1YR2A

Structural and mechanistic analysis of two prolyl endopeptidases: role of inter-domain dynamics in catalysis and specificity
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
701
structure length
680
Chain Sequence
PPYPASPQVPLVEDHFGEKVSDPWRWLEADVRTDAKVAAWVQAQSAYTAAYLKQLPERAALEKRMKALIDYERFGLPQRRGASVFYSWNSGLMNQSQLLVRPADAPVGTKGRVLLDPNTWATALDAWAASDDGRLLAYSVQDGGSDWRTVKFVGVADGKPLADELKWVKFSGLAWLGNDALLYSRFAEPLNYNQTVWLHRLGTPQSADQPVFATPELPKRGHGASVSSDGRWVVITSSEGTDPVNTVHVARVTNGKIGPVTALIPDLKAQWDFVDGVGDQLWFVSGDGAPLKKIVRVDLSGSTPRFDTVVPESKDNLESVGIAGNRLFASYIHDAKSQVLAFDLDGKPAGAVSLPGIGSASGLSGRPGDRHAYLSFSSFTQPATVLALDPATAKTTPWEPVHLTFDPADFRVEQVFYPSKDGTKVPMFIVRRKDAKGPLPTLLYGYGGFNVALTPWFSAGFMTWIDSGGAFALANLRGGGEYGDAWHDAGRRDKKQNVFDDFIAAGEWLIANGVTPRHGLAIEGGSNGGLLIGAVTNQRPDLFAAASPAVGVMDMLRFDQFTAGRYWVDDYGYPEKEADWRVLRRYSPYHNVRSGVDYPAILVTTADTDDRVVPGHSFKYTAALQTAAIGPKPHLIRIEPIDKQIEETADVQAFLAHFTGLTPRPWSSVDKLAAALEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords prolyl oligopeptidase
publication title Structural and Mechanistic Analysis of Two Prolyl Endopeptidases: Role of Interdomain Dynamics in Catalysis and Specificity
pubmed doi rcsb
source organism Novosphingobium capsulatum
molecule tags Hydrolase
total genus 199
structure length 680
sequence length 701
ec nomenclature ec 3.4.21.26: Prolyl oligopeptidase.
pdb deposition date 2005-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00326 Peptidase_S9 Prolyl oligopeptidase family
A PF02897 Peptidase_S9_N Prolyl oligopeptidase, N-terminal beta-propeller domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.120 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Prolyl oligopeptidase, N-terminal domain 1yr2A02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1yr2A01
2Y6UA 4B7ZA 2G5TA 1IUPA 1LPOA 3R3XA 3DKRA 3G9XA 1EX9A 5AH0A 5AM2A 3FVRA 2RGUA 3WJ2A 5FKJA 2XQKA 2BGNA 2WU4A 2CEKA 1YR2A 3LLCA 4L9AA 5HFAA 5LLSA 1XRNA 1XZJA 4HRXA 5ALTA 1W6RA 3GROA 4QDTA 4BAGA 4MWSA 3I1YA 4Y2VA 4DMFA 3ZV7A 3CXUA 1LPMA 3G0DA 4BC1A 3AJAA 2J4CA 3ZLUA 1ODCA 4BATA 4I3FA 4J3JA 2Z3ZA 3F98A 2XMDA 5CXUA 4BVLA 1DWOA 2QMQA 3WZLA 5BWBA 2HM7A 4Y2YA 2XUPA 5FPQA 3ZPXA 2C5FA 3FCYA 3E3AA 4N5HX 4QWMA 2H7XA 3DD5A 3I6MA 3PE6A 3BE8A 1CVLA 4HAIA 3V9AA 4BP9A 5AI8A 1MN6A 3QVMA 5JAOA 3LS2A 2XMSA 1XRPA 2HRQA 4UUQA 1W75A 3DS8A 3C70A 3G0BA 4HVTA 2XUGA 2GZRA 5AM3A 3RK4A 1UK8A 1QIJA 2D5LA 3L1IA 3R40A 4WFIA 4PW0A 1A88A 2CBGA 1G42A 5ALFA 3V48A 1YAHA 2PUJA 2WHPB 2HL6A 1F8UA 4BAUA 2LIPA 4IH9A 3SC2A 1NU8A 3E4DA 4UFNA 2WUFA 3STUA 2HRRA 5HF5A 4LXGA 4LIPD 1MX5A 2BAGA 1R1DA 2WHRA 4G4JA 2X5XA 3LCRA 1U2EA 4C4YA 3WKAA 4GI1A 1WHSA 1MU0A 3I6YA 2BJHA 2HU8A 3G0IA 3WWPA 5JADA 2JIDA 2ZSIA 1ETHA 3G7NA 3C6BA 2WIGA 3ICVA 3VDXA 4YPVA 2BGRA 4BB0A 1JI3A 2IITA 2WHPA 4H0CA 3DDUA 4X85A 4AQDA 3EIOA 1WPRA 1X2EA 4BDTA 5DLPA 3FYUB 4H7DA 1MAAA 3C45A 5BWCA 2ZYIA 4FBMA 1ZJ5A 4G8DA 4C87A 4F60A 2ZYHA 3HABA 3TEJA 3VJLA 3HYSA 1BE0A 4EZIA 4I4CA 3H2GA 4AN1A 1TQHA 4TPKA 5AM1A 4BAZA 1YA8A 1CUGA 4UBNA 2RI6A 4H7EA 4N8DA 1QIMA 1P0QA 3A6ZA 4U2BA 5CRIA 1KEZA 4UHCA 5HF9A 4FOLA 2QUAA 1H22A 3IDAA 1Y37A 4QLAA 3FYUA 1GXSA 3AZQA 1LPNA 4OPMA 1AURA 4Y2RA 2ORYA 2DQYA 3G9TA 4Y2QA 3F97A 1K8QA 1BROA 1WOMA 1MT3A 2WIDA 4EB0A 1QO7A 1UK7A 2E3JA 4BZZA 5ALNA 4C6HA 2X8BA 5HKAA 3ZLVA 5FV4A 2DHDA 3G0GA 5FP0A 1XKLA 3WL5A 5KREA 3A70A 5K3DA 4K6KA 2YXPX 1VXOA 3IUJA 3E0XA 2HA6A 1QIEA 1QIKA 3A2NA 2RAUA 1CRLA 2WLSA 4XX1A 1EHYA 2DSNA 4W63A 