 4QDOA 4TQUS 4NENA 2AMVA 3KZVA 3GD1I 3OJLA 4FFMA 2XCIA 4NFYA 4QKQA 3WAJA 3M4NA 5TEEA 3W4JA 4DHWA 1RXUA 3RRMC 1KNXA 2BM0A 1H42A 4NHOA 3OKWA 1YGYA 2IP1A 2RAVA 3QXSA 4PW0A 4CV0A 3MVEA 1PJLA 3DZKA 1T5IA 1CKEA 2FXVA 1A9YA 1GO2A 4J03A 3VHQA 2ENUA 4LJ7A 3WLHA 2R4QA 1XKSA 4KDRA 1OXMA 3CC8A 4PSUA 3RBVA 2X1VA 4D3ZA 1RXIA 3R7DA 5GPBA 2EEPA 2QLLA 4QQNA 2GPYA 4R40A 1RWXA 1WP4A 4RBNA 5FOUA 3UPTA 4HAXA 1N2HA 3G1UA 3JVDA 5I47A 2VBIA 3CEPB 2H2AA 3QA9A 5IJ9B 1KOLA 1TBGA 2DPGA 3IDQA 1LBTA 2UZ4A 4N9QA 1BDIA 4EJMA 1DUVG 1R1DA 2CGEA 2JIDA 3I7NA 1OLXA 1TUGA 5BRNA 2Q0SA 1R18A 2OXRA 1U7UA 4RA9A 3LYUA 4YRJA 3QNUA 1UQUA 1LNSA 3Q3IA 3DWLC 5BMVB 4FINA 1RZRA 3RCBA 5KEIA 3MHTA 2CHQA 1SXJB 2COEA 1UOPA 3EARA 3EZ2A 1QHEA 1Q57A 1T5SA 1YQWA 3DBLA 4R54A 3VZBA 2PJZA 3U7IA 2IE0A 2QN3A 3VI3B 3I01M 1ZSNA 4BVLA 1P3Y1 4C4PA 2O5EA 2R4UA 4MULA 4QAJA 4XFJA 1BMFA 5ESWA 4D3SA 3GLIB 4D9GA 3EQ8A 1SXPA 4N5NA 1CBUA 2LXNA 3MSCA 3OW8A 3UJBA 1Q1ZA 4IG4A 2RHRA 1PUJA 2VLBA 3C3MA 2WE8A 4D8WA 2J30A 4U4AA 3IAS6 1XDZA 4XB2A 4W1RA 3V32A 1VPEA 4QULA 3I76A 2Z5VA 2AR7A 4FBGA 5FBLB 4F9TA 1SBQA 1TZBA 2C4UA 5AK5A 3UMRA 2XSZD 3FBGA 3KPYA 4BP9A 3DLIA 3P5BA 1L7MA 4IZOA 1T8UA 1OZFA 3MCWA 4NHEA 1XLTC 2CWDA 1NX9A 3V2UA 1FFEA 2AGYA 1TQDA 3NPAA 3G85A 3GUYA 4FBMA 1AA9A 4P7GA 3PF8A 1I14A 4M76B 2V7GA 2X4IA 4RJIA 4V02A 5FV4A 3M5WA 3K92A 4HH1A 2V6IA 3ZLTA 5CAEA 3KSAC 1K89A 5HSGA 2FZKA 1IZ8A 1O9HA 5AVJA 2BL4A 3TEFA 2RBEA 2OVQB 2Q6IA 4DQVA 1FCJA 2I7TA 3B6MA 3QW4B 3HA3A 2D4AA 3VNVA 4U3JA 3V97A 5IN4A 4FOTA 5FOSA 4RF2A 3LGAA 3X1WA 4K6FA 1TJPB 3IQWA 4ND8B 4TZ4A 4JGIA 2FGJA 3S2ZA 1L0BA 2CL7X 3DV0A 4NPHA 4YRFA 1PEYA 2JF0A 1O97D 1SGWA 3UWOA 4D9MA 2I6SA 1Y8QA 2SICE 2P2SA 2XU7A 3C74A 4YGYA 2IS1A 5K8CA 3FGOA 1O9GA 5EZYF 1P6UA 1UFVA 3PFWO 2WYIA 3LCJA 1MXHA 1U3CA 1XF1A 1W6UA 1DDGA 2WF6A 3QH4A 4R7GA 5DNUA 5TLSA 1HT0A 4ECAA 3O4IA 4S2UA 1B0UA 4MRNA 1CG6A 4EECA 5FF9A 2EW1A 2ZSBA 3WLQA 1GPNA 2GAIA 4EJSC 2ZIAA 1K4MA 3VOTA 1X7ZA 2I1LA 2NYVA 4KBGA 1JEEA 1E0JA 4NZOA 3S1LA 3TQIA 4EITA 2IX3A 1O4VA 2Q8NA 1IJKA 4W9MC 2PRJA 2VXOA 3FMPB 3QBEA 5K6RA 2UVQA 4KHPB 4R1QA 5EERA 2BHTA 1HDYA 1ORVA 3KX2A 3J81g 3BMOB 3MSXA 4RCYA 3SJBA 3QIAA 4B48A 1ZVVA 3J7TA 2WLSA 2FU5C 4EHLA 2CNXA 1YV9A 5G41A 1U7ZA 1I3LA 3KSBC 1PNTA 3PE4A 5CT6A 3LBIA 3CZ4A 1XTBA 4OQXA 1SXJD 5FBVB 4M0EA 2QX4A 4KLCA 4U2GA 5KDLA 3G88A 3KZXA 4A91A 1KS2A 1PYDA 3PEYA 3WWCA 5IVKA 1NLFA 4EWLA 1YAJA 4ZV4A 4EEZA 4TMYA 5LVAA 2RMKA 1SAYA 5HM6A 2IPOA 2VCYA 3TVYA 1X7ZB 1YB6A 1Y5NA 3L9XA 1WB6A 1XPRA 1X7WB 4D45A 4J3JA 5FNVA 1JEYA 1C80A 1BDMA 2COKA 4YRDA 3F3GA 4Q9LA 2FMIA 1WUIS 1IWOA 3OMLA 4GECA 2IXTA 4ERNA 4ENUA 2WUGA 4AP6A 5J43A 2CL0X 2YNMA 3NHZA 2XBMA 3UWPA 1L7QA 1M3SA 4ERXA 5KU1A 3TR5A 3MNFA 4UD6A 3ZWPA 3EFHA 4NYMR 3AU9A 1JLKA 3P96A 4ZQHA 3ZDDA 3T8YA 2NO9A 3UHAA 1E3SA 1I2AA 2BE7A 2ZOSA 4LXXA 4ZDIA 3NGMA 1JMXB 1KIAA 2QRHA 4WACA 2QR2A 3H1TA 5EXDA 5JROA 4ODIA 4G9BA 4MMZB 1SKAA 1QRAA 3F71A 4IIYA 3TW4A 2AMJA 3MUNA 4J73A 4FT2A 1ULUA 2VOJA 1FNBA 3HCOA 3OAAD 5DLYA 3SQNA 3QJ5A 1ZUNB 1EP3B 4FFNA 5FFOA 1V48A 2HPVA 2LNDA 4QPDA 1BS2A 1SBTA 1THZA 3FHJA 1V1JA 1UJMA 2XXJA 3VYUB 2HIAA 4LF9B 4L1QD 4IZIA 3EH2A 3IPXA 1Z22A 2X9QA 1DOZA 1J25A 2CF5A 4AURA 4HNHA 1YRAA 1CDZA 5KI6A 4NYJR 4AS3A 4IO0A 1PNVA 3TXAA 4EFDA 4ZCTA 4YT5A 