1YR2A

Structural and mechanistic analysis of two prolyl endopeptidases: role of inter-domain dynamics in catalysis and specificity
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
701
structure length
680
Chain Sequence
PPYPASPQVPLVEDHFGEKVSDPWRWLEADVRTDAKVAAWVQAQSAYTAAYLKQLPERAALEKRMKALIDYERFGLPQRRGASVFYSWNSGLMNQSQLLVRPADAPVGTKGRVLLDPNTWATALDAWAASDDGRLLAYSVQDGGSDWRTVKFVGVADGKPLADELKWVKFSGLAWLGNDALLYSRFAEPLNYNQTVWLHRLGTPQSADQPVFATPELPKRGHGASVSSDGRWVVITSSEGTDPVNTVHVARVTNGKIGPVTALIPDLKAQWDFVDGVGDQLWFVSGDGAPLKKIVRVDLSGSTPRFDTVVPESKDNLESVGIAGNRLFASYIHDAKSQVLAFDLDGKPAGAVSLPGIGSASGLSGRPGDRHAYLSFSSFTQPATVLALDPATAKTTPWEPVHLTFDPADFRVEQVFYPSKDGTKVPMFIVRRKDAKGPLPTLLYGYGGFNVALTPWFSAGFMTWIDSGGAFALANLRGGGEYGDAWHDAGRRDKKQNVFDDFIAAGEWLIANGVTPRHGLAIEGGSNGGLLIGAVTNQRPDLFAAASPAVGVMDMLRFDQFTAGRYWVDDYGYPEKEADWRVLRRYSPYHNVRSGVDYPAILVTTADTDDRVVPGHSFKYTAALQTAAIGPKPHLIRIEPIDKQIEETADVQAFLAHFTGLTPRPWSSVDKLAAALEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords prolyl oligopeptidase
publication title Structural and Mechanistic Analysis of Two Prolyl Endopeptidases: Role of Interdomain Dynamics in Catalysis and Specificity
pubmed doi rcsb
source organism Novosphingobium capsulatum
molecule tags Hydrolase
total genus 199
structure length 680
sequence length 701
ec nomenclature ec 3.4.21.26: Prolyl oligopeptidase.
pdb deposition date 2005-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00326 Peptidase_S9 Prolyl oligopeptidase family
A PF02897 Peptidase_S9_N Prolyl oligopeptidase, N-terminal beta-propeller domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.120 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Prolyl oligopeptidase, N-terminal domain 1yr2A02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1yr2A01
4HTAA 2HA4A 3WK8A 4J0JA 2ZSHA 5ALSA 5LZ5A 3PE6A 1E66A 2WG2A 4HXFB 1P0MA 5K3BA 2I03A 1QIGA 4LXHA 3D5EA 1DT5A 4AO6A 4CI9A 3C6ZA 3STYA 5T4HA 2WUGA 1Q0ZA 3PUIA 2B4KA 5AKJA 2XB6A 5CXUA 2OPHA 1UOQA 3BXPA 2XQJA 5CRIA 4BRZA 2VAXA 1K4YA 3AJAA 1S8OA 3GROA 1MN6A 1J1IA 5A7HA 1IUOA 3OPMA 2VJBA 3WWOA 1IUNA 1AKNA 3C8DA 1UZAA 4FFVA 1GXSA 4GDMA 2QJRA 4Y2SA 1F0NA 1C4XA 1EH5A 2C58A 1A8SA 3WLAA 1XKLA 2Z5GA 1E8MA 2BGNA 5AHXA 3VISA 1CUWA 4L72A 2Z3ZA 3IUNA 2Y2UA 4X92A 4A23A 4CIBA 3R3XA 5BOVA 4BBZA 4DNFA 4CIAA 2ZYIA 5K3CA 5IVDA 1BRTA 3R3VA 4YPVA 3EF3A 2YYSA 4L0CA 1TIBA 5EHQA 4EY4A 1I6WA 2WTNA 4ZGBA 4WDRA 3R3UA 1VZ3A 1Q0RA 2GYVA 2AXEA 5K3AA 3V1NA 2HU8A 3GBSA 4E46A 2HRQA 4X94A 2HDWA 2WFZA 4YASA 3V48A 1W1IA 4M0MA 1Y7IA 4ITVA 4J03A 4W1RA 2RHWA 2YASA 3C6YA 3M83A 3G9ZA 2OGSA 4NMWA 4WDQA 3L1IA 2XMDA 5FOQA 3FVTA 3DDUA 4H77A 4QNNA 2X8BA 1MPXA 3D2AA 5JADA 3G0GA 4AZ0A 2B61A 4G4IA 3AZPA 2AJBA 1CUZA 1F6WA 5AK5A 2WIJA 4FLMA 3WL7A 3H19A 1EB8A 5AJHA 4DM7A 4Y2VA 5DTIA 2PSJA 1VJ5A 1BN6A 2D5LA 4EUSA 5JAHA 5JD4A 2QJWA 3HXKA 2OCKA 3QH4A 2ZYSA 5AK6A 4Y2TA 4GI1A 2WU3A 3V1KA 2OCLA 1UK7A 3MVEA 4NZZA 4Q3LA 4BDTA 2IIVA 4C88A 4DMKA 5JZSA 3H2GA 1D07A 3F67A 3R3ZA 3WK6A 4FLEA 2RI6A 4KRYA 5JATA 1E89A 3DKKA 1QGED 2XE4A 2AJ8A 5EGNA 1NU6A 4AN0A 4QE3A 1BROA 4UPDA 2VQ6A 2ACKA 2LIPA 4I3FA 3WQHA 3O9VA 2Z8XA 5YASA 1CUEA 2QUAA 3QVMA 3DOHA 4J0GA 1EVQA 3WK7A 1YASA 3I1IA 2AJDA 2WILA 2C4HA 1WOMA 1ODCA 3D59A 4X91A 1MX5A 1UKAA 4B9EA 3E1GA 3FCXA 4Q82A 5DWDA 1SCQA 3NOXA 1FSSA 3QPAA 1QFSA 3BIXA 2JF0A 3ED1A 1UKCA 1ZI6A 3IA2A 3KWFA 2PU7A 3FYUB 1EA5A 3B5EA 1MX1A 2H9YA 1PV1A 2R11A 2QXTA 3G9UA 3IDAA 4J0KA 1XRQA 5D6OA 2V96A 4N8EA 5ALHA 5DNUA 1EK1A 2WM2A 2WLSA 1EB9A 3DD5A 1T2NA 5HK9A 1DU4A 1BCSA 2QS9A 5AKYA 1E8NA 4KE6A 4ETWA 1QO7A 1UKBA 5HKBA 4J3JA 4MQMA 1EK2A 2XUIA 3PICA 1ZIYA 4LXIA 4Y2QA 2I78A 4LKOA 3KXPA 5AK3A 1TCAA 5AKKA 4FHZA 1THTA 5ALJA 2O2GA 2HFJA 1QIKA 4UUQA 3ILSA 3GELA 3HC7A 3C70A 3FBWA 1XQWA 3BF8A 2OCGA 1XKTA 2VAVA 3WWEA 2XMCA 1MNAA 3VJKA 1WB5A 2K2QB 4CCWA 4N8DA 2FJ0A 5AI6A 3DYIA 1HKHA 3IVMA 4PV7A 4EY8A 5K3FB 1ACLA 5CT9A 3CN9A 4UFPA 1JMYA 5AOBA 3H17A 1OILA 5HK8A 3T4UA 3H1BA 4EA6A 5ALEA 3C5WP 1RWQA 5ALNA 3NWOA 5HF5A 2W6CX 1E3QA 3QMVA 3WL5A 2XLBA 1JU3A 2DQYA 5EHNA 3KSRA 3FVRA 2EDAA 1SCIA 5ALZA 4CG1A 3DKRA 4G5XA 3O4IA 1CUHA 4IQ4A 5DYWA 4PNZA 5AICA 1CFJA 2ECFA 3EQ8A 5CXXA 4IH4A 1VXRA 1CUDA 4P93A 3FOBA 3ZWQA 3FYUA 3RLIA 4QWWA 1XLVA 3G0BA 1LLFA 1XQYA 1ZD4A 5CW2A 3ICWA 4AMZA 2WTMA 1JFRA 2OCIA 4K6KA 2J3DA 2V98A 4HXEB 4UHFA 1XZCA 1VZ2A 2G4LA 4B6GA 1QLWA 4BVLA 1DWQA 3VJLA 4FNGA 3R40A 1A88A 2G5PA 4MEAA 4OU5A 1BEEA 4ZXFA 1QIEA 2WIGA 1DQZA 5IVKA 1Q84A 2Y1KA 2Z3WA 5AI5A 4W1PA 4HRXA 4UBOA 5AI4A 2JGKA 1NU8A 4U2BA 1X70A 3B12A 3BIWA 1E8DA 4K6HA 4YX9A 3L1HA 4K2AA 3DS8A 2XQKA 3V1LA 5C81A 4G8BA 4QEKA 1EDBA 1OXMA 4AO8A 1H23A 3AIMA 4B83A 3I2KA 1XQVA 4KE8A 1IUPA 4ZWNA 1FFCA 5C8XA 1XZGA 1YA4A 4HXGA 1Z68A 4OUKX 5A7FA 4Y7DA 5JD6A 4B7ZA 5AOCA 3F96A 1CUVA 2HU7A 1WB6A 5CH5A 4KAJA 2WJ3A 3I6ZA 4BE4A 5K3FA 3IULA 3I2JA 4JNCA 2BUAA 1JJBA 1UOPA 4RE5A 3W9BA 2WIKA 1JJFA 5LP1A 3I6MA 1JU4A 4OYYA 3C45A 1FFEA 4H7IA 4OB8A 4PW0A 5CURA 4OCZA 4FBLA 5AKHA 3FYUC 1TQHA 1XZHA 5DLPA 5I7UA 1DINA 2HM7A 1ZGBA 3C43A 2XQIA 3G0CA 4FNMA 2BJHA 3IBTA 2QRUA 5A62A 2AJLI 4M0FA 4BZZA 3FYTA 1DTEA 1XRMA 1CV2A 3TRDA 4B9AA 1PJAA 1ORWA 4DNOA 2PSDA 1EXWA 2WUEA 4Y2PA 2CKMA 2DHDA 4J0IA 4X90A 1AX9A 5JALA 2XMSA 