2QT9A 1J06A 5T4EA 4AO7A 3QYJA 1N1MA 4XIIA 3QM1A 5JZBA 4DNPA 3ANTA 4OYLA 4HZGA 3WZMA 1K6EA 1RYYA 2WILA 1CR6A 3TRDA 2PU7A 5CT8A 3QMVA 1WB5A 3WWCA 2QTBA 1QTRA 4GEGA 2WQZA 5A7GA 5LKAA 5ALHA 5DNVA 5JASA 4BRZA 2XUQA 5CT5A 1WM1A 4B84A 2QUBA 3DLTA 3RLIA 4TGLA 3WK5A 3C6XA 1ZD2P 1FFAA 3KWFA 5CT4A 2VSQA 1FJ2A 1ORWA 1WB6A 1JKMA 3BL8A 1OCEA 4DSAA 5JAUA 2XUDA 2QS9A 4LKOA 3O95A 1VA5A 2C4HA 4M0EA 1CUVA 2WG0A 2C0QA 3F9CA 4WY8A 1DT5A 1P0IA 3I2GA 3QPAA 3GELA 1H2ZA 1XQXA 3FNBA 5ALDA 1HL7A 3IA2A 4X6UA 2HDWA 5IH7A 4ZREA 4UBKA 3AUKA 3FAKA 3W04A 1A7UA 1QIDA 1Q83A 5F4ZA 3GFFA 1E5TA 5CW2A 1YSCA 2XUAA 4OB7A 3W05A 3F8SA 5JZ9A 3C8DA 5JANA 4G8BA 1IUOA 4UBMA 5CBKA 3FWHA 4B85A 5E4YA 1XZAA 2XMRA 3D59A 4FHZA 2XMQA 5LZ8A 3V1KA 1R88A 1T2NA 4U2CA 1XLUA 4G4GA 5ALLA 4JEIA 2XQIA 4P93A 3WKDA 6YASA 3V1MA 3UMJA 3WMRA 3V1NA 5CH3A 5DTIA 2VT7A 4KAJA 1F0PA 3QH4A 1CLEA 4CG1A 4Q1VA 3IUMA 1BRTA 3VISA 4GXNA 3ZI7A 2HA2A 3AFIA 1NU6A 1SCKA 1J1IA 1JJFA 2HA5A 3FLAA 4MEBA 2W6CX 4BTVA 3R3UA 2JGIA 5LKRA 2AXEA 4PQEA 4KYVA 5HK8A 3NOXA 2GBGA 1W76A 4CFSA 1ZI8A 3S2ZA 2ZJ6A 3ANSA 1K4YA 4W9RA 2DR0A 1UWCA 1UZAA 3FYUC 1YAJA 2OPHA 1EXWA 3I2IA 2C58A 2ZJFA 4FLEA 2R11A 5C81A 3LP5A 4O08A 1AKNA 1FFCA 2PL5A 3HC7A 3DCNA 5HK9A 1CUCA 3B3QA 1MX1A 3O9VA 3B5EA 1VLQA 1XQVA 2PSJA 4KE6A 3DKKA 3QBJA 4CG2A 1VA4A 1R50A 4A5SA 5FUMA 4U2FA 1I6WA 3ZWQA 2I3DA 1DWPA 5BV7A 4B82A 1HBJA 4Y2SA 3C5WP 1BCSA 3H2KA 4UBOA 4AX4A 4J0JA 2C5GA 3WQHA 2HA0A 3WWEA 2HADA 3O0DA 1IZ7A 1DU4A 1XZBA 3HZOA 1CV2A 3WJ1A 3WA6A 2VJAA 2GBCA 3D5EA 2B61A 3DYVA 1ACLA 4FFVA 1J07A 4S0XA 4OUKX 1MJ5A 1X2BA 5AI9A 5AK6A 3DQZA 4Y2TA 3AILA 1QFMA 3L1HA 1UOOA 4KE9A 2H7CA 4OB6A 4J0CA 5LIPA 2WTMA 1CUDA 1ISPA 2GYUA 2BFNA 1X70A 3I2HA 1HQDA 2CUTA 1ZGBA 2JGFA 5AOAA 4G8CA 1J2EA 4J0IA 2WJ6A 3DL4A 1LGYA 4OU5A 5ALSA 3Q0TA 5ALJA 2BUAA 1SC9A 5JZSA 1ORVA 4PSDA 4ZWNA 3STVA 2ZVDA 4KACA 4IHAA 2JGMA 2PVSA 4BE4A 5JYCA 1MPXA 5AI4A 1CUHA 3OOSA 5CH8A 4A16A 1JMKC 3QZUA 4FLFA 3WIOA 1AUOA 4BC0A 1QIIA 5A2GA 2Y6VA 1U4NA 1JJIA 2AJCA 5LZ5A 3RARA 2VJBA 3MGAA 3SX4A 4BCCA 2WG1A 2GYVA 3I28A 2P8SA 4X71A 4G4IA 3UUFA 4ZI5A 4DNQA 2YASA 5IKXA 2J3DA 1QE3A 5ALPA 1XZGA 3M82A 5I7UA 2W22A 5ALYA 5T4BA 4F21A 1TCCA 3A2MA 4KRXA 3KSRA 5FOQA 1XZIA 2JGKA 4H35A 1XRLA 5AK5A 4AZ3A 3R3VA 4AN0A 1A8UA 5ISMA 5EIHA 4EHBA 4J7AA 1QJ4A 3K9BA 2HA7A 1R4ZA 4X7BA 1EDDA 2O7RA 3O4IA 5I8PA 3G8YA 4LXIA 3WWDA 3CCCA 5EHQA 5ALOA 3GUUA 1BN7A 4K2AA 3DL7A 3ESCA 1UOQA 3U0VA 1MX9A 1ZGCA 5JD4A 3I2JA 5H3HA 3FYTA 1AMNA 4N5IX 1Q0RA 4L3WA 3QPDA 5ALQA 3FLBA 2XUFA 4B9EA 4DSZA 5ALEA 5YASA 3R41A 2JGJA 3ZLTA 5HCUA 1XFDA 4CIBA 1LZLA 4ARAA 1VKHA 2WG2A 1EDBA 4NVRA 5A7HA 1WHTA 1NX9A 4H7KA 4IO0A 1YASA 3KD2A 1GPLA 4JNCA 5JD6A 2D0DA 4RPCA 4CCWA 5EGNA 4ZGBA 1GKLA 5LZ7A 2H1IA 3HSSA 4UHBA 5AKLA 5ALWA 3GBSA 1QIFA 5SYNA 4D9JA 4J0GA 1M33A 5CT6A 1GZ7A 2C0PA 1BU8A 3OC0A 2WUDA 3OTQA 4CG3A 4TVKA 4E14A 4FFWA 5AI0A 3BWXA 3KXPA 2OG1A 2RIPA 3O9MA 3W2TA 3WL8A 5FPPA 2UZ0A 3H17A 4WDRA 5ALRA 1E66A 2WUEA 2CMFA 3IB3A 3EQ7A 2QKYA 4BVKA 3AIOA 1B41A 3PFCA 4WFKA 3BDVA 4DTCA 1LBTA 2J4FA 2WIFA 5DYYA 1AZWA 4ITVA 5LZ4A 1JFRA 2VT6A 3OM8A 4EY7A 4H7HA 5D6OA 2Z8XA 1E8NA 4UPDA 2OCKA 3BDIA 4B0PA 2VF2A 1ZJ4A 1CUSA 4UFPA 5HFNA 4C01A 2BCEA 3FLEA 4AB1A 2XE4A 2V9ZA 3I6ZA 4LYDA 5AKIA 2XUOA 4DYHA 1E3QA 1XZLA 1EB8A 1T4MA 3D2CA 4FWBA 2I03A 4ROTA 1QIHA 1EI9A 1ZI6A 3IBTA 1GT6A 2B9VA 5C7YA 3FSGA 4UBJA 2EEPA 5DNUA 2G4LA 5JAPA 5AKJA 4UHEA 3VVLA 4X91A 1XQWA 4MQLA 4GHWA 1MNAA 3C6YA 3U1TA 4OD0A 3BXPA 3KDAA 3BIWA 4AMYA 4X6XA 4LHEA 4ARBA 