1YR2A

Structural and mechanistic analysis of two prolyl endopeptidases: role of inter-domain dynamics in catalysis and specificity
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
701
structure length
680
Chain Sequence
PPYPASPQVPLVEDHFGEKVSDPWRWLEADVRTDAKVAAWVQAQSAYTAAYLKQLPERAALEKRMKALIDYERFGLPQRRGASVFYSWNSGLMNQSQLLVRPADAPVGTKGRVLLDPNTWATALDAWAASDDGRLLAYSVQDGGSDWRTVKFVGVADGKPLADELKWVKFSGLAWLGNDALLYSRFAEPLNYNQTVWLHRLGTPQSADQPVFATPELPKRGHGASVSSDGRWVVITSSEGTDPVNTVHVARVTNGKIGPVTALIPDLKAQWDFVDGVGDQLWFVSGDGAPLKKIVRVDLSGSTPRFDTVVPESKDNLESVGIAGNRLFASYIHDAKSQVLAFDLDGKPAGAVSLPGIGSASGLSGRPGDRHAYLSFSSFTQPATVLALDPATAKTTPWEPVHLTFDPADFRVEQVFYPSKDGTKVPMFIVRRKDAKGPLPTLLYGYGGFNVALTPWFSAGFMTWIDSGGAFALANLRGGGEYGDAWHDAGRRDKKQNVFDDFIAAGEWLIANGVTPRHGLAIEGGSNGGLLIGAVTNQRPDLFAAASPAVGVMDMLRFDQFTAGRYWVDDYGYPEKEADWRVLRRYSPYHNVRSGVDYPAILVTTADTDDRVVPGHSFKYTAALQTAAIGPKPHLIRIEPIDKQIEETADVQAFLAHFTGLTPRPWSSVDKLAAALEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Mechanistic Analysis of Two Prolyl Endopeptidases: Role of Interdomain Dynamics in Catalysis and Specificity
pubmed doi rcsb
source organism Novosphingobium capsulatum
molecule tags Hydrolase
molecule keywords prolyl oligopeptidase
total genus 199
structure length 680
sequence length 701
ec nomenclature ec 3.4.21.26: Prolyl oligopeptidase.
pdb deposition date 2005-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00326 Peptidase_S9 Prolyl oligopeptidase family
A PF02897 Peptidase_S9_N Prolyl oligopeptidase, N-terminal beta-propeller domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.120 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Prolyl oligopeptidase, N-terminal domain 1yr2A02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1yr2A01
4Y2PA 3WKCA 1RYYA 3S2ZA 3WK4A 5ALOA 5ALKA 1MX1A 2O2HA 4Q1VA 5AM1A 3PUHA 2GYUA 4AX4A 3M81A 3VXKA 3VJKA 2DR0A 4KE6A 1CQZA 5CT8A 5K3FA 1WHSA 2Y1KA 2ZJFA 1LZKA 4UHEA 2W6CX 3C70A 3D3NA 3D59A 4F60A 1YAHA 4KE8A 2D0DA 5EI5A 4F0JA 3ESDA 4FLFA 3FLAA 4PW0A 2VF2A 4TPKA 4WDRA 5AKJA 5LZ2A 2JEZA 3WYNA 2C0PA 2ZJ6A 3DLTA 4EY6A 1J07A 1R9MA 1LLFA 5DYYA 5LZ7A 1CUZA 2JGKA 1F8UA 1LNSA 1U8EA 3D0KA 1E8MA 5ALYA 4GHWA 3PE6A 4UBNA 4UBIA 1SOMA 1E5TA 4GDMA 5AK3A 5AOCA 5IVDA 3Q8WA 3F98A 3CCBA 3JW8A 2VJDA 2G4LA 1JT2A 3TRDA 1BRTA 2CJPA 3I1YA 1CUBA 1R1DA 2D5LA 5AJHA 1YB6A 5IVKA 4B7ZA 1ISPA 4BATA 4X3CA 1EX9A 2VEOA 3W04A 4BB0A 1YA4A 4G4JA 5ALIA 4N8SA 3I6MA 4BYMA 3ESBA 1BROA 5JATA 5EGNA 3OOSA 4IQ4A 1OCEA 5C81A 2XMRA 1UXOA 1PV1A 1ZIYA 2PL5A 4K5QA 4BDTA 1XLVA 5E4JA 3O4JA 4UBLA 2C0QA 4P9NA 1JJFA 1QIJA 5EHQA 1THGA 5HF5A 1H22A 2DFPA 4YASA 4H7DA 1YCDA 2ACEA 2BKLA 5K3FB 4AO8A 3G0IA 3UMJA 1EI9A 1SCIA 5K3EA 2DHEA 2GZSA 2WIGA 5AOBA 4PV7A 3PDCA 1HLGA 1KU0A 5T4FA 1EB8A 2WQZA 3C6XA 4HXEB 1CUJA 4QLAA 3RKSA 3M82A 3H2IA 5FPQA 2XMQA 1ZD2P 5BWCA 1UT6A 1D07A 4IH9A 3UUEA 5HZGA 3HLKA 3WI7A 4N8DA 4CCYA 1Y7IA 4G9GA 4Y2YA 3SC2A 4A5SA 1WPRA 1N5RA 2XE4A 4FHZA 5AI9A 5JADA 5KWJA 1CVLA 3LLCA 4OSEA 2J4CA 4ARAA 5HF9A 4RNCA 1BE0A 3G9UA 5AM4A 1QIIA 1FFDA 2YYSA 2DHDA 1G66A 3NOXA 4DNQA 4QEKA 5DYWA 2I78A 1WB4A 7YASA 3FSGA 4GXNA 1ODSA 5HKAA 3L1HA 2VQ6A 3GA7A 5AICA 2WTMA 1HDEA 2BUCA 3QH4A 3H2JA 1IUNA 5AM0A 3C8HA 1JI3A 3GROA 4B9AA 4EY8A 2O7RA 4L9AA 1VKHA 1AC5A 3KOOA 3GBSA 1Q0RA 4G5XA 1K63A 3STVA 3L1IA 2ES4A 1FFBA 5AI0A 5CW2A 2BUAA 2VA9A 2ZSIA 4WDQA 4B80A 1FJ2A 2VAVA 1YAJA 1YB7A 2ZYRA 4QLOA 5JD5A 3FNBA 1ZD3A 4CIAA 4EUSA 2ORYA 1MU0A 4OYYA 4PSUA 5IVIA 3W05A 2R11A 4W63A 5A7GA 4WY5A 2BUBA 5ESRA 4Q3OA 5HQ3A 5AKGA 4CCYB 1R3DA 3H1BA 1EHYA 5T4BA 3WL7A 1QIGA 2H7XA 4IO0A 1AURA 1G42A 4G8BA 1JMKC 4DMHA 4PF1A 4DNOA 4X7BA 1JJIA 3WA7A 5JD6A 4I4CA 4FTWA 3PFCA 4DYHA 4ZI5A 3LIPA 5A6VA 2BGNA 2IIVA 1Q0ZA 3A2LA 5DYTA 3LS2A 1A7UA 4GWLA 2JGIA 2NW6A 2QMQA 3JWEA 4Z49A 3BIWA 3EF3A 3WLAA 1EA5A 1LPSA 1UOQA 3FYUC 2Z8XA 5K3CA 1XZEA 4K6KA 2XQGA 3AZPA 4G9EA 3BJMA 3FSGD 3WKBA 2WG1A 2AJCA 5JZ9A 5FOQA 4MQLA 1EXWA 2JIDA 4K6GA 4AO6A 1HPLA 1JU3A 5LZ5A 4KAAA 1P0PA 3H2GA 3G7NA 4A23A 1F0NA 3STYA 5E2IA 1XFDA 3QMMA 4C4YA 2VAXA 2Z5GA 1QIKA 1X2EA 2CKMA 3KWFA 4O08A 2P8SA 2XMSA 3PUIA 1N1MA 3WJ2A 2AJ8A 3H19A 4MJ3A 3ICWA 4TVKA 1CEXA 4H35A 4X95A 2WJ6A 4Y2QA 1F0PA 4OUKX 4KE9A 2ROQA 1XLWA 4QA9A 1L7AA 5A2GA 2RONA 1LBTA 2OGSA 4W9RA 3AZQA 1W75A 4RE6A 3AIMA 3G02A 1WPXA 4MYDA 2B61A 3H2KA 3IULA 4GBGA 4X91A 3W9UA 3C87A 1XKTA 2RAUA 4HZGA 4EY4A 2H1IA 2Z3ZA 5HK8A 3IBTA 3GELA 3WKAA 3LCRA 1M33A 4N5HX 3WKEA 1NU8A 2XMCA 3DOIA 2WIDA 4OU4A 1A8QA 1H2XA 1QIMA 4JUIA 4I19A 3ED1A 3Q0TA 5ALXA 1LPMA 3BF7A 5ALMA 1CFJA 2WUFA 3G9TA 4FDMA 4XJVA 5ALTA 4GI1A 5KBYA 4G8CA 2QTBA 3WK8A 2WKWA 1AGYA 1QJ4A 3R3WA 4K6HA 1CRLA 2K2QB 2XUQA 3DQZA 3DNMA 5DJ5A 1CV2A 1GPKA 3LP5A 5BWBA 4Y2RA 3BIXA 2WSLA 2XUPA 4NS4A 1HKHA 1BN6A 1J06A 2JBWA 2Y6VA 3R3VA 2HA6A 4UBOA 2JGMA 3WIOA 2OQVA 5CT6A 2HHAA 4DNPA 2ZJ7A 3STTA 2VJBA 3STXA 2WU4A 2HA3A 1QFSA 1CUFA 1VJ5A 3WWEA 5AK6A 4WJLA 2HIHA 1W76A 1KU6A 2X5XA 4U2DA 1T4MA 5ALLA 3B5EA 3A6ZA 4TGLA 4XWGA 3VJLA 1LBSA 1YS1X 2IX9A 2PUHA 1AKNA 2C58A 3JYHA 2QZPA 3FLBA 4KACA 3F67A 3UUFA 2GBGA 1CQWA 1XRQA 1TKRA 1YASA 1UOPA 1EVEA 5E4TA 3V1NA 4UBKA 5AM3A 3IB3A 2JGEA 1A8UA 4B0OA 1USWA 1GPNA 4QWMA 2WTNA 1XZKA 3C6YA 2QUAA 3RLIA 2CZQA 3PI6A 