1YR2A

Structural and mechanistic analysis of two prolyl endopeptidases: role of inter-domain dynamics in catalysis and specificity
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
701
structure length
680
Chain Sequence
b'PPYPASPQVPLVEDHFGEKVSDPWRWLEADVRTDAKVAAWVQAQSAYTAAYLKQLPERAALEKRMKALIDYERFGLPQRRGASVFYSWNSGLMNQSQLLVRPADAPVGTKGRVLLDPNTWATALDAWAASDDGRLLAYSVQDGGSDWRTVKFVGVADGKPLADELKWVKFSGLAWLGNDALLYSRFAEPLNYNQTVWLHRLGTPQSADQPVFATPELPKRGHGASVSSDGRWVVITSSEGTDPVNTVHVARVTNGKIGPVTALIPDLKAQWDFVDGVGDQLWFVSGDGAPLKKIVRVDLSGSTPRFDTVVPESKDNLESVGIAGNRLFASYIHDAKSQVLAFDLDGKPAGAVSLPGIGSASGLSGRPGDRHAYLSFSSFTQPATVLALDPATAKTTPWEPVHLTFDPADFRVEQVFYPSKDGTKVPMFIVRRKDAKGPLPTLLYGYGGFNVALTPWFSAGFMTWIDSGGAFALANLRGGGEYGDAWHDAGRRDKKQNVFDDFIAAGEWLIANGVTPRHGLAIEGGSNGGLLIGAVTNQRPDLFAAASPAVGVMDMLRFDQFTAGRYWVDDYGYPEKEADWRVLRRYSPYHNVRSGVDYPAILVTTADTDDRVVPGHSFKYTAALQTAAIGPKPHLIRIEPIDKQIEETADVQAFLAHFTGLTPRPWSSVDKLAAALEHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords prolyl oligopeptidase
molecule tags Hydrolase
source organism Novosphingobium capsulatum
publication title Structural and Mechanistic Analysis of Two Prolyl Endopeptidases: Role of Interdomain Dynamics in Catalysis and Specificity
pubmed doi rcsb
total genus 199
structure length 680
sequence length 701
ec nomenclature ec 3.4.21.26: Prolyl oligopeptidase.
pdb deposition date 2005-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00326 Peptidase_S9 Prolyl oligopeptidase family
A PF02897 Peptidase_S9_N Prolyl oligopeptidase, N-terminal beta-propeller domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.120 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Prolyl oligopeptidase, N-terminal domain 1yr2A02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1yr2A01
3D2BA 3QPAA 1KU0A 4HVTA 4XWGA 1DWPA 4BDSA 4PW0A 4C87A 2HA2A 2DR0A 3EQ7A 3BDIA 1R9NA 4UBIA 5AK6A 2WJ6A 5KBYA 4W9RA 1D07A 4E15A 5ALGA 5EHNA 3H0CA 4J0GA 2DQZA 4MYDA 5HKBA 1ZOIA 1XZFA 3DJYA 5AKIA 4G9GA 4LIPD 2PKYX 2C7BA 4NMWA 1UOQA 1EVQA 1FFBA 3B5EA 2QTBA 3D3NA 3AINA 2O2IA 2CUTA 5AIAA 1I6WA 3STXA 2PVSA 1THTA 5LLSA 1TCAA 2VSQA 1BROA 3FLAA 4Y2RA 3Q0TA 3GZJA 4P08A 1GKKA 2WHPB 3IULA 2Q0XA 2JGIA 4N5HX 4L0CA 3C8DA 4MEAA 1CPYA 1A8UA 1SCQA 2CB9A 1IUOA 5FXMA 1CQWA 4QA9A 2ZVDA 1NU6A 2XMGA 3GROA 3IDAA 2XB6A 1W6RA 1QIIA 3G02A 3D59A 3I2FA 4I3FA 3AFIA 4JUIA 1QIJA 2GYUA 3H2HA 1YA8A 2QM0A 5FUMA 1XZCA 5C7YA 2ZJFA 1OILA 2C58A 5ALRA 5JADA 1LPMA 5CXUA 1Q0RA 3G9TA 1MN6A 3S2ZA 3G0CA 1AURA 4AO7A 3STVA 4BAGA 2WTNA 5I9IA 3O4HA 3G9ZA 2XUGA 1VXRA 2QS9A 2EEPA 5DWDA 2H7XA 3F98A 5DTJA 1JU4A 2R8BA 2WIJA 3QM1A 1FJ2A 2UZ0A 3ANTA 5AI4A 4WDQA 4AN1A 5ALZA 1Y7IA 2E3JA 3WWOA 1XLVA 5AI0A 1CR6A 4C4ZA 5HKAA 3PUIA 1E8NA 1LNSA 2OGSA 3ESCA 3WKBA 4Y2JA 2VF2A 2XUAA 1DTEA 2VATA 1AC5A 1H2ZA 5JAPA 1MX5A 1LBTA 3BWXA 4QZVA 5AM2A 2XQKA 1LZKA 3ZLVA 3A6ZA 5KREA 3DKKA 5ALYA 5AHXA 4QDZA 1XRPA 3VJKA 1X70A 4Q82A 5FLKA 5JAHA 3WA6A 4ZWNA 4INZA 1N1MA 5AK4A 1SCIA 1LBSA 5AP9A 3WIOA 1CQZA 4DNFA 3QITA 3DS8A 3HACA 2CKMA 3FSGD 5EIEA 1XLUA 2DHEA 2HADA 2X5XA 1DWOA 2I3ZA 3WQHA 1E8MA 2Z3ZA 1JI3A 4H0CA 1W75A 1TIBA 1WPRA 4U2GA 2X76A 1FFEA 1WPXA 4AB1A 5AI8A 4L3WA 3VVLA 1FFAA 3C87A 1CLEA 1CUJA 4GXNA 3OC0A 5ALVA 4KE9A 3CCCA 1K63A 5D3ZA 5K3AA 1F0NA 1GPKA 1TCCA 2ORYA 4GW3A 5HF9A 4Y2XA 1ZI6A 4F60A 1QFSA 2VQ6A 2VJAA 1XZAA 5D7BA 5EHXA 2HFKA 5EFZA 5AOBA 2BAGA 4AZ3A 3RK4A 3OTQA 4QDTA 3C70A 1WM1A 3F96A 2XMZA 3FVTA 3PFBA 4IH9A 3QBJA 2JEZA 4PF1A 1L7AA 1A8QA 3HEAA 1DQYA 1EVEA 2PU5A 3AUKA 4BVLA 3G7NA 2ZYRA 5ALLA 3FNBA 1P0QA 1XQWA 2C4HA 5LKRA 1MAHA 1UK7A 2FX5A 3C8HA 2CBGA 5JZBA 2I03A 3ILSA 3ESBA 2HA5A 3E1GA 3C6ZA 2VJBA 3D2AA 3WWPA 3OURA 4AXBA 2JGKA 5HF5A 4GLBA 1MX9A 3HRHA 5ALTA 1JMKC 2AJLI 4FHZA 5K3FB 2WTMA 2I78A 1WHTA 2XMDA 1U2EA 2ZYIA 4BC0A 5SYNA 1WB6A 3WYDA 2WHPA 5I8PA 3EBLA 2ACEA 5DYYA 2BJHA 1GQSA 4B6GA 3G0DA 2HRRA 1QJ4A 4Y2QA 5CURA 3UUFA 5IKXA 1CUAA 5JIBA 1QONA 1GQRA 3A70A 5ALOA 5HFNA 4N8EA 2WJ4A 5ALXA 1XRLA 1XZGA 2QMQA 4AO6A 2OCKA 2XI4A 2ZYHA 1VZ2A 2QKYA 3I2HA 3LIIA 4BE4A 5AKKA 4UHCA 4CFSA 5T4BA 1H22A 5CTAA 3F8SA 2H1IA 1VXOA 2HDWA 3E4DA 5DNWA 4P92A 3FAKA 1MT3A 5LKAA 3H1BA 2ES4A 5ALIA 2RONA 3QVMA 5LZ7A 2WJ3A 2G63A 2IITA 5T4EA 4YASA 5KWJA 1F0PA 2HU7A 5CBKA 5T4FA 4NZZA 1R1DA 3E0XA 2OGTA 4RGYA 1U8EA 2WUGA 4EY6A 1GT6A 1PV1A 4H7IA 3PI6A 1XZBA 2XUDA 2PSDA 3A2MA 3BDVA 1K4YA 1ODSA 3EQ9A 2ZJ7A 2BKLA 1QIFA 3H2JA 4RE5A 2BGRA 1HKHA 2D0DA 3R3VA 4BATA 1EA5A 3H2GA 1J1IA 2ACKA 1ACLA 2HRQA 4MQMA 4BAUA 4GECA 1VKHA 1YCDA 3WWEA 3WA7A 3W9BA 4CCYA 1E5TA 4Y2SA 4C4XA 1CEXA 4BCBA 5AM0A 1Q0ZA 4U2DA 3O4GA 2JGEA 5K3BA 2PSJA 1QIDA 3BF8A 2RIPA 4OD0A 5JANA 3F97A 3WWCA 1QOZA 3E3AA 4ITVA 1DU4A 1UT6A 3WL6A 1R88A 4JYMA 4KR0A 2C5FA 5HCUA 2PUHA 1EHYA 4CIBA 1KEZA 4P93A 4DYHA 3STYA 4Y7DA 2AJCA 1OCEA 2ONCA 1ZJ4A 4WY8A 4E46A 3STUA 4RE6A 2BUCA 1CUHA 2WFLA 1PFQA 2DSNA 1EDEA 3K9BA 3V9AA 4XVCA 4J0JA 4MWSA 4CCYB 3STWA 5CRIA 3WK4A 2XUIA 2XUKA 3FYTA 5AI6A 1VOTA 3QYJA 5IVIA 3DYIA 1XKLA 1W4LA 3HSSA 4K2AA 2RI6A 2BGNA 1ZI8A 5HK8A 3BXPA 1O6FA 1EH5A 5AM1A 4OU4A 5ALSA 4BRSA 1BU8A 3FOBA 4H35A 1BRTA 4X95A 1G4HA 1YASA 2IIVA 3FYUA 5AICA 3UMJA 1ACJA 2DCMA 4X6YA 4LYDA 1JKMA 5LZ5A 2DHDA 1H23A 2G4LA 4OYYA 1XZDA 5ISMA 