4AKSA 2BWJA 1HTWA 1VE5A 2B94A 3LO5A 5KTKA 4FFVA 4K9SA 1KDVA 1BC5A 2LE0A 1JA9A 4X1KA 2E4AA 2Y1OA 2UVDA 3O9VA 2FYTA 2O8BA 1BH2A 4H17A 4JQZA 4Y6SA 1ESMA 4M49A 4UEWA 4C0HA 4E22A 2ZRNA 2ZVDA 5IPFA 4Z0TA 2XGSA 2YWBA 5GOZA 2EQBA 3CINA 4BGDA 1NATA 3IUBA 1QG6A 2VHUA 1XZGA 1QZ3A 1FP4B 3R20A 2I7XA 5TPZD 1KS9A 4B6EA 3ODGA 2C7OA 5ALPA 1EB9A 2KBEA 4TXHA 5SZKB 4X65B 3G8YA 5AI0A 4B5LA 4NJMA 2JJ1A 3ZDQA 5BV2P 3AETA 5ELLA 2HJHA 2I80A 4KR9A 1YWGO 3NAQA 2FKAA 1FP1D 4ZQBA 3WWYA 1KMCA 3FSGA 4PU0A 5LYJB 4PN7A 4X8HA 1SIBE 2HCJB 3AR8A 3KNZA 4C0LA 4DC0A 1RW4A 3SXPA 1QP4A 2FEOA 3RSLA 2IH2A 1DFGA 1X38A 2ORED 1I1OA 5FKJA 1JE1A 1X7WA 3IJEB 2FFRA 4TKVB 3GZNB 1VLZA 3ZZNA 1E0AA 2J41A 3C1UA 3IAFA 1LDEA 4ZT2A 4B83A 4BNLA 3N39C 3EI4A 2A1UB 4B4VA 4K05A 4TT8A 4DW8A 1HYEA 3MQ2A 5AJXA 5BSFA 3KQWA 4BEVA 1HA3A 1YF3A 3T94A 1BG6A 2VYVA 4E11A 3C15C 9LDTA 4CY5A 3D31A 4ZYTA 1CRQA 1EWYA 1MA0A 4I5DA 1WU7A 1U7PA 1JXOA 4L57A 1ZD8A 2OAGA 3T5PA 5K3OA 1D6JA 2A9JA 2W2LD 2WDPA 4K9LA 3WC4A 3TLKA 2VSFA 3AG6A 1DPFA 4X1YA 2PR2A 4J0HA 3RSSA 1P9RA 3DWIA 4KP7A 4M9UA 1AUPA 3HUEA 4AUMA 5ABPA 2C54A 1B8PA 2J5RA 4R71A 4WBNF 5A5VA 3LX8A 4XYGA 1T1EA 4OFZA 3FZEA 3PCXA 3ORVD 3BC1A 4RQBA 2WVHA 1OQAA 3OOYA 5C3MA 3CF0A 1IAQA 4OH7A 1G42A 3T1NA 1E7YA 2IXEA 2IHNA 4BQQA 1J6UA 2ZZKA 4AQYB 2NZVG 1EK0A 2D2IA 3ISJA 4I55F 4DJTA 1RYEA 3K9QO 1Z18A 3INYA 1V1MB 3WRXC 3WL3A 3LQQA 1NPYA 2OV4A 3KTOA 4J91A 3HDGA 3K8QA 5KNBD 4G26A 2I4LA 1BH6A 4ILKA 4MZXA 1FVXA 1JMKC 4CF4A 1C7ZA 3VPCA 3GUVA 4B84A 4ZT4A 2GEBA 4L6IA 4JI5B 1TIKA 1D2GA 2Q0QA 1S7CA 3Q3JB 4HX2A 3FXAA 1JSRA 4G5XA 2J9ZB 1GNLA 2LRHA 4URUR 3NYWA 1XU9A 3AW8A 3K4PA 4ZD6A 4KNYA 4R5MA 1M5RA 2JPDA 1KSJA 2ZETA 2HLNA 5ENVA 4IDOA 2ZYDA 1NA5A 4R9RA 1TJYA 3TTTA 3FDFA 4YAJA 4JMPA 2VK2A 1MVLA 2C7GA 1IG0A 2REQA 4PWYA 3ZQKA 1NG1A 2O8FB 2F43B 1V8PA 2K5UA 4PPYA 1MDFA 4WCFC 4CYMA 2AKAB 4IIDA 1P9WA 3OQOA 5H16A 4BJ5A 3PIIA 2CO0A 1X1DA 3PDWA 1IHDA 1L5FA 2BD0A 3FTNA 5DOZA 5MGBA 3U17A 3LHDA 4B8WA 4RKWA 1K3FA 1NF2A 2IV2X 4B35A 3T3MA 3EVNA 4QDJA 4JHNA 3B6ZA 3RFFA 4B6FA 3N9IA 1FP2A 3PE6A 1TMYA 2AG1A 4OBWA 4OI2A 5D7BA 3LYHA 4F0JA 2I55A 3WGQA 4BLPA 1J00A 2WMOB 3WK9A 2YY7A 4AS2A 1UOQA 2R48A 4JLOA 3UJ3X 5KMGB 4IQ8A 3EGDB 3RJ5A 4DV1B 3Q2IA 2VFAA 1XK6A 2X4GA 1ICIA 1MJGA 4JELA 4B2LA 3M70A 3C99A 1OHHD 4IXWA 3UFXB 3VHLB 3O8OA 2Z1MA 3DP9A 4MTCA 5HDBA 1KEPA 1MRNA 3DE5X 4CHGA 1CQXA 1QBKC 2D06A 4I2VA 6REQA 5T4HA 4B3IA 4KBFA 3HJFA 2VDRA 2WQZA 4BC0A 2QQFA 3KVNA 3TXXA 3IURA 2DWPA 5C92A 1B73A 1Z3IX 2HLPA 2ZUSA 5BN4B 4GM4A 3QELA 4M54A 1ZOOA 4V0LA 5IFLA 4MS1B 4YDSA 3HWRA 2P9UC 4FB4A 4ZC8A 4DAEA 4PZCA 4MDEA 1JJIA 3D6MA 1JIUA 1U3VA 2VZ9A 5CK5A 1BMDA 2HW8A 1VPDA 3V9FA 2POQX 1Q47A 3BYZA 3C3YA 4I9UA 3GUHA 2ZYUX 1VIAA 4O45A 1PQPA 3H1EA 4KQEA 4JS0A 5JE8A 4YMTA 2MCFA 1TF5A 1BEEA 4US0R 4QTZA 3BQ9A 3V4VB 4L95C 3ITEA 3DEKA 1U4SA 3OZCA 3V80A 4E09A 3RTBA 1YKGA 2V3CC 4BLUA 5BVHB 2XKKA 1T4CB 3ZW9A 2HX1A 2Z2YA 2FPUA 4CEJA 4A2PA 4ZYYA 4EW2A 1Y1PA 3M9WA 4BQRA 1E1YA 4G1MB 2RC5A 3JQGA 1W6RA 4XX0A 4DCOA 1M34A 4EQ6B 1MAHA 4IDPA 4YN3A 1O0BA 2VHQA 5IH7A 1X70A 3Q6IA 2YUTA 4JLVA 5A5EA 2WFMA 1C8KA 2XB2A 4ITUA 1FMLA 1UTCA 4PYOA 3ZTWA 2H1RA 1PR9A 3LGXA 2OHOA 4A6EA 3K6JA 5G4LA 2D13A 1M73E 3UMJA 4N49A 4BCCA 2R6ZA 4L5IA 3ZW8A 3DZDA 4TTAA 2SECE 1AQJA 3KOOA 