5FPQA 3WWPA 1JKMA 3IUQA 2QZPA 1UWCA 3G7NA 4KAAA 1H2YA 1SCKA 1LPBB 3EIOA 2WUFA 4EY6A 1MNQA 4BAUA 2CEKA 2FX5A 2DHCA 3RARA 4DMHA 4KE9A 1CUYA 2DSNA 3HSSA 2PX6A 4UBLA 2O2IA 1XROA 1AMNA 3NGMA 4AXBA 4QDOA 2OGTA 1XRNA 3EQ9A 4FDMA 1IZ7A 4EZIA 2XUDA 5AM1A 2ZJFA 4E15A 3H18A 1EINA 2CBGA 5JARA 1VKHA 3I2FA 4PO3X 2WHPB 5ALKA 2JGMA 2V9ZA 2X5XA 1T4MA 1W75A 5CMLA 1F8UA 5FDFA 1G4HA 4J0CA 2EEPA 1R9MA 1WHSA 1GKKA 4BVKA 2JGEA 3IUJA 5JZ9A 1MAAA 1QONA 4AB1A 2RGUA 4C4XA 3W06A 4E11A 4B84A 3D3NA 3W04A 4WJLA 1P0PA 1GKLA 1AURA 3JWEA 4PSDA 1P0IA 3M3DA 3VJMA 1XZBA 2ZYRA 5I8PA 2WFLB 4NVRA 5CT5A 1R3DA 4JYPA 2XI4A 4ARBA 3I2HA 2JGIA 2Y2VA 5AI0A 5HFNA 4Q05A 2PSEA 2C7BA 3LIPA 3SC2A 2XUJA 5AKGA 3A2NA 2WIFA 1QFMA 1ZJ5A 4OD0A 3ESCA 4BC1A 4N5HX 1WHTA 3WKAA 5AM3A 4AO7A 4V2IA 2JGFA 4HZGA 2QMQA 5T4FA 3D4LA 1XZLA 4Q3KA 3D2BA 1R1DA 2WUDA 3D2CA 3G0IA 2WIDA 1GT6A 2XUQA 2HA2A 5FV4A 5T4EA 3ZLTA 3RK4A 4QA9A 2VEOA 1LZLA 2HRRA 3M82A 4BYMA 4H7JA 1LNSA 1CLEA 2CUTA 3B3QA 1ODSA 2QT9A 2ORYA 3AIOA 1PFQA 5FLKA 4DYHA 4H18A 1ZD5A 1BS9A 5FPPA 1W4LA 1QTIA 4O08A 3PFCA 2OXEA 5IH7A 4ZREA 4FFWA 4X71A 1AC5A 2OAEA 1JT2A 3N0TA 3LLCA 4U2EA 5SYNA 2GYUA 2J3QA 3A6ZA 4DLNA 4UBKA 2WJ6A 1MTZA 1JMKC 4MWSA 2RIPA 3WZLA 2XQGA 5EFZA 1R9NA 2QVBA 3C87A 2QKYA 1CEXA 1YCDA 2BGRA 4P9NA 1AGYA 3WZMA 3STVA 4Q3OA 2WHPA 1MT3A 4AZ3A 4A5SA 2ZYHA 3C6XA 4UFNA 5CT4A 3WL6A 5ISMA 3RM3A 4B0PA 3DLTA 1YS1X 2GBIA 2WG0A 1FFBA 4WCVA 1L7AA 4BE9A 1CRLA 3V1MA 3N2ZB 3TGLA 2WHRA 1XLWA 3JW8A 1Q83A 2JEYA 1O6GA 2BKLA 1J06A 4MEBA 3OC0A 2H7XA 4K6GA 1TRHA 1K8QA 3S2ZA 3A70A 4M0EA 2JEZA 1ZD3A 1W6RA 3C6BA 3FCYA 1ZJ4A 4AN1A 2HA0A 2WFLA 5DNVA 1ZICA 4B81A 1XZIA 3CN7A 2PVSA 5IVHA 5ALRA 4X95A 2C0QA 3PUHA 5AP9A 5EIHA 4RGYA 4LHEA 5BV7A 3D0KA 3FLEA 1EVEA 3IURA 3EQ7A 1ZI8A 1AUOA 5JYCA 2WU4A 1H2WA 5FUMA 1EDDA 1L7QA 6YASA 1G5FA 3WKBA 1B41A 2ES4A 4C89A 4B82A 1C7IA 1NX9A 4FWBA 1ETHA 2JGLA 2PSFA 4W1SA 3UUFA 2CMFA 4W1QA 3SK0A 1JJIA 4MWTA 1YAJA 4Y2YA 5LYYA 5AM4A 1UT6A 1XRPA 3DL4A 2UZ0A 1W52X 2QTBA 1MX9A 2VJAA 2PL5A 4FBMA 1TKRA 3H2KA 5ALDA 5ALIA 4UHDA 2RHTA 1GPKA 5DJ5A 5E4TA 4I19A 4L3WA 4ZV9A 3CCBA 3BJRA 5EIAA 3IUMA 4QWMA 3HABA 1BU8A 1IZ8A 1XZDA 3BWXA 2ZJ7A 1M33A 4HRYA 1HPLA 2OG1A 2O7VA 1UK6A 1BEZA 2QM0A 2IITA 4BAZA 2Q0XA 3R3YA 1CUUA 4DIUA 2CZQA 3MUOA 2JBWA 3STXA 3QITA 1J2EA 4HVTA 1CUJA 1GPNA 1GQRA 3I6YA 3ZI7A 3R41A 3QBJA 3HI4A 1WPRA 1A7UA 4H35A 5A2GA 1GZ7A 2QR5A 4H7FA 1DX4A 4QZVA 1QZ3A 2CB9A 1XZFA 1XQXA 3KD2A 2GBCA 4AMYA 2XMGA 5AI8A 1QIFA 2JIDA 4DSZA 5HF8A 1CUIA 5ALOA 2XUOA 4FOLA 5J3JA 4XJVA 2ROQA 4JUIA 5LZ4A 5H3HA 3WI7A 1YR2A 3G9XA 3WYDA 4BB0A 1X2EA 5CBKA 2W22A 2O2HA 1G42A 1ZGCA 5ALLA 1CUFA 2BFNA 2PU5A 3S8YA 3QPCA 2XT0A 3ZLUA 2I3ZA 4QDUA 4TVKA 4G1FA 3STTA 2HIHA 4KRXA 5A71A 1XFDA 5JAUA 1OCEA 1N5RA 3WIOA 1UXOA 1L7RA 3H2IA 1HQDA 3R0VA 3WL8A 1IVYA 3C8HA 4DMFA 5CT8A 1BE0A 2FUKA 5AIBA 1GGVA 4MYDA 1N5MA 5KWJA 1XRLA 4P92A 2WHQA 5I9IA 3DCNA 3BL8A 3KOOA 5HQ3B 1P0QA 2V97A 5BWBA 5AKIA 3OTQA 3OM8A 5HFAA 3WWDA 4FMPA 3ICVA 4B0OA 4OU4A 4EY5A 3IIIA 1U8EA 1H22A 4D9JA 4G8CA 2ZSIA 4U2CA 2GBFA 2DFPA 2XMQA 2WG1A 1JI3A 3VXKA 3HJUA 1ORVA 5ALYA 4QDTA 1AQLA 3K6KA 2VF2A 1CUAA 1LGYA 1LPNA 5C8ZA 3YASA 3M81A 5AM0A 2J4FA 4F60A 2GZSA 4U2DA 3IB3A 3BE8A 1ZI9A 1H2XA 2HA3A 3QZUA 5ALMA 4EBBA 4PQEA 2DHEA 2Z8ZA 5C8VA 3W05A 4WFKA 1FFAA 3I1YA 3PI6A 2PSHA 5F4ZA 4OB7A 3BJMA 4HAIA 3F98A 2G63A 5AM5A 2VSQA 3DYVA 3WK9A 1YB7A 2ONCA 3JYHA 3E0XA 1CUXA 4J0DA 4KEAA 2R8BA 1N1MA 2HA5A 4KR0A 4IHAA 1ZD2P 4Z49A 4C6HA 4JEIA 1LPAB 4UHBA 2X76A 3GUUA 4JYMA 1CIJA 4F5ZA 3OURA 5IKXA 4NS4A 3WKDA 3FSGA 3I2IA 4OYLA 1QIDA 1SFRA 5JZBA 2XLCA 1ZOIA 3LCRA 2BCEA 1DWPA 2VT7A 5ALUA 1U65A 4UHEA 2CJPA 1ZIXA 2GZRA 4BTVA 2DCMA 2HA6A 1LPPA 1YS2X 2QUBA 2WQZA 4U2GA 5KBYA 1VE7A 3AZQA 5FKJA 1MO2A 5KREA 2NW6A 1KEZA 1YB6A 3DEAA 3D7RA 1IMJA 3I2GA 2YH2A 3BDVA 2PUJA 1GPLA 3STUA 1RYYA 1EX9A 3TEJA 5AKEA 4BCBA 2YXPX 5ALWA 1CQWA 5CTAA 5HQ3A 4J7AA 4BRSA 5AO9A 2JGJA 4BAGA 3Q8WA 4BATA 5DTJA 1LBTA 3WK5A 2H7CA 4J0HA 5AI9A 3HEAA 4BDSA 2WKWA 1USWA 1UK9A 1CUCA 5LKAA 3V9AA 4BCDA 5DYYA 1B6GA 5ALFA 3QMWA 5D3KA 1THGA 3DNMA 5KWIA 4BP8A 1R50A 3F9CA 4X3CA 4KAFA 4FLFA 1WB4A 5K3EA 5JANA 5DNWA 5ALXA 2GBGA 2HADA 4GBGA 2XUHA 4ZRDA 3U0VA 5LZ2A 3GFFA 3VVMA 3P2MA 1XZJA 3WYNA 5K5EA 5FP0A 4G9EA 5AKZA 3BDIA 4WY5A 4X6UA 2ZJ6A 4GW3A 3W9UA 3O4JA 1VLQA 4Y9SA 4C87A 3WJ1A 4UBJA 1CR6A 4XWGA 3RKSA 3LP5A 1RP1A 4B80A 4RPCA 1XZKA 2PPLA 1R4ZA 3QMMA 3PDCA 4CFSA 1K6EA 3ANTA 4QLAA 4OSEA 2OLEA 5ALGA 4GWLA 4TPKA 1SOMA 1EDEA 4I4CA 4A16A 3A2MA 5SYMA 2ACEA 2XUFA 3ESAA 1QIIA 2ZVDA 3QM1A 4BCCA 1TK3A 1LZKA 1XZAA 3O4GA 2O7RA 3SX4A 5AIAA 4MXDA 4CCYB 2OQIA 1CUSA 5LZ8A 1LPMA 4X6XA 4UBMA 4IH1A 4BC0A 3O4HA 2XUKA 1BCRA 4DMCA 1VXOA 3OOSA 5LKRA 4TGLA 2XQFA 3AFIA 4QDZA 3WMRA 1O6FA 1J07A 2H7YA 3DQZA 3GA7A 4W9RA 4UFOA 5ALPA 4EHBA 2PM8A 4GEGA 4X97A 4FTWA 1TCBA 1AZWA 1YAHA 3A2LA 4GXNA 4MJ3A 3UUEA 4XIIA 2XUAA 2BAGA 2D0DA 2OQVA 2QXUA 5FXMA 2DR0A 5ALQA 2VJDA 4AQDA 4CG2A 3G9TA 3O95A 3FAKA 2PBLA 5ALVA 2HA7A 5HF9A 3FLAA 3HRHA 5K3DA 4S0XA 4Y2UA 4GECA 1CVLA 2XMZA 3PF8A 2BUBA 3H0CA 3AIKA 4X85A 1F0PA 3H1AA 4X7BA 4KJXA 1SC9A 4Q1VA 1VA5A 1C7JA 1UFOA 4EY7A 4WFJA 2XUGA 3O9MA 1FFDA 4QLOA 3AILA 4EB0A 1LPOA 1CQZA 4BZWA 4G4JA 3WA6A 3BF7A 4X93A 1QIMA 2OAGA 3X3HA 4F0JA 3H04A 4ZI5A 5ESRA 