4BTLA 2WG1A 1P0PA 1LZLA 1HBJA 1Y37A 4OU5A 1UOPA 3ESAA 4XIIA 3N0TA 1BCSA 2XMQA 1QIMA 3C5WP 3W06A 1THGA 2PSEA 1JT2A 5K5EA 5AKJA 4J0CA 2ZJ6A 1ORVA 2OXEA 2YASA 2HHAA 3HYSA 1MU0A 1DX6A 5DNUA 2K2QB 1MJ5A 4PNZA 3I6YA 3QMWA 3F67A 4OYLA 1UKBA 2QOEA 5HQ3B 4G4GA 2B61A 5FP0A 4B82A 5ALJA 5JZ9A 1DT3A 4WY5A 2DQYA 1G5FA 1Q84A 1E66A 5LIPA 3DCNA 2RGUA 1CFJA 4KRYA 3OPMA 3R3UA 5EHQA 3LS2A 4I4CA 3RLIA 4G5XA 5CT5A 2WFMA 4ARBA 3KWFA 4X85A 3OOSA 2WU4A 3R40A 1ZD3A 4J7AA 2JEYA 2HA4A 5BWCA 1CUFA 2OQIA 5LYYA 3DDUA 3M81A 5EI5A 3H04A 4J0IA 1XRQA 1E8DA 4KAJA 3FCYA 1VE7A 2QUBA 3F9CA 3I2JA 3BE8A 5AJHA 5E2IA 4LXGA 5CT4A 2XE4A 1CRLA 1B6GA 3C45A 1BN7A 3SX4A 1P0IA 1AUOA 2ECFA 2RHWA 4DNPA 3N2ZB 2WHQA 2VT6A 2CJPA 2HA0A 5FDFA 1GZ7A 2B20A 1ZD5A 2PU7A 4KRXA 4C89A 3G0BA 4BTVA 4A5SA 3AJAA 3AIKA 5BWBA 4KJXA 4GHWA 2NW6A 5CW2A 4ZGBA 3GUUA 2YH2A 4BDTA 4Y2YA 2Z8XA 4EUSA 2HA6A 1HL7A 2W22A 1A88A 5EGNA 1CUCA 2V97A 4UFPA 5LZ2A 1K5PA 1HQDA 4JNCA 3I2GA 4FLEA 3V1KA 5CH5A 5CH3A 1TCBA 1ISPA 1QO7A 4ZREA 3KXPA 3O9MA 4JYPA 1WB5A 3FCXA 4WJLA 1CUSA 1QTIA 4X94A 5E4JA 1AGYA 4DMCA 2V96A 1W52X 4AN0A 4KE6A 5A7GA 1IZ7A 2J3DA 4D9JA 5AM3A 1XZMA 4J0DA 5HQ3A 3BIWA 2XUHA 5DJ5A 5AKXA 1UZAA 1RP1A 2WG2A 2WU3A 4H7FA 1YA4A 2QZPA 2OG1A 2RHTA 4H77A 3VVMA 1XQVA 1LPOA 3K2IA 1TKRA 5J3JA 4CG3A 4LHEA 5CT8A 3AIMA 5HF8A 5HK9A 1YB7A 1G42A 4C4YA 2OGZA 2LIPA 4V2IA 4H7EA 3SC2A 1XZJA 4FOLA 3FLBA 5DLPA 4FNMA 4YK7A 5IH7A 3VISA 3WK6A 2HFJA 1UK8A 3C6YA 2BUAA 4BCDA 4GWLA 1T2NA 4FTWA 4ROTA 5AO9A 4PSUA 2B9VA 3O4JA 4GBGA 5ALNA 4EY7A 5C8XA 1HPLA 2BUBA 4OB8A 3DD5A 4HTAA 3FWHA 3EIOA 4HAIA 2C5GA 3IURA 2JIDA 3WKCA 4J3JA 2YYSA 4E11A 3D4LA 3BJRA 4K6HA 1USWA 1UK9A 1FSSA 3SK0A 4QE3A 2WUEA 3WK8A 2GZRA 1VZ3A 2G5TA 2QVBA 2B4KA 2XMCA 4X3CA 4W63A 2QR5A 2P8SA 2WFLB 5FOQA 2HL6A 1MAAA 3WKDA 3Q8WA 3KOOA 5F4ZA 1ZICA 4UHDA 3U1TA 2Z5GA 4Y2VA 3C5VA 1CIJA 5I7UA 1BS9A 4UFNA 3IUNA 1AKNA 5A7FA 1IUPA 1BE0A 3QH4A 1EDDA 2QXUA 3L1JA 3C6XA 4RNCA 4MEBA 1QGED 3KDAA 3WJ1A 1AX9A 1UXOA 5FRDA 4UBJA 3VKFA 2WKWA 4UPDA 1ZIXA 4X71A 3QPCA 4MWTA 5BOVA 5SYMA 1W76A 3NOXA 4C6HA 3ED1A 3W2TA 4LXIA 1XKTA 2JGFA 4EY8A 3VJMA 4AO8A 5AOAA 3STTA 4JEIA 4PO3X 4H7DA 3V1NA 1YAHA 4DMFA 3ZPXA 2EDAA 1LPPA 4Q34A 3LCRA 5EIHA 2XUQA 1GKLA 4BC1A 3TEJA 4AQDA 2VA9A 3NUZA 1N8SA 3RM3A 1ORWA 1LPNA 3AIOA 4DMKA 1H2WA 3H2KA 4QDXA 1SFRA 1CUZA 4ZRDA 3HABA 1U4NA 4X6XA 3YASA 1YR2A 4J0KA 1L7QA 3V1LA 4WDRA 2WIFA 4FBLA 1VLQA 4M0MA 1WHSA 3G8YA 5K3DA 3I2IA 4X97A 1C7IA 5JASA 3WK9A 2XQGA 5DTIA 2CZQA 1XQXA 2XQJA 4A23A 1ZGCA 2H9YA 1TQHA 3AILA 3R3XA 3ICWA 4NS4A 4FMPA 3FBWA 3PE6A 2C0PA 4N8SA 2HU8A 4HZGA 2OCGA 1MNAA 3VXKA 4UBLA 4Q3OA 3G0IA 4L9AA 1QLWA 3HZOA 4AMZA 5IVKA 2GZSA 3DL4A 5EIAA 5AM4A 3BIXA 2WHRA 4BZZA 4L72A 2QXTA 3GFFA 4U2CA 2ZYSA 3R3WA 3V1MA 4KACA 3MGAA 2XQIA 1XRNA 3QZUA 2O2HA 1DWQA 2PPLA 1E89A 3FSGA 4G1FA 5AI5A 1XLWA 1IMJA 3ZLTA 5JD5A 1JMYA 1IUNA 7YASA 3I6MA 4U2FA 5C8VA 2XUOA 3HJUA 1K8QA 4Z49A 2GBFA 4Y9SA 2XUPA 5LP1A 4W1SA 1ETHA 3I28A 3O4IA 4X93A 2WM2A 1F6WA 4O08A 2JGMA 2QUAA 5AKHA 2XQFA 2BCEA 2J3QA 5ALQA 1MPXA 4K6KA 3OM8A 2PSHA 5CXXA 4BB0A 1BN6A 4FWBA 2CEKA 3W04A 4X7BA 2PX6A 1A7UA 3A2LA 3M83A 4Y2PA 2WUDA 5BV7A 1E3QA 5CMLA 3R3YA 2WQZA 2WIKA 1IVYA 4KE8A 1WB4A 3EQ8A 4DNQA 1K6EA 4WFKA 1IZ8A 2Y2UA 1NX9A 3TGLA 1JJBA 1Q83A 2J4CA 4F21A 1CV2A 4TPKA 4KAAA 1JJIA 1UWCA 3C43A 5LZ9A 2XMRA 2OCLA 5A62A 2O2GA 6YASA 2QRUA 5HZGA 4U2BA 1B41A 4UBKA 3PF8A 1EX9A 2V98A 3CCBA 3M3DA 1AQLA 1RYYA 2HIHA 2VAXA 2FJ0A 3P2MA 4S0XA 3NGMA 3MUOA 4EBBA 4G8DA 4QWMA 4B83A 1Z68A 1RWQA 2R11A 5DNVA 5ALHA 3ZV7A 4YPVA 4UUQA 1CUDA 4Q3LA 4FBMA 2HM7A 4UHFA 4AZ0A 1A8SA 2D5LA 4BAZA 3ANSA 1T4MA 3V48A 1UK6A 4J0HA 4DSZA 4HS9A 4C01A 3CN9A 4FLFA 1YB6A 3CXUA 1CUGA 5CT9A 3TJMA 2WILA 3FYUC 3HLKA 2AJBA 1CUXA 3R3ZA 2RAUA 1GPLA 4M0FA 3MVEA 1R4ZA 2X8BA 3VJLA 3VDXA 5AKGA 2O7RA 5ALEA 1QZ3A 4BRZA 1XFDA 1P0MA 1EXWA 1W1IA 1YAJA 1HDEA 3A2NA 5ALKA 4K6GA 1R50A 3BF7A 2VJDA 4AMYA 2PM8A 4X92A 1UFOA 4Q3KA 4B85A 5IVHA 3ZWQA 3G0GA 1ZI9A 1XZHA 4DTCA 4B0OA 4QLOA 4A16A 1XQYA 3W05A 5ESRA 1JFRA 1PJAA 4PQEA 4X91A 4UHEA 1TAHA 2CMFA 4W1QA 4DIUA 5A6VA 5IVDA 2OLEA 4DNOA 3FYUB 1R3DA 4H7HA 3I6ZA 2Y6UA 1XRRA 4IH1A 3DQZA 2W6CX 4ETWA 2O7VA 5AKLA 1CUBA 4MJ3A 2GYWA 4X90A 5A7HA 4QDOA 4BYMA 1F8UA 4QEKA 4MQLA 5A2GA 2XUJA 2GBCA 4XJVA 4WCVA 5JD4A 4WFJA 2Y1KA 4J03A 1UOOA 3QPDA 3IB3A 4F5ZA 2I3DA 3H2IA 3JYHA 1CUEA 1MX1A 4G9EA 1CUUA 1FFCA 5AKEA 4OB6A 3JWEA 4BZWA 5DYWA 1JU3A 1C4XA 1ODTC 2WFZA 4QNNA 4UHHA 3WL7A 2XLCA 4HXEB 4PV7A 5FV4A 3I1IA 2JGLA 5AOCA 3WI7A 4FNGA 2PBLA 1HLGA 5ALDA 5AIBA 4Y2TA 3JW8A 4HXGA 5LZ8A 5AH0A 1Y7HA 1DT5A 4ZV7A 4UFOA 5LZ4A 3G9XA 5AKYA 2BFNA 1ZJ5A 5CT6A 1QIEA 1WOMA 3T52A 1BEEA 4B0PA 1S8OA 1C7JA 4BCCA 5A71A 3DOHA 3BL8A 1LGYA 5ALMA 2OCIA 2HA7A 1XRMA 3QMVA 4CG2A 5C81A 5FPPA 3QMMA 5JZSA 2XT0A 1MNQA 4UHBA 4B9EA 4H7KA 4P9NA 3CN7A 4IO0A 4DLNA 3U0VA 2JF0A 3O0DA 4BBZA 4B80A 3LP5A 4XX1A 4OB7A 1TK3A 4G4IA 3AZQA 3FLEA 2WSLA 5AKZA 3I2KA 5YASA 1CVLA 4PSCA 4DGQA 4BP9A 3WZMA 1EB8A 4EY4A 1H2XA 3C6BA 4LXHA 2ROQA 2WIDA 3HXKA 3SWWA 2FUKA 4QDUA 3B3QA 2VTVA 5ALWA 1ZD2P 1L7RA 4Q1VA 1AMNA 4CI9A 1H2YA 4TGLA 1DQZA 2Y6VA 1TRHA 1VA5A 5K3CA 2H7YA 1J07A 1CUWA 3RKSA 1SOMA 3O9VA 3D0KA 1X2EA 1OXMA 3LLCA 4IQ4A 3WYNA 5JYCA 3S8YA 4GI1A 1XZKA 4KE7A 5FPQA 3R41A 4MXDA 3D2CA 