3OIGA 5BR8B 5C7OO 5TB5A 1YCGA 2HV8A 3E9YA 3FGNA 4KJXA 4OGGA 1G5IA 3GPDG 4ZYWA 1ZJ4A 3UTDA 2C5FA 4RELA 5EPUA 4TM8A 5L40A 3FYUC 2V4ZA 2GFHA 4PZDA 3RVBA 4J0QA 1KAGA 4QATA 1QJ4A 2P6UA 4ARZA 4M37A 3FOZA 4XWTA 2J5QA 4EX6A 5DEIA 2NVWA 2JLCA 3ETCA 1R4NA 4FLEA 5F9FA 2AEMA 4CPDA 1GL7A 1PFWA 4G65A 1T4GA 2IZ6A 3C3AA 3IQDB 3K53A 4G1MA 2ONKA 3GJ6A 3MZLA 3IP7A 4LHEA 4D5EA 1U3FA 2GCIA 1H6DA 1GR0A 4DLRA 1BAPA 1GLVA 2A9PA 5C34B 3W8EA 3O83A 4AT1A 4DLXA 3DR3A 2JBAB 3MT9A 4RPLA 1ZGCA 4S24A 2A9KA 3VOSA 4D9HA 3JRNA 1YIDA 4GXQA 1ISRA 2HMAA 2VTEA 4J4BA 3GIDA 4NRDA 4NPAA 2BHRA 4IIJA 2PEYA 4YRLA 2A7QA 4LJLA 4KXQA 2LVBA 4CQNA 2OLKA 1CIJA 4LDNA 4D9CA 2W6ID 4CCWA 3NHAA 2VBFA 2P67A 4UJ5A 4IHAA 1EXMA 2O3QA 5KC9A 2OZEA 3OT5A 4YCLA 3FYDA 4ZCQA 3T3OA 1GRNA 2JCGA 2Y8EA 1DJOA 1ZCZA 5FPSA 2NYUA 1QJCA 2BP7B 3OZEA 5LP6F 3D3NA 2OGUA 4LZJA 2WVGA 5AKGA 2AUNA 2FZ5A 2XWQA 1R0XA 1IBCA 2YWXA 3MN1A 3ZHZA 5J58A 2IHUA 5A03A 4LMBA 2DBYA 4AJNA 1KYZA 2PXAA 3WMRA 3ZDZA 1DXYA 4MTLA 1YMUA 4MDFA 1JYFA 2BFBB 1PGUA 2IRWA 2K87A 5TVKA 1GTRA 2OORA 4IFBA 4EUKA 1EFLA 4DWWA 4Y18A 1QCYA 4BB9A 2WZCA 1VE1A 2CDCA 3KVOA 5FXYA 4LDAA 3PHBE 2C57A 4DCSA 2ZAYA 1PEAA 2PMWB 1CF4A 3RFVA 2ZRAA 1U0OC 2VEOA 3ESQA 1N5JA 3RC9A 3VOAA 1DC8A 2ES4A 2EF0A 5JQGF 5CITA 2VP0A 3MS2A 4RZSA 3K8OE 3C5EA 1M72A 4JR2A 3V8MA 2J48A 3AR5A 4B1FA 4XRRA 4WJKA 3RYFA 4F60A 6AT1A 1GOFA 1KBZA 3ND6A 4JK3A 4RVDA 4LF7B 2R8BA 1XAGA 2HA2A 3R9XB 1G17A 3UATA 4AY4A 3BIWA 1SCIA 4WXMA 1Q7RA 4UPVA 3MJTA 1RR6A 2XVZA 3LPCA 3VV2A 4F21A 2XKBA 3OMWA 5AESA 5EWJA 3WS7A 3VHXB 1HKHA 4QZVA 5DNYB 3IUQA 1SWVA 1I7DA 1EVLA 2F4NA 3QVVA 1OIVA 2BFBA 4BASA 3NBYC 4EGSA 1K7YA 5A06A 4JJEA 3ZXUB 2Z1NA 5MN4A 1B15A 1XDGA 1AT1A 2FQYA 4GRIA 1PGQA 2YBDA 1J56A 4GX1A 2XVMA 3ETJA 2CJWA 4KEAA 4UQPA 3C6MA 3QX9A 1ZSVA 3QKSB 1L1FA 1RXCA 1KVSA 4A23A 2E82A 3PUYA 1WXHA 4S35A 2Q1UA 2AQ8A 3KJGA 2ZRCA 2B5NA 2A6PA 1RE0A 2JGRA 1QK5A 2QRJA 3WVNA 1G8MA 3JAMg 2IPLA 3VVCA 3MVDK 1E6MA 2H7CA 4KQXA 4YUZA 3ZW7A 5DNDA 1TQ6A 1U3UA 1TJ4A 1U31A 2AG8A 2D2XA 3DV0B 3R3JA 3TDMA 1Z63A 3B38A 3HR4A 5DCUA 3VVLA 4V0MA 4O8ZA 4M1TA 4R8MA 5M5VA 3RGWS 4ZOAA 3UG6A 1JE0A 1IB0A 1AQYA 1FFXA 2XUQA 2ILTA 1H0HA 3SBOA 3OIDA 4RIGA 3LY8A 1Y48E 2WM2A 3A6JA 2HO4A 4XWYA 4J3NA 2J6HA 3JPYA 4EYGA 1F5SA 3HI6A 2VR1A 3ER9A 2O19A 1YU6A 1DKRA 2QX7A 3UANA 4MROA 5E8JA 2LIPA 2PGJA 2PU5A 3BH0A 2ORVA 3DCYA 1C9IA 1WXXA 2JD1A 4DBLE 1W36B 3ORSA 3C9CA 4MP6A 2WWXA 4R81A 5JAPA 3S29A 1RZ3A 5LZ8A 4CMKA 2WR8A 3EJ6A 1DO8A 4TKLA 1AMOA 3K9GA 1MF7A 1CZUA 1WUTA 4J0GA 4XOIA 1DQPA 1LK7A 3CLHA 3TCXB 2G9NA 3TQQA 1PVVA 3NNNA 4PAOA 3SSMA 2ZIXA 5ILQA 1KJIA 1XAJA 3BRQA 1G0NA 1IVYA 1WQ4A 1XZNA 3ZOKA 4BFTA 3H5NA 4X6LA 3RC2A 1XV5A 1R5MA 2GWHA 2YZKA 1EEHA 2C3PA 2JLBA 4ETIA 3K9BA 1VE6A 3L8YA 1M2JA 1NVKA 3NT4A 3O4FA 1CJMA 1PDVA 4FFOA 4G2NA 1ZQ9A 1I5EA 1D09A 2HYDA 3I5UA 1ZHFA 4IPTA 4EKNB 4YT4A 5AUPB 1L2TA 3ZY5A 1XFDA 3DTVD 4NZYA 3UJAA 4F3YA 3KLNA 3PQCA 1UAGA 2ORWA 3A25A 3E3MA 3L01A 4QUGA 4ZQGA 2B37A 2XKJE 4PRZA 4R84A 5F77A 5EJ6A 3H5LA 4U7AA 3CIOA 3TZHA 3X1KA 2QW0X 4NVRA 1P2UA 1NJFA 3GFRA 1QDEA 3ZN2A 3HM2A 4U9UA 3SDSA 4Q5IA 2Q27A 2Q1WA 2ZDHA 4FYYA 1NT4A 1TIPA 1Y3HA 1ZAKA 4HLNA 1FJHA 5LA6F 1ABBA 3BBPA 3TFOA 3FCSB 5C51B 1KPIA 2A94A 2D0OB 4C1BA 4KCGA 2C8LA 1Y6RA 3VJRA 4L76A 1C50A 5TJ9A 