1CUBA 3ZV7A 3LS2A 5IVIA 3VDXA 3LIIA 3SWWA 1DX6A 5BWCA 2VT6A 1QO9A 1HL7A 1ODTC 3H2JA 4QDXA 2G5TA 1ACJA 3GZJA 1DWOA 4UBIA 4CCYA 2I3DA 3UMJA 4G8DA 1TCCA 3HACA 5HCUA 3R3WA 2VTVA 1EI9A 4UBNA 1QE3A 4X00A 2DQZA 4UHHA 4RE6A 4C4YA 4P08A 5FRDA 4DNQA 1XRRA 4BP9A 4PSUA 4WY8A 1LPSA 3ESBA 3DJYA 3E4DA 5HF6A 3G02A 1HLGA 4F21A 5EIEA 2OGZA 1WM1A 3WK4A 4CG3A 1G66A 2EDCA 3NUZA 5AM2A 1DQYA 3G0DA 1QOZA 1K63A 4LIPD 5E4JA 3ESDA 4Y2XA 5EHXA 3AZOA 3WWCA 1Y37A 1UOOA 4K5QA 2PUHA 2WSLA 1MU0A 1EHYA 4H7DA 5JASA 1VA4A 2QOEA 4H7KA 4LXGA 5JIBA 1CUGA 3VVLA 3KDAA 4BTLA 1XZEA 3KWJA 1X2BA 4N5IX 4G9GA 2C5GA 4H0CA 4B85A 2XMBA 1Y7HA 5AH0A 4KE7A 1YSCA 2WFMA 5LZ9A 4KACA 2XMRA 3HLKA 1H2ZA 2AJCA 3HYSA 1A8UA 1QIHA 4DSAA 3QYJA 5ALTA 1QJ4A 3WJ2A 2WJ4A 5AK4A 4PSCA 5HKAA 4X6YA 4Y2JA 5E4YA 3WIBA 3F97A 1KU0A 3STWA 3MUNA 3E3AA 1DT3A 2RONA 2Y6UA 1CPYA 1KU6A 4XX1A 4XVCA 1ISPA 1VOTA 5AKLA 2E3JA 3L1JA 2B20A 5D3ZA 5CH8A 4INZA 3T52A 4H7HA 4E14A 4AX4A 4OB6A 4RNCA 5CH3A 4LYEA 2GYWA 5LLSA 4L9AA 1XZMA 3I28A 1UK8A 1N8SA 4N8SA 4ZV7A 5AOAA 2XUPA 4LYDA 3FNBA 3H2HA 3FLBA 3DL7A 4G4GA 4MQLA 3WA7A 1VE6A 3K2IA 7YASA 3ZPXA 3CXUA 4IH9A 3AINA 3FSGD 2VA9A 3F8SA 5AKXA 3ANSA 3WKCA 2PKYX 2H1IA 4WFIA 4Q34A 4C4ZA 2HU5A 1HDEA 4DGQA 1MAHA 1MJ5A 4YK7A 4KYVA 4JH0A 2BUCA 1U2EA 3EBLA 4HS9A 4Y2RA 4GLBA 3U1TA 4DNPA 1A8QA 1TAHA 1WCYA 3OG9A 5EHZA 3TJMA 1W76A 4FKBA 3G8YA 2P8SA 3O0DA 2IX9A 3CCCA 4GHWA 2HFKA 2J4CA 1HBJA 3ZLVA 5D7BA 4PF1A 4C01A 2FJPA 4UHCA 1E5TA 2C0PA 1XLUA 4DTCA 3Q0TA 4OPMA 1LBSA 5T4BA 4BVJA 5C7YA 3C5VA 1FJ2A 4W63A 5DYTA 5A6VA 3VKFA 1U4NA 3K9BA 1GQSA 2HHAA 5JAOA 1K5PA 4U2FA 1QTRA 3FWHA 1QIJA 2XDWA 3AUKA 1YA8A 5EI5A 2RAUA 5JAPA 4MYSA 5CT6A 4IO0A 2Y6VA 5E2IA 2VJCA 5A7GA 1BN7A 3PFBA 2B9VA 5LZ7A 1WPXA 1R88A 5JD5A 2C5FA 3PF9A 5LIPA 3WKEA 4ROTA 2VATA 3DOIA 4H7EA 4ARAA 3QPDA 3W2TA 2HL6A 3MGAA 3HZOA 5HZGA
chains in the Genus database with same CATH superfamily
1E32A 3JTMA 2WIAA 5JEEA 1ISRA 2VQFB 4H4DA 2I22A 1M83A 3F3GA 1KZGB 2WG2A 1P0MA 3B6JA 5I48A 1W5TA 3OCWA 1MG0A 3T3NA 1MQ8B 2WUGA 1TA4A 1DO2A 4F45A 3VR6D 4S1TA 1UOQA 3I2NA 1JZTA 3AJAA 4QUGA 3GROA 4HAOA 3ZHVA 5A7HA 2TRSB 3QWHA 2V65A 3DEIA 1A5TA 4HYQA 4DBLE 5LNK1 4WCFA 4CVNA 2HLNA 3RC8A 3FTNA 4IX9A 4B6OA 3KBBA 3HY4A 4ZALA 4JIGA 4MIOA 2W48A 3OSUA 2GO1A 1JLLA 4O1MA 3HDGA 4J86A 1XI2A 1ZXLA 1VL1A 1WKBA 2R6CA 3JATB 1GPUA 3EI4A 4DNFA 1OBCA 1P5ZB 5IVDA 1DKOA 1DDIA 1NVAA 2FCRA 5A2QA 4NU8X 5J4KA 4BKQA 4L4XA 3PRHA 4ZOQI 3OX4A 1K8XB 4C2BA 2XBLA 2BKAA 3DKVA 3HI6A 3TBHA 1SVNA 3LUCA 4P3OA 3TAUA 3G9ZA 3MBKA 4M22A 1NUTA 1JJUB 4PXYA 1B43A 3U3OA 1TYZA 3AJ9A 4E1VA 1E6KA 2BJVA 3ORQA 3G2IA 4YRCA 4MDEA 1IOLA 4PU0A 5TMBA 3KPYA 4ND6A 1PJRA 2AJBA 1F6WA 2J45A 3UWDA 2WIJA 3U7EB 1L5HB 2E48A 5DLQC 3GAZA 1BN6A 1NQVA 2L69A 3O73A 4KXUA 4KXWA 4XIYA 5C1IA 3JQBA 4L8VA 4GI5A 3B8HA 1U3WA 4YJ3B 1G41A 2ZTSA 3W8FA 5EXXA 2VRBA 3WLHA 3EMVA 4Q7LA 3RSEC 2RI6A 3SF0A 1UIMA 3MMNA 3IQIX 4QJ3A 4EVIA 1VIVA 1B0PA 1VLMA 1BNCA 2AEMA 2ACKA 1YHZA 3DFFA 5ICGA 1J5PA 1QE5A 2FOLA 1RMTA 2PH3A 1EE2A 4CM1A 1BPOA 4RM3A 4L73A 1EVQA 3OBIA 5K3SA 2Q6TA 3JATA 2GFIA 5AW6A 3BGIA 1H8HA 1EA5A 3FB4A 3MTJA 1KDYA 1RYZA 2H9YA 3R2JA 2R11A 2QQFA 2LR0A 2ZATA 4IDCA 1T4DA 5GADl 1EXVA 1AN9A 1N2CB 4PFJA 1UJ5A 2HBZA 4RIIA 3MW8A 4DQVA 4G01B 4B76A 1GRNA 3PICA 5LQJA 1XWWA 4C0KA 2GNAA 5IDXA 6CHYA 4PO8A 5I01A 2QQGA 4DQUA 3WIVA 2A5YB 2BGWA 4MVJG 2FEMA 2Z4RA 2YIMA 4NCBA 3FRXA 1L5HA 1K32A 1OSNA 4D0RA 4GWGA 2ZQ5A 4IZHA 1WKVA 3RVRA 2X14A 1T6ZA 1RS0A 2V7QA 3T0GA 2P3SA 1Z3CA 2A1TS 3NW9A 4YJ3A 2RHJA 5JPCA 1ZN9A 4F71A 1ZMXA 2D2XA 1N2OA 2FJ0A 4C0SA 1M3SA 5AI6A 5K3FB 1ICEA 1E4YA 5AOBA 4BP3A 1JPVA 1OILA 4ZYXA 2VK4A 2CYAA 3P9KA 5B3KA 3T7JA 1R5NA 4GI2A 3TX2A 2VYFA 2W6CX 1JQ3A 3G2LA 4QFCA 1J97A 4RPLA 2PKRA 1BGWA 4CG1A 1I7DA 4GLJA 2QYHA 4LJAA 3HCEA 3SLGA 1A98A 2ET6A 2LV8A 3H87A 4OJMX 2BRUA 4AWAA 3JZHA 4TM8A 4KZPA 4WNIA 2GAFA 4X54A 3KKPA 3LGXA 2G9NA 2I3AA 3L40A 1A88A 3S99A 1N2CA 1WABA 4I79A 2C7PA 5FF9A 3ZV6A 5JRZA 3G49A 3D8RA 2AGZA 2P40A 3L1KA 3W0LB 5IJ9B 4E5SA 5AI5A 2NIPA 1Z0UA 4BVBA 4NCAA 3UGJA 5G53C 3SOPA 1E8DA 1NW4A 1W9HA 3IPCA 5KI6A 2P2CA 3AB3A 4FZJA 4Z54A 1FUIA 3T35A 5DCWA 2AOXA 3UGKA 3HXLA 4OJKA 4WOCA 3HBFA 3KZNA 4LG1A 5A7FA 2ZUTA 5BSGA 3NKLA 3FDXA 4EPTA 1BWPA 2JAXA 3NOVA 3SWSD 1IOWA 1WMEA 1CUVA 3MMPA 3ASVA 1CE8B 3W77A 5K3FA 1UP6A 2GN6A 3DMPA 2IOFK 4EB6B 5FAKA 4B48A 3RFHA 3HYLA 5CURA 3ZEIA 3U48A 1TQHA 5JSQA 2RJOA 1VHLA 3VGPA 3A3YA 3G0CA 3RSHA 1FMCA 4CKWB 1A77A 1POXA 2AJLI 3I52A 1TEVA 1TZMA 2Y1GA 4HMOA 3TPZA 3RRMA 2GK4A 4HSEA 4MLDA 2FUG1 2IHBA 4GQAA 1MBZA 4KODA 5FPKA 4OHWA 4D74A 1GNTA 4B8WA 5FOTA 4HZIA 1ZAKA 3NR2A 3MTDA 1DL5A 5FNZA 1CKEA 5DHSA 1KVRA 4JP5A 4BRWA 1U0OC 3NT2A 1Z4IA 3LY8A 5FUXA 5FL7A 1FP7A 5JCJA 2BIFA 5IJ9A 4LYJA 2FH5B 4HYTA 1KI3A 5LMZA 2B1RA 2ZT5A 4W7IA 3KTAB 4F6CA 1R6VA 3DR5A 2WOJA 1NJ2A 4KW7A 4QJ4A 4G8JA 1XHMA 4RV4A 4ENSA 2WNSA 2GNQA 2Q9CA 4EW2A 5IBCA 5DGHA 3IUJA 4CZXA 1Z13A 4CU2A 4B84A 1X0XA 1FMLA 2Q1UA 1CE8A 2WYWA 1WZIA 4Z51A 3BGDA 4IHJB 4LV8B 3PFKA 3FZQA 4NVRA 4EB6A 3VX4A 4L5YA 2XKAA 4EFNA 1M5RA 4D3YA 2J3HA 3OAAD 2RHDA 2ZJOA 1U8CB 2A0WA 4YT2A 1NOIA 2WP0A 2JJ8A 3KPUA 2A9KA 1NJ5A 1P91A 3OZVA 1O54A 1A4IA 4RAOA 3GBVA 2YRXA 4JI5B 4CKWA 4N5HX 3TWOA 1RJ9B 1YKSA 2BFCB 2CLDX 5F76A 3PFNA 1CD5A 1PLLA 