2OCIA 4WFJA 3FBWA 4X97A 1EK2A 5JALA 1XRQA 3DEAA 4A23A 4KE7A 4J0KA 2VA9A 3T52A 5AHXA 2WM2A 4FMPA 2X76A 1ZI9A 4NS4A 3STYA 5AKXA 1KU0A 5CXXA 4G9GA 1ZD3A 7YASA 3HXKA 4Z49A 1DX6A 2VTVA 2HA4A 3BJMA 4WDQA 2DQZA 1A8QA 3HEAA 4E46A 5EHNA 4W1QA 4HXGA 3CN7A 2XQFA 1C4XA 5EIEA 3DOHA 4B6GA 2JEYA 4UBLA 1H23A 2QRUA 3R0VA 4YASA 1CFJA 1E89A 1CUWA 1F0NA 2BKLA 3FCXA 1Z68A 5FDFA 3IIIA 4MWTA 5HKBA 2OGSA 5FRDA 3VKFA 1LBSA 3W06A 3H0CA 5AK4A 4AO6A 3HRHA 4X00A 1XRRA 4QNNA 2XMCA 4Q82A 5EIAA 3WKBA 2ZYSA 5AJHA 3GZJA 1GPKA 3WWOA 4ZV9A 1W52X 2VQ6A 5JD5A 4ZRDA 4QE3A 1LPBB 3I1IA 4YX9A 5LZ2A 4IQ4A 4OSEA 3T4UA 2O2GA 4RGYA 3N2ZB 4YK7A 4KJXA 3PDCA 5AKGA 4HXEB 1B6GA 3N0TA 2WIKA 1JU3A 5ALMA 1WPXA 1FSSA 1JT2A 1VJ5A 1O6GA 3PFBA 2QXUA 4BTLA 4FKBA 2WFZA 3L1JA 5IVHA 1CUIA 1QOZA 3F67A 1GKKA 2XT0A 5HF6A 1K63A 5IVIA 3D4LA 1EINA 2HIHA 5IVDA 2OCGA 1CEXA 3V1LA 4P08A 5HZGA 4DLNA 2WU3A 3STXA 1TRHA 1TKRA 2PUHA 2WUGA 1SCIA 3W9BA 3ESBA 5K3CA 1MTZA 3NGMA 4MJ3A 4Q3OA 1N5RA 4Y7DA 5AM4A 1BCRA 3P2MA 2VAXA 2EDCA 2YH2A 1ACJA 4FNGA 2I78A 2WFLB 4GBGA 2ECFA 2AJLI 1PV1A 3MUOA 2Z3WA 1ODTC 5CT9A 1G5FA 2FJ0A 4WCVA 2XMZA 1UK6A 5AICA 4QDUA 2XUJA 3EQ9A 5A6VA 5KBYA 2ZSHA 5AOBA 2WTNA 2I3ZA 3OG9A 4B80A 3ED1A 1PFQA 2AJ8A 4GECA 5DJ5A 3IURA 5DNWA 1TCBA 1CUJA 4RE6A 1P0MA 1UXOA 3G9UA 3D2BA 3VJMA 1XQYA 1RWQA 2IIVA 3R3ZA 2WFLA 4UHHA 4V2IA 1S8OA 5ALIA 3C6ZA 3BIXA 3MVEA 2JGEA 2ZJ7A 5I9IA 5JAHA 2CZQA 3SK0A 1CQZA 2WSLA 2Y1KA 4BCBA 1QZ3A 1N8SA 3PF8A 1CUZA 4EBBA 5D3KA 2Z5GA 2JGLA 3ESAA 4K5QA 2DCMA 1DTEA 2HFKA 2HFJA 2BUCA 3IUQA 4Q05A 4MXDA 5ALVA 1QIGA 5E2IA 2WKWA 3CCBA 4B81A 4QDXA 4UHFA 1C7IA 3WL7A 1CIJA 4BRSA 2QZPA 5CMLA 4UHDA 4GDMA 1DQZA 1JU4A 5K5EA 3E1GA 3HACA 4MQMA 2PU5A 4B9AA 4U2EA 1JJBA 3C87A 3M81A 3PI6A 5JIBA 2V97A 4L0CA 3WI7A 5T4FA 1IUNA 4DMHA 1ZIXA 1SCQA 4J0DA 4GLBA 4CIAA 5LZ9A 3I2KA 4Y9SA 2HU7A 4Q3KA 1KU6A 5EFZA 3AZOA 1CUEA 3W9UA 4HTAA 4AXBA 2CB9A 2FJPA 5KWJA 3STTA 1CPYA 2WJ4A 5K3AA 4WJLA 3TJMA 5FLKA 1DINA 3YASA 5EHXA 1BEZA 4X93A 3ICWA 4XJVA 4PF1A 2OAGA 1BEEA 3R3WA 1LZKA 4JYPA 5C8ZA 4AMZA 1UKBA 3QMWA 1LPSA 2XDWA 5E4JA 4UFOA 3FSGD 1WB4A 4OCZA 1GGVA 4NZZA 1XRMA 3TGLA 4OU4A 2VAVA 2PM8A 4E15A 4KR0A 1L7QA 1TK3A 1R9NA 1TIBA 4G9EA 5KWIA 2ACEA 4Q34A 4IH1A 4QLOA 1CUUA 3GA7A 4FLMA 1BN6A 4IH4A 3VJKA 4BZWA 4OB8A 1E8MA 1AGYA 3WLAA 5AKKA 1MO2A 3KOOA 5C8XA 4XWGA 3DOIA 2XUHA 2PSEA 4RE5A 5EHZA 1UOPA 2QJWA 3NUZA 3STWA 1ZD4A 1IZ8A 4QEKA 4M0MA 4BYMA 4ETWA 3O4GA 5BOVA 2XMBA 2XQGA 3DNMA 1G66A 4C4ZA 5AM0A 1LPAB 1UT6A 1Q0ZA 3QITA 1SFRA 3AINA 1QONA 1DX4A 2H9YA 2RHWA 1QLWA 2QVBA 1LNSA 3R3YA 3H18A 5CH5A 2RONA 3H04A 3A2LA 2QXTA 1U8EA 2QR5A 5SYMA 4DMCA 3C5VA 1CUBA 4HRYA 2GYWA 3RKSA 1QO9A 5DWDA 4K6HA 5A71A 3WK6A 1XZFA 3F96A 4W1PA 4MYSA 3FVTA 4W1SA 2ONCA 2PPLA 4X95A 1VZ2A 3O4HA 5AKYA 2Y2UA 4MYDA 1HDEA 2JBWA 1YS2X 1XROA 2G63A 4BP8A 1XZDA 2C7BA 4DMKA 5HF8A 3C43A 1O6FA 1MAHA 1UKCA 3BF8A 4DM7A 1YS1X 4H77A 4KAFA 3AIMA 1RP1A 3ILSA 1L7RA 4X3CA 1TAHA 4WY5A 3H2HA 3SWWA 2ES4A 1DQYA 2QJRA 4DNOA 3PUIA 3WYDA 2QM0A 3BF7A 1AX9A 1C7JA 5AM5A 1EH5A 1N5MA 1E8DA 1QTIA 1ZOIA 1GQSA 3D2AA 3C8HA 2PBLA 3LIPA 2VEOA 1EDEA 3EF3A 5AKHA 1H2XA 2AJBA 2WIJA 3H19A 2HU5A 2ZYRA 4FDMA 3DJYA 2OQIA 4B83A 5AIBA 4LXHA 3LIIA 5JARA 1P0PA 3H2IA 2WFMA 1XZCA 3D0KA 1BS9A 2DHEA 1ZICA 3CN9A 1VOTA 5AI5A 3AIKA 3KWJA 4EY5A 3MUNA 1F6WA 5T4HA 2BUBA 4H7FA 1UKAA 1XKTA 3HJUA 2PX6A 2XLBA 2IX9A 4I19A 4G1FA 2YYSA 5ESRA 3IUNA 2XB6A 1QFSA 2O2HA 4H7JA 3WKEA 4KAAA 3H1AA 5A7FA 1ODSA 4NMWA 3QMMA 1W4LA 1QGED 4Y2XA 3WL6A 5K3EA 2GBIA 