3PQ4A 4YJFA 4CTKA 1V45E 4JIMA 4L28A 2QNIA 3TLZA 1QHIA 1Y33E 1XTUA 2VAMA 2VT6A 2BCJB 1LDBA 4FPXA 4MWEA 4OYYA 5LZ5A 3TW6A 2QLJA 2YNMC 3VGZA 3ZWMA 3HZHA 1TVEA 3VMMA 5IT9A 3GPIA 1JSCA 3N2EA 1T9GS 5ALHA 4GKVA 4MXDA 1N1EA 1QP7A 1MA3A 2C3OA 2D7JA 3IE2A 4NQZA 1C5KA 1RT9A 1CS0A 3VDMA 1KH1A 1W19A 5HTOA 2O4UX 3KSDO 4C87A 2ZSJA 1R8JA 3OOWA 4I81A 5A3QA 5BSGA 5A4KA 5JDIC 4JEHA 3S2FA 5B7QA 3AF2A 3H1AA 4GI3A 2G4CA 1WX1A 4FMBB 5FNZA 4QTYA 3CGWA 4OJQA 4IJMA 1GLGA 1NC3A 2J7KA 5H14A 3GWGA 3OZRA 5DYIA 3KRTA 4G0WA 2NMVA 1JKFA 2MSEB 2OKCA 4P5EA 3VPAA 4D43A 3BWMA 1GSHA 3S2YA 1VI6A 4D97A 5CVCA 1J4AA 1RQ7A 3OM1A 2UZ0A 4AG6A 4ZDJA 2RH4A 1V1RB 1KSFX 2XZPA 1VRVA 3FFTA 4CM7A 4JL8A 2CLSA 1XD2B 1DAHA 1M1XB 2QM8A 2PJDA 3IA2A 4RMNA 3RF6A 4BMVA 1NW9B 5GV7A 2BCGY 2AGWA 1E6LA 4H4EA 4PFJA 4Y6PA 1CY0A 3STWA 4XDHA 2GEKA 3VU9A 1GNPA 1DMRA 2W4IA 2PLNA 1OC2A 1SHTX 2OVBA 3OQMA 5G1OA 2AYXA 1SA0A 2EIXA 4U5QA 4BKUA 3ACCA 2H48A 2J7PD 3EQ6A 6REQB 4K2HA 5CA0F 5DF1A 2GK7A 1R4MB 3HXPA 1YA6A 2WWIA 1CY6A 2QZSA 3W2HA 2J55H 1S01A 3JSXA 3PUZA 5JZBA 2ISQA 2EZ4A 2HOQA 4PBZA 1N2CE 2PX2A 3Q0IA 2OAQ1 3H65A 4MUJA 4O08A 3QMWA 5J4LA 1KBOA 3AF6A 5EJAA 2QN1A 2YMPA 3FFWA 5CDYA 1JFRA 1UZMA 1CV2A 3D6HA 1OAOC 3MTQA 1NKSA 4RVNA 4DIUA 1CF9A 4F4UA 5KZMB 1DTWA 4TKUA 1H1TA 1Z4MA 3HFQA 4MRVA 1LX6A 3H05A 4XJVA 4ZAZA 3TAHA 3U4HA 7REQB 3ZQJA 5LWQA 3LF2A 3KLBA 4OP1A 1F8UA 2WIDA 3GJ8A 3CKYA 3G7NA 2B34A 2BCEA 3MCZA 3JWPA 4OZUA 3IGFA 4OV6B 3O7WA 4G85A 1PQUA 3S81A 2Z8ZA 5E6SB 4DE5A 4KE6A 2ZRQA 4MQ5A 3GLFA 1TYAE 4TV8B 2AXEA 4JHXA 4M7PA 2P30A 5MN6A 3C5MA 2WSLA 3G17A 1M9NA 3CEHA 1EGVB 1VCOA 4RTQA 4X1YB 1MQ9A 3RLFA 1JKIA 1B7GO 2F6RA 4BNWA 1Z0IA 4XUGB 2A84A 1D6SA 1MBZA 4UE6A 5DI3A 1G21E 2PL1A 5EUBA 2C61A 3UKUC 4UU1A 2P9YA 4RY9A 5IF9A 1LSJA 3BGVA 3FRIA 1UBGA 1OBFO 1TM7E 2MMGA 4GPEA 3H11B 4IQ4A 4Q66C 1GUBA 2QVCA 1B8VA 3ECCA 4F9GA 3M6VA 1QFYA 3O3MB 4GHWA 5DW3A 4DM4A 1Z2AA 4GUAA 3MRSA 4EG6A 1IY8A 5CT4A 1YBVA 4K8RB 1FDIA 3Q8MA 1RPTA 3WYDA 3T3NA 3VSDA 4FGWA 3ST7A 3T38A 1FXSA 3M1AA 4FD2A 5B6JA 3TTSA 4PO3X 4GBGA 4U9IS 5FO0A 2HDWA 3EISA 1GFWA 3C6KA 3AVTA 2P91A 3I1IA 3GLUA 2QXUA 3IQIX 4MUXA 4QPCA 3WXMA 5AO9A 3VH2A 1J07A 2QYOA 1EGAA 2VCHA 1FMFA 2XT6A 1L4NA 3PSCB 3C3BA 1FTYA 4MVCA 4MI3A 4A4DA 1K5HA 1Q91A 1OAKA 1Q1BA 1QKJA 2GWRA 4B2PA 5BSEA 4WX2B 1GPAA 4DLPA 2FRVA 1X1SA 4MQFB 1MVNA 3FUUA 5FFFA 4CLOB 5FX2A 5AVRA 3TZ6A 5HE9A 1V96A 1MOSA 2IYZA 4A08A 2W48A 2XWJI 4NI5A 4JLDA 4FU0A 4WGFA 3SC2A 1H2XA 2ZANA 3ZJYA 1ZBDA 2EGUA 3B1WA 4DQKA 4KPEC 2Z2KA 1I36A 4C1NA 3ZHSA 2X5NA 2FWJA 2RH5A 4RX1A 3WADA 3ZE0B 2BLLA 4MWZA 5KU7A 1YZYA 2FSPA 1NSTA 3V1TC 4UDNA 2SKEA 3L6OO 3ZYCA 2J0UA 5K2OA 1XPUA 5EARA 1V9CA 2OXTA 1M0SA 4Q3KA 3HU5A 3VR1A 3G5LA 4GX0A 3IKOA 5BV8A 2ZKIA 1T9ZA 3SHQA 1LSSA 1GQYA 3TNLA 2CJXA 4U7HA 3W2GA 2QTVB 3KSUA 3X2EA 1U99A 3F5QA 4L4XA 4NCKA 3G8DA 5TPWB 3UUFA 1BCRB 2B5OA 3HB7A 2VJKA 1AN0A 2E87A 1VJCA 3R5FA 4BP1A 3L06A 3U7EB 4IFTA 5JRJA 4KRGA 4N3CA 2GPTA 4C7KA 4FE4A 4G8BA 3MFYA 5GY7A 3KOUA 2PWPA 3L3BA 1ZFNA 2IYPA 2WPDD 4P34A 3IJ0A 3RVJA 2R6FA 3CXUA 2HSJA 1FDRA 3EXIB 5D3MA 3X1ZA 5LA6A 1UBFA 3UR4A 2FRXA 3QXXA 4MZDA 1OW3B 2F48A 5F3RA 4L5BA 3DBRA 4N7BA 2EJUA 5U4QA 1C8VB 1Z0UA 1L7VC 2CEAA 2XTJA 2YDXA 3E1GA 1KIMA 3ZD9A 3ZE6A 3P9NA 1ICEA 2IXGA 5KTTA 4HRAA 