3PUHA 4BP8A 1AZWA 4X6UA 3DKRA 3AZPA 4K5QA 3WKEA 1SCKA 3G9UA 4DMHA 3BJMA 5D3KA 4ZXFA 1O6GA 4B7ZA 1ZD4A 1N5RA 4IH4A 2WIGA 4ARAA 4LKOA 3PICA 2QT9A 3IVMA 1CUVA 2PUJA 4HRXA 4UBNA 2XMBA 4W1PA 4QWWA 1KU6A 2J4FA 1EK2A 1QFMA 1M33A 4E14A 2DHCA 2ZSHA 3ESDA 2VAVA 3M82A 4AX4A 2AJ8A 5HF6A 3WJ2A 3WMRA 1J2EA 2Z8ZA 1EI9A 2JGJA 1XROA 4N8DA 1ZGBA 5FKJA 4TVKA 3IA2A 2FJPA 5D6OA 5HFAA 4Q05A 1QIKA 3TRDA 3AZOA 5K3FA 2ZSIA 2VJCA 4N5IX 1R9MA 3ZLUA 1GPNA 4ZV9A 3L1IA 3OG9A 1X2BA 5H3HA 1XZIA 2EDCA 2YXPX 3IBTA 4BVJA 3ICVA 2OAEA 4PSDA 3WL8A 4YX9A 4EY5A 5JARA 4EA6A 1EINA 2WUFA 3PDCA 4WFIA 3WLAA 2PL5A 2QJRA 1U65A 3B12A 3RARA 1QO9A 4FDMA 3KWJA 3WK7A 4CG1A 4C88A 4EHBA 1GXSA 2IX9A 4DM7A 5K3EA 5AK5A 4F0JA 5ALUA 3H1AA 3I1YA 5AM5A 3PFCA 2GBGA 3D5EA 4CIAA 2HA3A 2AJDA 3WL5A 5JATA 3H19A 2GBIA 1LPAB 2VT7A 4UBOA 1MO2A 2OAGA 3R0VA 5ALPA 2HU5A 3PF9A 3W9UA 3IUJA 3H17A 3WZLA 4KAFA 5AI9A 3WIBA 4FKBA 1BEZA 3HI4A 1QTRA 1YS1X 1JJFA 3DNMA 1VJ5A 4OUKX 2G5PA 4MYSA 4G4JA 2V9ZA 3DL7A 3IUMA 3KD2A 2OPHA 1GGVA 4Y2UA 1XZEA 4DSAA 3EF3A 3FVRA 2H7CA 4QLAA 4H18A 4X00A 1FFDA 1CUYA 1EK1A 1LPSA 3HC7A 3X3HA 4OPMA 2GYVA 1EDBA 1VA4A 5T4HA 1MTZA 4H7JA 1WCYA 5E4YA 5ALFA 5E4TA 1J06A 1QE3A 5CH8A 4BVKA 2XUFA 2C0QA 4JH0A 4G8BA 4GDMA 5AK3A 4KYVA 4OCZA 3DYVA 3DLTA 3DOIA 3KSRA 4HRYA 2PSFA 4HXFB 4U2EA 1ZIYA 4FFWA 3DEAA 4NVRA 3GELA 2XLBA 2AXEA 3LIPA 5DYTA 4B9AA 1QIHA 4G8CA 4EZIA 3T4UA 4EB0A 2WG0A 2VEOA 1UKAA 3O95A 5EHZA 4KEAA 3WK5A 1CUIA 4RPCA 1DX4A 3GBSA 4CCWA 4ZI5A 5C8ZA 2DFPA 3WWDA 4OSEA 3IUQA 2QJWA 1VE6A 2JBWA 5JAUA 5JAOA 4BE9A 3UUEA 3WKAA 5KWIA 4M0EA 3GA7A 3H18A 4FLMA 1ODCA 1UKCA 4W1RA 3NWOA 3K6KA 2WLSA 1N5MA 1BCRA 4LYEA 4FFVA 4GEGA 3MUNA 1XZLA 3L1HA 5JALA 1LPBB 4I19A 1DINA 1NU8A 1EB9A 1YS2X 4B81A 1YSCA 2XDWA 2OQVA 1QIGA 1G66A 5JD6A 3IIIA 1LLFA 1SC9A 2XMSA 3ZI7A 4B84A 4UBMA 3D7RA 2Z3WA 4IHAA 2Y2VA
chains in the Genus database with same CATH superfamily
4ND4A 4RCZA 4JEUA 3M3HA 3DYBA 3D2BA 1FLNA 4YY3B 3UWOA 5FYQA 1T0UA 1DRUA 2VXOA 4JOBA 3FFTA 5M34A 2C96A 3SE7A 2E9SA 1XUOA 4A1FA 4ERNA 3H6KA 1NJSA 3EHDA 1NN5A 4B4WA 5ECYA 2OEPA 3SBDA 2ZP1A 3I2YX 1OZFA 4F72A 4K7JA 4ME6A 4RPGA 5HKOA 1FK8A 1R6BX 1KKMA 3K2EA 3QUAA 3RVOA 1XAHA 2P2GA 2FN7A 1QHHA 2DR0A 3CF6R 4NC9A 4WA7A 1HRDA 4XKJA 3BRQA 2XX3A 3M6AA 3MJCA 3FVQA 1QYVA 4IJ5A 4OP1A 4P5DA 3EQ7A 4A0QA 4A2PA 4PAQA 4OTZA 4UBIA 1R3UA 2GHRA 4LJ4A 4ILEA 1C9IA 2VNHA 1AJEA 1J5XA 2YXEA 3KSMA 2PWBA 1PZFA 2YIVX 3EI2A 1OJ7A 3T95A 2GAAA 4QXQA 1D07A 1YTLA 2FUG6 2FRDC 3UMVA 3T3MB 2XNJA 1KOGA 3HMKA 4ZAXA 1NFRA 1NG1A 2X8WA 5ALGA 2NU8A 3T41A 3N8DA 3OQMA 3MMZA 2WSIA 1U3WA 4HEQA 4C07A 2RB5A 3HB4X 4RDHA 1A9SA 5HKBA 1TYAE 2IPAB 5COQA 2TS1A 3QBVA 5B4TA 5AVRA 1A4RA 1KYYA 1QU2A 3FR7A 5ELMA 3KKNA 1VHQA 3TD6A 4RV4A 2XE6A 4KG7A 4EW6A 3QI0A 5A6SB 2B8WA 4PBRA 2GVDC 4LIPD 2ZVJA 2O7SA 2SICE 3KR9A 4PSVA 5KNBH 4CNQA 2XEDA 3HNOA 4CUJA 3EZ7A 2FX3A 3HA7A 4LPSA 1JV2B 5K09A 1VCNA 2Z4SA 3IE2A 1UFVA 4R9UC 1QRUA 1VIMA 4BMZA 1QKJA 3ACCA 3AINA 3BRWD 3IXQA 1JHQA 2EFGA 3L04A 4FX2A 1YR3A 5EIWA 5IXJA 3OEHA 1BGVA 2P9IC 2ZRLA 2ORIA 4JI4B 3A6FA 4G26A 3PQ3A 1WA5A 2GJSA 4XQ0A 2NGRA 4JJ6A 3VM6A 1R0LA 1OB5A 3FLAA 3EPHA 2UXCB 3MT8A 3I9JA 3BFVA 2BBTA 3QPBA 2PUVA 2ZUVA 3THXB 5I5EA 3JQQA 2FR1A 4PHFA 1XALA 3UGJA 3GZJA 5CM8B 5TXGA 3B9BA 2W4MA 4N18A 5BW5A 4EEKA 4P08A 5BO5A 2VZ3A 1MH9A 3GCGA 1E63A 3B7PA 5GAJA 3CO5A 1P9WA 3CR3C 3QTBA 3USZA 3R6GA 3TTWA 1DEAA 4O0MA 2YMQA 3DBHA 3UFXA 1F2TA 4NSNA 4FOSA 4GRIA 1RLJA 4BN4A 4HJXA 3H6GA 2XSZD 1LBHA 2O1WA 3AI7A 4MEAA 4YVFA 4HBGA 4ZO4A 4HGPA 4LOKA 4FFDA 4H1UA 2ZIEA 3AVYA 3LVBA 2VDMB 2WMOB 3DWFA 4HB0A 4L4XA 4QOJA 1F0KA 1IIBA 1OU0A 2IYYA 2RGAA 1CB7A 4ZO6A 4LBYA 1PL0A 4HLNA 4QA9A 1CULC 5E0OA 4FEEA 4HNGA 3GROA 3GLUA 2J48A 3ETLA 4MV4A 4UTXA 1JVNA 1MQSA 1XEXA 4ARZB 1KI7A 2DF8A 4UARA 2FR8A 1D5CA 2XB6A 3N28A 4KWEA 3GREA 3O6VA 1DS6A 3SYTA 3DBRB 4Q9KA 1RMYA 4EG4A 2AG0A 4Z4CA 5EHIA 2W6NA 1BDJA 3MIIA 2PGLA 2HSWA 3MTGA 4MIYA 3G02A 3M4NA 4AK9A 1SOVA 4B3HA 5DW3A 3I2FA 1Y4UA 4DLRA 1SUAA 1KPHA 4H5JA 2QM3A 1OBFO 5FJIA 2JAWA 3GGCA 4M37A 4NDAA 2ODQA 4PHHA 1A5SB 5F35A 3V33A 4AZWA 5FUMA 5JHGB 4GYKA 3E3NA 2NSHA 1WXFA 2B0CA 1U2PA 2ASVA 2QV7A 2WAOA 2PLFA 3GP3A 4TV9B 5AJZA 5JQGA 5LMNB 4V0OA 3SFZA 3GDGA 3REFA 1UH5A 1UPAA 2CVZA 2VRCA 1XU4A 4D80A 1CDEA 1LPMA 2R25B 4YV7A 5KYUB 5IT9A 2WWWA 3WRXA 4B33A 1OREA 1R7RA 3JQGA 3WGTA 2C3OA 5BUZA 3PB3A 4Q6WA 2EZ8A 3BUSA 4NCKA 4M3NA 1U81A 1VE5A 2YRFA 5KWEA 3D6NB 2XTJA 3G0CA 5KPDA 1Q95A 3FI0A 4NJMB 1E0DA 3MPUA 4L16A 2NYAA 4D8VA 1XTZA 3O4HA 1DXHA 1GYQA 3G9ZA 1P3JA 2QS9A 1B93A 2VH1A 2H7XA 4BKMA 5K0ZA 5EZYB 1LV7A 3IAS6 3ADDA 2H4ZA 4LCBA 2BEKA 4HGYA 2HHHB 3MSCA 1T1JA 1EGQA 1F2UA 2H57A 3N1UA 5JTTA 4RBNA 1XTBA 2UZ0A 1CZHA 3MTAA 1ZA2A 5DB4A 4K9OA 4AN1A 3UF0A 4URZR 5ITZB 4DPKA 1V26A 2E3JA 3VU3A 2OWEA 3DLCA 1U4SA 4OZUA 3ELDA 3HI6A 2VT3A 3R44A 3PUIA 2NZ2A 2IYTA 2O06A 2V03A 4GBJA 2C92A 2P9QA 1LNSA 3A1CA 1CJSA 1C81A 3CJTA 1CHNA 4FGJA 3HN6A 2PS0A 2OGSA 1FRNA 4MLDA 4URUR 5AVTA 1I4TD 4XPIB 2CZCA 4WLVA 2GN4A 2HCBA 3GJXC 4LCJA 4XDHA 4AKHA 2XUAA 1DTEA 4N9QA 4CM7A 2B5VA 4H4DA 4F8JA 3FSRA 3MT9A 1G3RA 1YBFA 4UCFA 2X2FA 3OLZA 1UC4B 5JAPA 5REQB 3JTEA 2XB2A 3OEED 4RL4A 1MX5A 4PLZA 4CN9A 5BR8B 2POQX 5I4CA 4A91A 5C53B 4RK4A 4X1KA 4FYMA 1EP3B 2HJBA 1WCIA 1TVKB 