2EDAA 3M3DA 5AKZA 5AI6A 2WJ3A 3O4JA 3M83A 2VATA 4INZA 4Y2JA 3WYNA 5FXMA 2OGTA 2PSDA 4AZ0A 3PICA 2XMGA 4N8SA 1ZIYA 1THTA 3VVMA 2Z8ZA 3G02A 4KE8A 2K2QB 3H1BA 1W1IA 1VE6A 1TCAA 4X92A 4Y2UA 1D07A 2DHCA 4M0FA 2CKMA 3UUEA 5AK3A 4BBZA 2RHTA 3NWOA 2B4KA 5D7BA 4X90A 2O7VA 4U2DA 5JATA 1CUYA 4JUIA 2ROQA 4EY4A 4PNZA 4B0OA 4QWWA 3PF9A 1L7AA 1CUFA 1HPLA 4H7IA 2PSFA 4G5XA 4QDOA 2OXEA 1EVQA 1U65A 4BVJA 1UK9A 4P92A 4FTWA 1H2YA 2PKYX 1AC5A 5K3FB 3X3HA 1DWQA 4BDSA 2XI4A 2H7YA 3WK4A 4X6YA 1PJAA 1AQLA 1Y7IA 1SOMA 2JF0A 3IVMA 2GBFA 1DT3A 4Q3LA 3JWEA 3JYHA 4W1RA 4DIUA 2PSHA 4F0JA 5E4TA 3G0CA 4KRYA 1YA4A 2J3QA 4UBIA 1OILA 1XZEA 2DFPA 4QZVA 5DYTA 4RNCA 1THGA 2OLEA 3I2FA 3WK9A 3WK8A 4ZV7A 2AJDA 1LLFA 3K2IA 2XUKA 1H2WA 4PO3X 4EA6A 5K3FA 5CURA 2OGZA 3H2JA 3WK7A 2R8BA 1EB9A 1XLVA 5ALUA 3BJRA 1Y7HA 4X94A 5AO9A 1EA5A 4E11A 1R3DA 5ALXA 1FFDA 1XZHA 5D3ZA 3WIBA 2VJDA 4AO8A 1UFOA 2O2IA 4F5ZA 2QOEA 4ZXFA 4DGQA 4PSUA 3ESDA 3IULA 1HLGA 3D3NA 5LYYA 1CQWA 1VXRA 5A62A 1JMYA 5DYWA 4K6GA 2B20A 4XVCA 4LYEA 3OPMA 4J0HA 3K6KA 1Q84A 3PUHA 4OYYA 1YCDA 2OAEA 2WHQA 3DYIA 4C88A 4JYMA 5AP9A 2V98A 4CI9A 5AKEA 1HKHA 2V96A 4EUSA 2XLCA 3HLKA 3Q8WA 1R9MA 2JEZA 3RM3A 3VXKA 5EI5A 1IVYA 4HXFB 3WKCA 4J03A 4CCYB 5AIAA 5LP1A 2OCLA 3D7RA 4BE9A 2XQJA 5C8VA 3FOBA 2HA3A 2NW6A 3AZPA 5ALKA 2G5PA 4EY6A 1A8SA 1VE7A 4EY8A 5AOCA 4FBLA 1GPNA 2OQVA 4C89A 3B12A 4MEAA 4H18A 4C4XA 1FFEA 3OURA 5ALGA 3EBLA 2FUKA 1YB6A 4P9NA 1YB7A 2ACKA 3G9ZA 1CUXA 1GQRA 1XZMA 1WCYA 1OXMA 4PSCA 2CJPA 1EVEA 1USWA 5HQ3B 5DTJA 4CCYA 5CTAA 2Y2VA 4BCDA 3EQ8A 4Y2PA 1XLWA 5ALZA 4U2GA 4FNMA 2Q0XA 1FFBA 1LPPA 5J3JA 1VZ3A 2VJCA 1EK1A 4GW3A 4L72A 4N8EA 3JW8A 3S8YA 3HI4A 3WA7A 4KEAA 3QPCA 4QDZA 4QA9A 4HS9A 1MNQA 5HQ3A 4DNFA 2GZSA 1ZD5A 2HHAA 2FX5A 1CUAA 5K3BA 1IMJA 1XZKA 4PV7A 1G4HA 4GWLA 4JH0A 1K5PA 5IVKA 2XUIA
chains in the Genus database with same CATH superfamily
3KETA 5FOWA 2C54A 3OMXA 4J0XA 3Q12A 2P6MA 4JS0A 5A5FA 3NHYA 3CX3A 1SXJB 4I8DA 4MGKR 4PBZA 3F8WA 1EP1B 3BSWA 4CKZA 1I9CA 1VG9B 5K4AA 2A8YA 3NIDA 2XZOA 4AP6A 4Q5IA 3O90A 3LDUA 1KVTA 4L75A 3DKPA 2X8JA 3VC7A 5HZMA 2NTEA 1G3RA 5KYVA 2D0PB 4EVQA 3HHPA 2VUIB 4JVMA 2HLPA 1M8PA 1Z6ZA 2W18A 3X1KA 3V1TC 1LS6A 1DV1A 4BX2A 4C0HA 2NXNA 2Q7XA 4HAIA 3V9AA 2W6JD 1TJPB 2XF2A 1NM5A 3D7KA 3BQMB 4YRRA 3DC2A 2F43A 4QOIA 1XRPA 3UMYA 5IT4A 4QHSA 3KV1A 3LQKA 2CF5A 3DZDA 4B6RA 4QJ5A 5LFAA 3GUCA 1G17A 3CWQA 4W7HA 4LA4A 2ZATA 3D8BA 3UVMA 3JARA 3DWGA 1RKUA 2YIVX 3L4MD 1GPMA 2Z2KA 1DC7A 2HWKA 3H99A 4AP9A 1KEEB 3REQB 4B7CA 5SXMA 1TF7A 3L8YA 3SC2A 3KPVA 4JEUA 4IWXA 1OXSC 3UWMA 4E51A 2X5XA 5TMEA 3EEQA 4LMPA 2GKSA 4TXMA 4DUGA 3WWPA 1M5UA 1ZD8A 3C6BA 2W43A 3ER6A 2WKQA 1I2MA 1OB5A 2ZKLA 1LV8A 3A28A 1QZZA 1I33A 4I36A 2WHPA 5J59A 3F3KA 4QVKA 4OH7A 1WPRA 3BM5A 1TM4E 1UPTA 4AG3A 3G2QA 1J22A 2QTCA 2OYRA 3SJUA 2Q5IA 3CGGA 4LTDA 3SGLA 1Z7BA 4EJ0A 4BTEA 1MB9A 3UMRA 5K99A 4GGCA 2P9GA 4F92B 4W99A 5CRIA 1JFVA 4NH4A 3PRKE 3H5IA 2B0CA 3ZWLB 3F6BX 3CE6A 3ZCTA 1MVLA 1W581 2IYXA 3DBHA 3AU9A 4DEVA 3HGQA 1OIWA 1RJFA 1ZL0A 3EF0A 1UK7A 4BZZA 3ADKA 4MPDA 4Z7OB 3ZLVA 5KREA 3PSHA 5CDYA 4BRWA 2B98A 3F7NA 1Q95A 1JG2A 3I04M 4KFRA 2M6KA 1SBZA 4TRJA 3K4HA 2HA6A 2W42A 3T12A 3BRWA 2AWOA 1SK9A 1DEAA 3FI9A 1Z62A 1K4MA 3PVUB 2ECQA 1CC1S 2VHUA 4NOJA 8ATCA 2Q6LA 1ADBA 3MJTA 2WTEA 4PTYA 1W88B 3EA0A 1EUDA 2CN3A 4BO4A 5K0TA 3UNXA 4HV4A 3O4VA 1K6EA 1R0WA 1B6TA 1BFUA 2JD2A 4PLWA 3KLMX 4CDRA 4XGKA 3TOSA 3ZJVA 1JVNA 5GINE 1X7GA 2KHZA 3DLTA 3F9RA 4LV6A 3RLIA 1T2UA 3O3NB 4E5PA 3E05A 