4RF4A 4IRMA 1R12A 1PWZA 3L0PA 1NZDA 4N5NA 4IHKA 2V45A 3I0NA 4HDQB 3WXBA 4YP0A 4CM3A 4JVNA 1YI8A 5BWMA 2ARKA 1IPHA 4GGPA 1ZVMA 3PFCA 3G2NA 4HT3B 1Y8ZA 1UINA 1AC5A 4O2WA 2XVXA 3N0TA 3KXLA 2J3QA 4DLNA 1QR2A 3FWPA 3KTAA 1W2WB 4EG4A 4L4ZA 2VCYA 3PFGA 5TVKA 3WLFA 3H5AA 3ZJTA 4TMFA 3E15A 4KBYA 5TE9A 3QFFA 2O2DA 1C5KA 3ZCTA 2WZCA 2C8LA 3U9SA 3DVRX 4ESHA 4P32A 1L7AA 4BE9A 1JBQA 6LDHA 3JALB 4RDIA 4TTSA 3MS4A 2R86A 2CLCX 2H7XA 3QX8A 3MCUA 4JVSB 3S2ZA 4H9GA 4IHJA 5F1OA 2C2GA 3ZE1B 3WGVA 3RHTA 4ZN6A 4IMRA 4XJXA 1NBMA 4PX9A 1U8CA 1R4NB 2FEKA 4G1EB 4OMUA 4XH9B 2QVCA 4KITB 4BYGA 4AIRA 4NP6A 5FX2A 4XVUA 3UZUA 3D43A 1B7GO 1RJ9A 2Q3LA 2BFCA 1T9ZA 3GCXA 3S70A 3DWEX 2P6UA 3ADKA 5CGZA 2AFHB 4X7PA 3LX5A 2QTLA 2PZGA 4UNSA 1AK1A 4W1QA 3TRFA 2QI9C 1NVEA 3LQQA 1E2GA 2PRKA 5D87A 4BVAA 1DEAA 3O38A 4U6QA 3DL4A 3OPYI 2HXYA 3TIIA 1TKRA 3LUHA 1NVFA 3BFPA 1WW3A 4IGKA 5H81A 5IGOA 3VR1A 3OEWA 5GGXA 4W5HA 2P7HA 1TVCA 4LNAA 3PC4A 3N0VA 2JLQA 4D6YA 1W19A 2GJ8A 3WV5A 1IDOA 2HCTA 4OXNA 1GPH1 1PYOA 2JLAA 3L0OA 1RQ7A 2CMHA 4BGDA 3INNA 5IT9A 3ZK8A 3C3XA 1NT4A 3RFGA 4MW2A 3C6KA 3R41A 2QY9A 3TGWA 1RSZA 1OXVA 2RGXA 3P96A 3QQ5A 5CHEA 3OPQA 1G8SA 3WAGA 2QMYA 1BVYF 3JALA 2CB9A 2ZI5A 3KJHA 5E7JA 3SR4A 2GN0A 4WI1A 5DXAA 4J7XA 4LY6A 3ZE1A 3QOYA 5ALOA 1IZZA 4YP1A 4U39A 4E4YA 3P0JA 5COBA 1C4KA 4XDGA 4UE2A 4BB0A 1R4NA 4G1EA 5JCXA 2QYTA 3EEIA 3HA2A 4QUBA 3IAXA 1ZSNA 3C1TA 1J99A 4FR0A 1ZP6A 4HBGA 4IFBA 4CDNA 4C43A 3HYRA 1L7RA 2FU5C 2EFJA 3JPYA 4K3ID 2AFHA 1P22A 3EC2A 3SM9A 2OO5A 2VA8A 2CT8A 2X42A 3P0IA 3DF7A 1G5QA 1F48A 1A96A 5DHPA 1SO8A 3UT6A 4NU0A 3F5SA 2F59A 3E9CA 2YDXA 4LTNA 3WWDA 2GFQA 1ZSVA 4EY5A 1H85A 2QZ9A 1I4TD 2GBFA 2P0YA 2I6FA 3PJGA 5A4MS 2YWEA 1ESEA 3ITDA 1M5UA 4R1TA 1H2XA 3GXOA 4LF8B 2PZMA 3PXTD 1SK8A 2YVQA 5AM5A 1MABB 3QXXA 4ZRNA 7REQB 2I2CA 3BAFA 3FMFA 4BO6A 2F1IA 4ZQCB 1N4AA 3HCNA 4NBVA 3H5TA 3NBFA 3L0ZA 3L6EA 4KNWA 4PIMA 2QMUA 4EI8A 1II9A 2PMFA 2L2QA 4F5ZA 3BTOA 2RCNA 3GH1A 3WKDA 3L0SA 3FSGA 2XXBA 1M2JA 5K05A 1L4EA 3WSVA 4Q9NA 3K6JA 3BL6A 4AYTA 2GZRA 2DCMA 3RC7A 2N47A 4CCSA 5THXA 4UQPA 2GAOA 4AC9A 5K0JA 4IA9A 5BRAA 2AFRA 3VH2A 3F2IA 3RJMA 2JS7A 5KREA 1YB6A 2VKTA 1LDEA 1IHPA 1Y6FA 3G8BA 3HJTA 1JT9A 3SEZA 3ZXSA 3J7AC 4B32A 2AFVA 2YXPX 4D46A 3HN7A 5CTAA 1PEAA 4BRSA 4Z5XA 1KQFA 3UK0A 1A5SB 1BHSA 4LNHA 4RQBA 1IN7A 4HB4A 4G25A 3P0RA 4UPEA 4J0HA 1FK8A 5J23A 1SUAA 1JSZA 1UK9A 5AXCA 1Q20A 4INAA 2DZDA 5KTOA 2D2VA 2DFLA 4ECAA 1RQGA 4MW0A 1J0CA 1SUEA 2W6IA 5AJZA 3O2SB 3UCXA 2HSWA 3F9CA 4PC3A 3EZ2A 1RYDA 1E4VA 5ALXA 4ZRDA 2DC1A 1PJLA 1KEWA 1JR6A 4GP6A 3EDQA 1MABA 1PZXA 2XCQA 7REQA 4PQRA 4WVLA 2H3XA 1XVIA 5K8IA 1WCV1 2F3SA 3AETB 2JGNA 3QSGA 4GW3A 3SDZA 4OXKA 1JIJA 2QW0X 4RZSA 2VZ1A 1ML4A 1FNNA 3IS3A 3P9SA 5JQWA 1K2WA 5F5NA 4EECA 2WWYA 1EU1A 1ZH0A 3COYA 5IBPA 4QPZA 3BWSA 4HJRA 2FG7C 3C3DA 4CFSA 2JFOA 5ALGA 2QL5A 3M1IA 1PTJC 1CY2A 3ZN2A 2CJFA 3KSUA 3GFCA 4J1TC 2ACEA 2HMUA 5FKSA 1OW3B 2ADFA 1FB5A 5AIAA 2DR2A 5DM2A 1T1EA 3MWJA 4IH1A 3TOXA 1FWXA 2XNJA 4P5DA 3NDRA 2YY5A 3OQOA 4L8WB 2UYCA 3PENA 3H9QA 2P5YA 4MUFA 4A2LA 3MB5A 4TYYA 5JDCC 5HBRA 4D4IA 5DOZA 4EJMA 2XY4A 4FTWA 1GRCA 4TVBA 1YAHA 1YE8A 4DCCA 4O2RA 3IAS6 5ALQA 3TM5A 3HJFA 5F12A 1I3KA 3OLYA 4I9FA 4C78A 3O8OB 4NCNA 3O8NA 1VTKA 4EI2A 2Q7QA 1FYWA 2CE7A 1AKVA 3KV1A 2IS6A 3ZVLA 2ZYWX 2BUBA 4MJ7A 3D6AA 3BRCA 2B78A 3GJ6A 3AETA 2WSSD 4YT5A 2B2NA 2GQ0A 5GVRA 1XZNA 4UXHA 3JYOA 4MI3A 1ULUA 1X14A 1ONNA 2G09A 4NMMA 1VFPA 3SPXA 2LPMA 3ZWLB 3REOA 1KK1A 1DX6A 2OCPA 1S2NA 5E9WA 3ZQ4A 2J4DA 4MUYA 1PL7A 1DWOA 3THRA 1TCCA 3TI9A 4E54B 1B14A 3CRW1 2EWMA 2QZZA 2I0TA 3I0ZA 5CDUA 1AGNA 1F8GA 2PX3A 4TKMA 3FPLA 3TIFA 4DNQA 3EIFA 4TXNA 5E8RA 1PBTA 1PS0A 3V9PA 5M5UA 4REQB 1G8HA 3RTCA 9GPBA 1H4VB 2ZIXB 4GIBA 1K7EB 2JIPA 3EDCA 3PKJA 4IGIA 4RY9A 4PRZA 4WESB 2EDCA 3KUKA 4PLPA 1HZZC 4NQZA 3K09C 4NE9A 3VNQA 1MA3A 5DIZA 3TLBA 3C5CA 4O1HA 2XB4A 3AVWA 1KAEA 2ZB2A 3NASA 3C3KA 2OBLA 3CE9A 2YJ5A 4Z2YA 3EF1A 3O8OA 4IYRA 3JRNA 4TZ0A 1WMAA 4O1QD 2PZLA 1MQSA 1U7OA 4OI0A 1SQ9A 4HYEA 5IC5A 2WFMA 2IEIA 2Z1NA 4N49A 2N1BA 2RBGA 5M3BA 1ENZA 1QIHA 4W8HA 3LWBA 3AG6A 4TRNA 1SCDA 4JBIA 3E3AA 2IZ1A 2FPOA 3IVGA 4E2YA 4COOA 1JE1A 1LDBA 1MQAA 2Z58A 1JBEA 1FNMA 4INZA 2H85A 4OB6A 2Q6LA 3EIQA 2IIQA 1A4UA 3OE7A 1VHDA 4QECA 1N8SA 3VKUA 1VJ1A 1KP9A 1RC0A 3KE9A 1NWHA 1EBBA 4C3VA 2C59A 4G4GA 1K6IA 4WFQA 3KAPA 1Y9ZA 4OHCA 4E54A 1KEEB 4U0JA 1I3NA 3DOCA 1E7QA 4ZEMA 5IDVA 2TMGA 4DGQA 5LYJB 4OL0A 4ZYUA 4D0SA 1ZH4A 2ZLBA 2GRAA 5D6NA 1O0SA 3IEVA 2H59A 3UKRC 3C98A 4REQA 4QT8A 2ZIXA 4OQ4A 5KYGA 5LBIA 2XUZA 4U7DA 4WESA 2D6FA 2V9CA 3ZLVA 1ZCBA 2JJ1A 3FMIA 4B5LA 4HWSA 4IW3B 1XLUA 4TSRA 4HQRA 2PANA 3C5VA 3COSA 4PQGA 5CP8A 2ATVA 5BNFA 1XO1A 3DBOB 1CQXA 3RUCA 3WYGA 2VC2B 2VQSA 2IAAA 1QTRA 3FWHA 1OIXA 3LQYA 3MTEA 4DCTA 3SS9X 4FSDA 5CT6A 2VJCA 1SVUA 5A7GA 3PFBA 5TV2A 2O20A 4CKXA 4B17A 4DR5B 4H31A 2E6UX 4R8SA 4WMLA 1RWXA 3T94A 3W2TA 3AWIA 2GN1A 1DFGA 1IXSB 1IQ0A 2Y1EA 4GKAA 1XDZA 1Y80A 1GNPA 4BGUA 5J2UF 2RGWA 1KO7A 1D0VA 3D8NA 1NL3A 1H5QA 1K4YA 2VSNA 1U7TA 2CXRA 1GAXA 2Q21A 1WP4A 5JMPA 1KEEA 1KQNA 1F2DA 4FFVA 4R84A 4M38A 5LYJA 3PUXA 2B21A 1OAKA 3DGEC 4CLHA 4D9GA 3AB7A 4BNTA 5DT9A 3NNSA 3CE6A 1I33A 1XU7A 1KIMA 4A2CA 4PC0A 1X74A 4RPJA 1QHIA 4A23A 4PLVA 4CIBA 4BMSA 1CU1A 