3GZJA 5JASA 1TRHA 1PFQA 1R4ZA 1NX9A 1EK1A 1UZAA 5FPPA 5AH0A 3EBLA 3H17A 2OAGA 5AHXA 1AMNA 4GEGA 1MNAA 4A16A 5I7UA 2QR5A 2XLBA 3MVEA 1CUCA 4BTVA 2DQYA 4Y2XA 5AK4A 3D7RA 3EIOA 3QYJA 4KAFA 2VATA 3X3HA 4C4XA 2DSNA 1L7RA 3I2JA 1DX4A 3F9CA 3DL4A 4UHHA 4DMKA 1XQXA 5FP0A 4X6YA 1MJ5A 3OC0A 5HKBA 3IUJA 4H18A 3QPAA 4CG1A 5ALUA 3G0GA 1XZLA 4DNFA 1GQRA 4UHBA 1YSCA 4J0CA 3OG9A 3ZV7A 2HU8A 1WCYA 2OXEA 5BOVA 3T4UA 2ZVDA 1O6FA 2JGJA 2GBCA 4HVTA 2WLSA 1JJBA 1XZIA 2GYVA 3DKKA 2QUBA 4W1SA 1XZFA 3SK0A 1CUDA 2XB6A 2XMDA 1ZD5A 4J0GA 4JNCA 3R40A 1EVQA 1LPNA 2PSJA 4P92A 1XROA 4PO3X 4EY5A 2PU7A 2JGFA 1BCRA 1X70A 3O0DA 5A7FA 4QDUA 1H2ZA 5A7HA 1U4NA 3ZI7A 4Q3LA 4Q3KA 3B3QA 3QVMA 3MUNA 4DLNA 3KSRA 3H0CA 3PF9A 1CLEA 1TIBA 1RP1A 5ALFA 2ECFA 1RWQA 5AP9A 3STUA 1VXRA 2WHPA 1IUPA 3ZWQA 5LIPA 5D3KA 1DT3A 3QPCA 4QZVA 3WWCA 5D7BA 4QWWA 2GZRA 1XZJA 2ACKA 1ZI8A 2B9VA 2WIKA 3I2HA 4PSCA 4Q82A 2C5GA 2AJLI 3GUUA 2QKYA 2YXPX 3HI4A 1E66A 5CT4A 5EHNA 5LLSA 4FBLA 1NU6A 3AILA 5ALQA 1E3QA 2VJCA 4U2EA 1ZJ4A 2EEPA 2I3DA 1GKKA 3BXPA 5AKLA 3NWOA 5CXUA 1ODTC 1DINA 4ZWNA 1CUSA 3F8SA 3V9AA 1U2EA 4FLMA 5FUMA 5AIAA 4XIIA 2WFLA 2Y2UA 4ROTA 1IUOA 2C4HA 3YASA 1K4YA 1XZBA 3ZLTA 3FOBA 2CMFA 1HQDA 1TQHA 1YR2A 2EDAA 1O6GA 1QIFA 3AFIA 1CUAA 4MWSA 6YASA 3WK9A 2EDCA 4DSZA 1QIHA 2AJBA 2I3ZA 5D6OA 1OXMA 1TCCA 2RIPA 5ALRA 4JEIA 1ZD4A 4RE5A 2OCKA 2XUFA 4PQEA 1H2WA 3C5WP 4AMZA 4H7IA 2XUJA 5C7YA 3ANTA 1A8SA 2CEKA 3V48A 3FBWA 4B0PA 3V1MA 2DHCA 2CB9A 2XLCA 2BJHA 3D2BA 4E11A 4H77A 3PF8A 3W06A 2G5TA 2VJAA 5EHXA 5DNWA 3HXKA 2H7YA 4P93A 4BAUA 5EIHA 3WZLA 2Y6UA 1ODCA 1LPBB 1SCQA 2OGZA 5HK9A 4HTAA 2O7VA 1VA5A 3I6YA 1CUEA 4FNMA 3HC7A 4N8EA 3W9BA 4AZ3A 1EDBA 1XRNA 1CR6A 3FVTA 4LHEA 5JAUA 1XZGA 4YK7A 2DQZA 3WYDA 4ARBA 5I9IA 5LKRA 5DLPA 1BEZA 1TCAA 4Y2JA 5EHZA 5FV4A 2QRUA 1XRPA 1XZHA 4BCCA 1VZ2A 1H23A 3K2IA 1WHTA 1GQSA 3HYSA 4X92A 4DSAA 4UFOA 3IURA 1BN7A 2BFNA 2J3DA 3CN7A 2RHWA 3MGAA 2XMBA 5AI8A 3U0VA 5DNUA 1W1IA 5AI6A 3SX4A 3V1KA 4E15A 4J3JA 5CT9A 1BEEA 4BCDA 1DWOA 1MX9A 2XUKA 1QO9A 4ITVA 4HXGA 1LPPA 4LIPD 1WOMA 1EDEA 2BCEA 5FXMA 1CUXA 4CCWA 3NGMA 4U2FA 4Y2VA 1T2NA 3A2MA 4J0IA 1E8DA 1R9NA 2HRQA 3BDIA 4J0HA 1QO7A 4IH1A 3I1IA 2WJ4A 2QXTA 1LPAB 2WFZA 5ALZA 4JYPA 5BV7A 2E3JA 4Q05A 1W4LA 3D4LA 4AXBA 3H1AA 5C8ZA 1WM1A 1K5PA 4EZIA 4LYDA 1ZGBA 4WCVA 2JF0A 5AIBA 1P0IA 3N0TA 1XQWA 2B4KA 1HL7A 4OB6A 1ZJ5A 4CG2A 2XUGA 3O9VA 3TGLA 3WJ1A 1VE7A 3ZLUA 1CUVA 3CXUA 3I2KA 4C87A 4AN0A 1VXOA 4Y7DA 4BE9A 1CUIA 4UBMA 1R88A 2BGRA 4QDZA 1DTEA 5EIAA 1MX5A 1IVYA 5ALEA 2HA7A 4Y2SA 4M0FA 1AQLA 3HEAA 4AMYA 4KRYA 2LIPA 2OGTA 4BVJA 3D5EA 3WK5A 5AKZA 2HDWA 2XUIA 3VISA 3WK6A 4E46A 3G9ZA 1XRMA 3G9XA 5AI4A 3O95A 1XRLA 2YASA 5HF8A 2HA2A 5K5EA 3FAKA 4EY7A 2OG1A 4E14A 1XRRA 2QJRA 5AK5A 3FWHA 3WWOA 4OU5A 2PKYX 5JAOA 5AI5A 1ZI9A 4AQDA 3FYUA 3DDUA 4JH0A 4OYLA 2PU5A 1B41A 5JD4A 1SFRA 1EINA 3BL8A 1MN6A 5CMLA 4B6GA 1QLWA 4B85A 3IUQA 1CUYA 4H7JA 3E1GA 4X00A 4MEAA 1FFAA 2O2IA 1GXSA 1QFMA 1GT6A 2BAGA 3K9BA 4M0EA 4QNNA 2Z3WA 4ETWA 1F6WA 5AM2A 5FLKA 4BZZA 3NUZA 4BCBA 4UHDA 3R3UA 2WIFA 2Q0XA 4QDXA 3G0CA 2XT0A 4AN1A 2I03A 4BVLA 2H7CA 1LGYA 3R3ZA 4CFSA 5HCUA 4BVKA 1IZ8A 3BF8A 2GBIA 2XUDA 1MPXA 2QT9A 1A88A 4LXHA 3ESCA 3OTQA 3G0BA 2XQKA 5ALDA 4H7EA 2WFMA 5AO9A 5ALVA 2XUHA 4W1PA 4DM7A 4OB7A 2X76A 5CTAA 4IH4A 1EK2A 2AXEA 4U2CA 1E89A 4AZ0A 2Z8ZA 3R3YA 1FFCA 2WU3A 1XZCA 4M0MA 1UFOA 2PSHA 4UUQA 3DYIA 1XZMA 5SYNA 4K2AA 5HF6A 4C88A 3AJAA 2PUJA 4X93A 4HXFB 1L7QA 3L1JA 5HQ3B 2PBLA 1XKLA 4D9JA 4GECA 3IA2A 4YX9A 4DTCA 1DX6A 3ILSA 1CUWA 5JALA 5EIEA 1ORWA 5JAHA 4UFNA 3HZOA 3QBJA 2WFLB 1CPYA 3VVLA 3D2CA 3KWJA 4BC0A 2VT6A 2WHRA 4DIUA 4WFJA 3F96A 3DS8A 5FRDA 5LYYA 1G5FA 1XQVA 5K3DA 4CIBA 4MWTA 1ZI6A 1ACLA 2V97A 3R41A 5CH3A 1K6EA 4UBJA 3KXPA 1LPOA 1QIEA 4KE7A 3WWDA 4CG3A 2QS9A 5CH8A 3EQ7A 2OQIA 4F21A 1ZOIA 4V2IA 4FFVA 5T4EA 5AKXA 1DU4A 2QXUA 2HFJA 3OURA 3VDXA 2VT7A 1HBJA 3PFBA 5LZ4A 3R3XA 2V9ZA 1EDDA 3WKDA 1OILA 1X2BA 3KD2A 1XLUA 3M3DA 4C6HA 4LKOA 3C8DA 2WHPB 2XMZA 1FSSA 4FNGA 1CUUA 4XVCA 5YASA 4KAJA 2OCLA 4PSDA 5AKEA 2HU7A 3FYUB 3I2GA 1MT3A 1UWCA 1VOTA 1XZDA 2XQIA 1J2EA 3IIIA 2GBFA 5C8XA 4G4IA 4NZZA 5JARA 3W2TA 5EFZA 3A2NA 2FX5A 3F97A 4U2BA 4GW3A 1UKBA 2V98A 4NMWA 1UKCA 4FMPA 5JAPA 3AUKA 4J7AA 3C6BA 3VVMA 3IVMA 5CURA 5LZ9A 4L0CA 4C89A 3FCXA 4B84A 3AIOA 1C4XA 1DWPA 4GLBA 5AKKA 3DD5A 3BE8A 2OPHA 3WZMA 3A70A 1P0QA 1IZ7A 1VLQA 5JZBA 5LKAA 1Q84A 5CT5A 3VKFA 5IKXA 2ZSHA 1GZ7A 4KR0A 2PX6A 5ISMA 4DMFA 3BWXA 3E3AA 1G4HA 4G1FA 4QE3A 3M83A 4BDSA 2FJ0A 2RI6A 4JYMA 2HFKA 4NVRA 2PVSA 4J0KA 3O4GA 4BP8A 1Y7HA 1N8SA 2OAEA 4G4GA 1UK6A 3BJRA 1TAHA 3HRHA 1JMYA 1UK9A 3IUMA 4ZREA 5ALGA 3R0VA 4DMCA 4J0DA 3DL7A 1QTIA 4ZXFA 4X85A 3BDVA 3IUNA 2HADA 4X97A 4BRSA 4UHFA 5A71A 3HSSA 1PJAA 1JKMA 2FUKA 2XQJA 3STWA 5HFAA 3K6KA 3H04A 4AB1A 2PM8A 2W22A 2QM0A 4ZRDA 3G8YA 1XQYA 4CI9A 4P08A 2HL6A 4WY8A 2G5PA 4OPMA 1E8NA 5CXXA 2RGUA 3O4IA 3KDAA 3OPMA 1QOZA 4J0JA 5DTJA 3DKRA 5ALNA 1FFEA 4OCZA 4EBBA 5A62A 3RM3A 3C6ZA 3T52A 1N5MA 3I2IA 3CCCA 2WHQA 5JYCA 3IDAA 3WL5A 4L3WA 2WIJA 2IITA 5AKYA 2ONCA 4FFWA 4B9EA 4B81A 5ALHA 4L72A 5LP1A 4C4ZA 4PNZA 5LZ8A 4C01A 3PICA 4OB8A 5DTIA 1JFRA 1C7IA 1R50A 2HA5A 5HFNA 3AZOA 1I6WA 2PSFA 5T4HA 1CUHA 3OM8A 3WIBA 5D3ZA 2Y2VA 2RHTA 1DQZA 1ETHA 