2QM7A 1JHAA 4Q48A 4WPGA 1NULA 4G1EB 2UZAA 3VHLB 4C3ZA 4I6JA 3C6QA 4HX9A 1JLHA 2EF1A 4JJ7A 1VA5A 2E4ZA 2B8NA 4M0EA 1TYZA 4GGMX 4IGFA 4RFVA 3TTSA 2IS2A 2XNCA 4OH1A 1DWUA 2C2ZA 2ESRA 4J0EA 4X6UA 4UBKA 1DTSA 5D85A 3WAKA 4Q9LA 3HV0A 1TO6A 1Q83A 2DY0A 3KSBC 2ORED 1QVVA 2Q2VA 3BGOS 5COAA 4TYMA 3FWHA 2BTQA 2XMQA 3I0ZA 2DF8A 1KI6B 1Y6ZA 4G4GA 1G7RA 5BMVA 1JIIA 4O2BF 3LGXA 4BX3A 3SF0A 2IOFA 1F0PA 1PP4A 2GVDC 4CJXA 4OQQA 1ZYUA 1FW6A 1LUAA 2HJWA 3V8QA 4GM0A 5F3WB 4BQSA 4WOBA 1QUEA 4EKEA 3CEAA 1M6VB 1ZA2A 2GBGA 3HP1A 2H3EA 1M7BA 1UMDA 1YAJA 1ZBQA 4Z1MA 4L02A 4FLEA 4OQMA 4RVSA 3LP5A 2HKRA 1PN3A 1KAHA 5EY5B 4BNZA 3KK0A 3NRCA 2HWUA 3UVEA 2YNPA 1SVIA 4HSGA 4ZC8A 2FN3A 5LU8A 1NAIA 1K6XA 4JLJA 4Y2SA 4KSBA 3IOBA 1ISHA 1QPZA 3WBFA 2H31A 2C5GA 1Q21A 3WQHA 5HM8A 1BGWA 2VJLA 3L8DA 4O8CA 3TXAA 3HZOA 2C31A 4REQB 1P1JA 4CI3A 2PYIA 2Z43A 4YJGB 6REQA 2R8PA 1J8VA 2VA8A 5EJ9A 3E5MA 3EULA 2EKBA 3DQZA 1W59A 3IQIX 5EPOA 4WN3A 1IG0A 1MC5A 3P9ZA 2VWGA 1BVUA 2GYUA 4LJ6A 2VYNA 5F7JA 2H52A 2EP5A 1K08A 1ZK1A 221PA 4LCJA 1XHEA 4S0ZA 1VCOA 4OU5A 4CEHB 1N0WA 4CBVA 2CNOA 4A2CA 2EXXA 4BUZA 1SCAA 4TT8A 2MYPA 1YB5A 5DSZA 1VBFA 5JCOA 1T8TA 1B73A 1KFBB 3EOBI 2IYTA 4C5AA 4UVEA 1QIIA 5KKAA 4BMDA 3IAEA 4HNQA 4B17A 4DJFC 3DBIA 2GPSA 3VR2A 3Q4GA 2QTRA 1DRVA 4DNQA 4FCTA 4TV8B 3OCCA 4UM8A 3ZXIA 3KSRA 1UC5B 1P3DA 1JR6A 4H35A 2NACA 2I0TA 1WAMA 5EXSA 4FMBB 2FZLA 4GKJB 2WM9B 1O0SA 1CY4A 2XNHA 1KJNA 1U3GA 2WAOA 4PG8A 3AYZB 4M7RA 4FDTA 4YVFA 2Q28A 3IMEA 4QHTA 1BN7A 4JLWA 7ADHA 2RARA 4L6AA 5JD4A 2P2YA 3LPNA 5JR3A 2XYGA 2OVRB 5HDBA 4CM6A 2OK4A 1CB0A 3QHQA 2PGNA 1W0CA 3ZHCA 3HR4A 2VO1A 2YVUA 4RHEA 3R7WB 3T35A 1YU9A 1MOZA 3WNDA 3HZRA 4Q4AB 3BXHA 2HBQA 5BXQC 2VNIA 4IA9A 1X1QA 2M6LA 4IEEA 4LE0A 3TCKA 5MN6A 3HL0A 4EUNA 2PD6A 3V4FA 1Q7GA 5CFQA 3CYFA 4F5WA 2PFKA 2W8BA 3RU3A 3KZCA 4ZT2A 2RIPA 2VPTA 4DWOA 1NOJA 2RGBA 2YMUA 2D4AA 2ZAMA 4RIHA 5AJUA 2PTGA 3PFCA 2QLLA 2D54A 1LBTA 2WIFA 3NT4A 1S1CA 4H7HA 2GEJA 2OCKA 4L6CA 2RC5A 4WXRA 3ZDZB 4QXOA 2NVWA 3U4IA 4MHTA 2Z09A 5AKIA 4PGAA 1RMYA 5B1IA 1M1UA 4OBEA 2WVAA 3EMHA 4TZ4A 5T57A 4Z9YA 3P45A 5H7XA 4EP1A 4KRFA 1K5GA 1XQWA 4A09A 1CD5A 2NSLA 4UVGA 4MHSA 3SYTA 4JR2A 5TPWA 3BXPA 2BY4A 4AMYA 2VLIA 1V5IA 1TJ5A 1N0IA 3PFHA 1NC1A 4MWZA 4ARBA 3KCNA 4OM8A 2OCIA 1MO4A 4TLEA 2CNWA 4MUMA 2BCGY 2VXYA 3I76A 2Q8NA 2W11A 4DLPA 5DHFA 3LHFA 3CEJA 2NZYA 4KDRA 1C9YA 5D6NA 2B1IA 4UD6A 4P5PA 1NW5A 2IH2A 3VTFA 2R7MA 4GWKA 2ASVA 1B00A 3HFRA 5KNDH 3SZLA 4C22A 3BJMA 3EUWA 3WQSB 3SI7A 2IOQA 5H1MA 1ABFA 4EOGA 4B2YA 2JGRA 3JTMA 3AEQB 3MWFA 3ONNA 1W35A 2REXB 3QKUA 4LXYA 3TR5A 1ONNA 2QWXA 5JYBA 3B3AA 5TMBA 3T7CA 2BKLA 4QUKA 1TM5E 3KJQA 4WXPA 3WYGA 4UZEA 6ABPA 3UJNA 4S1NA 3K09C 1U1CA 4X00A 2AMVA 4BBPA 3AR3A 3ROEA 4FEAA 4Z0HO 4Z2AA 3FPEA 2GPJA 4N65A 3V46A 3K5PA 3U3DA 4FZ5A 1PR3A 4EZEA 4A9AA 4ZK2A 5G53C 1KKLA 1L4MA 4BO9A 3DBOB 3PKIA 5M34A 4MW1A 1Z2CA 1JEOA 4G5YA 5DGCA 1TKBA 3E27A 1YJXA 3U4HA 2QTLA 2VHWA 2MT9A 3A4NA 2Z57A 2QXUA 4KIFA 1Q7CA 1VSUA 3QVGB 4HFNA 3P20A 3HB1A 2XKKA 3AF4A 5KYGA 4DV3B 3I3OA 3B9PA 3JSAA 1FDOA 4Y98A 1QBGA 3O8RA 1QFJA 1KAQA 3ZW9A 2WYWA 4MKIA 4S2UA 4L8YA 4NECA 2BBWA 3FR7A 3ZNNA 1Y0BA 4B3HA 5HIIA 4DY4A 4JC0A 3N75A 2BKXA 3KQHA 2WUGA 2VNSA 3DEIA 1BCRA 3ELDA 1KZ9A 2PNJA 1M6EX 3L6RA 5IBPA 3T0IA 3PC2A 3IVGA 4F6RB 3CNLA 3RS0A 1MW9X 3ORRA 4LRXA 2R7LA 3ZZ1A 2VK1A 4MKFA 3ED1A 3QA9A 3HZZA 3AVTA 2J5QA 4HNAA 3G9UA 4BU0A 1XQYA 4KL8S 4YRGA 1Z22A 4J29A 1PR9A 2I22A 4Y2GA 4UMEA 2EKLA 3MWKA 5P8WA 5E2AA 1VGQA 3TTYA 4FX2A 