2R7MA 2FOIA 1IYZA 3I62A 1HY3A 1QS0A 2Y9MB 4FCCA 1TKCA 1WVGA 4DCPA 3COWA 3ESYA 3INGA 1Y3IA 1BRMA 5DNAA 1TYQC 1I7NA 4RDXA 3RIEA 4CV1A 1GU7A 3B52X 3CVWA 2H9AA 3T34A 4CIVA 2P2NA 3BA6A 4MIOA 5AHXA 4YUVA 1C8KA 2AH5A 2OR3A 3ESRA 2FZVA 2C9OA 1X70A 5FLKA 5K05A 1HETA 2JKXA 5A1JA 4LZJA 5IM4A 2DOKA 2A1TR 3MMYA 1GN8A 3H5IA 3P7MA 4M1ZA 4RHXA 4DABA 3G2JA 3B36A 1K8KC 1SCIA 4E88A 2PRZA 4CQJA 5AP9A 4F06A 1K2VN 2LDXA 4Z7OB 1T0PA 1K89A 3F0TA 3MRXA 3L1UA 3AFNA 5A0VA 1SKBA 5B1DA 2FCAA 2QVGA 3DZ8A 1D4FA 4RD6A 2GRAA 3M6VA 2RDMA 3AUFA 4GO1A 4PINA 1PNTA 2IHZA 1GD1O 5EIEA 4E30A 2CJFA 3N2GB 3TM4A 4ERZA 2GA8A 3NVKI 1VMKA 4DR6B 1GO2A 2JLQA 5FCDA 3VPDA 2WABA 1GFIA 1YZNA 2R9VA 1JQ3A 3ASZA 4JODA 4K28A 3H5AA 4KQ9A 1ESDA 1EGHA 4IVPA 3MS4A 4IF6A 3Q8XB 4FR0A 4LBWA 4LYJA 5E6RB 4DBZA 3Q3JB 1BW9A 2FPOA 4E5MA 2WB2A 3V6LA 3P8ZA 4AB1A 3OHMA 3I6BA 2CL7X 4TM8A 5AJWA 3T1NA 1WL8A 4RF3A 1B8VA 3F6RA 4L3WA 5I5GA 4C6TB 4X84A 4B4OA 3C87A 4G0XA 4M0KA 3U09A 2IPXA 3BTOA 3IV6A 4ZYTA 1CLEA 1XVAA 1IOWA 4WK2A 4RKFA 5KTPA 4CGZA 1ZMXA 3L7CA 4TKMA 2HJGA 2P9PC 1RKQA 1YKSA 3EA0A 3HRIA 4RF2A 4I1OA 2CMHA 5ALVA 4KE9A 1E6CA 3W8EA 4BBAA 1EFHA 3CNQS 5KUTA 3ZDZA 2QU7A 4V03A 1K63A 4RD0A 3FZNA 3H9QA 2DBZA 4W8OA 4E5DA 3OX4A 2GFIA 5ES3A 4EB8A 2ORYA 3CB2A 4IJKA 4KL8S 4GW3A 4Y1FA 2OYRA 2E2WA 1NFQA 1Y7TA 3JZGA 1ZI6A 3A1UA 5JISA 1QFSA 3O1IC 5K1CC 3NT4A 2WA1A 4L5BA 2YXDA 5EFZA 2BFWA 3BTVA 2I76A 1I2ZA 2OZEA 1SIBE 5EE0A 1K5DA 1BX0A 1M3SA 3JQPA 1LSJA 2X0JA 4QDTA 4GKJB 1C9LA 1KJ9A 3HNRA 4OA8A 3DZKA 4D9CA 3KQOA 4EAAA 4DQVA 1T9GS 1R8XA 1CYDA 1LX6A 2DBVO 4PAOA 1OLXA 1TC2A 3FCUB 2Q99A 4UZSA 5KVQA 1UAGA 4BLSA 1YK0A 4ZZ0A 3U16A 3FVTA 3KQTA 1NN1A 5E6UA 3CUYA 4Z7QA 3HP4A 1UCFA 3O9ZA 3QBJA 4TXJA 2OO5A 3F46A 1G5HA 4PF1A 2C99A 1K9SA 4K9DA 3ZDXB 1L7AA 2IDMA 4FFNA 3TVTA 2I67A 1F6BA 3E61A 3KM0A 1DQYA 5EXDA 1EVEA 5F9MA 1IN8A 2EL7A 2PU5A 2DJ5A 1HLDA 2OPBA 3R1IA 3WGJA 1A76A 4WE3A 3JAWA 4C9BA 1YWGO 2QNRA 3N9IA 5ALLA 3L7IA 2NVBA 5AHWA 3S2UA 4CKYA 4J91A 5EXSA 4PWZA 5E9AA 4KHPB 1I51A 3OETA 4RJKA 3ELYA 2HBYA 4A0BB 2I4MA 3CONA 4MVCA 2VIIA 1IG3A 4EA8A 1Z6QA 1GAQA 2DWOA 4NYIQ 5KKNB 1ENYA 2WEKA 4Y6GB 5HDBB 3C8HA 2CBGA 2FOXA 4HCJA 5JZBA 5LQUA 5M2QA 4XD7A 2ANBA 3OVMA 3WLMA 4QO7A 4URHA 3BG1A 3U13A 5FUYA 4A8JB 4I9UA 3C6ZA 5AESA 1EFLA 1ZU4A 2CJWB 3D2AA 3H5OA 1DOZA 3V1YA 4X7MA 3QVWA 5GZ1A 5HSGA 1T0IA 3DMNA 3EGXB 5FA5B 1X1CA 4YRCA 1F2TB 4JC4A 1MX9A 4MSUA 4WVLA 5EFOA 3F8TA 1V11A 1Q0SA 1SM4A 1TVKA 3LECA 3OLYA 4HDMA 3LGXA 4UUAA 4V2UA 4IQ0A 5G02A 3T7CA 2WTMA 3TE6A 3WADA 5ABPA 1U2EA 1X1BA 3J7AC 3OIUA 2ZYIA 1L1EA 3HJGA 3IP1A 3OU7A 4HFRA 3J81g 2I2AA 4IVNA 4NZ9A 4MVJH 3RJMA 3RUEA 3V1UA 3IIWA 3SF8B 3H5RA 3KZMA 1Q0TA 4XJTA 3LT2A 3LUKA 3U9TA 3CA8A 1JIKA 1ZOOA 3L4OD 1QJ4A 5DSZA 3QLVA 1EFTA 4Y2QA 1DRWA 2QPOA 4S05A 1RWBA 1K7CA 3OT4A 3FGZA 1TJ5A 4TUYF 5A9TA 3THOA 1QONA 3AF1A 3FCAA 3K5WA 3EQ6A 3IPLA 3P5SA 2GPBA 1KMCA 3A70A 2YR0A 4XVHA 4I08A 5AHRA 2OE2A 3TOZA 4NAHA 2GO1A 4PYNA 1M1UA 1OASA 1YOVA 4OQMA 2HLNA 3H3FA 1X7ZA 3H9BA 4LDJA 3SP1A 4ALKA 3L4MD 1I4EB 2HO4A 4Z4QA 4C0JA 3BG5A 5DGTA 1CFZA 4REQA 2AC2A 3B9PA 3K1YA 4EUFA 5L3ZA 1W34A 2ERCA 5T64A 4CC9A 1ZD1A 9ATCA 1H2FA 1X7WB 1L5HB 5L6MB 3K09C 3B13B 1ODIA 2VTKA 4ARSA 2V59A 1J2RA 1N77A 2BYTA 1VHWA 1XE3A 4ND6A 1G9XA 1RYBA 3KHKA 4NBSA 3TKYA 3A3OA 3NBZC 3RHFA 3OF7A 3QFSA 4RHTA 1TD9A 5AKKA 2YINC 4MKRA 3DE7X 2GM9A 3CXRA 4RPLA 1E4OA 5T4BA 4HVLA 3SQLA 4F7WA 1SKUA 1UODA 1BYIA 2B82A 3S68A 3TL6A 1M34B 1II9A 1NP3A 2HXSA 4IJQA 3F8SA 5E2AA 3LXUX 1E2HA 2ZB7A 2H1VA 1ICEA 4WFQA 4BVBA 4G0WA 1YR1A 4QGFA 3KJXA 1EGVB 3AHCA 4Z7NA 2DEUA 1OI4A 4BRWA 3E7XA 3FAKA 3IE0A 2XA2A 3KLMX 5LKAA 3AFHA 4MS3B 1JAXA 3UCEA 1XIVA 5BSFA 2JLWA 5F7XA 3QBDA 3P0EA 4HDQB 1HKUA 2C5EA 3EUFA 2VWPA 2WT4A 6PFKA 2IITA 4HDOB 1EGMB 3CUVA 2P2CA 3S0JA 1F4LA 2Z2NA 2ZIWB 1J22A 1UZMA 5GM2A 2GASA 3PXCX 3WGYA 1S1CA 1YOBA 2HTFA 3LK7A 1Y34E 3H2YA 2ZCUA 2X8JB 2BLNA 1JXQA 4UAUA 1GKIA 2APJA 4J29A 1LSOA 1OYYA 1NBEA 5AT1A 5T4FA 3TSWA 3QU5A 1LI7A 2ZBQA 2PRIA 2OGTA 2I7DA 2PGOA 5EMKA 2A5DA 3DAPA 3LYUA 2CC2A 4DCTA 4O1MA 3NX4A 2NIPA 4UE6A 1XYGA 4RLSA 4QATA 4EUNA 1D6JA 3AF0A 2B92A 2DPLA 3AKDA 3E5HA 2JIOA 3LY9A 1UANA 3KKEA 2EIXA 3V42A 5JPCA 4P35A 1S4QA 1ZBQA 3PLRA 3K09A 1Z74A 2ZS9A 5DT9A 4TMZA 1JH8A 2EEZA 2BH9A 1G8AA 3VR2A 4JVNA 4QYTA 1YJQA 4M8IA 3DSRA 4JHXA 3D81A 3DVAB 4FJ0A 3TI9A 4ALLA 4TTSA 3ICQB 1M67A 2DUJA 4KO2S 3MW8A 2OO3A 4HPJB 3RSCA 4LAFA 2EZ9A 3B85A 4AJLA 2NM0A 2CB0A 2QQGA 1ODSA 1OW3B 2ZI4A 3ABIA 3FCEA 4MUYA 2QN3A 3JD1A 3IKMB 4YI3A 4RTNA 1OXVA 2WU0A 4CVNA 1RBYA 3ERCA 1SXIA 1CJMA 5FOSA 1JQEA 1KR5A 2J0UA 4RE5A 1JLHA 3V7DB 2KX7A 3OIFA 2X9GA 4M76B 4Z1MA 1HE8B 3I12A 3PUVA 4D44A 4A6XA 4D7AA 4ZEMA 3R3VA 4EFMA 2IYSA 3EBPA 3TQFA 3RANA 1EA5A 1Z4MA 1HEIA 3C1OA 3CBGA 3FFXA 1N0VC 3SKVA 2CL5A 1OWOA 2GUGA 1KH3A 2JCSA 2DE0X 3Q15C 4POOA 3O1JC 1NVVR 1PGUA 2CMKA 4KH0A 1SD2A 3O3OB 3QTTA 2B5LA 1A27A 1W46A 2OQ2A 4IUDS 1WTAA 4L8LA 2ATXA 3PJRA 1SKAA 2CZGA 2JGDA 4ZQHA 1RTTA 3SEZA 1EQAA 3HB5X 1M1XB 4D9NA 4HB4A 4DCOA 1LFAA 3X43A 2V7QA 3ACDA 1WJGA 1Z2DA 1NVMB 3WGNA 2IH5A 2Y4OA 1R8JA 3WDSA 3OSUA 3UG7A 2OT3B 2X3UA 1Z38A 3VOBA 1BO6A 3I9NA 2CN3A 1VHLA 2Q62A 1QIDA 2C57A 2GPNA 1O95D 1V35A 2GWHA 5FT9A 2ZOSA 1Z06A 4OHUA 3BG0A 1L4GA 1NSYA 3KKKA 4ASUA 1UXGA 4I6GA 