4MEBA 3C5VA 3HJUA 1H2YA 1YA8A 3QMVA 4Q34A 5AOAA 1UK7A 4Y2UA 4FKBA 1MO2A 2X8BA 1VE6A 4H7KA 3ICVA 4BAZA 3ESAA 2FJPA 4Y2TA 1QONA 2PPLA 4BBZA 3QZUA 4H0CA 3FCYA 5SYMA 2WM2A 1MAAA 3V1LA 5I8PA 4UHCA 3WK7A 3DEAA 2B20A 1DT5A 4HRXA 3P2MA 1EH5A 4FLEA 1TCBA 3O9MA 1CIJA 1U65A 4MYSA 3VJMA 2YH2A 1CUGA 4ZV7A 2H9YA 2AJDA 4X90A 4UFPA 2WJ3A 2WUGA 5C8VA 3B12A 3C43A 4W1RA 4BC1A 1SCKA 4XX1A 1DWQA 3CN9A 2OCGA 1ORVA 4BRZA 3DJYA 4N5IX 1AZWA 3FVRA 3DCNA 3HACA 1IMJA 3WL8A 5CRIA 4BZWA 3O4HA 2HA0A 1BU8A 1VZ3A 3WMRA 4OD0A 2C5FA 2WILA 4FWBA 4J03A 2CUTA 2PSDA 3E0XA 2JGLA 2UZ0A 4LXGA 5KREA 4MQMA 5AM5A 4ZV9A 1UKAA 1QZ3A 4HAIA 3SWWA 5IH7A 4X6UA 5H3HA 4BAGA 1UK8A 2XQFA 2WUDA 4KRXA 3AINA 2XUAA 4KYVA 2WUEA 4LXIA 2HM7A 4H7FA 4BTLA 3ZPXA 4EA6A 2HA4A 5IVHA 4EB0A 3WA6A 3QMWA 2XI4A 5F4ZA 2ZYIA 4U2GA 1QTRA 1AX9A 2WG0A 1WB6A 2C7BA 4B83A 2OLEA 3ANSA 1XZAA 3D2AA 1GGVA 2R8BA 1Y37A 1TK3A 4HS9A 4KEAA 2ZYSA 2JEYA 4BE4A 4F5ZA 2V96A 1SC9A 3ZLVA 5FKJA 2HU5A 4QDTA 4DGQA 2OCIA 4WFIA 4FOLA 2J3QA 1W52X 3DOHA 1KEZA 1W6RA 3I2FA 5FDFA 2ZYHA 2O2GA 4RGYA 4LYEA 3DYVA 2PSEA 4WFKA 3MUOA 5AKHA 4H7HA 3I28A 3WQHA 2QVBA 3EQ8A 5ALJA 3RARA 3I6ZA 5CH5A 1ZGCA 1ACJA 3RK4A 2G63A 1VA4A 4HRYA 3G0DA 4S0XA 3QM1A 4ZGBA 2WG2A 3AIKA 3H2HA 4MXDA 3HABA 4B82A 2J4FA 5DWDA 1S8OA 1Z68A 2CBGA 3FLEA 1LZLA 2XUOA 5E4YA 1MAHA 4FBMA 1BS9A 1B6GA 2VSQA 3H18A 4X71A 5K3BA 1THTA 3N2ZB 2XDWA 1YS2X 3S8YA 3E4DA 3WWPA 1MTZA 2XMGA 2QOEA 5AKIA 2QJWA 3TJMA 1C7JA 5DNVA 4G8DA 4W1QA 3TEJA 1QE3A 4YPVA 4BP9A 1K8QA 1DQYA 2HRRA 1WB5A 3EQ9A 1ZIXA 3LIIA 1ZICA 4KJXA 1GPLA 5JZSA 1QIDA 5K3AA 3FYTA 2VTVA 1AUOA 5CBKA 5KWIA 5JANA 4AO7A 5J3JA 3U1TA 1QGED 4UPDA 1GKLA 4EHBA 1UOOA 4X94A 4X6XA 5ALPA 2DCMA 3C45A 4QDOA 1EB9A 2GYWA 1J1IA 5ALSA 4IHAA 1MNQA 4RPCA 1Q83A 3GFFA 3WL6A 1BCSA 3QITA 1JU4A 5JIBA 4I3FA 3QPDA 4Y9SA 4INZA 5ALWA 1P0MA
chains in the Genus database with same CATH superfamily
1NXPA 5JJBA 3HN7A 2UZYB 1FWXA 1I24A 3HUUA 4IX9A 4CE6A 4BBJA 3WKCA 1R5MA 1H0SA 1ONNA 4ZMBA 3PUJA 1DDIA 3JQ9C 3INYA 3CLVA 9LDBA 5K8IA 2IPMA 4JP8A 4Q48A 1V9CA 1GXRA 2PX8A 1RYYA 1M74A 2GKGA 3FGOA 4TM7A 1G38A 5ALOA 4Z2YA 1N5JA 1N4DA 2FMHA 4GKBA 4A2LA 2BM9A 5ALKA 1QKIA 1HT3A 2IUTA 3FCUA 2WW8A 2YJ4A 3AVOA 3AI7A 1V11A 4LGMA 4CTKA 2HKRA 3W3AA 4QATA 1EVIA 5F7ZA 4NYIQ 2O2HA 4MV6A 2MOKA 3QWBA 1VI5A 3MQFA 5DHTA 4FC7A 2HTFA 4HB4A 2D4HA 5DBHX 4AUKA 3AR5A 5LXTA 3STHA 2YY6A 4JT2A 3VXKA 5G3YA 5F2KA 3URKA 1MG3A 4Z0HO 1EJ0A 4KE6A 5ICEA 2OD9A 4DV0B 3GJZA 5KX5A 5DISB 1KZ7B 4MB0A 4LNAA 2VT2A 4N0PA 4AWBA 4DM3A 3LUAA 5K3FA 4A0BB 2AW5A 1MEJA 3VTZA 4FYHA 1BFDA 4EAQA 1QHYA 4V03A 4LY9A 1NATA 4QPZA 1Y80A 4G5QA 3PNBA 4DV4B 1PJBA 3D3NA 4LZWA 5KC9A 3NEPX 5MN6A 2GERA 1TTHA 2CGEA 3HUTA 3C7AA 1PJTA 5G4KB 1N3IA 1CJSA 1O96B 1X1QA 2RBKA 4LKRA 4NZNA 4CHTA 4F60A 4S2UA 1D04A 2ETXA 1ZL2A 3KJZA 4JLJA 2G4CA 3EFHA 4ZAXA 1BJTA 4KIFA 3IEVA 1YH3A 3FMPB 4KE8A 1TTTA 1JIQA 3IEUA 3ZHCA 4LC0A 2H3EA 2KI5A 1GKIA 1XEXA 2D0DA 2OWEA 3DBHA 3DULA 3VX3A 3DHWC 3ESDA 1J8QA 1SHUX 1YJBA 2FPWA 3F3MA 3QVJA 4FLFA 4G5FA 3KJIA 4PW0A 4TPKA 5AKJA 3A58B 3AVPA 3DFFA 3MLEA 3SGLA 4JR0A 5M5BA 3RTDA 1IOWA 1GTMA 1A77A 4A10A 1KC3A 1PU2A 2C0PA 3I7OA 2PQ2A 3LCCA 3PDJA 4KMSA 5DW3A 5BRNA 1SVMA 3K09A 2AUNA 3OPYI 1LLFA 1QLHA 2B92A 5DYYA 4INAA 3KYJB 5LZ7A 4OGKA 1NYTA 2JGKA 3ZK7A 3QI2A 3J80g 1YRWA 2FSVA 3D6VA 2FZWA 5AVWA 2J5BA 5B57C 5KI6A 1C5KA 2B7CA 1P0CA 2NPOA 3VH1A 1OVMA 1KSJA 1TAGA 1A2QA 3D0KA 1NMSA 2AFIB 3CUYA 3LWZA 3MS2A 4HWTA 3BRSA 4KRGA 1E8MA 2QMUA 3IODA 2QRHA 3TQHA 3GP5A 2JJ2A 2O8FA 4BVBA 1T15A 3EYAA 4BFCA 4UBIA 3SX2A 4H16A 3RFFA 4E5DA 4QPNA 4EJMA 3TG8A 4CV0A 1ODLA 2P9IC 5HIKA 2WSMA 1IDN1 1NXTA 1TGYA 3B1FA 5AHRA 4CMHA 1KRWA 3MHTA 1IN5A 2GVNA 4I4NA 2XE6A 3TBFA 4PZUA 2UDPA 2VJDA 3INNA 5GVSA 2QNRA 4X1YA 2IVFA 3AH8A 1P7CA 2DM6A 3E23A 3Q3HA 1FFHA 2HYDA 4RY8A 4PRYA 2NU7B 4LJ7A 4DEVA 2A3NA 4GWGA 4PHGA 2LWIA 1SUAA 3DZHA 2D5LA 3CIKB 3R6LA 3BXFA 1NWCA 4UASA 2NU6A 4IDOA 2NUTA 4DE5A 1S0UA 2VZLA 5JECA 1ISPA 3VGZA 4C14A 4WOKA 1R8JA 3QE2A 1VE1A 4X3CA 5EAMA 4F5EA 2HBYA 3B9RA 1M1XA 2VK4A 4S1TA 2JAQA 1IHDA 1D6MA 2GXUA 2NU6B 2R751 4B3MB 4NXMB 1ZY2A 1UJ5A 2FXVA 4GL4A 1L8OA 1PL8A 2VK8A 1BMFD 4MW2A 1DARA 3AFMA 3SSMA 4CMKA 4TYQA 4C7KA 1FQJA 2WSIA 3K6JA 3MBIA 2CNBA 2N0SA 4LMAA 1E1LA 4G4JA 1P6XA 1D1TA 2QN8A 3L7OA 4IWNA 2BLNA 2HBZA 3KKQA 2H07A 5ALIA 1L5MA 3OLZA 1FEZA 1YBFA 2VYNA 3HN6A 3R20A 5JC8A 3DDHA 2GLUA 5EHIA 4FZRA 2J7PA 2UZIR 4FEYA 2DLCX 3OOSA 2NSLA 2CCGA 5I5MA 1IQPA 4IQ4A 4H15A 3TLXA 4CIDA 2B1QA 3NHFA 3UFXB 1RBZA 5H7XA 5HP4A 1MXHA 2EG5A 3R7BA 4XQ9A 4CI8A 4PYQA 1E77A 5CPBA 4ZT6A 1BX3A 4B6FA 2MU1A 2FE4A 4GI5A 5B37A 3ZYCA 4R69A 4RVCA 4P7KA 4DANA 1PKXA 1Y5IA 2E85A 1XLVA 3ONEA 4JJAA 2X1MA 4CKBB 1SC6A 1T6ZA 2AYXA 1IQ0A 3WP0A 4Q4LA 2NACA 1E2JA 2W00A 2ZXFA 2H1HA 2L2QA 1P17A 1GV1A 4ND5A 1V48A 4Z3DA 1V1JA 2UUBB 4CDMA 2HJ4A 1XJ0A 4ZCQA 2NQTA 4BRUA 5F5NA 1RI2A 4Z4FA 1GYPA 4RV9A 1Y3IA 4C76A 2J4DA 4DDUA 2IHTA 1XWIA 3LHIA 3PNOA 4HB0A 3U9SA 3I7LA 2A14A 3VSBA 2GFIA 2YJ3A 3VOAA 4UTPA 5ECWA 4B5KA 3BM5A 5K3FB 2AD5A 3G0IA 1OFUA 3RSQA 1BWPA 2WQ8A 2Q7QA 3UQYS 2NMVA 1EI9A 1DAEA 1ZSYA 3V4LA 2ID7A 3K2QA 4KLZA 1T9CA 3ECSA 1RBQA 2H2GA 5JTUA 1QP4A 1YVPA 5LXTB 2FFBA 2GZSA 3GUZA 2IS6A 4WXYB 2OECA 1MB3A 2WIGA 5DOZA 2JK1A 1WOYA 5AOBA 1N2HA 5K0NA 