2V0GA 1GL9B 1S3IA 3U61B 1ZYUA 2VDLB 1MJFA 1T0JB 2PM8A 5BSKA 1KYXA 1RLUA 4QDXA 3PD1A 2HWXA 1RXEA 1H3NA 1JLSA 3BQNB 4MUEA 1C9DB 1JR3A 4NS4A 1NQXA 1T4MA 1JVNA 1YVDA 2ZBPA 3LU1A 3PZBA 4Q7KA 1PEDA 2LCFA 2ODBA 2X4DA 4R69A 1UQTA 4F3CA 3OF2A 2EICA 1E6KA 3LCRA 5A4IS 1T9AA 4GKJB 5JNVA 4OYHA 1JZQA 5HQGA 2X2FA 2PIAA 3TOZA 1AZWA 4FWWA 2BH9A 4R1TA 1W0KD 3L1HA 1XMQB 5C4GB 1IDOA 2B25A 2YVQA 4NOLA 1K97A 2C03A 1KP9A 4ZVNA 3HP4A 3IQEA 2ONJA 1WMAA 1EFHA 1I9GA 1R64A 3QEMA 4BWGA 5T57A 1VJ0A 3RVLA 4EVIA 4DDTA 5FOTA 4JI2B 2BF4A 4LNAA 2PUWA 5CXUA 3BD7A 4N39A 4OIFA 2DPXA 4N0MA 4QYMA 5C46F 3AFGA 2Y1WA 4L7VA 4OU4A 1E7SA 2P6MA 5F4ZA 1NVGA 4EHAA 2W37A 3CZ5A 4YAOA 3ZI7A 1KR2A 3FRXA 1HK7A 1UADA 4CM9A 1JGTA 1EBFA 2QR3A 5KJEA 1P1IA 2GUWA 3QTLA 4ALMA 4P08A 4HDQB 3F7NA 4G23A 4Q9NA 3RU7A 1YRLA 4X5OA 5FB3A 5CLFA 3J81k 3FNHA 3EF0A 1T9HA 1GGKA 5KNDH 4UNRA 4F9FA 1TO1E 3GXOA 4KQ6A 4FSHA 1ZX1A 1AXRA 5B36A 2PS0A 3DFIA 1M7GA 3Q98A 3SDBA 3T95A 5SZJA 1UMCA 1BD4A 4HTFB 4B45A 5JAZA 4QPZA 5JO9A 4NOMA 4YROA 3MAGA 2WHXA 5IDVA 3E23A 4N0PA 4CM8B 1MPXA 2D0DA 5DM2A 3C3CA 1IHOA 1IK6A 1RXYA 2Z09A 3P26A 3O91A 4RIFA 1AVTA 2I0FA 2BI8A 4J0IA 2OTCA 3AHJA 4XSVA 4GM8A 4WKNA 4G84A 3T3PB 2W00A 5EFOA 4R9VA 3ML1A 4PG5A 5IBQA 5JNLA 1W88A 3KOMA 1IN4A 4YPFA 4CKWB 8OHMA 1L5QA 1I01A 1OKKA 2GD2A 2I29A 1OXBB 3B82A 4YXWD 3D8UA 3ZDRA 1KTIA 3K9WA 2AJDA 3ZQUA 3ZWXA 1UKEA 4HNSA 4AY3A 5JQGA 5K4HA 5HA5A 4C6SA 4KVGA 2Z4TA 2I78A 3ANLA 3RD5A 4YH1A 3AFHA 3FWPA 2O8CA 4DQ0A 1DTSA 3N0EA 4H1VA 2VYND 3R9XA 4EI2A 4MP8A 2FSGA 2PAFA 2BGUA 1U0NA 5CHEA 3C48A 1JT9A 5NLLA 4I1IA 4LHVA 1TW2A 5AJTA 2W6JD 4AK9A 2JZOA 3L7NA 1U4OA 3FA2A 5FIUA 4EATA 5I7RA 2VSNA 4TYYA 4F6LA 5H8WA 1PAUA 4J6FA 3OKAA 1IEWA 6LDHA 1BYIA 1HM5A 3KB1A 2KS6A 2J57G 4YJGB 3MTBA 4Y0AA 3MJVA 3C8UA 2XMBA 1CUEA 2QMOA 5HCUA 1JALA 4PNZA 4QU8A 2AIRA 5F51A 1ZNWA 3EQ9A 4LK3A 5IHPA 4WLVA 4OH1A 1PR2A 1NMEA 3D3WA 1JLLA 4J0KA 2ZUTA 2W5UA 4FHLA 2C96A 2WF8A 4QO7A 3VV3A 2H8KA 1N36B 1O0SA 2QL6A 5B4WA 2OC4A 3C3XA 1R15A 3IEKA 4U3JB 2HMVA 3UMFA 4PSDA 3ZCXA 1JWAB 3ZD6A 5J59A 4ALIA 4IIJF 2MMCA 4GPIB 4ZAYA 1ZBQA 1TK3A 2CEKA 3ZBTA 2G40A 2F3PA 1RCFA 2P1RA 2R2AA 3QENA 1QHHA 5CCBA 3X1MA 1Q17A 2GBPA 1F0PA 4Z49A 1JG6A 2HMWA 1W5EA 1XRSB 3EVFA 5A5FA 3MWKA 4MLCA 2E1PA 1Z13A 3L7BA 4PCLA 3AKZA 4X64B 2IBMA 2HKRA 2JC3A 1R37A 3FVRA 3VBEA 3VPBA 3WLOA 4AMBA 5C81A 3LF1A 2OORC 3KL2A 4O1IA 1FRFS 1J8YF 3AB8A 1CZRA 3CXRA 2R47A 5DE3A 2QIOA 4RZHA 2YWHA 3PFNA 7YASA 2WU8A 3K71B 5FFGA 3EA5A 2W98A 3SICE 4JC5A 3OIWA 5CLQA 3TCNA 2CLLB 2FEKA 3BL8A 1S2GA 1M6VB 1N2OA 1YQEA 2ECQA 2XGOA 2OHIA 3W5SA 3KDSE 2AZXA 5IN5A 3MTAA 4NV0A 5EZYB 3FCCA 3IMKA 4WFJA 5A1JA 2X4LA 3P0JA 3N7AA 2PMFA 3GPCA 4CT0A 5F21A 5JYDA 2CK3D 4L75A 1Y4ZA 3DKVA 3R7AA 1G9TA 1Z0SA 3PFHA 4ID3A 4JMLA 1LPNA 1PFGA 5BP7A 1BWRA 2YY6A 5K1ZA 2YS6A 1YDHA 2EG5A 4EVSA 2Z43A 2QLMA 3CKMA 3SCZA 1HLPA 2FDCA 4U5XA 2PE5A 1YR3A 4LKOA 4ZVPA 2DUMA 3DSRA 5CGZA 2NU8A 1F6BA 2RI6A 3T34A 4COKA 4X66B 2A9FA 3D4PA 3EZGA 3O8NA 1HZZA 1ZVKA 2FH5B 2Q3LA 4HQ6A 1DRVA 4OHXA 1G6KA 1NBIA 4IL5A 1OH6A 4IDNA 4TSFA 4BFYA 1VPVA 2R62A 4FHEA 1P6QA 3QGMA 1SHJA 3NEPX 5KJFA 4TLMB 2ZRPA 3EHDA 1W85B 2YRFA 4I9GA 3AUFA 5F12A 2Q8PA 3UW3A 1MZPA 1C41A 3G59A 1N0WA 1CEXA 1I51A 4GWKA 4LOJA 2HJ9A 4TYPA 4WV3A 4MW4A 2R7NA 1IBSA 