2ZUBA 3B1ZA 1WP4A 2QT0A 5HUHA 4C04A 1V6CA 3QHYB 4Q9IA 1RVV1 3H5TA 3WL6A 1HGXA 3BQNB 3VDNB 1GGKA 1OI3A 1PGOA 2CCGA 3PIDA 3A4NA 5FI1B 4R8KA 1LWOA 4IXNA 3VV2A 5KWSA 5C3MA 5AJYA 4LN1A 3ABSB 2C5FA 1TTQB 2QVXX 1H1DA 3I1FA 5HCUA 3GLQA 4FHDA 4PFSA 4ZHQA 5LJIA 3JQAD 3ZCUA 5BY2A 2XRFA 4YLGA 2JC3A 1MG3A 4P93A 3HLYA 1EIZA 4LJ7A 2IYZA 3F6YA 2AHRA 1QCZA 3L01A 1K5GA 2IEGA 3STUA 3KV3O 4RE6A 2BUCA 2G80A 3FYSA 3KZVA 3Q7EA 2WFLA 1NR5A 3EPPA 3DPIA 1PFQA 4LYHA 4P5PA 4Y7CA 2Z3VA 3WHLA 2QX9A 4B2LA 3BCSA 3RABA 1EDEA 4IKEA 4QICA 1W0JA 4P7FA 3EPRA 3CUUA 3RIHA 1X7XA 4Z9FA 2HESX 2JFYA 4J0JA 4MWSA 2VXYA 2I2CA 1IHDA 4EDHA 2HNAA 3AF2A 3GA5A 3ME5A 4J75A 5DF1A 2AKAB 5AYVA 3EZFA 4U7DA 3IJCA 3CU5A 3GFSA 3PC7A 4FYWA 1ZPDA 1J8MF 2E4UA 4NG5A 2UUOA 3U3KA 3WV5A 3N59A 1J0DA 3WGHA 2XUKA 2IEYA 3NI2A 3NU1A 2VJQA 3PDIA 4YAKA 5IVIA 1B74A 5BQ3A 5JNTA 3DYIA 4GPEA 4CIDA 1G63A 1XKLA 2AWOA 4JP3A 1W4LA 1AK2A 1U04A 2HWWA 4WBXC 5FWXA 4X65B 3HSSA 4K2AA 1MZVA 2BGNA 1NVBA 2RI6A 5EPUA 3ZWAA 2GTHA 1C8VB 5JXWA 1YA6A 3BSWA 4DZRA 4K9RA 4DXAA 1PGQA 5HK8A 3KZOA 1PV4A 3BXPA 4C7XA 1VE3A 1EH5A 1KP2A 3CW8X 3S44A 2Z2KA 3CCFA 4Z4EA 1RYMA 3KPUA 3H13A 5K7SA 2HK9A 4QDZA 3GFVA 4OHOA 4WXYB 5ALSA 3CV3A 1RCTE 3COSA 3DMHA 2I6SA 1YL6A 2OBBA 3GT7A 1JFSA 1I8TA 3OZRA 2CNBA 4ACBA 4R31A 2CLEB 1C1DB 3FOBA 5FQNA 5HTKA 4ACAA 1O03A 3CKMA 3QLUC 3GJYA 3NH6A 4P4SB 4R9RA 1SG6A 5DX0A 1OH7A 2YNMC 2LNDA 3KLOA 3TLMA 1R4MB 3CRVA 4KXFB 4YRRA 4U0KA 1R00A 1WBDA 1BGWA 1VYTA 3M5CA 3LUHA 3LNTA 3EVDA 1JH9A 2FZGA 4HSGA 4FKZA 3UMJA 3EVNA 1ACJA 1NR1A 4X6YA 3WGOA 3P0HA 3MB8A 4LYDA 3JQFC 4Q3NA 2D7JA 4REMA 1Y8ZA 1JKMA 2YNMD 3AMVA 1JSLA 2DHDA 4R3WA 3NT2A 5EAIA 1D4ZA 1W4AA 3AM1A 3R9KA 4NSXA 2W6IA 5IC4A 3KEOA 1H2HA 1GTL1 4YRAA 8LDHA 5KWVA 1P0PA 2A8YA 1JG4A 3LUCA 4FHEA 1EP9A 2WJIA 2R2AA 2C9BA 4PPNA 4XLTA 3OMXA 2RGRA 1NVGA 3ESAA 3OPQA 5EVJA 1KVQA 1Y4DE 2IY8A 3ZU3A 2PXCA 4BWYA 4DG8A 3HVJA 4LY6A 3C5WP 3ZE9A 3I5YA 1DMSA 1S2LA 1NPYA 2BTQB 3PSAA 2FVYA 3QFCA 4IQGA 2QP3A 1C0KA 4WOJA 4DRYA 4NU0A 3OQOA 1JEAA 1NG9A 4JB0A 1ZUWA 5DX8A 5EUMA 2Q7XA 3OFNA 5F12A 5FQOA 5BN5B 1DUIA 1ZOLA 2R6JA 4IXWA 3U7IA 2EW1A 4GRDA 1Z29A 4A11A 1RTKA 3FRIA 4CM3A 4Z1MD 2KLBA 2IXBA 2Y0DA 4G67A 4I8IA 2ZJ6A 4NE9A 1GZ5A 2OXEA 3FGOA 2YASA 3Q0EA 5EJ6A 3TE7A 4ZOQI 3HYSA 3ZJ5A 4HZUB 2FE1A 1RJWA 3K2BA 3NM5A 4P4NA 2VDOB 5GWXA 3SYMA 4PPGA 5GONF 4PNZA 3I6YA 4N41A 2Y0BA 3MJ4A 3OTIA 3LRPA 3N8KA 1PJQA 3GLHA 4OYLA 5IHPA 1SK9A 1OMWB 2P5YA 1MIHA 3GB9A 3GYGA 2QOEA 3C8ZA 5C8YB 3P94A 4TRMA 4UM9D 1BDBA 1WSDA 2C1EA 2H1WA 3C7CB 3PNBA 1Z5ZA 3C85A 4B82A 5F5NA 1K3TA 4ALIA 5JZ9A 4J79A 1CZLA 3RQSA 2EGGA 4WY5A 4AXXA 1WZ2A 1G5FA 1P5ZB 3BD8A 3EB9A 2QR2A 5KINB 1DAGA 1E66A 4UNQA 4LNUB 2AD1A 4B6QA 3OA2A 1LI5A 2GHTA 3LQ1A 4NBKA 4EP1A 5L95A 3GH3A 4EENA 3WP0A 3K32A 4HDNB 1GUZA 1QRAA 2CVOA 2OCBA 2VF5X 3COVA 2PUBA 3Q85A 4JWTA 5IFKA 3R3UA 4NRDA 1VL6A 5C32A 5C34B 5EHQA 2XNKA 3NHYA 1MOQA 5FFGA 1Q3KA 3TQSA 4N1AA 2BM1A 4HAXA 2O2XA 1CY8A 3B6ZA 5CP8A 1XTVA 3B9QA 3LL4A 4FYKA 1Z63A 2MT9A 2QTVA 1YDEA 4ARBA 4KFRA 4IF4A 4X85A 1Z5GA 1CR1A 1K7FB 1Y6QA 2FDRA 1O9GA 1YVRA 3D8TA 3SEFA 4C5AA 1PK7A 4I9FA 2JEYA 1NXSA 4OO3A 3IHTA 3ZH2A 4LDQA 4W5OA 2NTEA 2Z08A 5G0WA 1E7SA 1CUFA 1M0TA 5HE9A 4RA6B 3K8YA 4R1QA 2GZAA 1JDNA 1LDMA 1T8SA 3ZUGA 2BTOA 3L0DA 5DIFA 5EI5A 1UBHS 2GJ9A 2PS3A 1KYTA 2GPTA 4OLFA 5T3UA 2VCYA 5K0SA 1U2QA 2LIVA 2RKWA 1P1IA 1CY6A 3I04A 1K08A 1ZM2A 3WJAA 4QJIA 3S81A 4N5NA 2I3AA 3V6MA 4LXUA 1C9EA 2PBZA 2F8LA 4S12A 5DCLA 3F9CA 3T5GA 3BE8A 3PXUA 2BFCB 5AJHA 5F2NA 5ENVA 2D62A 4J2OA 2BGGA 3FPFA 3PC3A 4QXOA 1Q7TA 5FPTA 1S8FA 1JFFB 3C3PA 3C45A 3SX4A 3DTTA 1UT5A 2RHDA 3M7IA 2O59A 3UVOA 1P0IA 3HU1A 3UMGA 4AG3A 1L5ZA 1NIJA 3N2ZB 4DA6A 3B7FA 4AP9A 5A4JA 1J8FA 4REOA 1EE9A 3GX1A 3F6SA 1L4NA 2QN8A 3DWGA 4I55F 3PRJA 2RJNA 3OQIB 5GVRA 4KRXA 3UHAA 3ZBPA 4NHEA 1B0AA 3ZWPA 3G0BA 1U11A 1HOXA 1ISGA 1KSHA 2UUPA 1QDEA 4MK4A 1TBGA 2V7VA 3AJAA 1OY1A 1VJDA 5GJWC 2LDBA 3EZ6A 2P8JA 3W79A 1SQFA 2JH9A 3RIMA 1M0SA 1AHIA 1PQUA 2Q2NA 4LC0A 1NJ8A 4PO8A 1DCTA 5KMGA 1VIDA 1U9ZA 4KJXA 4GHWA 1PFGA 4HNAB 1WZIA 3C3KA 2EZ4A 3EASA 4TXMA 5E7JA 1XL1A 9MHTA 5H4HA 4CTKA 1XZ8A 2SKDA 2WD7B 2GYYA 1IXKA 2PBRA 3GUUA 1SU7A 3LJKA 1CDDA 4NNPA 3U7RA 5IYZB 2PH1A 3VAZA 5EESA 1SMKA 4L02A 2XL3A 1GUAA 1DXQA 1NI3A 2I1WA 3GJ8A 5JS6A 4B75A 1PVDA 2V97A 1WR8A 2MMCA 1KO4A 3GOHA 3MWEB 4YRFA 2ATEA 2L2QA 1K5PA 2A9PA 2WP8J 4YMIA 1HQDA 2XIQA 2WAYA 4KLCA 3VI3B 1EK5A 3W9YA 5EMNA 4BNYA 2F90A 4PWYA 2OJYA 4Z0NA 5CH5A 4QYMA 4AKEA 3U3OA 1QG4A 2O2DA 5CJPA 3F1KA 2C7OA 4JLJA 4B17A 2JJ8A 4D6YA 5K8UA 4TYYA 1ZK3A 2AIRA 3QEJA 4AS1A 3KXPA 2ATVA 3O9MA 1AUXA 5E6SB 3Q87B 1ID8A 4ZOLF 2JA1A 1I14A 1E1LA 4FIZA 4L4UA 2IRWA 4D45A 3QEKA 4Q7EA 5E6RA 4DXHA 1KKLA 2JLRA 3LBYA 3DM0A 3TLYA 3ZHCA 4OHFA 1UMBA 3N2NA 3OLCX 4C0LA 3ORQA 1QRDA 4JL5A 1CF4A 1HNZB 3QE0A 4V0QA 4XGNA 2WAAA 1D6NA 1JUDA 3N0RA 3GFRA 3BWYA 3K5IA 3BRSA 2AV6A 2OVPB 1KARA 1C1XA 4HMOA 4LSMA 3SZGA 3ZC3A 3SMQA 1FMLA 3NS7A 1Q12A 4R2WA 1XU7A 2QTMA 2V96A 2MU1A 4M99A 3NT5A 1PRYA 2CMGA 2OM2A 4RK5A 5IJAA 1XNHA 2KSQA 3VR3A 1A9ZA 2P69A 4KE6A 5A7GA 4M86A 1YZGA 2GN0A 4OXNA 3ZHOA 3EWSA 2XQVA 1KBOA 2PZFA 2Z6VA 1N8TA 4JELA 3JZMA 3EBOA 3QHQA 4KFUA 1V1RB 1X0VA 1Q1EA 1XZMA 1YO6A 3CNOA 5JUWA 5KU7A 2HPVA 3G8CA 5KYNA 2FPIA 3B1WA 3BIWA 