1DAGA 3ZUGA 4WBNF 3QUCA 3BWEA 2ZDGA 3NXSA 1ZS9A 2NSJA 3SI7A 2J5RA 2WTNA 2YJGA 1VZ3A 4IGAA 2AXEA 3H99A 2VC2A 2ASEA 3LJKA 1GL9B 1P5RA 2VHJA 1PQUA 1ZIPA 4R2XA 2JC3A 4ITVA 3D5TA 2ZZNA 5I7OA 2ZVQX 4ON9A 2X5JO 2YZGA 5DBHX 4MB6A 4WDQA 1H93A 1N3LA 3L1IA 4JDPA 1P1JA 4DILA 1Q1AA 1LSOA 1KI8A 1ZGGA 5FOQA 4OFBA 3DDUA 5LJIA 1KMCA 3G82C 1KE2A 3ZHZA 4AROA 3SXPA 2H52A 4I5DA 4MEJA 3ZZTA 3IQEA 4PRKA 1PZMA 3AVXA 4FLMA 3EVFA 1SWWA 2WHEA 3RODA 1X7YB 5I7RA 4Y2VA 2DETA 3UMGA 3INYA 4WCFC 5KSWB 1EM8B 1SURA 3IVAA 3L02A 3U7IA 4Q4AA 4LFBB 2O0KA 2NU6B 1NQXA 3MMZA 1YBAA 4BO9A 3MPUA 1CRQA 1V2GA 3TH5A 2IXBA 3DL2A 1SUSA 2HJWA 5ITSA 3BPSA 2AKAB 1GR1A 4NCJA 5BQXA 2VJKA 3L0DA 4QG7A 3DEFA 2OXCA 1PQWA 3SVZA 2JIQA 2C2XA 3PP8A 3OY7A 2YNMD 4B9EA 2PX5A 5DWDA 4JB3A 1QFSA 2BTEA 2GCEA 4O45A 4HWOA 5KWEA 4PBRA 2C7RA 4I36A 1IH8A 5J2TF 3W5SA 2F3RA 4NJEB 3Q15C 4FZRA 1EK1A 3DD5A 1EB9A 1F14A 1DRKA 1Z7EA 3TR5A 4DKXA 2SCUB 3PNSA 2ZRFA 4NDAA 3WQSB 1EDOA 1ZIYA 2BL4A 1I3LA 4BX0A 4UM9D 3OCXA 1W88B 1ABBA 3SQMA 4XE5A 4CQLB 1MB4A 5FBWB 4R1OA 2IYUA 4C4RA 1X7YA 3F71A 1RRCA 5F1YA 2HJBA 2JATA 2QTVB 4PLCA 2HSDA 3ILSA 4ZJPA 2IU3A 2O3RA 2JAQA 4BKPA 1EM8A 3GJ0A 4JCCA 3DV0B 4QICA 3FDFA 1KJZA 2NU6A 4IJQA 4CCWA 3KZXA 4HS4A 1QKIA 4B7CA 2JLYA 1G63A 1JMYA 3T4UA 1BD3A 4RF2A 1XA3A 1LQUA 5TC4A 1JLRA 2G9QA 2HXSA 4PG6A 3C97A 1R9GA 3OH8A 1EXDA 1Y4ZA 4PYQA 5M5VA 4FS8A 3GZTB 1S01A 3PQEA 1FFWA 1VI6A 4B3TB 3BHJA 2IH4A 3WGQA 3K35A 5GINE 3KYBA 4FGSA 1ZLXA 1CFJA 2X8AA 4A10A 2ECFA 1OX4B 3MBOA 1TADA 5BPHA 1FDSA 1WSAA 3NTOA 3R9IA 2PR7A 2Q7XA 3HJHA 4LF5B 4D99A 3JV7A 3IVXA 4NJEA 5FV7A 4ZK2A 1AUQA 5D5QA 1QLWA 1TJ5A 4S1NA 1UJNA 1MHPA 2C00A 2SCUA 4OU5A 4BWVA 5KX5F 2XYRA 2C03A 2IUTA 1ORHA 2G04A 4ESGA 3O3NB 3SN6B 5JT1A 1CJKC 1E6EA 1U0GA 1W88A 1TFRA 2COKA 1HRDA 1GARA 3BIWA 3V6MA 4CQLA 3VR0A 1I5RA 3KB6A 3I2KA 5IT5A 4ZCRA 2JG3A 1SQJA 2L17A 5C8XA 1NGSA 2AZDA 4EW3A 1PNTA 4AAYA 5EUBA 3DV0A 1SRRA 3O8BA 2XVYA 2OV2A 3TAXA 2D1QA 1T2CA 2GHTA 2EIBA 4JA0A 4D3XA 5EP1A 3CZCA 4QASA 4GQ1A 4H1VA 2FMXA 2ON6A 4CUKA 1E1LA 1WSDA 5HUQA 1L6RA 1NQ5A 4X8LA 2XQIA 1VB5A 2O52A 3FUUA 2VPIA 3ODGA 1C8BA 4XAQA 2HHLA 2YUTA 4M7RA 1NXSA 4AX8A 4BZZA 1UADA 1OX4A 4MWDA 2W83A 1XNQB 2C95A 3PXUA 1CV2A 4YB8A 3E2IA 3H1EA 1SQ6A 1JSLA 5F77A 2PGAA 1M8JA 1M75A 5CNJA 4G9BA 4JJAA 4A1OA 4MNTA 2AQKA 5IPFA 3H5IA 4TV9F 5IC4A 4U3JB 1JIVA 1SHTX 3OCZA 4BNFA 3N8IA 2ATIA 3DPIA 4CNBA 4ZC1A 4QYWA 4CLDA 2JZNA 4QU5A 1QR6A 1BO6A 3SN6A 5AVJA 5ARCA 1PTJA 4MKIA 4BQOA 2Z6QA 3U49A 3I2FA 1DRVA 4AFNA 1PZGA 1PL0A 2BGTA 4TT3A 4CF6A 3ZU6A 4MVJE 5CDTA 3AM5A 2WMYA 3WNCA 3SG0A 4NENB 2OVQB 1Q7RA 3AL3A 1U3GA 2AWNA 1YV9A 2AN5A 5JDCA 2WF6A 1EBUA 1E9AA 3FPCA 4W6QA 5ICFA 5C2WB 5INTA 4EZBA 4QVIA 3P9YA 2OY0A 3GLSA 1HDOA 4FJ0A 3PS9A 3GGOA 2L0XA 1QYXA 2F1OA 5ARBA 1JPJA 2B8TA 3ZY3A 2H4JA 4BUJA 4MAMA 3S5JA 1HYEA 2WDPA 2P4UA 2QPTA 4LECA 5TGDA 1GT6A 1PZFA 4EJ2A 4WT7A 3VH3A 2G4CA 1KQGA 1KJIA 2WT4A 4AKSA 4U3JA 1L6IA 3FYDA 4E2XA 4H7JA 1ODSA 1UC8A 3KUUA 4DYHA 2AQ8A 2YN0A 4DLBA 2AGVA 1QWOA 1JT2A 5JNVA 3T38A 4ENTA 4N76A 1GGMA 2Y76A 5JXWA 3LXXA 1R0CA 2ZI4A 4KKXB 1BA3A 1W44A 2BGRA 4LOLA 1BC5A 3I76A 3STVA 1JH8A 4C9BA 2A9OA 1KRHA 2IYZA 2KLBA 4KSCA 3DLTA 1SZPA 4MRAA 16PKA 3WIEA 3N76A 3PRJA 4Y9TA 1PFWA 5DGTA 4NENA 3FPKA 3W90A 3KPVA 2AD1A 4JR1A 4M7OA 3ETDA 3UCFA 4B81A 3AEKB 4L75A 3N5CA 4YRSA 4Z8LA 1G20E 1GGEA 1WMFA 3F3MA 1QPBA 1C1XB 4GZ8A 1AUOA 1ZA1A 1MFPA 3EN0A 3GVCA 4KVFA 1XAIA 2BDEA 2P2YA 5CA0F 2J0UB 2ODEA 3VKHA 2FSSA 5ELXA 1UFQA 1UAAA 3F9RA 1DHRA 4RD3A 2GVDC 3PRYA 2G88A 3O4VA 4KBFA 4ASUD 4V24A 3T6KA 3FRIA 4IKPA 1KBOA 4ZARA 1T8UA 2UZ0A 2C92A 4FNOA 5KWSA 1QFXA 4WLUA 2B4AA 5ALIA 4YCJA 4ZV9A 3E9QA 3DUWA 1VIMA 1URPA 4TX1A 3CMMA 4TUYF 3SYKA 4F97A 1GZ4A 4KU4A 2IQIA 3L8HA 1OA0A 2X58A 4A8HA 2VHZA 3HKCB 1PFGA 3IAHA 3KQQA 1Y6GA 5GY7A 2YRFA 4LVOA 2Y1DA 5D5HA 5IM5A 4KQJA 1KY2A 1N5DA 2H31A 4INOA 1PQPA 1QZ3A 3JQAD 1A8IA 3T06B 2OPBA 5KYWB 2I7CA 2P30A 5E7QA 4GM9A 4JB8A 5EWJB 3KEFA 5M5BA 3D6NB 5JHGB 2BFBB 2VNAA 7GPBA 3WYDA 1C1XA 5CBKA 1NTOA 4FC7A 1O03A 1SBCA 4S2UA 4DYDA 3KC2A 4HD8A 3DPSA 4QDUA 1HEYA 2J0UA 1ZVVA 3ZGLA 5DWVA 4S3MA 1NJFA 4FGJA 3M5PA 3NM6B 4P31A 3NT5A 2GEUA 3OF3A 1GGVA 5DGDA 4CI2A 4B44A 2P4QA 4RVCA 1I1HA 5FA5B 3DW1X 3N2YA 3BL8A 4QATA 4O25A 4EYEA 2BISA 4RVHA 2GVNA 2WVAA 1I1QB 1N6RA 4KXXA 4RK5A 4JI0B 1H6AA 4NATA 3EEBA 2CFOA 1M1ZA 3I4CA 3PFHA 2XWPA 4F60A 3MKQA 3NUGA 4UEWA 1A4XA 4TSKA 721PA 3HKCA 1Q57A 2ORWA 5C2VB 1IEVA 5ULLA 4EX6A 3VVBA 3D1JA 1GQQA 3PI6A 3UB3A 2R6JA 4GYYA 4ZO6A 5HOQA 3I34X 4KQWA 2V5AA 5A6SB 2ONCA 4JXMA 3JYHA 4G65A 2C5HA 1NVDA 5KYWA 1IHDA 3DW3X 5LUBA 4LVCA 4V0NA 1FLDA 5EWJA 4R0MA 1X1DA 4DM3A 5JY6A 4DLUA 4NIMA 2BFBA 3I2IA 2OO5C 1CJUC 1NV8A 1DMSA 4EHIA 1Z6QA 2RCYA 3O2JA 3HJGA 2IA5A 3PGLA 4ZZ2A 2H1HA 1QMGA 1LDYA 3VV3A 2DWPA 3WLJA 1L8OA 5KOIA 4Y7RA 4CKCB 3G23A 1BMFA 4PLGA 2XR1A 4BFWA 1FXSA 2OENG 4BCBA 5FA5A 1C29B 1AQUA 2QW8A 1AUXA 4P3YA 1RHUA 4Q9KA 2C3UA 4ZZIA 2IXAA 1JN0A 3GMDA 3E5HA 1XRJA 5EINA 3A1VA 4NK5A 3UG6A 4BDSA 1Y3IA 4XWAA 1G8KA 1KXJA 4DB4A 5SY4A 1YJ5A 1NDQA 2C7OA 4Z0HO 2FN7A 4E5UA 2QN7A 3CF6R 5A4AA 3IT1A 3L9XA 3EEQA 3QU9A 2ETXA 3IL2A 4FIDA 4BP8A 2YWGA 4FEGA 3S40A 1A2BA 1SUWA 4YGYA 4KXNA 4BZQA 1OHHD 1ZJZA 4HNUA 3DTYA 1IHOA 5FNVF 5GP1A 4WA8A 5A6SA 3VPXA 1IJBA 