4G1EA 3HY6A 3R5XA 4R9SA 4A8JB 2D2EA 1EWQA 2JFFA 4F93B 2V97A 3NLLA 5C8YB 5L7TA 1B74A 2JGLA 4M0FA 4UVHA 5CK4A 1U94A 1NJ2A 1SXHA 2A5DA 2DFVA 3W15A 4G56A 3FCAA 4PC2A 4YASA 3UT0A 1NAHA 1ID1A 5ALIA 2AYZA 3DEFA 1JI0A 4TXLA 4WMLA 3TZLA 4F8EA 4ITRC 1UBKS 4U7TB 3VR0A 1RHRA 5FPHA 1NU6A 5AJUA 2INGX 2GI4A 3C75H 2V55B 1Q77A 4GI1A 4CR7A 4FHFA 2YOGA 3E0CA 3H5OA 1B76A 3SG0A 3TEMA 2AOTB 2V45A 3BE8A 3M7IA 4J76A 4UULA 4DY4A 5LM3A 1EB8A 2CVHA 4PX9A 3NGXA 3OY7A 3CTPA 1L7PA 4RF5A 4W5QA 3LPAA 4LDJA 1FC0A 3SHOA 2V5AA 1SZJG 3SNKA 3E1KA 1YBHA 1JIKA 3GLKA 2XH8A 4HQFA 3ANNA 4N5DA 3ZY6A 3H3JA 3A9UA 1OWOA 1K5GA 2BKEA 4FLMA 3DSMA 2R00A 4HDCA 1Z2PX 3LY9A 5LB2A 1K32A 1UJ4A 4H1WA 3BDVA 4HHEA 1ACMA 2Y4NA 3RM3A 1HYHA 3WBJA 4GP7A 3R3ZA 2WJWA 3W5JA 3V34A 3DEHA 2VNKA 1DLJA 3P4UA 3GRPA 3K8ZA 3UFBA 4EELA 2CO0C 4OD0A 1HYQA 3PENA 4Z0NA 4YX9A 2A3NA 3ONNA 4INPA 2BDUA 1SNYA 5JS7A 3DPIA 1DL5A 1MB9A 3KCIA 1O08A 1VHTA 1DE0A 2NPOA 2FF5A 3KALA 1E1NA 3NKVA 4LNUA 5CVUA 1J9ZA 2RJ3A 1D1QA 4IBOA 1PJTA 1N0IA 1K6JA 2FZGA 4WJZA 4ZQEA 2OSBA 1YCHA 2EYUA 1M8FA 3R0IA 2ASVA 4LVCA 4LFCB 4CNBA 5I8PA 3TF5A 2QYTA 1RQPA 1QZUA 1K7XB 4ROTA 1PJBA 4WL0A 3PE7A 1J5EB 2QD2A 2B0CA 2JHPA 5HKOA 4QEDA 4ZDKA 2VRCA 2BFEA 1HH4A 2PUVA 2EFGA 3FY4A 3PXXA 4RWZA 3VI4B 3UB3A 3BM5A 2MU1A 3MZKA 5ERGB 4DUGA 3LW8A 4E03A 5BV1A 2PH7A 5EE9A 1RJ9A 2LTAA 4XB1A 1A7JA 4R6XA 1G1MA 4ARIA 4UZSA 7REQA 5JZMA 1XMJA 4G01B 4ZI7F 3HCPA 1V7PC 4RC9A 2GK3A 3GARA 2CC2A 3ROPA 3U56A 2J3QA 3RUDA 3UAVA 3AL0C 1FEZA 1ZVQA 3ZR4B 5EJ7A 4DIMA 4FB1D 3IKVA 4B0PA 2GRUA 4ZOYA 1E69A 4M1YA 3AOGA 5K3SA 4FB5A 1EFKA 2ZYHA 4JBHA 3A1UA 4HJXA 2FUCA 4KLRA 4Y9SA 5CPFA 3JPXA 4S1VA 1E1LA 4D9KA 1Q2UA 1TYZA 2X0EA 4N82A 2PBFA 3R3VA 4S1PA 1IN7A 1T25A 3GY0A 3OCJA 4ZYZA 3D4NA 3LXXA 1HOXA 3OPYB 1U2SA 2JGMA 1U5BA 3OCVA 4CEHB 4CEIB 3RMZD 1UL1X 2B1QA 2ERYA 2AQIA 3NWEA 3O1IC 4JBNA 3C3EA 3QI7A 4YWJA 4KRFA 1EVEA 2I66A 4TYMA 3I2IA 1E66A 3O74A 5E7IA 1U0TA 4KQ2A 4Z51A 4H6VA 5K6AC 3IULA 1WMDA 5EM2A 3RN0D 3ETLA 3HKEA 4ZVSA 1G3UA 3NS7A 1FX0B 3KSZO 1N1GA 2D3WA 1XYVA 5AW0A 4OHRA 3ZWCA 1N2CB 4UKDA 4RQUA 1CUYA 1E1DA 1JLRA 3FFXA 5AKLA 4EWRA 3CSSA 3OZIA 2I8AA 5H9VA 2CMGA 3CBGA 3RVNA 4BX9A 1H6AA 4DA0A 1XALA 2GBLA 3DQPA 1GPDG 4RPCA 3W2FA 1TCVA 4B6JA 1QIJA 1ODLA 4PSAA 2CE9A 2HBYA 4QSHA 4S05A 3FWKA 3HGMA 1FIUA 3AUTA 1P2GA 1US8B 1YULA 4LY6A 2H54A 2JD0A 3QPDA 2B0JA 2VDNB 3PT5A 4RS3A 2IUEA 1VHWA 1JDVA 3KU4A 1FP7A 3I9MA 1OAOA 3USES 4UMVA 4GI5A 2AE2A 4R8LA 1Z62A 1FDOA 1ESNA 1Q7CA 2FWBA 2R2GA 4REMA 2VDRB 4RESA 3T4EA 3C8HA 1WS6A 3PHGA 4L7QA 5ERYA 2QGNA 4BJHB 1V95A 3CLUD 4AUEA 2CLOB 2ID4A 1T8RA 4KIWA 1MPTA 4P7BA 5L6LB 4ALJA 2NVUB 3N8GA 2YX1A 3AF5A 2CF6A 1ZC4A 3LP6A 4P92A 3RS7A 2Z0MA 1TJ5A 2CNBA 3P2IA 2WKPA 1K92A 1TM1E 2HRZA 1RAEA 3F8TA 4ENVA 2A9RA 3G0CA 1VLMA 2W4MA 4NBSA 2Q7QA 4FD3A 2GXQA 3MILA 1PHPA 1C0PA 1ZLYA 2DCUA 3L5KA 4OEHA 5TQJA 3UEOA 3IMGA 4RSMA 1UBHS 4XUEA 3PR3A 4CR8A 1M2HA 3RB8A 1KKMA 2ZM6B 1G3QA 4P3YA 4KQCA 3L07A 2H4JA 1NY6A 2C0CA 3CUUA 4ZARA 4KMRA 3UAWA 4PGGA 4TUYF 5DT9A 1T15A 3AIMA 3I2KA 4FYJA 1PBTA 4OSPA 4NK5A 3HK2A 3WL7A 4BWVA 3K96A 1N3LA 5THKA 3P1JA 4W5JA 5AKEA 2GNOA 2WYOA 3ZS9A 3E3AA 4KFTA 1ABFA 4OB7A 5FXMA 4Q47A 1BPOA 3HJAA 2OFFA 3UXYA 2PTHA 4LC1A 4A8HA 5BUSA 4X60A 5HIKA 4E5ZB 4XLZA 3CVOA 3CX4A 3PXGA 