4WA8A 2XUHA 4AJIA 3DHVA 3KVRA 4XWTA 4G0MA 4BFVA 5FTLA 4RZSA 3QFFA 3HFGA 1QQAA 1F8GA 2K87A 2B2XA 1GL9B 4LJ6A 4S35A 3ZR4B 4QDKA 1CXZA 5FWXB 2WG2A 4PYOA 3ZWKA 3FW1A 2W2TA 4BX3A 1V4VA 3TX6A 5CEEA 4H7FA 3EI4B 1TQ6A 3OIWA 1P7VA 3N5KA 4CKXA 3ZY4A 2B99A 1AB6A 1MVNA 2OORA 4RFSA 2F4NA 1YA4A 1KO1A 3R9WA 4UUPA 3CY6A 2RHTA 3CWZA 4BZQA 4DEYA 3EEBA 5J2TB 2AOVA 2FB9A 3VVMA 2OCYC 5B7PA 4CGYA 2VHJA 4TM7A 4G5SA 4K03A 3NYIA 3T5BA 2GJKA 1RXCA 3AEXA 4KBYA 2BFOA 3JPXA 3K96A 5HW0A 2YHUA 1NJGA 1WUYA 3HR7A 5C3UA 4CG3A 1EWQA 4HF7A 2GB4A 1I7DA 1KC1A 1RWPA 4E70A 3K71B 5HF8A 3QYFA 3BN3A 1NASA 5HK9A 1YB7A 4X1OA 3DDHA 2FN3A 4PHTA 3UMSA 2H14A 2PA0A 5HG0A 2OGZA 1A1VA 4Q9JA 5CX1A 3IDOA 3P9XA 1FYVA 1BSVA 3OWOA 1Z2OX 2JJQA 1QWSA 1VB3A 1XZJA 1Y3BE 2Q4TA 3FLBA 4KXXA 2Q5CA 2C7VA 2IYLD 3SHTA 1SUWA 5FH9A 5CYGA 3R6LA 4TUYA 2L82A 4FS3A 3AM4A 4HBZA 1DO2A 4Q4AA 4R3UC 2ID8A 4M1KA 1NVKA 4W9NC 3UOWA 4DLYA 3WK6A 1UK8A 3L7MA 2V4UA 4NOKA 5MN5A 2HV9A 2DULA 2PRJA 3GAAA 4Z0TA 3VNQA 1G7CA 3HO1A 3GFQA 5IT5A 1D1SA 2OK7A 2JJ1D 2E1RA 3ROGA 3BJEA 2YHAA 1QF9A 3BB1A 2ZS7A 2DSTA 1N0WA 4MV0A 2P0EA 4NMMA 4BQPA 3D7SA 1SOUA 1ZHHA 3DB2A 3DP7A 1RYEA 4GE3A 4HLQB 4RGQA 3ZX4A 4PSUA 3B38A 1CLUA 1U8CA 3O4JA 1TFUA 2B9VA 3H16A 2JGRA 4YA6A 3SLKA 3PI7A 4KVAA 4RM3A 3LA8A 3D7KA 3K9FC 1LVUA 1NUSA 2J8ZA 4RIEA 4FD2A 3Q11A 2A57A 3SC2B 1UQRA 5D1HA 4FHFA 5DLDA 3ZD9A 5CFOA 2WAMA 4YMGA 3DT9A 4PZ9A 3IR6A 4HAIA 4QQEA 3MYYA 2B4RO 2JIDA 2L42A 5KSPA 4GPTA 1XXHE 1WY5A 2O8NA 2RCNA 4J3JA 3WKCA 3ZYCA 2B3TA 2PXHA 4B7AA 1ZCJA 2PKQO 2PZLA 3DCYA 2Q7OE 4PR3A 2YYSA 4XUDA 5EE9A 1DFHA 1P2TA 2JI8A 2X9LA 1YDMA 1USWA 2J32A 4O4LB 5I5IA 2QRGA 4CKEB 3O83A 1C4KA 4KWTA 2Q9BA 4P31A 4P32A 4YTEA 5J2TA 5HE8A 1S2MA 4Q3DA 3PXTD 2NZWA 3HDHA 1JZSA 2GZRA 3KHSA 4N6NA 2VOJA 3HJHA 4J1SA 2RK6A 3RI3A 2PL1A 2G71A 3BWEA 2O23A 4HN2A 3K72A 2B37A 1JDBC 2W83A 3IEXA 2XMCA 2JKYA 1Y9AA 1RFGE 1RFLA 1TECE 3RC2A 1R37A 2B1QA 1EHIA 2Q5OA 1V8PA 3LYAA 3WX0A 4BVEA 2IUVA 2CXSA 2OWDA 3GAZA 3EJ6A 3RFGA 3EAGA 3X1KA 1L8XA 4F5EA 3EG9A 4JI8B 3AGPA 2IL1A 2ZVQX 4ZOEA 1VYHA 3RKUA 2FQXA 1NOJA 3WBKA 4GZLA 4YRSA 1OR8A 3OUUA 3JALB 3F6PA 4PR0A 1E7WA 3ISTA 1A1SA 3P97A 4WLUA 3U1TA 1SU4A 2R65A 3DDCA 3NAQA 4D0RA 2HF9A 2PO7A 2IU3A 3FZYA 2OMKA 3SAJA 3I05A 3WAGA 3CLRD 1GVNB 4YJHB 1NUHA 5LNK6 1J6UA 1HDCA 1XMXA 1RKBA 2I2XB 4LHVA 3RC9A 5JH7A 4LGVA 3BK2A 3S29A 1BS9A 5KNCA 4J1NA 4KGXA 4BLTA 1AV6A 1IUPA 3O5AA 4IPTA 2XD9A 4L07A 4DLAA 3ZHVA 4GNRA 1AG9A 1BE0A 1JYEA 3QH4A 3W78A 1EDDA 3EI2B 3L1JA 1VMDA 4AI6A 4EGJA 4EFLA 2AOTB 3AUXA 3C6XA 5BQXA 2XZPA 1T25A 1J4AA 1MRNA 1RU3A 2C1XA 5BR7A 4Z9YA 2FN9A 5E3HA 3KEQA 4MEBA 2IWRA 1MAWA 1NXOA 4Q9NA 3N8NA 2YN2A 2VHYA 2X4DA 3QVLA 3WJ1A 2VDVE 2IU0A 3C5EA 5DSTA 1K7XB 3GZTB 4YWJA 3EIEA 4HN4B 1JR3A 5CFRA 4CMAA 5MGBA 4MICA 4DFDA 2AFHE 4JJ4A 3OJEA 5ER6A 1GAWA 4O3TB 4FN4A 1LVGA 4X71A 4YT4A 2CXXA 1S3GA 3VGZA 3ZWNA 1RAGA 2A1TS 1H8HD 1YDWA 4YP6A 1A69A 3D5TA 5G0TA 3RSSA 1DKQA 2FPMA 5CYKA 3ED1A 4J07A 2JVIA 3U3DA 5IDWA 3EDYA 2JIZD 3ZDEA 3IQXA 1XKTA 3TS1A 4JXMA 5KOHA 2ZT6A 2FP4B 1Q22A 2JGFA 2GO7A 1PJCA 2XSZA 5EIOA 3LU1A 3VJMA 4NCAA 4FZRA 4TKLA 1UPCA 1EFRD 3RSQA 4ZVMA 2GF2A 1TVEA 3GH1A 3JWIA 3FTCA 1XTRA 1KJ8A 1RQNA 1WF6A 2O0JA 2YHIB 2ZTMA 3A6HA 1LQTA 3NDIA 4KUGA 2WDZA 4G5YA 5EA2A 3ZCXA 4DMFA 1F20A 4F4UA 2GEBA 3PRKE 1U9JA 1EX7A 2EKBA 2OCDA 4JUCA 1D09A 2DKNA 3ASYA 3SN6B 1YRQA 3HFRA 4JFRA 2IP4A 2KS6A 2RC5A 4NV0A 4UU7A 5IDQA 4MW6A 3D6TB 4YDRA 4E5NA 4PSXB 1EKXA 1Q1BA 4QUJA 2ATCA 1YQWA 3IQGX 2YBAA 4L9RA 1ORWA 1AMUA 4QD3A 4IILA 3SXPA 1LPNA 2YJ4A 3EAQA 5CNKA 3PYXA 4DMKA 8MHTA 4B3GA 2ZI6A 1WKBA 4L15A 3H2KA 2R2GA 1NQVA 3C1TA 1SFRA 1CUZA 1IM2A 2DLNA 2E4ZA 3HXPA 3KJNA 2FLVA 1U8AA 5F4BA 5J5AA 1KDZA 3MXTA 3P0IA 3SX2A 3AF5A 3HABA 3HY3A 1U4NA 3PE3A 4A0GA 2SCUB 4DRXA 1YR2A 4J0KA 5ESXA 3OZIA 1Q44A 4INAA 1XQ9A 3NUGA 3JAKA 1Z35A 2WIFA 5EPOA 4FBLA 1VLQA 4D9KA 1QUFA 1B42A 4WK4A 3HDYA 3I4LA 5FI5A 2OP1A 1BC5A 5DK4A 2AZTA 2VRBA 5TS3A 5K0FA 3GP8A 3G8DA 3DDNA 2C3UA 2Z9DA 3TX2A 1UEXC 2WFAA 4C21A 2PKCA 4BBJA 2CZQA 2XQJA 3QKIA 4JENA 4NE2A 1U3UA 1ZDMA 3PXDA 2H9YA 4LI3X 5ESDA 4A23A 5A3QA 2DGDA 3AILA 3SF8A 4XYLA 3I9MA 5DBEX 4OL9A 5L45A 4JX9A 4DV4B 1R16A 1LU9A 1PZXA 2I6XA 4PCLA 4YP5A 3MG9A 1SQ9A 9GPBA 2IBSA 1P8AA 2O05A 1JTEA 1BD3A 3QNMA 1QSGA 4R16A 3T5DA 2OBNA 3TCNA 4EHAA 3HJNA 1Y82A 2QJTA 3NHAA 2XTAA 4EGFA 2V6JA 2JEOA 2IYNA 5JNRA 4PG6A 4Q3OA 4D97A 4RKYA 5AW9A 1QLWA 3LT5A 4UCQA 1W5FA 2PAFA 1KYVA 3FRJA 4IHJA 1X42A 3VC1A 4DVJA 3G8BA 1JR3E 3ZCTA 3QEAZ 2PQ0A 1E3LA 4R7ZA 5HOQA 1JILA 2RI0A 2Q3LA 3HCAA 4URYR 3OFVA 1N3YA 3GGDA 4OIFA 5EIAA 5CXBB 1L7OA 1T1EA 4K6MA 5BWOA 1XTKA 4YAGA 3QSGA 3DT6A 4QODA 1XK6A 3T1VA 1YK1A 3HDVA 1MF7A 5FTKA 4IO1A 4WKNA 2C9DA 2QXTA 5HBRA 2IF0A 3H7IA 3R3WA 4K9QA 4JL6A 1Y5MA 2CLIB 4HNVA 2AHOA 2BFEA 3HYNA 1YFQA 1LCIA 4PYQA 1GZ4A 1E2QA 1R4MA 4UQLA 2XA1A 1HE2A 2RFLA 3COPA 3OQPA 2O2HA 4LV6A 5JJKA 2AR9A 4KWCA 1DWQA 3Q7QA 1HYQA 3V4VA 1JEEA 4FT2A 2PXXA 3R7SA 4E5ZA 4GKKB 3BQ9A 5HP4A 1XAGA 1JEOA 3SZOA 3FSGA 1E4YA 3RAGA 4TZ4A 3MTQA 4MW2A 5AI5A 5THAA 1RXWA 1Z26A 1XLWA 3FUUA 4IP0A 3TXXA 1EG2A 2XODA 1IMJA 2D06A 5B30A 1YCGA 3V7NA 1H66A 5C31A 5MHTA 4EI2A 1IUNA 1ZC4A 2VK8A 3EVCA 4LVOA 5CAEB 3I6MA 3HXOA 4LG9A 1GN9A 2J3MA 3HJUA 4XWAA 4EQ6B 4V39A 4AYXA 4NS1A 2D7CA 3TW8B 