3QKRB 5E9QA 3DT8A 4K9MA 3NTXA 2O8BA 1FFXA 3NX4A 2BH2A 4GMDA 4QX6A 4U3JB 1UPBA 4B6EA 1Z8DA 4GVLA 4WCFB 3VR5A 2WKPA 4TQ9A 4E88A 4UZFA 4R9NA 4UTNA 3N87A 4DLAA 4EEXA 4JUAA 3T7AA 3WGNA 2RH5A 1ZMBA 2FSUA 4L76A 3C6XA 5DGXA 1IAVA 1CF2O 2OBXA 2Z5VA 3U4AA 4MRNA 4BNIA 2DPHA 1OLSA 5K9ZA 5KYGA 3OT4A 1Z5NA 2E49A 2VDJA 1ZBQA 2I2BA 5H17A 1G7TA 2VXYA 3BD8A 5JQGA 1CSEE 1N78A 4GVPA 3GT0A 4QOEA 3SJ7A 3ACDA 3FMFA 4ZXPA 3R6GA 3IL2A 3DE2X 4RGBA 2E4VA 5HUQA 3VR4H 3EVGA 1ZD2P 2C7GA 2Q2NA 2C61A 2VJQA 5BYKA 2UZ3A 1OX5A 5BWCA 1M2EA 4NK5A 1UT6A 4WA7A 5IG2A 1Z2AA 1UJCA 4N01A 2OK8A 3ZYZA 4NYMR 2XHEA 3DFIA 1T1SA 2NYRA 3WBKA 1PFKA 3PD7A 1HDCA 3HLKA 4BVAA 4F5YA 3OMLA 3JAWB 4C4PA 4DWOA 1IY0A 4MQEA 3I5XA 3FNFA 4D0GA 1Z7EA 1OZFA 3NCTA 4G9GA 2CNWA 4O2AB 2H08A 3U1BA 3KT0A 2XRZA 1N5RA 4QSMA 2QJOA 4D9SA 3AG5A 3BGWA 1AUPA 2DUJA 5KDOB 2MYPA 2Q5LA 3HR4A 4OSEA 4J82A 2XB9A 2NP6A 1L3IA 1VRVA 1NJSA 2NADA 3I9V6 1R5JA 2ECPA 4BMZA 1KI6A 3WGVA 1ZHOA 1GUDA 3ZDZA 3PVSA 4NF2A 4Y9UA 3CPEA 2AHOA 1W4BA 2A8YA 1M1YE 5HSGA 1ZGAA 5HCIA 3I83A 1P81A 4UM9D 4Z1OA 3THWA 4F2PA 1H1LA 2C3OA 2YYSA 3CUUA 4BU1A 2DHDA 5FTKA 3PQCA 2HQ1A 5DTRA 1R0XA 4E5NA 4QEKA 2QTVB 2QE7D 3FBTA 2XKAA 5EAIA 1S8FA 3FSGA 1EAYA 1GZ5A 4GR5A 1EVKA 2JAOA 2BM8A 3B48A 1O9GA 2OYRA 1SNYA 3VPCA 3BT7A 3PRJA 3AVXA 1RQXA 2WJZB 4PZDA 4RVSA 2P40A 2HSZA 3E27A 4DLKA 4TRNA 4ZOEA 2NTYC 1UCFA 1B7GO 1K9SA 1HFEL 1NI4B 1AO3A 2EQAA 3F7TA 3UJ9A 4CKEB 6GPBA 3QEAZ 4JJEA 4DF3A 3H2JA 4Z7JA 4JYZA 5EKTA 3B89A 5JSYA 4C3VA 5J4LA 1SXJD 3EEFA 2HC9A 4GQAA 3GROA 3N2LA 4OGGA 1ZN8A 5LL6P 3MGKA 5E2AA 4RIGA 1OAKA 3M4YA 4YHBA 5K0ZA 1VKHA 3ENWA 3L8ZA 4N7RA 2ARKA 1J24A 2R7KA 5SZKB 4V0MA 4RS4A 3H8SA 2PFGA 4HFJA 2V6MA 4ALMA 3GBSA 1Q0RA 4M99A 1VL0A 4R83A 4CLHA 1HNWB 2ES4A 5GV8A 4EWRA 1FFBA 2FNAA 3G1TA 4KV9A 2SCUB 5CW2A 1W44A 2NUTB 1P2VA 4RVGA 1DQSA 1E9VA 2C4UA 3TIXB 2C7QA 1FMFA 2AEMA 2ZSIA 4WDQA 2EIHA 4LSMA 2ANCA 4B80A 2EJWA 4CC9A 4DUGD 3HZHA 1E1MA 3OTHA 1FJ2A 1GG5A 1Y4SA 2F1HA 2R85A 3PS9A 1UKVY 2IDMA 3TTYA 4FFMA 4YMIA 4ZICA 3MS7A 4RVOA 5JD5A 4E03A 4YECA 5DNDA 5A4KA 1ZD3A 1SAYA 1O94D 3V8VA 1Z9BA 3NKLA 1P4JA 2R00A 2J08A 3RC7A 5HKKA 4CN8A 4PSUA 2B69A 1AKTA 1PLKA 3CEHA 3RNLA 1W0JA 1JEDA 3RF7A 4XYEA 3L8CA 1TVMA 3TLJA 5IAAA 1J2TA 2WF9A 1SUEA 2BGLA 1NQOA 4FJ0A 3UAYA 4Q3OA 4WN9B 2CJYA 1VJGA 3RAPR 1WNTA 1OBVA 5CVJA 4REMA 4P5PA 1NW5A 3U3MA 3RYCB 3M6WA 3WL7A 2GJ4A 3CWQA 1FTGA 4IO0A 3L84A 3LUHA 3PK0A 4LK2A 4G81A 2ZZNA 3QWHA 1YS4A 1SXIA 2VWPA 1TLFA 4FR0A 4BNDA 4PONA 2YMUA 3D7LA 3EZFA 2ID9A 2JFBA 4G3XA 2HRBA 3A8TA 3AY3A 3FHJA 1L1FA 3GN1A 5M5TA 1B8NA 1VSBA 2G1KA 2Y3IA 1HFKA 5B6JA 1NDQA 1FYDA 3IE0A 3WA7A 3V4PB 2IHNA 2F3UA 2R7NA 3CWCA 3IBCA 3NIGA 3PFCA 5ERYA 4BN5A 1RWXA 2AYYA 4JFAA 4CEJB 1SEVA 2ZJ0A 3LIPA 2BGNA 3MA0A 5A6VA 3SFVA 1Q0ZA 3A2LA 4HWGA 1DMSA 4MUIA 4WBNF 1E63A 3ZHRA 1UKZA 2JJ2D 1VLJA 1XTTA 4QYWA 5M5SA 1FYWA 1KJ9A 5DYTA 1C9DB 4DN6A 3OWHA 1QXSA 4QARA 3ESYA 4OX9Y 1JIJA 1GILA 2Q99A 3AMVA 3BIWA 1EUDA 2IUSA 2O2EA 3D6AA 3OPQA 1LSJA 5FEMA 5SZHB 3A31A 2E55A 2HZBA 3UCXA 3WLAA 1OH7A 3QELB 2ZRNA 1TUEA 1Z4JA 2A35A 1Y48E 2PGDA 4C7MA 3DXFA 2Z8XA 5JQGB 3JPWA 1M1ZA 2FDXA 2ADFA 4U7TB 3RGWS 3NVMB 1CX9B 4MKIA 1OI2A 3KQHA 1RRVA 1GL3A 4KH1A 4K6KA 2XQGA 5EWLB 5JXIA 3PPYA 3EI2A 1RTTA 4F56A 4MHOA 2YVAA 9ATCA 2TMKA 3BHJA 3SC4A 1DEXA 2ZJ2A 2IYTA 3ROMA 4P35A 3BMNB 1WMBA 3BJMA 4M9RA 1IK4A 4TMWA 4WLNA 3UVMA 3D8RA 3OY2A 2WG1A 3BG1A 2ZVPX 4HBZA 1N6KA 1P5RA 4I50F 3PFWO 1D2NA 2XBLA 3ENVA 4B2YA 4KW7A 1Y8QB 3HYNA 4RDXA 1VIMA 3C1AA 4TX1A 3VHXA 1U11A 4LXXA 1KAGA 2JIDA 1FUIA 2QR2A 4K6GA 4KQCA 3NGLA 1ZVKA 4ZHQB 5JZOA 1KMQA 3EQ6A 2QY6A 3D9QX 4J1QA 5M61A 4XGQA 4YWJA 5TPZA 3IQGX 4QUKA 1QC5A 4MUFA 1I10A 3UVLA 1ZGZA 1TYDE 1ZK4A 3PQDA 4PE5B 5C5IA 1PK9A 3Q6MA 4DV5B 1SQ9A 1Z4IA 3FCAA 3PNQA 3SS8A 3HKDB 2C95A 5JAMA 2MTBA 5DP2A 4Z4QA 4M54A 1XZPA 1ZP6A 2BMFA 3QMMA 2FLVA 1Q7RA 2L42A 4OKSA 4I9UA 3GCWA 3WGQA 4A2QA 2HXGA 4C4YA 2Z5GA 5G1NA 5KNDA 2VNKA 1X2EA 1R18A 2Q7DA 2O5CA 3E9QA 4PNPA 2OFWA 4O08A 4O1MA 3PFGA 3HJTA 5K03A 1T8WA 2PS3A 4HUQB 4A0AA 4Z9BA 2C2MA 3K0BA 3SP1A 1I51A 4BO7A 1THZA 4CLRB 4ZHSA 3AKZA 1E6MA 4DA9A 2EFYA 1BW9B 1SG9A 2YWFA 5AMXA 5KJCA 5JG7A 1FA9A 1OBOA 2AEJA 3MB5A 1IM5A 2FXIA 2GILA 4MJ3A 4NP6A 4LEIA 4WVLA 3KRTA 4B3DA 5TLSA 3KOWA 4TVKA 3LYAA 1NZDA 2DRIA 4OQZA 1WPGA 4LC1A 5DKFA 4MI1A 1CEXA 4ZN4A 2UVDA 2XWJI 4FMBB 4H35A 4X95A 4B79A 3N53A 1XWWA 2WJ6A 1IATA 2Y0CA 3H1EA 1TJNA 2PKXA 3I8EA 1IEWA 4D0KA 3L8DA 1CQJA 3KJFA 3DNFA 1RZUA 2OAQ1 3G1UA 4ALNA 5JS6A 5BSMA 1A9TA 1RHUA 3OD1A 4QICA 4TV8A 3TM4A 1Z18A 4EB8A 1R0CA 1E9AA 4QRIA 3LW8A 4Z7OB 4HMOA 4AM8A 5HTOA 1XYVA 3ZD8A 1SQGA 2GPNA 2BHNA 1XQ1A 1N8NA 1TUBB 2Z57A 3O31A 1LBQA 1LBTA 1MFPA 2GN4A 1XKQA 1JKIA 3ADBA 4W9RA 2YVUA 1J99A 5EZQA 5CVDA 2B0CA 3FZNA 4Y1EA 2NVUB 2HSEA 3M4XA 2R47A 4BZXA 4DMMA 3OF3A 4QQKA 4ZOAA 5EG5A 5G2OA 4DCOA 1TD1A 4FZ3A 3FNRA 5FOUA 1OJ7A 1YZNA 3LT0A 5AVZA 3G02A 5ILOA 1K89A 3WWYA 1PTKA 5LNK1 4MYDA 4D0RA 5EJAA 4TWBA 4WUVA 2X0EA 4YY3B 1F0YA 2OHJA 4YP0A 1FTNA 4I8DA 4QGSA 3KLMX 4ND8B 1I3NA 1KO5A 2D5BA 5JFTA 2G82A 4MINA 5KDLA 1FU7A 4KQ1A 3C87A 3RI3A 3SQMA 3CF6R 4ND6A 1X86B 2Q3JA 1WUTA 1Y8RA 1EVZA 2DX7A 4F71A 2CFTA 4O45A 2FMKA 1UT8A 3EIUA 5JYDA 3MWKA 4BMCA 2JH8A 1QHHB 1YE5A 3IRUA 4UM9A 4X41A 2YB8B 3ADPA 2B1IA 