2Q4RA 2R9VA 3UUWA 1HYGA 2PWBA 5BWNA 3UWMA 1JHOA 2P2NA 4PHFA 3WNVA 4EMTA 2Y05A 5E3IA 4PYNA 1KA9H 3DLTA 2OA0A 4K9KA 3REQB 3RG2A 3RRZA 1J90A 3RVKA 2DFPA 2W6OA 3A26A 3W5VA 1F9AA 1UM9A 1BHQ1 2ZPTX 4FAVD 1LD3A 4UZFA 1GPLA 3VR5H 3EGOA 5FWYA 1Z34A 2JKYA 1V41E 1K66A 3L4OD 3NWBA 4JLUA 4RJKA 5DYTA 2MINB 3PXBA 2ORIA 3UA3A 1LLUA 4LGNA 1I6LA 1I3NA 3A6EA 3NOXA 4IYJA 4BRUA 1Z4KA 4OA8A 2ENWA 4RD6A 2RI0A 4UNQA 2O1EA 3VPDA 5IVIA 3L92A 5AICA 1FMCA 1XRJA 4WXPA 1K06A 2P4UA 2XRMA 2PUBA 2G09A 1PV2A 1R12A 2FDXA 2FPPB 2B2CA 3DMRA 4Y7CA 4C2BA 4I1SA 1JWLA 2F1IA 4EI7A 1VE7A 2XUPA 5BRAA 1RI6A 4Z6KA 3NV7A 3F5SA 2OKGA 1HQKA 1KI8A 1U1GA 1BE0A 2NAPA 5DOVA 3BICA 3TQTA 4GDFA 1VHQA 3CURA 4URHA 3RLIA 5F98A 3PNVA 1LPSA 5CX1B 1NBAA 3WRYC 1XQ6A 2QMHA 2VYCA 5ALKA 1ZK1A 3T1QA 2B4AA 1VSQA 5HBGA 4HFMA 5DB4A 1FW8A 2C7VA 1AXEA 3EIXA 2ZUVA 3GFPA 5IAGA 4OB6A 1YS4A 1PFQA 3V4PB 5CXBB 3I2JA 3HCRA 4S1OA 2FEWB 4QECA 5I4CA 3ICEA 3EB9A 2RJNA 3MW8A 1YOBA 1DKPA 2EJBA 5C18A 1XDDA 4QAMA 2DTXA 2OCPA 4RSHA 3RYHA 1QP0A 1IG3A 5LZ7A 3BWSA 1SELA 4MV8A 4CKBB 3OTOB 1OH7A 1KXZA 2D3TA 2OHVA 3JV7A 4AKEA 1DKLA 5GMOA 2RSLA 1QVVA 3KRWB 1UWKA 3LBFA 5JS8A 4OQ4A 3UCXA 5C5DA 3BFJA 4EHKA 4EA8A 4E07A 1ZIYA 4NZ9A 5H0IA 3QUTA 1C0EA 1LK0A 5H59A 3LIIA 1Y9DA 3FDJA 4O4JF 5DV9A 1KO5A 5KTPA 1Z6GA 2WQ6A 4KAFA 3QKUA 4JJZA 4HEJA 1QRDA 2VLIA 3VR2A 4PFQA 4WH0A 1I1HA 1D9XA 5K3DA 4GW3A 1PW7A 1TUIA 2OZPA 2AFHB 3I34X 3VBCA 1O95D 2QTCA 3NYRA 4QDZA 4TTRA 3SQMA 4AZ3B 4B3XA 2CFIA 3ZJVA 4DLYA 1SCAA 3F5DA 1DBSA 1SVOA 2B4YA 2CT8A 1X92A 2PUEA 3HCAA 1P1BA 4FWTA 3TFWA 4U6QA 3T1OA 5HOEA 4GYYA 4KVAA 4P98A 3TSAA 1RC8A 2H5IA 3FNEA 4I5EA 1Q3TA 2TSYB 4GWLA 4EFNA 4EDFA 3PNYA 5CHYA 1C1DA 2QW1A 3NG1A 3O0DA 3OI7A 4P4LA 3GELA 2Q7DA 2W2MA 3WOHA 1TO2E 3UVLA 1WW3A 2X15A 3O8LA 1KC3A 1PTJC 3QLUC 4PYKA 5SV2A 3UK2A 5ARDA 4A5SA 1QYWA 3K35A 3IYLW 5C9ZB 1XBTA 2HU5A 3Q72A 3AX6A 2YICA 2HREA 4JT9A 3BRCA 4MV7A 5A7HA 3R0VA 4KXMA 4XARA 3DCIA 5ALFA 3ZWVA 3JQQA 4YQFA 2QBYA 4BFSA 1K8RA 3EI1B 1X3SA 3JS5A 3TCKA 3DE7X 1G21B 3N2NA 4V38A 1GKKA 2Y0PA 4YRZA 1ZRNA 3DTTA 4GE0A 3T7KA 3O90A 3L7MA 4JODA 3CSUA 1J2JA 3TQCA 4BZPA 1T2FA 5TQ0A 2RD2A 3CVUA 1AF4A 1WM1A 4Y67A 5FLXg 4RD3A 1UBSB 5ICCA 3ZDCA 1OLOA 5EP4A 4ZOVA 1UZUA 3G7SA 2PPLA 1ORIA 3VZQA 1G8FA 1XEWX 4N7MA 4JU8A 1AS0A 1KR5A 2BSXA 1EK2A 2P41A 3IHTA 2OK6A 1NW6A 3PGMA 5MFPA 1E2DA 1NIJA 1X86B 1GG2B 4NOJA 3WLEA 3LKVA 2EIBA 2WT8A 1A76A 2NO7A 4DBVO 3PR2B 1OWNA 1YFZA 2OG1A 4PQYA 1NNUA 2Q4BA 3ADKA 4YDQA 3IDAA 4MQLA 5EC8A 2DHDA 4Q1CA 3ZJTA 2ZYGA 4XJTA 2I0TA 1R9GA 2J85A 3IPRA 3I4FA 3DW1X 2V0NA 3N6RA 1IYZA 3NVQA 4PN3A 2IYNA 5KTOA 4A73A 5FLEX 4QUBA 1XZCA 4BKOA 1DBPA 1M75A 2YMQA 4CF5A 5BYAA 4PG6A 1BIFA 4PFKA 2RKBA 3DOIA 4FZRA 5CUQA 2VNJA 4JBWA 1QR2A 2R8OA 4DMGA 5U4XA 3HBFA 4H3HB 2P9PC 3CEMA 1W1WA 3AJRA 1UMBB 2I22A 3BIOA 3PC8C 5AM2A 4PINA 5IDQA 3CW8X 4A7PA 3BGIA 1R0WA 1OWMA 3KKEA 4I46A 5DNAA 4BUZA 2HYIC 3AWIA 1A8IA 1PR6A 1IJBA 1BJTA 1M6HA 5K8JB 1SOAA 1GNSA 5FYQA 4D4HA 1WUHS 2WJVA 4CN8A 3KFLA 1IL0A 5B3AA 3LRPA 5EQTA 3FWNA 2H6KA 1DB3A 5BUCA 1HTBA 1IQ0A 1WXGA 4QTUB 2JASA 1N5DA 4HX9A 1I6MA 2QB5A 2D1QA 4JXMA 3H5VA 3KR1A 1ERJA 3LDHA 2ZUWA 3N2LA 3FCEA 1WUKS 1WRBA 2P2GA 2ZRFA 1PK8A 2Y92A 2LP4Y 3EG6A 3IQFA 4XDGA 3GFSA 4NCIA 4ZT3A 1HDIA 4DA7A 3JQGB 2HR1A 