4PIVA 4PVDA 3K4PA 2OIZA 3VDMA 4L0QA 3MQ4A 3NONA 4AUKA 1YMUA 5KAMA 4GX0A 1KMMA 1LWNA 2GN1A 1Q0UA 1EQ2A 3I28A 4S1TA 5J2UB 3KJQA 4M83A 1Z4IA 2RG7A 1SBQA 5FI3A 6GPBA 3TXYA 1XF1A 1RHUA 5BYBA 3R9IA 4LNHA 2IWHA 5JS7A 3ROKA 2YBDA 2ISQA 2ZRBA 3FPKA 2J30A 5EUCA 5A3VA 3UKRC 1ZNYA 3H0KA 1P19A 2NMVA 1QS0B 3FM0A 4HAZA 4LMBA 4IIJA 1IOLA 2R4TA 4JLMA 4LE2A 4G86A 4QECA 2XQFA 2F3SA 2HPHA 2QRLA 3OE7D 1UJBA 1MPXA 4I5IA 3K0AA 4ZTBA 5FO0A 2OECA 5CXXA 3ZTWA 4XB1A 3H75A 4DJEC 1XN4A 2DHRA 4FWBA 1F8YA 1OQAA 1U4CA 1V96A 4GF5A 4NG4A 5G2OA 3VKWA 5F7OA 2X9VA 1GAJA 1C8BA 1ZH8A 2I2DA 1A7UA 2PX6A 2Q2OA 3PVSA 3M83A 4IQ8A 4YJGB 4OMFG 4ZQGA 3HKBA 4PPFA 2WUDA 1T10A 4EX7A 3EF0A 3F3GA 1OT3A 2FSUA 1VI5A 3PWTA 2H1RA 5H5JA 5TX7A 2AWNA 5LNK1 1ZK0A 2BFDA 1Z6AA 5GADl 5CMLA 1ZWKA 1I7LA 2ZYUX 3F78A 2G4CA 1JWAB 2VJOA 3R5TA 4QM6A 3KNZA 1DJQA 5DXFA 2Q3BA 1DQSA 1NKTA 1SUIA 1PR6A 2FFQA 5IBQA 2CDCA 3QWBA 1M7BA 4XFJA 5I8ZA 3SDZA 2HQSA 4L22A 1MAVA 5B5SA 3QEMA 3IUSA 2NWQA 4MLZA 3DW1X 3HPQA 1YI8A 4WFKA 1II8B 4KQFA 2E5LB 4FW8A 3P1JA 1U8TA 1JW9B 4C7KA 5EL0A 4DDKA 3HM9A 2QROA 2D5IA 2OXFA 3IV9A 3SQOA 2O6LA 4A3SA 4OQYA 4F21A 4TPKA 4RTJA 3NBUA 4YRZA 1CBUA 1PDOA 2UZXB 3DOJA 3EF1A 1VG1A 3MTJA 3FMIA 3UK2A 1IN1A 1EBFA 2VP5A 4WNAA 1Z33A 3AHHA 2HCJB 3MYRA 4IWYA 2OCLA 2QWXA 1EHCA 1DC3A 4BEJA 3T5AA 2DETA 3J81A 1ZVKA 2VRCD 4KQIA 2AGWA 5IN4A 3KIPA 1CC1S 1V25A 1ISSA 5C8DA 1C2TA 4R69A 4R9SA 3F8WA 1C0EA 4UBKA 5B3JA 4EIWA 4B4DA 1EFRA 1F7UA 1KC3A 4EJ0A 2C4TA 2FUNB 2Z57A 3PR2B 5DULA 3VVBA 1EZ4A 3BXOA 3MJEA 3ZXUB 5JAZA 1FFWA 1UXHA 2HIHA 3C3BA 4MA4A 5DN9A 4GICA 2QB5A 4OK5A 4XYMA 1CNMA 3BS4A 1ZOSA 1D8TA 4U00A 4BFZA 2AFIA 4FDTA 1DLIA 4DA4A 3P2MA 2UZYB 1G2IA 1VL2A 4EJFA 1FVFA 2H06A 3NVNA 1GPJA 3R8XA 1XQ6A 3F49S 4B73A 2P9JA 1PFKA 2SKEA 1COWD 2EICA 1NMSA 4FP9A 2ZEJA 1QGDA 2NNLD 4LJKA 1VPVA 4CIXA 1IUKA 1E6EA 4BNVA 1XTTA 2R00A 3ZU6A 5CD9A 1OXKB 1CUDA 4YJFA 4D0NA 5LR6A 3DZDA 1M6HA 3K8ZA 3FY4A 3KAJA 5ADWA 1ANKA 2HM7A 2GM5A 2AGXA 2NO7A 4G0OA 4HAOA 3WMFA 5HNKA 4V1CI 2OK4A 2ZB4A 3RMZD 1ECPA 1CR0A 2ZSUA 1GPMA 1O57A 4KO3S 1AKEA 4BAZA 2I2WA 4CTOA 4YEDA 5LQKA 4MVJG 3L0YA 3OOYA 1GILA 3QA3E 4Q15A 1FP4B 2GKGA 3IA7A 2G40A 1T4MA 1UDBA 3FHOA 4KBGA 5KS2A 2EOAA 1VPEA 4ZZ1A 3KE9A 1QDUA 1Z28A 4C01A 3C2QA 1OD6A 3OECA 4GR5A 2V9CA 4JLDA 1QM5A 3GZNB 2COUA 5KNCD 1QRRA 1ENPA 3OY2A 5IF3A 1GTRA 4BJ5A 3F73A 4YDSA 3TR0A 4YNBA 4C7BA 2O57A 5EZQA 4DQXA 1Y33E 3GGJA 4DMLA 2BR4A 1U8FO 3O73A 2B4YA 2W71A 4S1PA 3LO8A 4ZQFA 4KLZA 3WAJA 2CYAA 3HLKA 5AQ1A 4JLBA 1RM3A 2AJBA 2FUEA 2WSBA 1I2CA 2XPCA 2OZKA 4IHJF 3RVRA 1IWBB 3HYLA 4M0FA 5DM60 3CNLA 1CQIA 4LQCA 4MHOA 5EP4A 3U1BA 1FW8A 4JHNA 2X4IA 2X8BA 4OX9Y 2AEMA 2QRMA 4O4IB 2AZ4A 2AYYA 3WRVA 4E7OA 1NDUA 3OY7A 2R0QC 2Y67A 3AF4A 1U02A 3VJLA 3HJCA 5FR2A 2OB1A 5JY6A 3QVTA 5ALEA 5F52A 1QZ3A 3PG5A 3I92A 3GG2A 2FLWA 3BSFA 4CXMA 5B2ZA 1RC0A 1SZDA 4W4TA 3S1AB 2R6ZA 2H18A 3CUKA 1QGZA 3SIPA 3AVUA 1P0MA 1EXWA 1ABEA 3DXZA 3GLSA 3HSKA 3NBMA 4FYPA 3AR3A 1YS9A 2VP2A 2EQBA 1NZDA 1S2OA 2IYFA 1OT5A 2BGIA 1YHNA 2J5KA 721PA 4GXRA 3FPGA 3CH5A 3CNBA 3QE4A 3F1LA 4HMQA 4D4GA 5BPFA 1HWYA 3DR5A 3Q8KA 4EW2A 5DBIA 3PPVA 4BKPA 3T61A 2AZXA 1KVUA 3FYHA 4C76A 4BEWA 2I4OA 5JJBA 4KK4A 2Y05A 4LKRA 1X7ZB 3IELA 1FVXA 1QH9A 1Z0UA 3ZWQA 4HFNA 4I50F 4JSTA 4EJSA 3PWSA 3HE3A 4YXWD 5CLGA 1JR4A 3KZXA 2H1OA 3VNVA 3CZRA 5CDUA 2A59A 4Q9LA 4A16A 1IXZA 2CKDA 4PNPA 2C3YA 1TGVA 3FNHA 3VTFA 3TMKA 4DAEA 1NQUA 2Q21A 5JEDA 2QM8A 4X91A 2ODPA 2XTZA 4L9SA 3ZOZA 1TAHA 4XFDA 3EUEA 3V8BA 4W5NA 3QVGA 1H05A 2XMPA 1XAIA 4JI6B 1TPZA 4WNCA 5B12A 4YHHB 3I72A 4IAOA 4KMMA 1Z7YA 2P68A 3HWX1 3QLEA 5TPWB 2MTBA 1DPGA 1INLA 3WMWA 4ZEOA 4CWAA 4H7HA 4GI5A 3I6ZA 3UQZA 1GZVA 1YZFA 4QELA 2NYRA 5B3AA 1XRRA 5B3KA 2PH7A 1BXGB 2W6CX 2P4QA 4K46A 1UR5A 4OJYA 5JFTA 2Q50A 2A86A 3NVQA 4BQRA 1L3CA 2O7VA 2FN8A 2Q2QA 2Z1NA 3A14A 2PRSA 3D6UA 1D4OA 3HRKA 3WJ7A 4WINA 4OXQA 3ZK7A 3AF6A 1VJCA 5A6SA 2RB4A 2Y99A 3PQ8A 4GKBA 4I0WB 4MJ3A 3UB3A 3ETEA 2G1KA 2IVFA 4BLQA 2FKNA 2JFVA 7ABPA 3DZIA 4TTQA 4Q24A 1ZNWA 1AGNA 4IM7A 3WO1A 4GZ6A 2NZUG 2ZBPA 4XFKA 3THRA 5M5TA 2DBRA 2XUJA 1WZEA 1HLFA 5JNUA 2WI8A 1E60A 4XJVA 1S7CA 2X2PA 1Z7BA 2QGNA 3AQIA 3ZHQA 4YMUA 5JD4A 5IZ4A 3B8EA 1CWUA 1XWFA 3LC2O 3HVHA 4ESGA 1QV9A 2IW1A 3QPDA 3IB3A 1KS2A 2WUVA 4PC3A 4H15A 5ITVA 3OZCA 4PFKA 4A82A 1O97C 1TPYA 1L6RA 1VRVA 1AM4D 3CUEF 1CUEA 3H8SA 3PQEA 2H68A 2WHXA 2XNHA 2G9AA 3EZ9A 3HCEA 2VZ9A 2FPLA 1X7YB 3SYKA 4G9EA 1JAHA 1CUUA 1TJPB 1RYNA 1GXRA 4ZFNA 2QM7A 4KO8A 3CTPA 4US1R 3CLKA 3LKVA 3LP8A 4L3GD 2JDID 2XH8A 1NKVA 2VNAA 3JWEA 4JBNA 4PM4A 4W5JA 4B76A 5HUQA 1R5JA 4RVDA 1ONOA 3N0VA 2DM6A 3ELBA 1GL6A 2OVBA 1J56A 4O2AA 5G1NA 2ZE5A 1QP7A 3LKBA 5HS6A 4BO8A 4EG7A 4OHMA 1VE9A 2WFZA 1H5QA 3E9EA 4RVOA 4ONEA 3QUTA 3U4AA 4HDSA 1U3TA 4UHJA 5EERA 3FMFA 1OPXA 1XA3A 1LBIA 3VU0A 3S1LA 4JP8A 1ZR4A 3DMTA 3M1AA 4L6AA 4HXEB 4FGKA 4PV7A 4X61B 1N5OX 1SH7A 4LGMA 1C1DA 4G65A 1EFDN 2HI0A 2WTUA 5ARCA 2Y3IA 2DTEA 4QQKA 1SK8A 1RXIA 4LOLA 4ZQEA 2OHGA 4I99A 3SU8A 3MWGA 1K3IA 2R7LA 3HKCB 1JEQA 1ZM7A 3WI7A 2PBLA 1TTPB 3MMXA 2HGZA 3ER6A 3AHGA 1RR6A 4PGHA 4Y2TA 4HXGA 5CDHA 4MR8B 3CX6A 4D0LB 5LZ8A 2NP6A 4JB2A 3ITEA 1LQ2A 4DLKA 3SHVA 3DHWC 3SFTA 5BWNA 2O50A 2RHHA 1ULTA 4W7IA 3WIEA 3UKUC 4ZV7A 4YRNA 8GPBA 4QYWA 5LU9A 1P1FA 