1AHHA 1P3JA 1NR5A 1H1LB 3L06A 5FBQB 2QV7A 2CT8A 1ETUA 3IJ0A 2VDQA 3K0CC 4XWAA 1FDSA 3T9BA 4Q00A 2WAMA 1PEDA 2NV2B 4Q37A 1FS4A 2ZJOA 1YJ8A 2C2ZA 4N5HX 4MRAA 1KP3A 4E30A 4BWVA 1YK1A 4G1BA 4S1PA 4KL8S 4OJKA 1E6EA 4ZAYA 1XLTA 4XLTA 4YRQA 5LOVF 2Q5CA 3KUKA 2EJTA 1OFUX 4DMRA 1Q7CA 2D1YA 5IABA 2V65A 1XVTA 5LIRA 2AKAB 2VR1A 1CZRA 3FPSA 1A8QA 3QHYB 3TLGA 4MVJD 5J2UB 3NRJA 3KK0A 4BV8A 4ZHQF 2BFPA 2HJSA 4O2BF 3ED1A 4L2IA 1E5QA 1KNQA 3DWEX 2EBSA 5ALXA 3C75H 1LPMA 2W6NA 4IWXA 4BFXA 1UR5A 4L9RA 1PNOA 4IHKA 2I4LA 1SHZA 2R7MA 5ALMA 4IOLA 1FJGB 4K3VA 4DCGA 3F90A 5HQGA 1VRWA 3FPFA 4TSKA 4XWKA 4XJVA 5A4JA 2NO0A 1QVAA 1XPRA 2B78A 5DYNA 1UM8A 3TLBA 4U1RA 1Z2DA 1OB5A 4DMUB 4DQLA 4D57A 1QG4A 4MS1A 2QJFA 1PR0A 1KHHA 2WKWA 2QLJA 5DASA 3PD1A 2WF6A 1PHPA 5KVSA 3A1CA 1SQ5A 3EMVA 1VSVA 4EKEA 1ZIPA 4AVYA 4FZ5A 4MLDA 1WG8A 4MYRA 3WXMA 5JDIC 2REQB 5LQJA 5FYDA 4MWDA 3CYFA 1E2HA 2XUQA 5CEEA 4HH0A 4WCFA 1HDIA 4AI6A 3DNMA 1HZJA 3UK2A 1V41E 4HDRB 1VE9A 1RI6A 4J1TA 1H4TA 3LP5A 3W5SA 4JGGA 1LRLA 5BWBA 3AOEC 4N39A 1L5HA 2DG2A 3T3IA 4CPDA 5KS2A 3H83A 1Y8ZA 4GQ1A 5JCJA 4CNQA 2YKGA 3CWZA 2FVYA 3M9LA 2XCOA 4TRJA 1DAIA 2AX4A 4J8BA 3R5KA 3GPLA 2X8JA 1WZ2A 1GRVA 4L2IB 4B3XA 4GI7A 1TTQB 5I9SA 4OLHA 2RHJA 1ML4A 5A3VA 3RVPA 4ZKDA 3E2PA 1KJWA 1M2HA 1F8XA 2C82A 2W4IA 3R3VA 3CUWA 3Q8LA 1FVXA 2Z3VA 1JDZA 1WU8A 2J9FA 2YNNA 3WIOA 5KNBD 3VKWA 4DNPA 4HH3C 3TD9A 3KX2A 3HJBA 3RYFA 5AUNB 2O8EA 5HTKA 2ZSFA 2ZJ7A 1EKXA 3RWOA 3STTA 3M1LA 3VAAA 2OHHA 1Y6FA 2BLLA 1K6JA 1MB9A 2VZ9A 3DEFA 1WDMA 3G2PA 4PCAA 4XE5A 3I73A 5CVCA 2YXEA 4MCJA 4MSUA 3W2GA 4AJLA 3EW9A 3EI4B 2YC2C 2B7LA 4R0NA 4CLEA 3JWIA 1QS0A 1PP4A 2VC2B 5AVQA 4YI5A 1W76A 2ID4A 3EZGA 4R7GA 4V0OA 1A3CA 1UP7A 2VJMB 4TXNA 4RK0A 3AP3A 2QMHA 1XCJA 3ABSB 3WDLA 4QJIA 3B5EA 3RYIA 2GHTA 3A6ZA 4CMIB 1P6QA 3VJLA 4US1R 4JUBA 2IX9A 4F93B 1PX0A 1DKQA 3HSKA 3RC9A 4ND3A 4AJ4A 3ZIAD 5JVDF 1T36B 2Y1EA 4FHCA 4IDBA 1JA9A 1YDHA 2KB0A 4L7VA 4ZODA 4BNGA 4RXTA 1XN1A 1EHIA 5C2WB 1CZOA 2ZWPA 3GB9A 3JQCA 3UUFA 4DC1A 3EXAA 5EALA 1QO0D 1VIAA 3QBEA 1SCUA 5F51A 2CK3D 4N76A 1EVEA 3N0WA 3U81A 2ZTVA 4O4IF 1L7XA 1UDCA 2F90A 4UBKA 3JCZA 3JWHA 3K8ZA 3ZVNA 1ICIA 1NBME 1JLKA 4F3TA 4Q02A 3FYDA 3CUKA 3V4VB 4J86A 2B0JA 1A8UA 2CUZA 1USWA 4PLTA 3ZVRA 1CP3A 2WJWA 3KUDA 3QFTA 1VQ1A 3K0KA 3O8LA 3TDNA 3S40A 3N74A 3CFSB 2HWYA 2WTNA 3J7TA 4QWMA 4CLOA 1J0XO 2R60A 3C6YA 3CO5A 3RSCA 3TDKA 4DPLA 4EDHA 2I6SA 5HW0A 2VRNA 3EGDB 2C8VA 2CZQA 3PI6A 3AP1A 1HEUA 3GZJA 4LWOA 2ZPTX 2P79A 3X0DA 4YJ3F 1JTDB 3OUUA 5I7VA 4PBTA 2J0QA 1W5FA 1RQPA 4BQNA 4UU8A 1Y5LA 1NXSA 3HJCA 3WDSA 3EXIA 4AICA 1WUKS 1WVGA 2OYSA 2XX3A 5AH0A 1YACA 5JCOA 2EZTA 4Z4IA 2C88A 2NOAA 4QGAA 2H51A 2VDLB 2X9GA 3KJHA 4LRWA 4HRAA 2ZQYA 4L0MA 2D13A 4OIMA 1U3FA 5EMJB 1MRZA 2CFOA 2NQ2C 2YMMA 4ZOCA 4EQ6A 5DNYB 2E5LB 1B0ZA 1I2BA 3IESA 1JFTA 1MNAA 3D64A 3PNMA 3TI7A 4RLHA 2QTCA 1GYRA 2PMBA 4A16A 5IVPA 1E9EA 4WI1A 2XLBA 1SQFA 4OP3A 4BBAA 3I52A 1RHMA 2OB2A 1M3SA 3D7RA 3Q7PA 4NAHA 4KAFA 4EY3A 4FKZA 5IXYA 4NENA 4C4AA 1U8CA 1U1GA 4YJKA 521PA 3TBHA 3VRHA 2O9JA 5IJ0B 4E5PA 1LKZA 1TM4E 5C7IO 1L7RA 4BV3A 2P78A 5EQFA 1SCJA 3I2JA 2O7QA 1N3LA 4X60B 1HE8B 1DX4A 2EW8A 3F9CA 2OPBA 3H1PA 2TMGA 3DF7A 1EG7A 4P83A 1B93A 2XA2A 5KDDA 2P9SC 4BUCA 3SBRA 1MLDA 1YRHA 2WDPA 1MJ5A 3LE8A 4J9UE 4GLLA 3ROKA 4QJ4A 3SG0A 3RJ5A 2C2XA 2C96A 3EMBA 4KX3A 3CKMA 1SOUA 2ZSDA 1XZLA 3HBLA 1MGOA 2X13A 3F73A 2G83A 2F67A 3TOZA 2PUGA 4KMMA 3UFBA 2V5VA 1WCYA 3DAYA 1NQVA 2PN1A 4Q1CA 3VYSB 1AUVA 1BVUA 1FRNA 2ATEA 3TTUA 5IFKA 1CB0A 2QPTA 3U9TA 4YH1A 1MJGA 3IJ5A 4HDJA 2HLDD 3T4UA 4C4OA 5FOSA 3ELDA 2IPOA 4LPKA 4C06A 1JV2B 1HL3A 1XIPA 1CIVA 4MPJA 2QGNA 3KCIA 4RKFA 3DEJA 4G89A 2QGZA 1XZIA 1UQTA 4J2TA 4I36A 3WRVA 5EZ6B 4LDRA 4MUMA 4B2LA 2VDMA 1KH1A 1RJ9B 1U3TA 2CCJA 2FPIB 4YCJA 2WLTA 5DM2A 1XAIA 5GWXA 2XB6A 3LV8A 2PCJA 3OO0A 3BK2A 4LF8B 4JOBA 3R40A 4A0HA 1EVQA 4DR2B 3ELBA 2ZRMA 2PSJA 4UC0A 2ZULA 5T57A 4EY5A 1M2OA 1Z5PA 2JA1A 2Z08A 4LJ4A 5EJEA 1ZNXA 3UK1A 2QUIA 4HOYA 4L02A 4M60A 5A7FA 2GEUA 2QP3A 1Z5GA 3H13A 4QDUA 4Z54A 5KOHB 3H8JA 5ER6A 5BSVA 3ZI7A 1Q15A 3E53A 4YRNA 2YXBA 1N2OA 2VDOB 3FDXA 3ZK9A 1NLZA 1GCIA 1XDGA 1CDEA 2JG3A 4R40A 3J7AC 5JY1A 1NW6A 3SE0A 1NT2A 2VUHB 2BR5A 3QVMA 1LI7A 3LA6A 1JJ7A 1HTTA 1ODKA 2KJQA 2YMQA 3KB6A 1LFAA 1MH1A 3QXHA 4MP8A 4I9GA 4LRSB 5K0GA 3IDSA 3NHUA 4YP5A 2EX0A 4MQUA 5FKTA 4A11B 2XNDA 4GX1A 4A6EA 1UAGA 1MH9A 2C2KA 3ZZTA 1IUPA 5CK5A 2PT9A 3C8ZA 5BSEA 1KOLA 4DBLE 5KVQA 2BD0A 2V7TA 3T3PA 1G16A 1AT1A 3A3PA 5D7BA 3CNLA 4X65B 1Q0HA 2PRZA 2O1XA 4QWWA 2P2NA 2WT9A 3JQBA 3LF1A 2HV8A 1GGEA 2GZRA 1XZJA 4ZO7A 3LQ4A 1XU9A 1ZI8A 4CQJA 3BSWA 3ETCA 3WZ2A 4ERYA 4DLZA 1JSCA 1JR4A 1YCFA 4KIGA 4MGYR 1JMXB 5CNMA 3VZSA 1SHYB 3L41A 2J48A 2C5GA 3DMTA 4FWIB 4JBLA 4D41A 5HOQA 2YZGA 3I9KA 2AJLI 4GOMD 1OQAA 1I3MA 1O4WA 2QM3A 1NQ5A 5A05A 3PNSA 5BSTA 2I99A 3OKCA 5THQA 3QLUA 4D25A 1TJPB 2ZUBA 3IEIA 1P9WA 4R5MA 4YDQA 1ZRSA 1E2IA 3GJXC 3SFZA 3OFND 4FMCF 3AM5A 4Q7MB 5CEFA 3IPAA 1RP7A 2CMKA 3OQ6A 5K2OA 2ZUWA 1OGJA 1ZJYA 3PXEA 2IT1A 3B52X 1G8HA 2EX4A 3LQYA 2PM7B 1KZGB 1R00A 5K0LA 2YX1A 4PZCA 2PGIA 2QQEA 1TA0A 2FV8A 3CR8A 5CXQA 4A0RA 1OA1A 4R8KA 9GPBA 5HZMA 3QU2A 2PZGA 4ZN6A 1B3RA 1DIHA 1F4VA 5AVOA 3T9CA 3R8CA 1VKRA 3FY4A 3IDQA 3TPCA 5L53A 2H4ZA 2W9XA 