1LBIA 1G98A 1NOKA 2LDBA 5A0VA 4PGMA 3NIBA 1SBNE 3X1YA 1HE5A 1XZHA 2PV0A 2R6DA 5CDFE 1NHWA 1YAHA 4GMXA 4CHTA 1PL8A 4G07A 2CXPA 4ZVOA 4ZI5A 1EAMA 3W0LB 3WSVA 1UP7A 1V8OA 2QI9C 3MUFA 1IZYA 3MWLA 4YO8A 3WNZA 2RIPA 2GLTA 5B12A 1GZ6A 4MGYR 2XQKA 3IQZA 4BX8A 4XSHA 1DDIA 2BGTA 3RT1A 1UEXC 1ZOIA 3EPRA 4XYHA 1Q1GA 4RH0A 3JQ8A 2H0AA 1N77A 1NPDA 1L5HA 1DRKA 2ZSHA 1RLIA 4S1TA 1HV8A 1N2CA 1RYYA 4MOWA 1D2EA 3DVRX 1N6NA 5ALXA 2O50A 2WG1A 4P4TA 4GC9A 1G20E 5E1MA 5JXGA 4PRYA 5CDUA 4YQEA 4LJYA 1A5TA 5EAMA 3HBLA 1IEVA 3TOSA 3I39X 1RAHA 3SNHA 5AI5A 2QRVB 5AYVA 4Q19A 4GVLA 4F38A 3J81A 1R6AA 1X1AA 3A31A 4B2IA 2P3LA 1CU1A 2X22A 4FAND 1RKBA 3ETHA 3KOXA 4GEGA 2I03A 3TLMA 4UUPA 4B43A 4H31A 1MEEA 2Y66A 2H3EA 2P2DA 4G8JA 4IRUB 1ZKMA 3JU3A 1X7XA 3AP2A 4GR9A 4MUFA 5FYDA 3SS7X 4DRZA 1NM5A 3KT6A 4JQOA 5TARA 5C80A 5C0OE 5GV8A 1JKJB 3BHIA 1VB3A 1F4VA 3A2LA 2C2ZA 2JARA 4IF4A 4L8LA 1KI6A 4QTXA 1B8UA 4MVJH 4GVPA 3OM9A 4J7AA 3RSFA 3O92A 3QTBA 4IXTA 4A8TA 1A4IA 1T4BA 2Q5LA 1KOFA 4E1VA 1XTZA 4YMSA 3W6OA 4HFRA 1SKYB 3AIKA 1I5OA 4YRGA 5JZSA 4CCAA 1M2FA 3RAFC 3LOUA 4A15A 2BFDB 1RHMA 3PX2A 1V8BA 4LWQA 4PLYA 2QQ5A 1PNOA 3G9TA 5CYPA 1TT7A 3VHRA 4KR6A 4OSOA 4E7OA 4KPUA 1B43A 3BN3A 2JLQA 4JYCA 5DLEA 4M4SA 3HKCB 1SA0B 4QT4A 3EWAA 1NDUA 3G3EA 4BCBA 1A9XB 1DWUA 1VIVA 2CK3A 2HA5A 4RPGA 1A04A 2XMGA 1OLZA 3MPOA 1AK9A 4L02A 4PZ0A 4FDMA 4F4CA 3E15A 1GR1A 4HY3A 1K5DA 4P53A 1P7ZA 1QG0A 2GLUA 2XDQA 3AJ9A 1ENOA 4NMWA 2B5LA 1T6YA 4PXAA 4TMXA 5DI3B 1V9LA 2D54A 1R7RA 2XZOA 1WSAA 2P90A 2XNDA 1EWVA 3IUYA 3HB9A 5A2Qg 3LC0A 4FGZA 1BN6A 2QMUA 4M7OA 4OXQA 1I2MA 4EYEA 5ECWA 1XMIA 1X87A 3L0ZA 1IIRA 3R77A 3WMFA 5FAXA 3QMPA 2CXTA 3R9KA 1POXA 2IZ5A 1NUUA 3M34A 2Q0XA 2R66A 4LF4B 3OQJA 5K3FB 1UT8A 2XR1A 4CZ2A 3A1CA 4Q3EA 4QU9A 1E2LA 2OBMA 1PL7A 2VT3A 4BNXA 2Q29A 4MJLA 3HYSA 1JJFA 2RH8A 3QQPA 5C7IO 1VJTA 4LAFA 3P9KA 5MF6A 4CMIB 5JXHA 3M9XA 1ZM7A 5DFAA 521PA 3R76A 3GW8A 1PSZA 4NXMB 1PBYB 1W4AA 2I3GA 3AIIA 4EUNA 1YQ9A 4MR9B 1EXVA 1RYMA 1WXFA 1RADA 2IPXA 3I09A 4MI9A 3G23A 3KT3A 1SZDA 4P9NA 5DJ5A 3W1VA 2IL1A 1KZ6A 1SPXA 4HMPA 1DAIA 4QOHA 3M4XA 1U11A 2A4MA 3KL4A 2Y76A 1VFPA 5K51A 3MIZA 2WJIA 4IAOA 5LR6A 5C31A 2OL4A 2XQFA 4B4KA 3CJQA 4BGIA 2E48A 2B98A 5EN4A 3H18A 4TXMA 4DCNA 5HR5A 2VDMA 3MEQA 4UU8A 3AL9A 3EXHA 3SX2A 1MJHA 5AI6A 1R6XA 3K72B 4J8PA 4MLPA 5B4VA 1K7FB 1SMKA 4GKBA 2P9IC 4MV6A 1POWA 4FJ1A 2QMYA 2JGEA 3HFRA 2OCYC 1U2PA 4C6RA 2UAGA 2NSDA 4ND4A 4HYQA 5FV7A 2NYRA 4FM9A 4DZTA 1G3RA 2CHUA 4LECA 1R16A 1WY7A 2PRSA 1T3HA 3DFMA 3DMTA 3I52A 3OE5A 4Z8LA 3DMDA 3NUZA 5EHZA 3QKRB 4JI0B 3ANMA 3H7IA 4YQYA 4E6PA 1KAMA 3KLPX 4P7KA 4EG1A 2GPBA 3SC6A 1SG9A 3A1EA 4FFWA 1ZS9A 1XQWA 4L5CA 1U0EA 2C9YA 4H18A 4DSTA 2BUAA 3A4YA 2D5BA 2QV7A 3F3YA 3V55A 3VISA 4KUGA 4D42A 3HLYA 3VPFA 3PUXA 1Z38A 2IZ7A 4WGGA 2QJFA 3MJDA 3TM5A 4HDNA 4TTIA 4OYLA 4AX8A 4TMFA 4HPWA 2HQ1A 4IGFA 4CMBA 5A4FS 2L19A 3FN4A 5HE3B 3FZYA 2PM9B 2AL7A 2G36A 3KTFA 3VZCA 5LLTA 5SYMA 5BOVA 2ID8A 4JVSB 1OX4B 2EBWA 3DMFA 4F46A 5YASA 4LCJA 5AI8A 4PSVA 4F4HA 1O96B 3D7LA 1YI0A 1GL3A 4DV3B 3GLGE 4JSVC 1UBRS 4ACBA 1MIOA 4XX1A 4NICA 4OA5A 2WWRA 1E1RD 1UKVY 2TMGA 3GOQA 4PZZA 2DSNA 3FYUB 3GGOA 1DAEA 3U48A 4ESGA 1JB1A 2KE5A 2PRYA 3E9QA 1Y82A 2GJAA 2VPPA 3MHPA 4GQAA 4HYEA 4IMRA 3V3KA 4OHFA 3TTVA