3ZWKA 4DC0A 3PX3A 4QL3A 3THOA 1SQ9A 2AI2A 2JGLA 4K3UA 1G3UA 5CBPA 4FDLA 3HKEB 2BBTA 3B48A 1BDMA 1GGHA 3W1VA 4UHFA 3H0EA 1N9ZA 1JU4A 1JI0A 3E9QA 1OLZA 2QL5A 2GNPA 3IUYA 1XLTC 2WSIA 1FS4A 4ZRNA 3NHJA 2B0JA 2VAMA 4ZAWA 3E35A 2IA5A 4DR5B 4CU2A 4NAHA 5HFJA 3JQEA 1M66A 2YHIA 4MKHA 5FLKA 2CO0A 4AAYA 4CUKA 4V24A 3IALA 3HJCA 1V47A 2BI8A 2V6JA 1B43A 1ESZA 4AMZA 1GQ2A 5EKDA 2BF7A 3IQEA 2O2JA 4JDPA 4OU4A 3RYFA 2G77B 2ODEA 2XYRA 4OM7A 3Q3HA 3FMVA 4NY1A 4BZWA 4ZD6A 4BB9A 3JASA 3MRSA 3Q41A 1L8AA 2KJQA 4JL5A 1C14A 3EVBA 4NQZA 1WSAA 3KTFA 4OMDA 5JWRA 2Q5CA 3WFJA 2Q3DA 2XQGA 4YJHB 3RU7A 4A27A 3DONA 3SQLA 5FWXA 5EFOA 3FD8A 3MRVA 1R37A 1SFRA 1V1MB 1HFJA 1CJCA 2ZUEA 2BFFB 3H18A 2V5AA 4L50A 2L18A 3QY0A 3H04A 3RTGA 1V6AA 1NLMA 3MWLA 3R3JA 1PIWA 3G1UA 3JQ8A 4JKOA 1NRXA 2IY8A 2BFPA 1OKKA 5A71A 1GFSA 2WF5A 4PLZA 3IVCA 3OPVA 1I94B 2AC2A 3IP3A 3MBOA 3OKCA 4TWJA 2C3OA 5CDHA 1KORA 5AKYA 1Q0PA 1U0EA 4BV2A 2KS6A 2COKA 1T1GA 1XZDA 3BH6A 5J4VA 3C43A 3FPGA 1MAHA 3OX4A 3BF8A 1JEYB 1NXSA 4H77A 4WK2B 4OGLA 2BDTA 1DQYA 3KRTA 1EG7A 1WQ1R 4QPCA 1Z5GA 2P6OA 3QF4B 2W6NA 3HRKA 2UUAB 4LKRA 2X5JO 2L17A 1YQUA 3ZWVA 1MA3A 4PLFA 4DCJA 3BD8A 4BL5A 3QPVA 4MEJA 3IEVA 4RC9A 2VHZA 1AV6A 1HXHA 3CR8A 3R6DA 3AV0B 4HDRB 4B6QA 1M5RA 1EGAA 4Q7MB 3U5ZB 1P61B 5KQMA 1CDZA 1CJUC 3KWJA 1R10A 5HJ5A 2ACWA 3U4YA 1BKYA 1XVTA 3BD6A 4RMIA 4M8KA 3H5AA 2GO1A 2WPDD 3M6XA 4H7JA 3NEYA 2H3XA 1HM5A 1ODSA 1FUUA 3Q11A 1QHYA 4Y2XA 2RKBA 3WL6A 3SBQA 4ZOQI 4MARA 2PVPA 4RD0A 3OFSA 5I6DA 3CLRD 1HZZC 2XA2A 2DLNA 1J99A 1Y42X 5CYKB 3TLBA 1IM5A 5TMDA 1SC3A 3BJEA 4AZ0A 4UAUA 3N8DA 3R8CA 1NN5A 1TADA 5IAAA 4ZA2A 3MRTA 2Q3MA 4XB6B 3VA7A 4LY0A 2ZT6A 3VBEA 4RM2A 2CKMA 4BBZA 3T5DA 3EVCA 3UMCA 3NVKI 3EGDA 1L1EA 2GEFA 4AW9A 3GLQA 2PWBA 3QU7A 2NPOA 2QRPA 4RH3A 2GXQA 1AC5A 3LX4A 2O59A 1BG6A 3ORSA 1NNUA 2R68A 1AQLA 5K20A 2I87A 1CP2A 2JF0A 3P0JA 1BPOA 2O2DA 4UUBA 1QHGA 4IFTA 2BFWA 1OILA 3FJOA 2OFFA 3GP3A 3F6EX 1ZVJA 1B76A 5B58T 1OSNA 1THGA 3GGGA 3IIEA 3PP8A 5BYJA 1HOXA 3SEQA 4FGSA 3H9BA 3IEKA 2VPYA 1U81A 4JSYA 5IC6A 2DY1A 2O7NA 4C7XA 4RZSA 4L22A 3RVMA 1W96A 1M6NA 4Y6LA 1HLGA 1ESNA 4DBVO 3TN7A 1ZQ1A 4H3SA 5LMZA 1WU8A 2JLVA 5B1SA 1XQ9A 4DPLA 1JBKA 1DXQA 5HQGA 1IHUA 1BQEA 4PS1A 1T0IA 2O8FA 3K0HA 3GDHA 3KKKA 3S2FA 1DO0A 1GO2A 4Q4JA 5DTQA 1HKHA 3G2MA 1X7XB 4EI8A 3D3JA 2X9QA 2XB9A 2VYVA 3Q5EA 5FJIA 1LBEA 4XTRA 3LPCA 3MW8A 3HHEA 3QLEA 1ZN7A 1E7RA 2EG5A 5AW8A 1NURA 1CJSA 1CIVA 3MTJA 821PA 2JDID 3G5TA 3RHZA 3OL2A 3U3JA 3CZMA 2RH5A 3E9CA 4KVFA 1N0VC 3IO5A 3N9IA 3PNSA 1QX3A 3HWWA 2IUUA 3ZDYB 3TYXA 3LAWA 3ZW7A 1OXVA 3IVRA 1YMVA 2I7VA 4CKBA 4CF3A 2Z2NA 4BO3A 5G4KB 4TN1A 4L72A 4EYEA 1F3OA 3HVUA 4Q18A 2AEFA 1EXDA 2PRYA 3A1DA 2WAMA 4Z9FA 2ZPAA 1Z56C 2FPWA 2R5NA 4X63B 3BMCB 4E4YA 5BPFA 3KZMA 5IXSA 4P3OA 4S1PA 1EX9A 3C8UA 5C4GB 2J55H 4E5ZA 4MINA 1JDBC 1MG2A 1E1QD 5FPSA 2PMFA 4AYWA 4Y2VA 4NAVA 4BYGA 4JJ6A 4I3FA 2G0NA 2I29A 2Z3ZA 2EJVA 1NNI1 1X1CA 3OM9A 1UWKA 2I65A 2VDOB 3LYUA 2C95A 4NYMQ 3DD5A 1UPXA 4LYFA 1U2ZA 3LPDA 3AI7A 2BEUB 2PMCA 2CNBA 4D4MA 1JBQA 4BNIA 3B5IA 3ZHTA 4C30A 3WFZA 5A9TA 4ARSA 3UZUA 3EG5A 1VI6A 4QGFA 2VJYA 5ECDA 1Q74A 1QIJA 3WXMA 3WJAA 2YN0A 3HVKA 2YY6A 4E5SA 5JHHB 1F7VA 5DASA 1Z6GA 4QVIA 4MTCA 3I9FA 3UR4A 2Q3HA 4AYXA 2ILVA 4H5JA 1T26A 4LPSA 1Q6YA 4NNJA 3B6JA 1M67A 4UEWA 2JFPA 4TTSA 1RABA 2UAGA 1TBGA 3MWJA 4N76A 3I9LA 2Q5OA 3PIRA 5CIWA 1AV7A 3D7SA 4F1KA 1IEWA 621PA 4EHDA 3IIYA 1YWGO 4I4NA 3QXCA 4XYGA 4X8OA 1M7HA 4A0QA 1X2EA 4BMZA 1NBOA 3EZYA 3I8EA 4G8DA 2BMDA 4IP0A 