4DMUB 2UUOA 5I9SA 4X6UA 5F51A 1J21A 2JKZA 1XCGB 1UBRS 1EFVB 3ER8A 3D54D 5JUWA 3CR7A 4IS3A 2CHVA 2ZRCA 4GSKA 4DW8A 3PYMA 3GJ4A 1P5JA 2EKPA 3ZDCA 1MV5A 1K8YB 4E5ZB 1X80B 4BCCA 1ODLA 1XD8A 1ZW1A 4LDAA 4CCYB 1EK6A 4JQCA 2YN2A 4CKCA 2Z6VA 1YL5A 3F73A 3DEZA 2AW5A 3NCHA 1SIWA 3VU0A 4KO4S 4RXMA 5B1IA 3IESA 2V4UA 2VSYA 1SA0B 3VSDA 1VP9A 3D6UA 3L46A 1XTKA 1SHJA 2WKSA 2PM8A 2NN3C 3VR5H 4GQIA 2ATXA 4PNEA 5EIXA 4XIIA 2QXUA 2QRLA 1VJRA 3VZSA 2F43B 2H1LA 2JCVA 3FM9A 2FZVA 4QBKA 4TT8A 1JYFA 3GNSA 2SICE 4DDHA 2EX0A 2MCFA 2NV0A 4UQOA 3GLRA 1SCBA 4PZCA 4GPBA 3QHYB 4DJ5X 1IY0A 4TWBA 2H16A 3KQWA 4D9FA 4KUEA 2HI0A 5A0TA 3KL2A 1TRKA 5IJ0B 3OL2B 2NUTB 4YO8A 2WD7B 4LOJA 4YFVA 1S7GA 2DTDA 3QHAA 2QVZX 1EFVA 2V59A 4YGXB 3K9QO 1T5OA 4CEIB 3N70A 3RV3A 3EFBA 4J43A 4ZI5A 3L5KA 5FOSA 1Z9BA 1L7MA 3GNLA 4B46A 4QULA 2FMKA 4FEAA 4B40A 1G5TA 5DE3A 1NF2A 1IL0A 4E5ZA 1X80A 4M1YA 4QDXA 1OXSC 3QXHA 3MZLA 1DKMA 1L7NA 5H4HA 4CCYA 1TDJA 2CZGA 3D4BA 5FTKA 3HO6A 5E9QA 5D3QA 4P4SB 3A8TA 4X00A 4YROA 2HMAA 2ZANA 5FRDA 4XI9A 4ED9A 4BP9A 1K5GA 1SA0A 1ZCZA 4OHPA 3ESBA 3E4DA 2QE7D 4IDPA 5SZKB 3GLHB 4TLMB 3HYCA 4CQMB 1YOVB 2NYUA 5SYAA 1U2VC 4K03A 1Y37A 1UOOA 5FJIA 4KH1A 3QYPA 2F43A 2PUHA 4F3TA 4JT9A 3BCSA 3KU1A 3UB4A 2IE0A 2H18A 3I5XA 3BIFA 2VUUA 2OZPA 1P2BA 1R5OA 3ND5A 4JN6B 1XZEA 3C4VA 1PLJA 2WOOA 4N5IX 3E81A 1HXHA 3QJYA 5J1TB 5DGXA 3REGA 1JLHA 4I4TF 3AFOA 3LDAA 1C41A 4KE7A 5GXIA 3WLLA 4H4CA 1NRIA 2A0UA 4IQGA 4M86A 5IJ0A 1E63A 3PX2A 3OL2A 2YB8B 1YFQA 4FA1D 2NUTA 2PKQO 2WD7A 4PSWB 1XCPA 1AU9A 3F97A 3MUFA 2R44A 4OKNA 2KQUA 1DFIA 5EZQA 4CEIA 3K70D 1YQUA 3SQXA 1A50B 3VZQA 3WRXA 1GD1O 3QF4B 3WGNA 1G1MA 2Q6KA 4I2NA 1YHYA 1UK8A 3IQXA 3TZCA 3GJZA 3AOGA 5AW7A 5H3CA 3WXMA 3RFCA 3PG5A 3PXEA 3NYWA 1S4QA 4MQLA 3ZOZA 3B2EA 2BELA 5J1SB 4D26A 4WFIA 4P4SA 2HU5A 4XA8A 2F62A 2RHBA 1WXIA 2HB6A 3QENA 3JU3A 4QJ5A 3BA1A 3GLHA 2DH6A 4CQMA 1YOVA 3BRSA 3FIJA 3UEOA 4ZIRB 4A0QA 5T4BA 1FJ2A 4GXRA 3VKFA 3D4OA 3QIAA 3AUKA 2MU1A 1AH2A 4HN2A 3TF5A 4Y2HA 3ZD9A 2OHOA 3RBVA 1PCXA 4ZAFA 3B1KA 2D62A 4DREA 2ZWMA 3A32A 3I32A 1A97A 5EIOA 3VBCA 2GVZC 2MSEB 3QPDA 5B7GA 1FDIA 4OG2A 3HZOA 2H2AA 1YZKA 3TEFA 3D6MA 1WBBA 2HA4A 1UBOS 1P60A 4YPFA 3IBYA 1M1NB 3C48A 5CB4B 4M2LA 3QF4A 4Y1EA 2I03A 4PAWA 2O8DB 1JE0A 2Q2NA 4ZKEA 3VU1A 4HZUB 1AD2A 1Q0QA 1S9DA 2IUUA 2OC4A 1ABFA 3TBKA 2PLAA 3AI1A 3USCS 3HB7A 3C4QA 4HXYA 4FYJA 1VSBA 1KJ8A 2E4UA 4YUXA 5F2EA 3ANLA 2UUPA 2JCGA 2I3SA 3NH9A 4XVRA 1MFZA 1GQYA 2J9ZB 1QUEA 1G5IA 4NF2A 4W8OA 4NAAA 4R01A 1CUWA 4L72A 4KLRA 2JZOA 3ZBQA 2AT1A 1RTKA 3UICA 4ZIRA 3KUXA 4N7JA 1Y81A 4BNYA 1P1HA 2GUWA 1T2UA 1C9DB 1QHFA 3AHGA 1UMDB 2ZBGA 2D59A 4ZMRA 2G06A 1ILWA 4KI7A 3L6DA 4KMOA 5KUTA 3GFVA 1RIIA 1IYZA 3M83A 2FMUA 621PA 5ER9A 3EI3B 3P4XA 3W8NA 4RY2A 2PV7A 3EWAA 1AKTA 4QNNA 1XWIA 3TQTA 1MPXA 3D2AA 1U94A 3A1WA 2IEGA 3AZPA 2IPAB 1PDOA 5CD1A 1M1NA 3MMSA 2PA3A 2PS9A 3R6TA 5CB4A 2VHXA 1RRGA 4Y9DA 1TVEA 1AKEA 1PGOA 2HJ4A 2O8DA 4HZUA 4DV3B 1R4MB 1JAXA 5E6SB 2O50A 1QLHA 2WZBA 3T9CA 2X2OA 1JPUA 4BP1A 1YRWA 3T61A 4Y67A 3CX6A 4BDTA 3F67A 1SC6A 4FBGA 5BR8B 4F93B 4QOSA 1QVZA 3DKKA 4ES6A 5CGQB 4GG1A 2BEKA 4WKPA 4ZVRA 1TJ3A 4Y30A 1E1NA 4B3HA 3Q11A 4O29A 5EXDA 4QRDA 1DV2A 3VYTB 4WXHA 4EHAA 4X91A 5TEEA 1MX5A 2O8VA 2IIBA 1BWQA 3W9SA 3ETJA 4E4RA 4TWIA 1FSSA 3DKIA 2J3MA 3ABOB 1E3MA 3KWFA 4OLBA 1TK9A 1UMDA 2QN2A 1FLVA 4YACA 4KFSA 1VL8A 4YMIA 3F5FA 3WBJA 1UEJA 3SYNA 4TYWA 5JMOA 5FXYA 1FMFA 2WLSA 1E1QD 4RJIA 4PFQA 5ERYA 2QS9A 3MXTA 4HH4A 1BMDA 3EI3A 5HMMA 4NCXA 5EJGA 3EYWA 1G16A 3S2YA 2E55A 3R5SA 5H9VA 3E53A 2XOKA 1V6SA 3OJLA 5B53A 1LCIA 2HFJA 2OHVA 4HGRA 3C39A 3PDIB 3PQ6A 5AHKA 3WGZA 2ID4A 1UBUS 1R4MA 5DEIA 1F1BA 3AMVA 3C70A 5E6SA 2VAVA 1PFVA 3FXAA 3SDSA 4FYKA 5CT9A 4JLNA 4Q16A 3VNAA 3H1BA 4Q1DA 1TXGA 3F3YA 2O3TA 1DZIA 4NABA 1UODA 3IEMA 3KKNA 2W2TA 4AU1A 4WAUA 4N9QA 1JU9A 1F3LA 3C4JA 3A6PC 3L49A 3LX8A 5G0SA 3OPXA 2WF5A 3L8CA 4YV1A 1I2CA 3O4IA 3TRHA 3O9ZA 1PI6A 5EZ5A 1JG1A 5IXSA 1MOPA 2YHAA 4EKEA 5FULA 4TKZA 1VXRA 1OA1A 2DR3A 3O8DA 1A7JA 3ABSB 3TUIC 1M66A 1U3DA 2VPPA 1P7WA 4RJ2A 1GPDG 2B4QA 5FPYA 1UPCA 3PX3A 1V48A 4EDFA 3PXCX 4EKNB 2R25B 1LVUA 3AO0B 3NEPX 4H15A 2XA9A 1PVVA 1PJ8A 4XARA 2P6NA 3TSWA 2O6HA 1EFRD 2XZDA 1RMYA 4K6HA 4KN5A 4Y7CA 1JIIA 1A76A 1VL2A 3AIMA 3CKLA 4MVJI 4Z4QA 2QUHA 3OLXA 5KPJA 3PDIA 3H9JA 1CDZA 5FL3A 4HXGA 4U8GA 1WXGA 3NWEA 5TJ9A 1XF1A 1AK2A 1RWKA 3D3KA 2QNBA 3BGOS 3AFHA 3KT0A 1R00A 1YKGA 1EWRA 3CVWA 5AXDA 1JHRA 4AP6A 4F2PA 5ED0A 4TS9A 4PFKA 3WGKA 2CBZA 5I7VA 1FFEA 1WRBA 1ADGA 3GLVA 2OUKA 1Z5VA 3MN1A 2O3JA 2IODA 4I5IA 3OLZA 3JXEA 4KGVA 3GCDA 3JYNA 3IOCA 2P7IA 1IATA 3CNNA 4D3FA 4LWOA 2XMSA 4DIOA 1Z39A 1O94A 3WWPA 3C3WA 3AU8A 5CVVA 1CZOA 3PUJA 2FWBA 3PGMA 3I9MA 4EG5A 3AQIA 1SCKA 5I9TA 2QAGA 3EIOA 2IRWA 1Y3FE 2YXNA 3V97A 2CNDA 3BKWA 4GZ6A 4C7KA 2XE8A 4XGNA 5IULC 1G5RA 5ALKA 3UAXA 2V9ZA 3GC6A 3SBXA 1GKKA 3I8OA 5CTJA 3U56A 2KX7A 3V7YA 4C4XA 2B34A 2UU9B 3E27A 3ZDYB 4RV9A 1UWVA 5KC9A 3B8EA 2VDPB 5EJ8A 5DM0A 1QAMA 1KFJB 4QDJA 4G0VA 3GDGA 4Z9YA 2GJSA 1R3DA 4DF3A 1PD0A 2Q4EA 2YN4A 2UVQA 1B6TA 4EEXA 3FTFA 4FMDB 3TW8B 4YCSA 1IB0A 4J77A 5KHAA 3BWDD 5L40A 3L2OB 5J58A 4TKLA 4YHBA 5B37A 3AFMA 4PR0A 4NBWA 4K9KA 2INGX 4Q3KA 1FJGB 2EKBA 3D2BA 1DC4A 1RLMA 4OOFA 2X9NA 1VHTA 3LUAA 3VPSA 