2CUZA 2PTGA 2RHOA 2C84A 2VDPB 3DTVB 2R66A 4UFOA 5FL7A 4NWIA 3OPNA 1NDQA 2NUPA 3TKLA 4ND2A 2MCFA 4P4LA 1QIEA 3TB4A 1QAMA 5AWFC 5HKKA 3EVBA 5FWNA 1AXRA 4QPDA 2I91A 1C7JA 2ZJ8A 3CLRC 1QH8B 4MV8A 1SHJA 5ECGC 5A71A 3COJA 1TM3E 3Q40A 2Q5JA 2X5JO 1TZMA 2OCIA 4MV9A 1ADJA 4ER6A 3QMVA 4Q7MB 3HEMA 4YRQA 5LLTA 5FPPA 3OLVA 2XT0A 2YXNA 3EDQA 1GLVA 2K5UA 2WKQA 1RAEA 4H2DA 3T54A 1W5SA 2V4MA 3LKZA 1TOAA 2JIZA 3ND5A 4TVBA 2FSSA 3BCHA 3AHIA 1IQ0A 3NXSA 3U7HB 3A9TA 1R10A 3NHUA 2QD2A 3NHPA 2FFHA 2YC4C 4H7KA 3TLJA 3AI2A 3UWSA 3RC7A 4EG5A 1SG0A 2NUBA 3QX3A 4CY2A 4UE2A 1Y1SA 3GJ0A 4YCJA 1XNRB 4U7HA 2I4NA 4B3BA 2ZJBA 2CLSA 4B80A 1A5TA 2O14A 4XX1A 1RKUA 4OB7A 2P1RA 3A4MA 1TK3A 3SIXA 3CLTD 1WXXA 4Q4CA 1JKFA 3FLEA 5K8CA 2OGUA 3CSUA 4IIDA 3WNBA 4BKQA 4EVIA 3JWJA 4LJLA 4G1UC 1DI0A 2BOVA 2AFRA 2VHWA 4NYIR 5D3MA 5LB4A 2AQIA 3HFSA 3H05A 1Q7GA 3VOTA 4AJEA 5F98A 3K0FA 3LUGA 5MN4A 5CD1A 4DGQA 3D4PA 4BNUA 3L06A 1N3IA 2FWAA 1PBNA 5CNIA 2JAPA 2QJOA 4XR9A 3GBPA 3M4ZA 1Y1LA 3MD9A 2NO9A 4GX5A 4U39A 3RFVA 1D1QA 2PGDA 3T7SA 5DHPA 3V2GA 2VTVA 2AR7A 1GNQA 1FXWF 1QHYA 1DBQA 2AOUB 4Q1VA 5ALWA 5TQ0B 1Q47A 2O8DB 1JBKA 5KQMA 3G5UA 1AMNA 3OQHA 4OK3A 5IVPA 4NDZA 2QE6A 4RESA 2PKWA 4J0FA 2LCFA 3AFGA 4IGKA 4ZAFA 1DQZA 1NBIA 2Y6VA 1TRHA 4MRRA 4P38A 5KJ1A 3FNRA 2GTPA 2BISA 4MYTA 1KFJB 1RHJA 2WB4A 3AU9A 3BAFA 2FPIB 3NBKA 3R7BA 1Y8RB 3HWWA 4DWVA 2KBFA 5G0SA 3A0FA 3D4IA 1U5CA 1MDAH 1U7PA 3R0XA 3A37A 1CUWA 4FXOA 2OYCA 5EG5A 5FBHA 3VTZA 4C0XA 3A58B 1GQQA 4IDHA 3S8MA 2JLVA 1L5GB 3MK31 1X2EA 3I32A 1WLYA 2WZCA 2PQMA 4MMXA 4IQ4A 4UCWA 4Z9BA 3WYNA 3ZY6A 4DEVA 5ARBA 2GRUA 4AZVA 5KCMA 4C3UA 5JYCA 2YV4A 1DC8A 4CL0A 5JC8A 1W47A 1OWNA 2FWRA 4CHGA 3THYB 1E5VA 3R41A 3I7OA 1A4XA 2O8VA 4BP8A 3DE0X 2ORWA 3ITDA 3TLGB 5L40A 1GV1A 4MVJM 4MCIA 2Q3MA 4NYMR 4RSGA 4K5QA 3L0CA 3Q1KA 1E7QA 1SCKA 3G9UA 4DMHA 3JZFA 5D3KA 1M10A 3DO8A 3QKRB 1XU9A 1U1FA 2QG9A 3D6VA 2G9NA 3M5WA 4NNOA 4XEUA 3OKTA 4DNVA 1QQBA 2FGKA 3FUWA 1K8RA 1QC5A 1SULA 1LUAA 1C7EA 1QG0A 2KM1A 3IJRA 5JBIA 4B8YA 4X8HA 1XD9A 1I1HA 4OBXA 4DZTA 1IJKA 3FH0A 1YI1A 3DNFA 3LX4A 4FQ8A 4EPTA 1YFZA 4P80A 1Z5UA 1GADO 4TSFA 1PBTA 1P81A 1D7OA 1EK2A 1QFMA 1Q92A 1A7KA 3EW7A 1VSUA 2XF8A 4C14A 2O3SA 4HDKA 4JV5B 2R1VA 1L7BA 3GZ4A 1A2OA 3MOIA 4RKRA 1ULUA 5EEHA 1E9BA 1P4AA 5TF0A 8OHMA 3IO3A 1PQ4A 2BRUA 2ZSHA 1NJ5A 1QQTA 1ZNZA 2RJOA 3H99A 3OF2A 4AWXA 4KR3A 4AY4A 5HF6A 1E6KA 1W19A 3G13A 3PVZA 1JJVA 4PYRA 4CDNA 3RS9A 3UYKA 4LTNA 1KAEA 1F8XA 4Q3BA 2O8EB 1IULA 2I3GA 2VQSA 7MHTA 2V6BA 1DCFA 2EWWA 3LBFA 4AG6A 3RS0A 1ISMA 4EB6B 2FW0A 3GRRA 3EXG1 3JQ8A 3E27A 2NTNA 2CLOB 4DJAA 1PAUA 1O0SA 1H2EA 1QMPA 1ZZEA 2XIJA 4WLEA 4J81A 2XCLA 3HYRA 2AJTA 2XECA 1GG5A 2PHZA 2YUIA 7GPBA 1NQ5A 2PMCA 3FBTA 3TOVA 3LLVA 4B31A 4CCAA 3AV0B 4KV9A 1ZRHA 2ZWAA 5GJBA 4IVQA 1RI1A 4OL0A 1YS7A 1Z08A 2Z95A 3N2KB 4XQEA 1F2VA 3L7NA 4OWRA 1W9HA 2DT8A 4QARA 2CXHA 1GPNA 3JQDA 3WLQA 3HADA 3TLKA 3ZV5A 5IXYA 5DGCA 5H3HA 1MORA 4II3A 4Q1BA 1JG3A 1QE5A 1XNGA 3NM6B 1N1GA 1ZP6A 5B53A 3O8OB 5WRFA 2J3LA 4UXHA 3IBTA 4WN3A 3TRFA 4ZTZB 4Q1AA 4DLWA 4HDNA 5KCZA 2OAEA 4PSDA 1LDYA 2IHYA 2I6UA 3OQ1A 4BJ3A 2AMYA 3P5BA 4YFVA 3WL8A 4YX9A 1LLUA 3ZZUA 2HSEA 1W8DA 2EGHA 2XITA 3D5QA 4KR6A 1YZQA 1KZ9A 1ZH2A 2P9YA 2VG8A 2UYYA 1XHMA 1VB5A 2QI9C 4WFIA 3LQQA 2Q41A 5IUNC 4RIIA 4E7PA 4FDMA 3NEAA 3AX6A 4KXWA 1MHPA 4RWEA 2JD2A 3PC4A 4TOIA 3B5IA 4LXTA 1XIPA 5EIBC 3AR4A 4JSPC 2PEYA 1NVVQ 4J0WA 4X3EA 4WY2A 1QHFA 1BMFA 1NP6A 3OLXA 4M4SA 1IY8A 2PX8A 2QD3A 4YREA 5ALUA 4QULA 2R7KA 3MKQA 2X8AA 3NB0A 1LJ8A 4N7JA 5K0TA 5BVHA 1EBUA 5FBLB 1A9XA 1PP4A 2QRJA 3UJNA 4ZCPA 1Z4PX 1UXKA 4QNRA 3D5EA 5JC1A 1WE2A 4B6OA 2YW2A 4N5MA 3BBLA 1A5ZA 4B3JA 1QQ5A 2J0QA 1B0PA 3UZUA 4KQGA 6ADHA 1A96A 2CJWA 3EI4A 3AEUA 4TWRA 2HGSA 3X1XA 1LPAB 5GTDA 4RIGA 1QG6A 1WTCA 4GNKA 5KOHB 3ZI4A 1JG6A 2OFPA 1NZJA 1X7DA 3IKOA 2R85A 4F04A 1GA6A 3UWDA 3ADCA 1KEVA 2ZYTX 3CF4G 1NURA 3O26A 1X39A 2JFFA 3PDUA 5CX4A 4CHTA 5H83A 3Q9SA 5J5VA 4QXAA 4KKXB 4YMTA 1EQUA 4KIGA 4E3WA 2B8NA 1R0WA 2Z2ZA 4M7RA 1YQEA 1FPQA 5LYJF 3DVLA 2MSLA 1BEZA 3DUWA 4WK0B 3WZ2A 3A4VA 1YL7A 5HA5A 3RW9A 1DIRA 1A7AA 3D2LA 4PYLA 3VR3D 3NRCA 4YCAA 1RCFA 1QTRA 1YS1X 3EVTA 4MMXB 2ZTVA 4OUKX 3RLFA 4C08A 4DLUA 2R79A 3CKKA 4F3TA 4KQ2A 1FX0A 3P52A 3UXEA 3SHFA 1GM5A 5EN4A 4R51A 1J0CA 1KPIA 4G4JA 3BJIC 2BBWA 1IY0A 1T8RA 3WYAA 1K1EA 1NGSA 1ZN7A 1JSRA 3M0EA 3DL7A 3IUMA 1ESEA 4ZALA 5IFLA 4ZC1A 1FDSA 2WF6A 3KD2A 2FWNA 1A71A 1R5OA 3KPWA 4BGIA 4HOYA 5G1OA 4G0VA 3ZGVA 4Y2UA 1MCZA 4WKBA 4F3YA 1YGYA 4P0QB 3CLSC 4FFPA 4ZYLA 3LOQA 3VKGA 2P5SA 1USUA 1OH6A 1LEHA 2VJMB 3DTYA 3BXGA 1PT6A 1S6YA 5ETJA 4YT2A 3Q0IA 4XCQA 4H18A 1FFDA 1Y4ZA 2A84A 2HY7A 2ID9A 3G79A 3ZJTA 3ZKWA 3UCFA 3L7DA 1CRQA 1T9DA 2ZK7A 3DE1X 2A3NA 4GZMA 2G1UA 1XMJA 4N39A 2J7PD 4LYFA 4XSGA 4A0SA 1RZRD 4RIFA 3AY6A 3DO6A 1MTZA 4WXMA 2P4EA 1LK5A 1YIDA 4H7JA 1KZYC 1SKYB 1N7HA 3GJSA 5CLJA 2GZ3A 1NJ1A 1XTUA 4GM4A 1M72A 1W8IA 4MS1A 4OA5A 3ZBQA 5AW0A 5LP6F 2HHJA 3V4FA 5KQSA 2IHTA 1BQ4A 1UBMS 3N6XA 5E4TA 1XN1A 1ZCAA 2EX4A 3NLLA 4L74A 4ZXPA 1G8PA 3ECCA 1QCYA 5LU8A 3U56A 3E22A 3D6JA 1NNUA 2OFFA 3DG9A 3DMDA 5AK3A 1E2NA 4IUCS 2BELA 1VCHA 1SIOA 2IUPA 5TEFA 1UBEA 3AONB 3DOIA 3PXXA 1J90A 3KYDB 4HRYA 3A3NA 3E8SA 1NVXQ 3RREA 2H4XA 2PSFA 3NHRA 4RVGA 1W36D 1Q74A 2JJYA