4BUJA 4QFBA 4LOAA 4PS1A 1DXQA 2J85A 3AR7A 1V8FA 1Z22A 3DL0A 4DQDA 4HZUA 3KSDO 2DHQA 4UUOA 3T15A 3RB8A 3BORA 4DT1A 3MCZA 1VSTA 2CMHA 3GO4A 4YAUA 4FWTA 1SHTX 3RVMA 5B6PA 1YJCA 1NG9A 4J94A 1V7ZA 1YO6A 2AH5A 3LG2A 4HO1X 3Q5DA 4XIIA 2O2CA 1B4DA 5C18A 4ROTA 5JJIA 3GJYA 3FYSA 4MLZA 2PL1A 4KQIA 4EB6B 3EJ6A 4G5RA 4YGXB 1GGKA 3QLVC 1YC5A 3NGXA 4KWTA 2WA2A 3O3MB 1YR8A 3UWMA 2FH5B 4NYMQ 1HQDA 3K20A 2EC5A 3KZKA 1O6GA 1QIFA 4JYCA 2SHKA 3QY0A 1T5BA 1UWLA 3B2NA 4Y8VA 3AXTA 1CUAA 3T9FA 3KSAC 3I32A 4I1PA 4JXKA 2EDCA 2ZW9A 4B6PA 4BQPA 1C7RA 3T1QA 3NV9A 2W83A 3CW9A 3G5TA 3PVCA 3UBTA 4ZT4A 3TW8A 4B4DA 2AJBA 4X1IB 5FPHA 4X1KA 4FA1D 1YMQA 3ENQA 1MOPA 5D6OA 1KEKA 3HYTA 2HTEA 2MWMA 3H84A 1JP7A 1IEXA 2VP6A 5LD2B 1UJ2A 4XGKA 3M8KA 1RMQA 1ZRHA 2H48A 3BE5A 3OICA 2XCSB 5JH7F 3ZHUA 3UAGA 3H2SA 3L40A 4PQEA 4PXAA 4AMBA 1GTG1 5I45A 2QDKA 1PYGA 6REQB 4H3VA 4OHRA 3W2EA 1CHNA 2IY7A 3EOBI 1QRSA 5ARBA 2ZUUA 3VPBA 4MR7B 1KHTA 3C5EA 4CQLA 1DUVG 1H8EA 2G08A 1ZAKA 1H2EA 2HBRA 2CMDA 2QRLA 2BZ1A 3UB3A 3V48A 5B1DA 1OZHA 4RD1A 3LX6A 3F5MA 2C1XA 3GMIA 3ZWBA 2GJ9A 2DETA 3HEBA 1OZ0A 2QSJA 3GNQA 2E48A 3HVKA 3UAXA 1EGHA 1H8ED 2CB9A 5ARDA 3C3CA 2NUBA 1E62A 2XLCA 3MN1A 3U44A 3D2BA 2ATIA 2DBVO 1JIVA 4MVJP 4JELA 5EN4A 2D8MA 2G5TA 1DI0A 1DE0A 3T5CA 3JRPA 4EYSA 1WBDA 1H9CA 1N2CB 1OI7A 1UFQA 4ZOYA 1XDWA 3AF4A 5CU7A 2R66A 1DXHA 3AFNA 3ASVA 1U02A 4QRDA 3W5VA 5EHXA 3THXB 3PC2A 4R68A 4LOIA 2R86A 1GZHB 3D43A 4WHMA 1PGOA 5CFRA 2X2FA 1IBKB 2CE2X 4BXOA 2F9FA 3WZLA 3HPRA 2FB9A 1KFKB 3O9ZA 2BTQB 4XWYA 3OKWA 1QZUA 2K2WA 4LVNA 3A36A 1NVBA 5EEGA 1N57A 1S3FA 2GX6A 3GJ7A 1GOHA 4HTAA 4OHBA 3SZUA 1XC7A 5IPFA 4BEVA 3K0SA 1PEVA 1JYEA 2KMLA 1IY8A 2UYYA 3F1KA 1BHQ1 4GKVA 4TMXA 3W5BA 2D6FA 2B5WA 5CFQA 3QKRA 2PWPA 1O4VA 4EPWA 2O7VA 3R0JA 4D45A 1VA5A 1E2UA 2FI1A 3V4VA 3RS7A 4DUGA 3G8DA 1RQ2A 2R6FA 4GPTA 2JHFA 1CUEA 1VYUA 2QZSA 3K15A 3V4OA 4NTZA 1JTEA 1BNCA 4QOFA 2XA1A 2MSLA 5AJAA 2CL7X 1KFJB 5IZ4A 1KR2A 3WSVA 3VO9A 3W9BA 5KYKA 1NKTA 3OZDA 1OWMA 4HEJA 1JPVA 4B3BA 3QXCA 3C4QA 4LUCA 3TRJA 4DCNA 1EIWA 2WF5A 1VIVA 4FCCA 1CR6A 1W34A 3KU4A 1P74A 4FZJA 5CG2A 3NIGB 1SKMA 1U99A 4HH1A 2IZ5A 1XPUA 5AVTA 1XZGA 4BBPA 3WYDA 1WULS 1K66A 1ZZGA 5JXWA 4L8FA 1EJBA 3OA2A 3L8MA 4OIFA 4U7JA 1BEZA 3A4LA 1OJLA 2F9LA 1ULBA 5CLHA 3FI9A 1N5IA 3CBGA 1U2GC 2H5LA 3EXEB 2IHKA 1J1ZA 3L49A 3L93A 3NBZC 1LLQA 1T1EA 4X24A 2GZ3A 4H1HA 3TQSA 2AN9A 1GSIA 4WERA 3T3PB 3NHWA 3Q5EA 4KBFA 1ZOPA 3HYSA 4DSAA 1IXRC 4JFRA 1DJMA 1XB2A 4IDPA 1YCHA 2Q7OE 8AT1A 3H05A 5BW6B 4QKQA 4GXTA 5BVGB 3TZHA 5CYKB 5JMTA 2GWHA 1MZPA 1C1XA 2BFMA 1V3QE 2R25B 3KWLA 3OI7A 4GICA 3SXPA 1Y5NA 3OQIA 2V6IA 4C6TB 1S2LA 1W1IA 2CVHA 3HBFA 4EF6A 2FWJA 3QTBA 1CU1A 1E6LA 1S2DA 4HX2A 3U2QA 4D44A 821PA 2QW0X 4MB2A 2AOWA 3LCMA 1NSFA 3LW7A 4PC6A 1CRPA 2XUKA 4Y2GA 1DL5A 2GM3A 4MQFA 4OFBA 4R3WA 4C3ZA 4O0MA 2C07A 3CURA 4HXGA 3UJBA 2I91A 1KEUA 2HGSA 4GE3A 3DE6X 2ODAA 5CA1A 4KLRA 5EIXA 1WOMA 1LJLA 3T7CA 4G1CA 4CCWA 4QU9A 4C6RA 2QMEA 4O4HF 1DIBA 4HAOA 5IWAB 3MW8A 1HDGO 2Y9MB 1VLLA 1RMTA 1QKKA 1NC1A 1KYYA 4KBYA 4Y2VA 4R0MA 5CXBB 2Q50A 1CEQA 3TB6A 2CJWB 2WJYA 3BDIA 2QYOA 3GA5A 2V6FA 4EGFA 3N8NA 3I1IA 4F6LA 2P62A 2QXTA 5M5VA 3IIKA 4UNNA 3IMKA 3P8ZA 4A1FA 4LS3A 4LXQA 4M1YA 2E3JA 4UNRA 3IQXA 5JU6A 4RIEA 1W4LA 5T3YA 4C7OA 1G21E 3KYBA 4ZZ2A 1U2SA 3R3HA 5C8ZA 1FPQA 2VF7A 1WM1A 2CHFA 3WGZA 1P9LA 3QJGA 1C8LA 3KOZA 2WJIA 1TEHA 4CDNA 4AQYB 4Y0AA 5BRJA 1QH9A 3QOFA 3VR5D 3R0QA 2YJ6A 1QAMA 1XQWA 2B4KA 2QG9A 2FWIA 3SXJA 2D5CA 5F35A 4QUAA 4GM0A 1DC7A 2QAGA 1ZJ5A 3O4RA 5D5HA 5FOTA 1VKJA 3S29A 4CW7A 4Z53A 3OZUA 3M3HA 5LR6A 2LRHA 4MR9A 3VU8A 5A5GA 4YTEA 1B43A 4LVCA 4ZRNA 3FBGA 1YQ9A 3I6QA 3QP9A 3WJ1A 3ZLUA 1LK5A 2O07A 2REOA 1BXRA 4N49A 3UGKA 1ZR4A 4C87A 4AN0A 1X0VA 4Y7DA 1XDBA 2F3PA 4D02A 4E0BA 1OU4A 2PRYA 3FXAA 3DM5A 3O92A 1CUIA 4IS3A 1P8AA 1DTEA 3CEAA 1C8BA 5ALEA 3RFCA 3FH0A 1Q0QA 3BWBA 4UD6A 3IR7A 3HKEA 4XWTA 1RLIA 5B3JC 2EKDA 2EP5A 4OHXA 3QTTA 1Z34A 3QU5A 4XYIA 5HKKD 2OLJA 4FYYA 2OJYA 1AQLA 4RM2A 5DMXA 4BPRA 2CEAA 3I0MA 5I8ZA 3ITEA 3L7NA 3CE9A 4M22A 4W5WA 1MV5A 1KMIY 2W6MA 4S1VA 3VGJA 1YFLA 4U1EI 5EPOA 4BVJA 1T2UA 2WNIA 2VZEA 4R8MA 1XDUA 3SEQA 1IZ9A 5FI5A 2YBDA 1M2GA 3HY4A 3A4NA 5FWNA 3NP9A 2P9EA 1LC3A 1F12A 3RUPA 2EYQA 4AD8A 2UYCA 3V1TC 4DGSA 3MLBA 3I5YA 3UGQA 4OHUA 1TJ4A 1R0SA 5KUTA 1PEAA 3KKOA 4Q9HA 2FSGA 4IQ0A 4N6OA 1F20A 4N48A 3QX8A 2XGOA 3HCRA 3RFXA 2G6BA 3UGJA 1XPJA 3SOPA 4BMNA 2B21A 2XF2A 3O95A 4D99A 4KO4S 5LZ2A 3LA8A 4P3NA 1BMDA 1E7WA 1JHMA 1D1SA 4I9HA 4ILKA 5TARA 2JGDA 4AIRA 4CM7A 3AEKA 4XUCA 3E7WA 2XCTB 1E59A 4OOFA 3KKPA 3IPRA 1BRMA 4YUXA 1TYZA 4GZ8A 2BKXA 3FWHA 3NOVA 4JVMA 2HWUA 1GNSA 3I45A 5AVUA 4EP1A 4E54B 3K32A 4LBYA 4DIKA 4OU5A 1GG2B 4WKCA 4M9UA 3RSGA 5JAOA 2ZSEA 2ZZMA 3OZVA 1K08A 1OF1A 4UVIA 5K4AA 7ADHA 3O8CA 5AI5A 1CEEA 1KYZA 4Q3NA 3IP6A 4M9XA 2IZ6A 4G97A 4JH0A 4BX2A 3LOUA 4HWOA 4Y3UA 1A27A 3CV3A 4QPDA 1NZFA 1CJVC 1GNLA 3PFFA 1NDUA 1GPAA 4I5GA 4JY7A 4NFSA 4XCXA 2PU5A 2P11A 4IX1A 5K0JA 3NR2A 1WUJS 2ZYWX 5TDHA 2H5EA 3RS0A 5F33A 2O5RA 121PA 1H6AA 1VJ1A 5G0SA 3UAWA 1VPTA 2DC1A 1SQ0A 4KN6A 1RYHA 4QULA 2XXJA 3D8SA 3WY9A 3SYKA 1II8B 4JV5B 4UATA 1Y4ZA 1ZC3A 1DEAA 2GR9A 3P0JA 1WW2A 1GZDA 4YRLA 3H9CA 3K92A 1KZ6A 2I67A 5H14A 3L07A 1QLWA 3T7KA 2FSSA 4B6GA 4B85A 