1T0UA 4FYKA 3FPLA 2VC2A 5B3JA 3GGCA 4OLBA 5TQ2A 1XYYA 1KEPA 5K9ZA 4CZ2A 4NZMA 3P9PA 1CF4A 3BZUA 4GZLA 2QUAA 4HMQA 1BU5A 3KHTA 5F9HA 4M36A 4I50F 2HWWA 2YL2A 3J81g 4ZKEA 2IDJA 2LXNA 3I1JA 1WOMA 3WYCA 1AS3A 2WIDA 2BVNA 3L6DA 2XQVA 2E3JA 3KTDA 2GJSA 5HKAA 4Q01A 2DHDA 1Y8QA 5KJCA 5K3DA 4N5DA 2VDKA 4XDZA 1UEJA 2OWEA 5HIMA 3T5AA 1UBLS 4EM6A 3IOYA 2GJKA 2Y9PB 2GX6A 1PFKA 1E6MA 4ND8B 2DSNA 2VHEA 3BXZA 1KKMA 3KYDB 1QRSA 3E2MA 3M5CA 1KO8A 3UXMA 421PA 1BXRB 2R96A 5FPYA 2J45A 1RQLA 4JX8A 5TS3A 1IULA 1TAGA 1QCDA 2F3TA 2H8GA 5DNVA 3FUCA 4F4UA 1FTGA 5CG2A 3T94A 4FA1D 1Z4MA 3A1VA 2FX3A 4TGLA 4XJSA 2AOTB 5KTTA 1THMA 1OAAA 3VU0A 5MGNA 2NN3C 4LKOA 2JKXA 3TOXA 4XFKA 3BDAA 3MJEA 4NYIQ 3H9UA 4E2YA 3DEHA 4V0QA 4N5LA 4C7BA 3IP5A 5FNVF 2SBTA 2ZIWB 2WK1A 4A73A 4H16A 4CKEB 2J3IA 2O1SA 3PQ7A 1UODA 4RABA 4KO2S 2Y05A 3W05A 3IPRA 5IM4F 3FZYA 2FUNB 1OIVA 4XUDA 2QUZA 2XMRA 1L9XA 1LDEA 4XR4A 2WAYA 4OK5A 1T2NA 1FNMA 2XYIA 5CHEA 1S3FA 8AT1A 3IT2A 4EH1A 1JE0A 2HA2A 1EESA 1P9NA 4K6FA 2Y9MB 2CJFA 1WU7A 4HGYA 2C03A 4KYVA 3GQVA 1XCLA 3G59A 1G21B 5LYJA 4D9FA 5ERGB 2IUYA 1YTUA 1KGDA 3DV0A 1N5IA 4P8RA 3G8BA 2W6QA 3Q3EA 1WY7A 4WZBE 4AJHA 3JALB 3EAGA 4HGNA 2BGIA 2AGZA 1J97A 3NMUF 3FPAA 4P58A 2BYTA 4BO7A 5BW5A 4JB2A 3TSYA 3ZKWA 1UWLA 4P83A 4Z9XA 3GRVA 4JC8A 1HBJA 4HT3B 4FN5A 3WWEA 3MJHA 1CVRA 4ESOA 2OQRA 2BFEA 1S5PA 4TMXA 2YVQA 3TTVA 3M6WA 5KYXA 3L49A 1KQNA 1J07A 1MJ5A 1N2CA 1WMEA 2DFDA 4LTNA 1I5OA 4B33A 2OO5C 2V1UA 1LKZA 5CCEA 5TR9A 3ZI4A 3RVPA 4HVLA 2VHVA 3NONA 4ENUA 4JVSB 4G0XA 3Q7SA 4A1FA 2XRYA 4DIKA 4FFLA 2FTKE 1RE1A 2FWJA 1JHXA 1JAZA 1XPUA 4JI6B 5BQFA 1FFGA 3A06A 1JH9A 3ZNQA 4BFCA 1UAAA 4ZWNA 2B4EA 2WYIA 2JGMA 4BE4A 5JYCA 2X1LA 5AI4A 2PJUA 4ITRC 521PA 1TIKA 1ZNWA 3JZAA 1KEWA 4B6SA 3PL5A 4KBYA 1GUBA 4MWEA 4KLRA 3EZ9A 4ICIA 3S2GA 2O8CB 3PGLA 4ZI5A 4US0R 1MUUA 1Z06A 3W5DA 4F21A 1UEIA 1QE0A 2XAUA 1H1TA 2C3YA 5BWLA 2CN1A 1HLFA 5BV0A 1P0FA 3LNTA 2B8JA 5EZYB 4U6QA 3Q3IA 2Y4NA 1ZMXA 1GTRA 4K2AA 3RUDA 1Z45A 4UQOA 4S1OA 4N5IX 4JUAA 1X7ZA 4E7PA 2EICA 4FSDA 5IJ0A 5A04A 4OTZA 5IJXA 1SXHA 1EDBA 3N6RA 2E4VA 3DPUA 4GMGA 2CXPA 3FPJA 2DJ5A 5CDFE 1NG9A 2XNSA 3HSSA 1NXOA 1UEXC 1TF5A 3ITKA 4V39A 4IVQA 1T15A 2XOKD 4ES0A 5I7AA 2VFAA 1WEHA 3NJ4A 1BU8A 3OC0A 1AOXA 4NS1A 1KSJA 2F3RA 4TVKA 1P2GA 1DKNA 3CPHA 3R5KA 1MEJA 3EY4A 4JWKA 3LFTA 1Z7GA 2UZ0A 5ALRA 3AKCA 3N2KB 3EQ7A 4BVKA 3W8FA 3L0SA 1TA0A 4RV5A 2FOLA 1N57A 4ITVA 3EZ2A 2MSWA 4XQCA 4UPDA 1CQJB 1N7HA 2AVNA 5ER9A 1CG6A 5IC4A 3VPXA 2C4VA 1JZSA 4D97A 3OPYA 2XGGA 1N6RA 2R1VB 1B1CA 1QR6A 4V1CB 4AKIA 1H8HA 3TD6A 2I03A 1QIHA 4KOAA 3IBTA 4PX2A 1PJZA 5EMKB 3K32A 3D8TA 2EEPA 4W82A 4BNNA 5I48A 2ILTA 3NIGA 2GUWA 3M3HA 4X91A 2ZRDA 4XTCS 2I8CA 1J90A 3RAGA 4HNTA 1NIPA 3UENA 1W5AA 1NR0A 3N8HA 4KN8A 3DVQX 3ZBQA 3FBWA 2R2AA 4EFDA 3QLJA 4J0KA 4NFSA 1QG2A 2VA9A 3U7HB 3CZQA 1KP2A 3T52A 3VR3D 1UT5A 2Z08A 3KLNA 2I3AA 4FXPA 4I5GA 4QOSA 4P36A 1FFSA 3GLVA 3U16A 3E9YA 5B64A 4B3JA 3IRUA 4Q9HA 3DFUA 4H0FA 5A2Qg 4BIIA 1JKIA 4M1ZA 5EIEA 3EXIB 1OW3B 3MA0A 4L28A 3I4LA 3QNWA 1RM5A 2ZJ3A 4RL4A 4AQYB 9ABPA 1JLLB 3DB1A 1PEDA 3N7TA 3EZFA 4TL6A 4QNNA 1Y3FE 2XMCA 2PEZA 3LKVA 4B71A 1P9WA 4B4VA 1TYEA 1E6KA 4X61A 5D87A 5BSTA 4RHYA 1L7BA 3ETJA 1B9YA 3VDQA 1L1FA 1TM3E 4PCAA 4R9NA 4ZZ2A 2YCLA 2BEVA 2ZUUA 1T36B 1O6GA 1SIWA 3MTIA 1Z35A 1ZK0A 3NNSA 4XKJA 4GMXA 3M3PA 2CL7X 1YBVA 4CF7A 2KW5A 1YQ9A 4WN9A 1A12A 3THWB 3D8SA 3P97A 1VMDA 3W8RA 3O75A 2XEDA 2C29D 1II8B 4JR0A 5KJEA 2JFNA 1MTZA 2B2NA 4YAJA 3A3PA 5BY2A 4GBGA 3QFTA 