4OQQA 4O3FA 2AGYA 3DLIA 3U5ZB 2E1PA 3E70C 2GM4A 4YRKA 3HCAA 3PC6A 2V7WA 1EVZA 4MTCA 3ADDA 2XXAB 5AW3A 1P19A 3GA0A 4BQNA 4RA6B 3WYCA 2YV3A 4B8YA 3OWOA 3W3AH 3TM4A 4U2EA 3ESXA 4MYHA 2HGZA 1RR6A 5BSFA 2IYLD 3A14A 4A0FA 3ASZA 3U44B 1NW5A 4E4TA 4QQRA 2WG0A 1FNBA 3DMFA 3HA5A 1KJJA 2OJYA 1K7YA 4IL5A 2JEYA 4QDKA 1O6GA 3RUIA 3ZDYA 4MEBA 1TRHA 2VDPA 3X43A 3L7DA 1Z0DA 3BQMB 3V4SA 4BUJC 3MCAA 4AMVA 5I7EA 2FQQA 4FYMA 3OIGA 1E2EA 1ZI8A 3W5BA 3TW8A 5FUMA 1QTQA 1U3TA 1G5FA 2OGWA 4IIFA 2BYTA 3FNHA 3I5UA 1EFPB 4EZEA 1RRPA 5FORA 4XR4A 3A4YA 4HPJB 2FPKA 4QEDA 1PT9A 2JGLA 3AUSA 1GU0A 3K9NA 2O5EA 2B5OA 1UXGA 2GSDA 2CN3A 4X64B 3UUFA 1Z16A 5FWAA 4AJNA 5KNCD 5TF4A 2XXAA 2O14A 2O1SA 4NBRA 3AM4A 4JU8A 3G88A 3LFUA 2MMCA 4Q47A 5CFNA 3CVJA 1GL7A 1QVAA 3HABA 4RA6A 4PWYA 1XZDA 1FYVA 3RVSA 4U7GA 3DOOA 3P2OA 3A6FA 1ZJJA 1G2QA 3A6GA 2G7ZA 1JDZA 4BTEA 4YRIA 2IY7A 2CN2A 3IRVA 4TZKA 3U81A 5E2AA 2QL6A 3U44A 5F2KA 5J5VA 3DQPA 4EF4A 1U8UA 2ORVA 3IO5A 3VI4B 1GCGA 3BFKA 1DAPA 3TNLA 3ND8A 4AOWA 2RKBA 4QZVA 1HG1A 1XQXA 4Q7KA 3NO4A 2NX2A 3PE3A 1ORIA 3ITKA 1Q22A 1NDUA 4QD3A 1U8YA 3QNMA 1YR2A 3G9XA 1J7KA 4IFEA 3GRFA 3I09A 3D7SA 4M0KA 1CUFA 4BFLA 1FEZA 5K4AA 2F4NA 1EGMB 1EFPA 4BU0A 3DDZX 3U6BA 2A92A 1YMQA 3D8SA 2AQHA 3NIFA 3WL8A 1L5NA 4BECA 3C8HA 2R4TA 4YH1A 1X13A 2WF9A 1DG3A 2WEKA 4NBTA 4IEEA 4QC2A 1H0SA 5C4GB 4B3RB 3QPUA 2EQAA 1Z2DA 10MHA 3KOOA 4MB2A 2I7VA 1ICIA 1S89A 1U8EA 4D9JA 1MZVA 3GRPA 1JSRA 1ORVA 3SICE 3GEDA 3PGJA 3AVTA 1DKUA 3LOUA 1I4OA 1I7PA 1GYQA 3ZD8A 1MB0A 3O0TA 4CRWB 1Y3AA 3F90A 1ZD9A 1UDXA 1JHYA 1SUBA 4D3ZA 4W5TA 3WNBA 3VI4A 2VYVD 3EQZA 3HB1A 5DBGA 1FXWF 3I01M 5DGCA 4FXPA 2WTEA 3D7KA 3QU4A 4D82A 4J0DA 1UBGA 4HEJA 3SE7A 4C4AA 2ZI7A 3AL2A 3ZVNA 2VPZA 1CZKA 1II8B 3CRNA 2AR0A 3AVPA 1Z0IA 2BHTA 3D7MA 5IC6A 1A1VA 3W6PA 3ZGVA 2BSXA 3IILA 1L7OA 3WISA 1VGVA 2VH1A 4RVGA 4A2PA 3EHEA 2HA6A 2LXNA 3RVLA 1ZN7A 4EJ0A 1JR3A 5B1YA 1KEZA 3D7RA 3N0EA 3I2GA 5K8CA 1HK7A 2FEOA 2QTHA 1AK9A 3X1JA 1P2SA 3DB2A 1ZM9A 4L15A 4IJMA 2YS7A 2WSIA 5BV0A 3CF4A 5ALWA 2GKGA 1VCHA 4EFLA 4GICA 2Z2NA 3DVLA 3LKVA 4TWZA 2P3LA 3P8ZA 4Q4AB 2XT6A 1P4HA 4Q00A 1W36D 1NRWA 4TVSA 1X7DA 4KWIA 3UM9A 2UZIR 3CPJB 4IRXA 3AVQA 3LHIA 2QTNA 2XYPA 3IXMA 4ZCIA 1KYXA 3FMVA 2PZFA 3PB3A 1HFEL 4RKRA 2WF8A 1GZHB 4LG9A 4OFZA 1TGYA 1MG2A 5KMGB 4G26A 3GFFA 1RXIA 3C3CA 3PR1A 3PC7A 1XTQA 5G0VA 1W5EA 1FU4A 4IV0A 4MI6A 1W1WA 3TQIA 2Z1MA 5IUNC 1JG7A 2VNKA 3K05A 5K09A 1KI2A 3FTPA 5L9AA 1FSGA 2IOHA 3WJ1A 1II8A 3DEJA 1VYVA 2PM9B 2GPYA 3ZE7A 4Q4CA 5BV1A 5K0CA 4B80A 5DM60 4RPCA 3CIKB 1X94A 2E6KA 4Z3OA 1S2DA 5KNDA 2DP4E 1SOMA 2W2VA 4WKOA 4DUGA 1SELA 1CY8A 2QHXA 3ESAA 3Q9NA 4HKTA 1F6BA 1VQ1A 4LE2A 1D2AA 4R8MA 4KDCA 3G0HA 1XA0A 4UBMA 3R7DA 2XUKA 1Y4SA 1UT8A 1H5UA 4YS6A 1U80A 4EKIA 2B7LA 1VDMA 4ZANA 2V74B 4URWR 1SXIA 2I7TA 4FGKA 4TZTA 1YFJA 4DIEA 4UFOA 4CDRA 5GQSA 3F47A 1OBOA 4PVCA 4KQ1A 1SOUA 4GEGA 1ZM7A 1QRRA 5IHXA 1KPGA 3AM1A 4H17A 3SSOA 3PFIA 2DR0A 4QHSA 4V03A 4UCXA 1DO8A 2VTKA 2Z2YA 3B1FA 4YAIA 2GN4A 1PGPA 2QJFA 1TE2A 4G86A 5A9TA 4RADA 3RRBA 2WSBA 5KMGA 3RWMB 3RRYA 3HTXA 2POCA 4KPYA 4FE3A 5JCZA 1GPMA 3TOVA 3BSSA 2ZTMA 1W47A 1G6KA 2V6GA 4X85A 3VVCA 3B3FA 5TVGA 4UNIA 2XE7A 3ROEA 3O9MA 1XAHA 5JMTA 5TQ2B 4I2VA 3ZU2A 4LSGA 4HWGA 1GSAA 3WGGA 3AXSA 4JHLA 1UWKA 4FGZA 2PM9A 1PWXA 1UBHS 4R68A 1XYVA 5TS3A 1RWNA 3VZPA 3UXEA 1G7CA 3S1LA 1A8PA 1X1RA 4GPAA 2B2XA 1YZYA 2XA1A 3NBZC 4BLOA 1E6MA 2JFVA 3H2JA 4EWLA 2C9ZA 1J49A 4O5OA 1JDVA 5JVDB 5DX0A 4MRPA 3A4NA 3AEZA 3CH7A 4ANFA 4PANA 4G3XA 4QYIB 2FOIA 3K1TA 5F9HA 5LXTF 1LA2A 4I6JA 3H9EO 2DQZA 4UHHA 4P08A 4Z4IA 1KIAA 2W37A 3FI9A 4WY8A 1XKSA 3LNTA 3N28A 1V8PA 1A3CA 4F21A 1CJBA 3AY6A 4DCSA 1VRVA 5EA2A 3UUGA 4UUMA 3AF0A 1RLUA 3DAPA 4ZOLB 3KP1A 2OUIA 1S8NA 3VVLA 5FYQA 4KQMA 4BTLA 2C7GA 1QAQA 1L7DA 1FDVA 3E5NA 4ZTZB 4UULA 4WEQA 2A3RA 4YBRA 4TMTA 2I54A 3K4HA 3WLKX 1TZBA 1EDZA 5EY5B 2O6LA 1E79D 5TQ2A 1J2YA 4FMCB 3ZK9A 3MUNA 2VT2A 5TPZA 2R85A 1EG2A 3FYHA 2YFKA 1T5TA 5C7LO 4BFYA 1WNTA 5D3ZA 3IKVA 5DHUA 2ILTA 4LXQA 3ND9A 1FYFA 3PEWA 2AMLA 4N65A 1P8JA 1S9HA 2MMGA 2Q0QA 4N3CA 5JZVA 5AOAA 4LXXA 2HCFA 2HLDD 4FT4A 2H17A 4X1KB 4FYXA 4XGKA 4YAJA 3CZMA 4AZWA 5JVDA 3CXUA 4QYIA 4BU1A 5MGNA 1TGVA 4MS3B 4J07A 4JSPC 1TU4A 4KVZA 1WCYA 3OG9A 2E7ZA 4FKBA 1E94E 3G8YA 4IIUA 2WVJA 2H0QA 3SKXA 4AF8A 1AKWA 5CNKA 2PLFA 2FJPA 4ZA2A 3LV8A 5HE2B 4ZOLA 1QZXA 4QO7A 5HDBB 5K3OA 5KQSA 3H8SA 2F64A 3GN1A 4ENVA 4EFKA 4U2FA 2X9QA 5JBNA 5JTTA 1MJGM 2RAUA 3ETEA 1M6EX 1U2TA 5T67A 1V3VA 5LIPA 4Z9BA 3WRXC 3NHPA 4H3VA 1R6BX 4NOKA 1HQYE 2JD0A 1NVXQ 1WUHS 1T34A 1M54A 2HW8A 5K20A 4UM5A 1EZZA 3QE9Y 2PZJA 1DHTA 2AOWA 3UMRA 1Z5GA 2NZWA 3HR4A 3UGQA 4MA0A 3QK7A 3AIIA 5AHWA 1QO0D 3PC2A 4XSHA 4YR7A 3KZKA 4K2HA 3EXEB 5KAPA 2V6FA 4UZSA 1ZCAA 5IUJC 2OEPA 1QKKA 2XBMA 1D4FA 4KQGA 4X1KA 1MO4A 2V0NA 2NO7A 2I3BA 2A59A 4EYGA 3IMFA 3GFBA 2I0FA 1RW4A 1IUNA 1PSZA 1DKLA 1UZAA 2B2CA 1VKJA 2FEPA 2QJRA 4QBFA 3I61A 3EXAA 2PH7A 1GG2B 4BB5A 2F3PA 5DT2A 5KKCA 4PHFA 4MS3A 4ZCTA 1QQTA 3RGWS 4MP6A 5AHXA 3VISA 2GI4A 3MJVA 2UVDA 2H9IA 3VSAA 3SC4A 5BOVA 1M2VB 3E8MA 3VR3A 1W9MA 1WSWA 4YJKA 1DAIA 1U7HA 1Q5PA 5G0WA 1U3CA 1RFGE 5HDBA 1IXRC 1FLAA 1T9CA 1JQLB 3EVZA 1VYHA 2R84A 3ZWNA 4RXTA 4A26A 5J4YA 2GZ1A 4OQMA 2EIHA 3CM0A 2YASA 1UQTA 1V37A 