3IUQA 2OT3B 1DLJA 2QUHA 1SKQA 2QN9A 2HNKA 4M21A 4R8RA 3VOBA 4H7JA 2OOSA 4U9IS 1N6LA 2LXNA 2PXXA 1PS9A 2WJAA 2I3AA 4UOQA 3Q4GA 4MEAA 3CH5A 4AJOA 1VYHC 3CC8A 1Q12A 4YJ2F 2CLSA 2BAGA 4P33A 5DXJA 5KWSA 4M0EA 2LW7A 5E0KB 3ODGA 1I4LD 2IU4A 5EJ2A 1P7PA 2PBIB 1HE3A 4A8TA 5KTTA 3T1TA 4TXHA 4ETWA 5JBIA 1GL9B 2I62A 3JR7A 3MT8A 4KPEC 3D3KA 3KB8A 3IEXA 4AY4A 3FWYA 4DR3B 4FNOA 5KWJA 1DXYA 3F7OA 3FCOA 3G8BA 1RIFA 2YVKA 2Z1NA 3RT7A 2Q0XA 4WPGA 2PUEA 3U3XA 2BEVB 1D2GA 1E32A 3SMRA 1K7SN 3KTAA 3DJFA 3NZEA 4MAFA 2ZS8A 2NZJA 3DAOA 3WYEA 5GGXA 4KR6A 5IT0A 3A1NA 3EW7A 4FK8A 2JAUA 3OOJA 4WZBE 1EE1A 1GDTA 1JG7A 3NDIA 3R3ZA 5EUBA 3AKEA 4KQXA 4TTAA 4BMPB 1FRQA 2FFJA 3CRVA 5EPUA 7REQB 1S3SA 3EI2B 4I1VA 5HYNB 1MPXA 3GPBA 3AERB 5FOXA 5B4WA 3SKYA 3BD6A 4DAEA 1OLUB 4ZIRA 3BHIA 3QRWA 3F3YA 3OQBA 3B1WA 1B23P 1T9AA 3UV6A 1S2GA 2WFMA 1P2SA 4QXOA 4R8LA 1T8PA 3ZWOA 3FOFC 2GFQA 4ZEVA 2DWCA 4W1PA 3P4UA 1XEFA 1IFXA 4DM7A 3KVYA 4IJWA 5I5JA 4FFDA 3KJQA 1WR8A 3EIHA 4GYWA 4HV4A 5CDHA 4PPGA 3GLIE 4COKA 4DLRA 1Z4OA 3U4QB 3NT5A 4J6FA 3TS1A 4IQGA 3DDCA 3JD1A 2I6TA 4P80A 5DNEA 4CQMD 4DXAA 1SVLA 2KBEA 3EF0A 4J43A 1T5IA 4J16C 4JAVC 1AQIA 4K87A 4RK5A 5KTKA 1TM1E 4CKWA 2AXEA 3BYZA 3MMZA 1E89A 1NF9A 3QA3E 4U2CA 3THSA 5LJLA 2C5BA 4LHWA 3K09C 5AVSA 3GH1A 1Q47A 3ONNA 4IRXA 1C9JA 4E5ZB 2EP8A 1BFKA 4F38A 5JCXA 2DLNA 4DIOA 5KQMA 4E51A 3X2EA 1QQBA 1D0VA 5HZKA 4FHLA 5GOZA 2YNMA 3EI1A 1HDRA 1ZD9A 2TS1A 2CE8A 3WJ7A 1RI4A 1NPDA 5G0TA 4A0QA 3AR6A 2QVLA 3RBVA 1FFCA 3CVVA 3UWDA 4BMVA 5JWOA 1REQB 1QO0A 3DFKA 3QUQA 5LP6A 5I3ZA 2PSHA 4DLUA 3PHBE 4UUQA 4M1SA 3EI1B 2ZM6B 5GSAA 4K2AA 4IDCA 2D5IA 3AJAA 3SJUA 2VDKA 1L7QA 3GWZA 3IAAA 3SM9A 3BWMA 1YR6A 3MTEA 4OJTA 4S2EA 2EV9A 4PLVA 4UM9B 1GTJ1 1EFDN 3WDKA 1MW9X 2PT7A 4R7AB 1G3IA 1SUIA 3BMCB 3KNZA 1ZH4A 4ZVPA 4D9JA 1ERJA 1RCFA 2ECQA 1ZLXA 1I6KA 4S1NA 4XDZA 1EUCA 4RPIA 2EGHA 4RO0A 3QXGA 2P7HA 4XOUA 5JQWA 1P45A 4JMLA 4IIGA 5CNJA 4DTCA 3ILSA 2NVBA 3IV6A 2WP8J 5L3RA 3M6IA 5EP2A 3AI2A 1U6KA 3BX1A 5TS2A 1PGUA 2M6LA 1X7GA 4DCJA 1M2FA 1QP8A 2UUCB 4QRJA 5CCDA 3QBJA 1B16A 1CPYA 2OQ2A 3NHYA 3PC4A 2BDTA 1JAIA 3D2CA 4JX8A 3HV0A 3OJLA 2QLBA 1I6MA 5AYVA 3Q5GA 1KARA 1S8AA 2C2HA 2IKQA 3DUFB 1XF1A 2I8LA 4HFNA 4DIUA 2J45A 2LV8A 3AUAA 1U0BB 2X0IA 3DS8A 4DZRA 1U7PA 5EJGA 3DLCA 4C7OB 2RGAA 1XMSA 4KBGA 5K3DA 1ZI6A 3DPSA 3LL7A 1BGVA 3OD5A 1IBSA 3K35A 3RANA 3M6VA 2PRIA 2P5TB 1B1AA 3TZCA 3UV7A 1OLUA 3HCNA 4ZIRB 1NM5C 4PHTA 2AQKA 3DMDA 3H3XA 2YFYA 1A04A 3RKUA 1NPTO 5GIPE 1GWNA 1W88A 4CTNA 1CR4A 2IYEA 4QOHA 4BV2A 3UYKA 1FDUA 4BWYA 4CEHA 1B0PA 1L6IA 3EQ7A 3QPBA 4TSRA 2GTHA 3DL2A 5CH8A 4C7VA 2Q9UA 1JWBB 1JQEA 1IN6A 2EARA 4MMXA 1AGNA 2JCGA 4XM1A 5I4BA 3SU8A 3TMAA 3E7DA 5FI0B 2Q3BA 3DO5A 3JD2A 3LH5A 4CF5A 4OHPA 2Q4OA 4FEEA 4DNVA 1TKBA 2JJQA 1ZXXA 3OTIA 5JRDS 3U19A 1N7IA 2PT5A 2BISA 2BTEA 1J25A 4RV5A 3FKQA 1DADA 2FEPA 1MABA 4B34A 4IXTA 1PNRA 1ID8A 2O0JA 1ABEA 2Q2OA 4QTUB 4ZYXA 1HBJA 1CNFA 3WYBA 2QV0A 3AT1A 3HWX1 3R3XA 2BT4A 1R7RA 4CMCA 1IM8A 3QU7A 4I14A 4FUQA 1F1BA 1T36A 4KKXB 3LPCA 1SC1A 1SPXA 1Z13A 3GGOA 4J4BA 2EXXA 4KYTA 5A1JA 4FNGA 4BTEA 1CE8B 2B37A 2E9SA 2GHQA 2RI0A 4LWZA 4RZIA 5M3BA 2P3SA 3UJDA 1E2GA 3BQ9A 4MQEB 1C3LA 1MT3A 4G2TA 1UWCA 3V8QA 2XTZA 1U9ZA 1FNBA 1HORA 4RJJA 4E08A 2X5NA 2I4RA 4CM8B 5K1CC 1GG2A 2A4MA 3ZJUA 2PWAA 4KXFB 1NJ8A 1Y9ZA 1E20A 4FS3A 5EFZA 3RSSA 1OMWB 2V0CA 5KOHA 1BAPA 4UAJA 5LB2A 4TN1A 4K9NA 3SS7X 3T35A 4DB4A 3K1YA 3PWKA 4FGZA 3KFLA 4OGLA 4S12A 5ANRB 1QUEA 4NMWA 1EXNA 1UJBA 2ZLBA 3AX6A 3RCBA 3TNLA 4YIHA 3GDHA 3KHSA 4DW8A 1GU1A 2JGRA 4K7JA 3GRYA 4EZBA 2C20A 2IDZA 2BP7B 2C92A 1W30A 3P96A 5MN5A 4JOCA 1UEJA 2ZATA 1A76A 2ZE5A 4NMMA 5C52B 5EM2A 4RBNA 4RTJA 1Q92A 5E6UA 4IG4A 5C1OA 1FUUA 2JI7A 3U56A 2WOOA 1KVTA 3A6GA 1MO5A 2RG7A 4UI9R 2A33A 1D09A 3FGNA 2AGXA 3W3AD 4EPXA 2BDEA 1UPTA 4MARA 2YCLA 4GM4A 2ZI4A 1PE0A 3IVMA 4JBNA 5AJXA 3AJEA 4LI0A 5E3IA 3PGKA 5E7MA 3B7GA 4DFDA 5LZ9A 2QTAA 1YR3A 3GP8A 3IFSA 3IB6A 1HYQA 2P91A 3FCXA 2V8BA 3VKUA 1SVSA 3I34X 5E9WA 3KG2A 2OOKA 4KHZA 4XZ3A 5BSRA 3ZE0B 1C4XA 5C4MA 3G3EA 1LLCA 3GVCA 3LP6A 1UBEA 4DNUA 5JWZA 2WUWE 5F7XA 3ENNA 1X92A 3BE8A 3WYAA 2OPHA 4J6EA 4JD5A 1E18A 4F11A 2W8BA 1GGJA 3OE1A 4MTLA 3Q15C 4F7DA 3RHZA 5JZBA 1N2CA 3GW8A 5LKAA 4URVR 3NVAA 3VKFA 4M1TA 3OFSA 3TXAA 3U4CA 3OUZA 3AJ8A 1GZ7A 2ZBDA 4QU5A 5GTDA 4KR0A 4EUHA 1TJ3A 4D9IA 3DEHA 3EJWA 4INPA 3PVWB 3JY6A 4BU0A 3H0KA 2FJ0A 1HDXA 1NRIA 1YTLA 3GK3A 3KUCA 4G86A 2A5FA 1L8AA 2XXBA 2E18A 5SICE 2ZBUA 3JVIA 3QWIA 4NVRA 3GAZA 3RODA 1QRDA 4BP8A 2OHOA 1FOEB 1GFSA 2I7XA 1PK7A 5BPFA 4JKYA 3DAFA 3V1YA 1KETA 1KO1A 1EXDA 1ND5A 1U6IA 2LDXA 3EIXA 3PLAE 3EF1A 5FA5A 3OIDA 3LYUA 5JSQA 3PX3A 1TAHA 2PIDA 3MAJA 3NM5A 1UK9A 4X60A 5H70A 2XPCA 3P52A 3VQTA 1ZNWA 3NEJA 1O6ZA 3EIWA 5ALGA 5TPWA 5BWNA 3KB1A 3VYVA 4WOJA 4KK3A 4AS3A 4LFBB 3S1AB 3DQQA 2WYVA 3TJZA 4FYPA 5MHTA 2VSXA 2JLAA 3KPUA 4ZXFA 3EDQA 1W25A 2VZ0A 4X85A 3OIVA 2FG6C 4KFSA 4Z9YA 4KSCA 1EGVB 3AVYA 1EBUA 3NH9A 2HR1A 3PGA1 3SDZA 5IKMA 4PR0A 3FOWA 1TYCA 5BV1A 2DTEA 2ODWA 1D5CA 2X42A 4DSUA 2GKOA 4X97A 2JDIA 4HMPA 4B4VA 3GMTA 1XCMA 2Y0DA 4TKMA 4ALLA 4POOA 1W0JD 2REXB 3CZ4A 1TU4A 5FTWA 4BFVA 1NR0A 1CG6A 4RMGA 1GFZA 1PJAA 5U9CA 5FO0A 1U28A 5DNAA 5MN4A 4WLUA 3QENA 5KNCA 1R27A 1ZN7A 1E9SA 1SZCA 2GOYA 