4A0HA 4NMWA 3OD1A 3HV2A 2ZYGA 1BG6A 4F9FA 2OVFA 4L50A 1ZGJA 4XUGB 4EKDA 4QTYA 4M9QA 4R71A 4YMVA 2V0GA 1GZVA 3DMNA 3I5MA 4FK8A 1E3WB 5I7HA 1D9ZA 4R2JA 1P9NA 1MORA 2G80A 4X9XA 5FHQA 3EXEA 4WECA 1Z74A 4R7ZA 1U9IC 3H6HA 1ODKA 1WULS 2OCLA 2PTHA 1UK7A 1MOSA 3RHSA 4IGEA 3R3ZA 3WK6A 1NW6A 2OZKA 3NVNA 1RIFA 1E89A 3SHQA 3SFVA 2QSJA 4QAMA 2JASA 2Q5QA 2N3ZA 1GG2A 4UPDA 1MAVA 2IDMA 3GMSA 3OFKA 1W96A 1X7HA 5IUKC 2Z8XA 3KKEA 2B30A 3I1IA 4UU7A 4CFZA 2C4HA 4GE0A 2Z2JA 1M2VA 1EGAA 3RI3A 3UPUA 3QPAA 3MERA 1T5SA 1UKCA 4C4OA 1XQ1A 4NPCA 2WJIA 4J0KA 4EO7A 3FFXA 4FB1D 3CLVA 3TR6A 5D6OA 2V96A 4MKRA 1L9KA 3SMVA 2IH5A 4ZKDA 4IAOA 3IKTA 1B8UA 3RW9A 1RTTA 3WVNA 3TIGA 2WUVA 5HKBA 3OCCA 4W82A 2IXFA 4FFPA 3JD3A 4Y2QA 1Z7YA 1P1FA 4LDPA 3STHA 3TQFA 1OGIA 4V3BA 5AKKA 4NAHA 2Y1OA 3H4IA 3LBNA 3FNFA 1E3WA 2FZEA 1LTKA 3HR7A 3D6FA 4XM0A 3Q41A 1HYHA 1PLKA 4EG6A 4D4KA 2YVUA 1XKTA 3EMHA 2J1LA 2EIDA 1PEVA 4YCDA 4QYXA 3K30A 3I7KA 3MF4A 1H8EA 3TEMA 1SULA 4JUBA 1GL3A 2AJTA 1SBNE 5A5FA 1NZJA 4ONEA 1JHOA 1OBFO 3SLKA 1IVNA 1NPYA 3BXHA 1VJDA 4CN8A 3KXKA 1IXKA 3M1YA 4JI4B 2OYSA 1CDDA 3ZZNA 4KWTA 5DYWA 4PNZA 2FFRA 2WD8A 3JS5A 3HDQA 2YR0A 5KPDA 1NYLA 2IUVA 3SLED 4D02A 2ZE5A 1RNLA 1TTQB 2NV6A 3QU7A 3TW0A 1P9RA 4JZYA 5T8KC 1Z38A 2IYPA 4QOFA 3K9CA 3NHMA 3G0BA 1LLFA 1XQYA 1W4RA 3IOEA 4LJ6A 5DXJA 4HQ0A 5LJLA 4K6MA 3RWBA 1PTKA 2F8SA 1PR2A 2OBXA 2QX6A 4B6GA 4GMDA 1H6BA 3ZQKA 2CEAA 4IQ0A 5DHQA 1BH6A 1NVTA 2CXQA 2IURA 1HETA 4J7UA 4EDHA 4GR9A 5LQUA 3E1KA 2VF5X 1XF9A 2QSUA 3CVXA 2JKXA 3SQNA 4F1KA 5C81A 3MT8A 2JLZA 1GP2B 1WE2A 4F3RA 3CKMA 4IPTA 1RKVA 4X0EA 4AVYA 1I2MB 3MWEB 1YA4A 3FJ1A 4C20A 2ONKA 5BN5B 1VMKA 1KY3A 2F7SA 1BFUA 4M8SA 1C0IA 3F96A 3IEIA 2I4MA 1WB6A 3S29A 3FZYA 4UE3S 5FFFA 1JJBA 4B3IA 2G9VA 3ELUA 1JJFA 2ALJA 5IAEA 4ITRC 1WBJB 1C9NA 4B3BA 4DVGA 4OCZA 2IWKA 2GZ3A 1LQ2A 4P4GA 5H1YA 5J4HA 3K32A 1UBNA 3E03A 4NMLA 5KDOB 2O8CB 2QRUA 4JSVC 3WLEA 1XTZA 4R2WA 4ZGGA 1XVTA 5A62A 4JX8A 3FYTA 3NDBB 1BVHA 3SBRA 1XRMA 3KL4A 1PJAA 1B74A 3ZK7A 4Y2PA 2CKMA 3R6GA 1YRAA 1KO1A 1FUYB 3S5UA 2PQ6A 1JIUA 5DU2A 1R0RE 1MT0A 4KXVA 3B1JA 3WQBA 3QBTA 4KAAA 2F55A 1KMMA 2VF4X 3LUPA 1U0SY 1S8AA 5FFNA 1IOZA 4IUDS 5LU9A 3OO0A 1TLTA 4FEEA 4HLCA 3IE1A 4BJ3A 4PWZA 1CUYA 5AT1A 3OF5A 4A08B 4UBLA 4QDOA 1XK6A 6Q21A 4XJSA 5GONB 2CBGA 4K0KB 5G2OA 1GP2A 2FSIA 4ZXPA 4LVUA 1FRZA 3GRKA 3DMRA 1I2MA 4ZO8A 3SX2A 3MWEA 1JRLA 4GD3Q 4ZYYA 3HA7A 5BN5A 2P8JA 1QBGA 4HBZA 1GDDA 3OKYB 1MAAA 3VU8A 3ENZA 3CS3A 1EUCB 3QU2A 2J46A 1GTSA 2I4NA 2NM0A 4IIYA 3COPA 2JVIA 3V3KA 3B6KA 5C35A 1L5ZA 4OQNA 3I4FA 1ANKA 2AC7A 3L7IA 3QVSA 2HEGA 4CR8A 3TO5A 2VDJA 1HSZA 1JW9B 1Y6ZA 4OMDA 5IDWA 3OWHA 3N58A 2I9KA 2HIAA 4HWTA 5H68A 1O94C 5LOVF 3OCYA 5KDOA 2O8CA 1HH4A 4AO7A 1PF7E 4RL4A 4UMFA 3NHRA 2I6TA 2QAGC 1OY1A 2B0JA 2Z83A 4NG4A 3BT7A 1Y4AE 3IJRA 5GIOE 3A10A 2G1UA 3Q8KA 5I3ZA 4BLUA 4OHUA 3IUSA 2ORYA 5DGIA 2ZIGA 2Y1FA 2X5NA 3BAZA 1IQPA 1FPMA 1Z12A 3Q7RA 5FPPA 1XN1A 4O3UB 3NIGB 1L5GB 3W1WA 4FFWA 4EUFA 3QEAZ 2ICAA 2BMFA 4ZPJA 1ZOSA 4A08A 1RHJA 2BMWA 3N2NA 3X2FA 1JMKC 1X9GA 4G97A 4CV0A 3UCEA 2P9QA 4ZOVA 3TL3A 5GONA 4ZVPA 1I9GA 3WZMA 3OJCA 4IMJB 1YK1A 1ZU4A 2ZCJA 5ISMA 5K0EA 3AEYA 4F96A 2ZXUA 2R7LA 4KWHA 3R6WA 1K27A 3OKYA 2I4IA 2OBFA 3PEUA 2VK2A 1EUCA 4IWXA 3ELWA 1O0BA 3FCYA 3RRNA 3FKSD 4A6EA 4U6SA 5CLHA 5DNVA 4M37A 1SHKA 2FWJA 2R6R1 3PUHA 1E2NA 5AP9A 2V7TA 1YR1A 5LQAA 1ZIDA 5EQJB 5TQVA 3KLNA 4MS4B 4NCKA 3BWCA 3CVUA 3AI2A 3ROXA 3MRXA 3ZQUA 4R6XA 4YPOA 3JTEA 4U7WA 1CK4A 3W3ZB 3OIYA 3RS5A 1DAMA 1E9EA 3IBGA 3W5AA 1PFYA 1XE3A 2NADA 4JX9A 4BQPA 1DZ3A 2FCAA 2IEZA 2B35A 5KTMA 3OFND 1OXTA 5H7XA 3T1TA 5IJWA 1J24A 5LYYA 3LO8A 2OFFA 3VPDA 1U0NA 2PL5A 3QKRB 3RB8A 2R2GA 2RHTA 3AGQA 1D0SA 1GXRA 3NIGA 1L5GA 1BU8A 4Q1AA 4G0NA 5D84A 3UAGA 4P22A 1UK6A 1USIA 1BU5A 4ZDKA 3VHXB 1P74A 3R3YA 2YVAA 4ZZ1A 1QYVA 2O2EA 4FZ3A 1J8DA 3UXYA 3NWPA 5IP5A 1DIHA 4PE5B 4EUEA 2IZ0A 4DV0B 3SZ3A 1E5QA 3RQIA 1B9YA 4IDEA 4XYIA 5B58C 4M0CA 4K87A 1TUGA 1T8TA 4G63A 2GEFA 4N6NA 1CUIA 1HDRA 2VI5A 3MRVA 1L5RA 5J3JA 3TJRA 2WMDA 4NFSA 4W99A 5H3HA 2Z9BA 1V5GA 2H07A 1ZNXA 1V71A 2PVCA 1QZUA 4ER7A 1QP4A 1IG3A 1E99A 4FB5A 4MS4A 4C6RA 3KG2A 4W5NA 3AEQB 4U5XA 4KRXA 5HUJA 3ZHYA 3S2GA 3PDWA 2D13A 2D7CA 3A0FA 5G0UA 4IUYA 1C7QA 5AIBA 3LVBA 3LL4A 3GLTA 4Q4HB 2P0EA 3I7HA 2AC2A 1P0QA 5JYBA 3QKRA 3T9DA 3B9RA 3T8YA 3QGMA 2QC5A 2LCIA 4KIUA 2C04A 4ZYZA 5IABA 2OBYA 4L1QD 2J31A 3YASA 4DZZA 4JL8A 3EEOA 3VHXA 3IRUA 2JIZA 5CDHA 3GLGA 3GEIA 4TXHA 4PQEA 1JEAA 3B6MA 1E3LA 2IZZA 2Z8ZA 3LYUA 2AGWA 4K9DA 3W05A 2QZ4A 3QPWA 4EHNA 1FFAA 1E0DA 1RJEA 4ISCA 5ITZB 1XTIA 3SXUB 4V1CB 3MAJA 1GY8A 3DT8A 2R8BA 3M4NA 2V58A 2DU8A 1T36B 4A4DA 5DLEA 1PNRA 4NONA 4L7QA 2C4UA 1X8KA 1R0KA 2D0OB 5JAIA 4M0PA 4BO1A 3TSOA 4YMHA 1REQA 5SZJA 1GHTA 3KFXA 3I12A 4UHEA 3HZRA 2YWRA 1DKRA 3OOYA 3AEQA 4UUOA 3SP1A 1K89A 1BE8A 2RHGB 4M99A 4DNVA 1EWKA 4OK5A 2YH2A 2FPRA 2YZ2A 4FONA 3ZC3A 3M0EA 1PV4A 2IS1A 4Q4HA 5AKEA 9ATCA 4ZYVA 4JBYA 1U0HC 3IAUA 1F8FA 2H5EA 2ZS8A 3W7AA 4PCUA 1MLDA 3DA8A 1HDGO 4X7RA 4J2HA 3BXGA 1DNPA 4BATA 5TEWA 5CIWA 4QT0A 2V7XA 3HEAA 2WKWA 1ULTA 3E61A 3GHYA 3SAJA 1BQEA 3CGWA 4IDFA 3BQ9A 5K4GA 4HAXA 1XTJA 2FLWA 1UKEA 2XDYA 1U9IA 4FFSA 2VXBA 5KWIA 5JWHA 3O94A 4BMDA 1CQPA 4B3JA 3URKA 3TNFA 1XB2A 2NZVG 5BSRA 2I65A