2JVIA 3FRIA 2IIBA 3UA3A 5E8RA 3STWA 5ESWA 1FS6A 3IP9A 2XKJE 4AJKA 2P6NA 1U4SA 3ZN2A 1R12A 3C3PA 1VPVA 3MELA 3FJ1A 3SYRA 3JASA 2PAFA 4P34A 4Q9LA 4EG3A 4EPVA 1HYHA 1NYQA 3GARA 4RKRA 3T5BA 2B1GA 3MJCA 3OEHA 1Y1TA 3PFNA 5MF6A 1ZEJA 3ZHZA 2I4NA 1H05A 1LVGA 2VPQA 1XQYA 5U1PA 5GJBA 3M2PA 1TU0A 3EI3B 4PO1A 3R23A 2B3TA 4YO8A 4CI9A 4ERZA 1KQNA 3UATA 1BHJA 2HL6A 5FTLA 4IMJB 2CY0A 1JZTA 2MINA 2XA9A 1IN4A 4FYXA 4NDZA 4OPMA 5DSTA 3EA0A 5GONF 4C0QC 4YCSA 1XLTC 4QL1A 3KEOA 4A08A 3O4IA 4NOJA 1CD5A 3KDAA 2ETVA 2WINI 4UPVA 1UIMA 2ZAGA 3HL0A 5IC7A 4A92A 4RC9A 3FGBA 3ORYA 1RXWA 2Q9AA 2QPAA 1QQ6A 4WSOA 3KETA 1NNLA 1QF6A 1KAOA 3U6BA 1N9ZA 4QTTB 1CE8A 1KI4A 1QYWA 1FP6A 2H63A 2KW5A 1Y81A 3AEQA 5EMKA 1C0KA 1N0WA 5FBLB 1KAQA 4OHZA 3SI7A 4J81A 1ULUA 4DRZA 2EZ9A 2FMXA 2O4UX 3C6ZA 3V7YA 1ZM9A 2WABA 3D4OA 1C2TA 5ER9A 2ILTA 1SY7A 3DCIA 1XT6A 3FROA 2GESA 4ZAVA 4YC7A 4JEUA 2CLCX 1DRWA 2WHQA 4QU8A 2CLMB 1VGRA 1E94E 4ZCSA 4N5NA 4BLSA 2AOUA 1F6BA 2X5OA 5B3JA 3WL5A 1JQLB 2WIJA 3C3WA 1IOLA 5C8DA 1UMDB 3I6BA 4Q5IA 4FFWA 4B9EA 5DK6A 2EU8A 3MPOA 2O59A 1KK3A 1BMTA 3OHSX 1AXRA 5TQ2B 2CHGA 4NBUA 5FNZA 2MINB 3V4FA 1ISMA 4MNTA 4FFRA 1R0LA 1E96A 1G3MA 3IJEA 4L72A 5P8WA 5LP1A 2Z56A 4PNZA 5BNFA 3SYNA 3U17A 4AROA 3ZWLB 4C01A 2R6HA 4E2ZA 2J9FB 1A5ZA 1QFXA 4MR8B 2I2FA 2HO5A 3DZJA 5D3MB 1QGAA 1XTBA 5LMNB 1G2QA 4C08A 4N4AA 1JFRA 2F8MA 5HE0B 3CMMA 2ZUVA 3H7AA 3AJRA 3PLRA 1C7IA 1R50A 4Q7JB 1L1EA 1RRPA 3BRWD 3IVGA 5EZSA 5IX8A 1D2CA 3O1LA 4MUNA 4TZKA 4MW0A 5HFNA 3AZOA 3RJZA 1I6WA 1GL6A 5HUJA 4ZPXA 4Z9AA 3OM8A 4PTZA 1NG1A 5GVRA 2G99A 3DKIA 4DG8A 2HIGA 2SBTA 3M1AA 3AHGA 4URWR 2YWGA 2VCEA 4MLPA 2GXQA 1I94B 1UUFA 1WLSA 1X1TA 2ZIWB 3AHFA 1W36B 3PXGA 2XL2A 3C0KA 5H1MA 2KX7A 3RVKA 3WTBA 3EQZA 1YGPA 3ELYA 5KNCD 4IW3B 5FJJA 2BTQA 1MC8A 1W7AA 3C5VA 5FEUA 2X8WA 5B7QA 1NDHA 1PZFA 4JLUA 1NI3A 4D9NA 2I6UA 4HQLA 4COOA 2J7KA 3O1IC 4RKQA 4YDSA 1F2VA 2PQ6A 4L3HD 1COWA 2X0RA 2ZSUA 4CTMA 4Q34A 5C86A 2WD7A 3EEIA 2QX6A 4FKBA 2A0YA 1P18A 1KZHA 2X8BA 4PIPA 5DCYA 3ICVA 3MTJA 1QHEA 4IYJA 2C9DA 3L7KA 4K28A 4BNXA 9LDTA 3COZA 1OC2A 4Y2TA 5T5QA 2PPLA 1DB3A 2H68A 2BGKA 3IILA 4KGDA 2JLUA 3T12A 1U2PA 3AUUA 3C5CA 4H0CA 4BFWA 3I89A 4W99A 2BE7A 2PEZA 3E3OA 3QQ5A 1E64A 3ASUA 5TF4A 4LRUA 3V1LA 4UHCA 3WK7A 2P2CA 1LF5A 1TQDA 3DEAA 4GPAA 1ANKA 5ITSA 2B20A 1PYOA 2J0UA 1NASA 3OKFA 4X20A 4BO1A 1E1CA 4ZMSA 3P2MA 3PJEA 4V24A 2ZT6A 3BXXA 3CZPA 4JJ4A 1UC4B 4FLEA 1TCBA 3JRXA 3HDTA 4NKRA 1VE5A 1UP6A 3SJLD 3UFXA 4K9DA 4ETNA 2QW1A 3AIIA 1G41A 2GA9A 2W5UA 2Z2JA 3GGJA 3HKCA 4FD2A 4MYSA 2EZUA 5SZJA 3V7NA 2PUVA 1RHKA 1Z0KA 5JAZA 1W0KD 1DJLA 5BT8A 4D9CA 2IOFA 3VJMA 5AHWA 1JA1A 1YB5A 1R4MA 2DJ5A 3R5TA 1Y6ZA 2NXJA 4CTOA 2QD5A 2FW7A 5D87A 1GTVA 1QH0A 3ZDXB 3BOSA 4NZ9A 5IXSA 2NO6A 1GV0A 2WJ3A 1R66A 1UBJS 2C1EA 2H31A 2VPYA 2FPKA 2CNNA 1ES9A 3ETJA 4EM6A 1VCMA 1HT0A 1L4MA 1XVUA 2BM1A 1NFRA 2WPNA 4KOAA 4DJ5X 5C8VA 5L8VA 4BVFA 1UXGA 4CL3A 3IJCA 1U0HC 4LBZA 4IIEA 4MITA 5FO1A 3DVSX 1NE2A 1U8ZA 2GD1O 2XITA 4RIIA 3VTFA 1OHHA 3CJTA 1N2IA 2Q5HA 4UOEA 4DNWA 1ZMOA 2H4FA 4AZWA 3G7UA 1AK2A 1UBHS 3ADKA 4JCCA 5TT0A 5KQGA 3DCYA 2Z2KA 3RRBA 3DXMC 2HMAA 4N5IX 2AMLA 1AZWA 2JIZA 1CR2A 3UYLA 2Z4TA 3VR3D 2BZGA 2AEEA 4JLAA 1HQCA 2REBA 4B7UA 1N6NA 2BP7A 2GYYA 2Y76A 1OROA 2R79A 3U49A 4HB3A 1TDJA 1Y7PA 5TB5A 3CVYA 4NWIA 5CRIA 2CHVA 3AESA 5C0OE 1M6YA 1UBSB 2P68A 3BK1A 2H29A 3RTGA 4BZWA 4CMGA 2HA0A 3IMFA 1VHWA 2FQ1A 2ODPA 3OCCA 3MTIA 1D6SA 4OD0A 2C5FA 2PM9B 3L6BA 4FWBA 3EDCA 1CYEA 3B85A 4OJYA 4L5JA 2QTVA 2NZXA 2OCXA 4OHMA 2A6PA 4LX0A 5FHRA 5FTNA 3Q8MA 4W8GA 1YQQA 3HJRA 1NONA 1G7SA 3JD0A 5JAQA 1JKFA 2BFBA 1RJGA 3JS5A 3OQIB 3HMKA 3UGTA 2DWQA 3RRMA 4J2OA 3BH0A 5KREA 1HGXA 3BILA 4JP5A 4KI7A 2WYOA 5DI3A 1PT8A 5F9MA 5CYKA 1UKAA 1QZ3A 3PHCA 3ITNA 2C9YA 3KCQA 5KHAA 3ZQ6A 4C2BA 4EJ0A 1NOJA 4A11A 3T3OA 4XTRA 5IH7A 2FZ4A 2V7VA 2EW1A 1E98A 1OXTA 2LBPA 4CZVA 4KIWA 4Q4CA 1E4EA 2I2DA 2RJNA 2W2KB 3FJYA 5H3HA 3KLNA 1UK8A 1TT5B 2BR4A 3UIEA 2RMKA 4E33A 3AR2A 2XQFA 5EINA 4NCBA 1IN7A 3P0HA 3B6IA 2VDOA 2XUAA 4YV1A 4M6WB 4DUZB 4Q01A 1KFBB 3I5UA 2HD4A 4JL5A 1SBZA 3ZU4A 1L0QA 1KP2A 3BCSA 2XSZD 1L5HB 1QLJA 2P9JA 3IT0A 3IQIX 4IIBA 1FTQA 1H2AS 4DLVA 5I9BA 1A2BA 1LDBA 2QTFA 3RQIA 2XNCA 3A0RB 1KIMA 2FK7A 2J33A 2SKCA 2ZYIA 4GRIA 4L5IA 2C2OA 2FP4A 1X1BA 4U2GA 2JPDA 3RHFA 3ZQKA 4E94A 5AW5A 2A78A 4A0BA 1AB5A 4OH7A 4JZKA 2CL5A 4GGAA 2WG0A 2ZBRA 2FQYA 3N8DA 1L5WA 1WB6A 2J3LA 4BV9A 5AVJA 5GADl 3OEHD 4BMXA 1IN1A 3RGGA 3RV4A 1R6TA 2P27A 3F4KA 1XZAA 5FCDA 1PT6A 3K70B 1U8FO 1N3BA 2R8BA 2V9CA 2B2NA 4PSAA 1UBUS 1IBRA 3ZCPA 2W2XA 3GLIA 1E3TA 1V37A 3CLHA 1L3BA 2ZB8A 4LZAA 5CFZA 1F14A 1KJ8A 4CV2A 2X9NA 5I4KA 1FZTA 1RM4A 4YMWA 2JEYA 2HH9A 1N2CE 1R6UA 5BW8A 1GPWB 3BCHA 4TLEA 1YOBA 3FSRA 1AXEA 3AJDA 4JSVC 1CRWG 1T9ZA 4IZ6A 2J56H 3ZLVA 4LGNA 5G02A 4M0PA 3HCOA 4WFIA 2DE0X 5DP1A 4N3NA 1XMJA 3AHHA 5IEBA 3OEWA 1KEZA 3I2FA 3EAQA 4ZVSA 5LP6F 4LVUA 5FDFA 2QQFA 1W5BA 1JAYA 2AQ8A 2XXAB 4HR7A 3CPSA 1E0JA 5BOSA 4RGYA 4Y2HA 2XYGA 4FDLA 4LYEA 3GGGA 4WN3A 2OEPA 4I5EA 4KJZA 3E70C 1Y3HA 3P9NA 4HX5A 1TRKA 4CKBA 2FN9A 4E7OA 3ETEA 3PXCX 4H7HA 1EP9A 4FFLA 5T3UA 4CM1A 2GO7A 2X0NA 4FFBA 3A3KA 4I6GA 4RHEA 1RE1A 3I6ZA 1D7AA 2BMJA 5PNTA 4NECA 1WLYA 5M7EA 1ACJA 5DHSA 4KR9A 5A6SB 1OFHA 3E2MA 1U0RA