3I3SR 1PT6A 1XE3A 5M5VA 4GMFA 3I2YX 3BMQA 4KR7A 3TDMA 1W49A 2ZOSA 3CKKA 1PG0A 4NE7A 5AOBA 2WTNA 4N9QA 1SA0B 1XVVA 4AT1A 2E5FA 2OO7A 5I8ZA 2QX6A 2F3UA 3EQ6A 4GSKA 2QT0A 3E84A 1X7YB 3DTVA 2IIVA 5CM8B 1E1CA 2P9ZA 4PZDA 5CNIA 3JXEA 4LF9B 4RH0A 2V7UA 5M5UA 4CT4B 2NT4A 3THRA 3VR5H 5L53A 5T8KC 3MB8A 3PFKA 1KVSA 2VYCA 3TXYA 4CZXA 3CB2A 2BM1A 3VKVA 5EKUA 3V8VA 1S1MA 3DUWA 5CA0A 3THYB 5FUWA 1EP9A 1JUDA 2XT6A 3WC4A 1GAQA 1PI6A 1FX1A 4IX1A 3A7DA 4UQLA 2QZPA 3ROQA 5JEEA 2XZGA 2V0CA 3QELA 3PFFA 3UHJA 4WQMA 2QJTA 3M81A 3WGGA 4DW8A 3N74A 1WTAA 5THQA 1J00A 4BB5A 2HF2A 4DNUA 4UOZA 2JASA 4DMHA 5TPZD 2HJ9A 1ZIXA 3RK0A 3I4CA 1QBKC 4J0DA 3FUTA 1RKQA 1JYFA 3BJIC 2WJIA 4IKEA 1O03A 4WFQA 3WRYA 2EJBA 4C0BA 1CPYA 1PTJA 2IDZA 2I4TA 1MR3F 1BFDA 2OV1A 1BEZA 4X93A 2NNWB 1LZKA 2PM7B 1NN0A 3R2JA 2JJ1A 4HNSA 4KQ9A 1GG2B 4L73A 4G9EA 3CZAA 3LQFA 4XA8A 4QLOA 1TLFA 4FLMA 4ZVKA 2OXIA 4QFCA 1ILEA 4TKZA 2EZ8A 3SVZA 4RADA 2G6TA 4YRIA 2CZCA 3C3WA 5FBWB 4TYNA 2VF5X 4RTPA 3DO5A 2D3WA 2R86A 2A35A 4RFSB 2EKZA 3GLHB 3S2SA 3DNMA 4LRUA 3OMWA 1Q1GA 4O2AB 5AJYA 3AB3A 4FGLA 1QLWA 2X8AA 3E03A 4WKNA 4TQGA 3MXXA 1NI4A 2WR8A 4HWGA 1T9DA 2Y99A 4BO6A 1P1BA 3ICEA 1A9PA 2UVPA 1K0UA 3HCAA 2ONCA 2G72A 4DWWA 1V11A 4ZCSA 3DAOA 1YS2X 5BSMA 5JSUA 5HJ2A 4BP8A 3A1CA 4MUEA 2HMUA 4ZHQA 2XWSA 4DM7A 3AIMA 4GNKA 5A9RA 1XX6A 3BK2A 1EE1A 2V3VA 3L7AA 2YQ4A 1XVUA 2C82A 2AGWA 4LXUA 1SVUA 4LOJA 1YCGA 2DYKA 3O31A 1V2GA 3VYRB 4LJSA 3AKZA 2H1RA 1C9MA 4F4HA 3ICOA 1VBNA 3I45A 3ED5A 2OTCA 3E53A 3K7EA 1EU1A 4LSMA 3T3MA 5DM2A 1JZQA 4GX1A 2FWNA 4I1VA 4IRUB 4JVNA 4P35A 4F86A 2DVMA 1I4LD 1JHZA 4B83A 3EX7C 4H1HA 4QXRA 2B1GA 4A08A 1TZ2A 3EWIA 3RAEC 2OV3A 5SZHB 1XZCA 3BRCA 3NNDA 4ZFNA 1O5IA 2AGXA 1RYHA 1KJQA 3KM0A 1GOGA 4KFUA 1UKAA 2IGBA 4EMUA 1DC3A 3OJCA 4N7BA 2YYSA 4MVXA 3OCWA 1XA3A 2HSDA 3CNQS 2P40A 3EGVA 4MV6A 1Y6RA 1C30A 3DEJA 3OUTA 5KCZA 4MWCA 3G82C 3BMNB 2GCOA 4ZOBA 5JS2A 4LZJA 2BDEA 2EDAA 3GAFA 2WJ3A 3CIOA 1SWWA 1UQTA 3FPSA 3P32A 3RASA 2OGTA 4KB5A 3U3ZA 1KZ7B 4E7OA 1OFTA 2B7BA 5KYKA 1K6IA 2QP4A 2YVKA 1VE6A 1TCAA 4X92A 4A11A 1AQIA 2YXLA 3QJGA 1PGQA 1R0ZA 4EY4A 3PF9A 3OFND 2WHEA 4CE6A 4ARCA 3HVRA 3R5TA 3FTPA 4MV9A 2X13A 4G89A 2B6NA 3ES9A 2NU9A 1IE3A 1TM1E 5IMBA 4G65A 2WTXA 4XYMA 3T5BA 1KOLA 3OEEA 3TMAA 3T15A 5KX5F 5JYEA 5FORA 3RRYA 4XEIC 2WPNA 3M4XA 4KWIA 3HVJA 1YR3A 4YP9A 1QH8B 4EJMA 3I2FA 5CUQA 1WKCA 2HQ1A 1H4TA 4LDQA 2AOWA 2HK8A 3PQ2A 4EA6A 1DKQA 4OF4A 5FAKA 3UWOA 4UARA 1LS1A 1F20A 1D4OA 4AF8A 4GXTA 4X3PA 4OAPA 3T3IA 4ILKA 4E09A 1X94A 3H1GA 3E1KA 3HO1A 4LC9A 4PSUA 4NPHA 2B5LA 1G8PA 5A62A 1K7CA 2VDVE 4E5YA 4OOEA 3FCOA 1BWSA 1ONOA 2M32A 4LYEA 2ZR9A 2XVYA 4RY2A 3IAS1 2O4UX 3RKRA 4WNYA 1NOIA 1HK7A 1V8FA 3Q8WA 2Q9CA 5CLHA 1EK0A 4J03A 4K6MA 2OCLA 4L15A 3N0XA 1A8SA 1FVFA 1J7KA 1IB0A 1UBCA 2GDZA 2NPIA 3LQYA 5GQSA 4Q15A 3OURA 2ACKA 1PCXA 4IQFA 3CRRA 1DUSA 1POWA 2TMYA 2BSQA 2AHOA 1NMZA 5A1TA 4C7OA 3AFCA 1LRKA 3OSUA 3OOHA 3GG9A 2FPIA 3UO8B 2F8SA 1MJHA 3QW2A 5ICEA 4XGIA 1AK9A 3ORVD 4L16A 4RW0A 3ZN2A 2ZLBA 3RJ9A 2QQ0A 1IRIA 2FGJA 3S68A 3PGA1 5IVPA 4XX0B 1MJNA 5BSUA 1MC4A 3TW6A 3JW8A 1EM6A 3H13A 4QDZA 3ND7A 4G25A 2LWIA 5BWMA 3A3YA 2DPGA 1JQDA 4LQCA 4U5QA 5EUBA 4QQ8A 3GRFA 2RH4A 1Q19A 3QW4B 1U8YA 2FVYA 2ZB8A 1RZRA 2OZPA 4K3JB 3G9XA 2AYXA 1NG1A 2WMNB 3PCTA 3ZE6A 1N6DA 4GBMA 1AKRA 4FMDB 4OGKA 1D8TA 3OQIB 1U4SA 1UMBB 2G1PA 1B16A 3NBZC 4FR5A 2ECKA 4F8EA 2QRMA 4LYAA 4WNAA 3X0DA 2X5KO 3HEMA 1RJWA 2PLWA 2QLNA 4J3JA 2IX3A 1PGOA 3R5FA 5ES3A 4ZEOA 2XUPA 5KJ6A 1IEQA 2PA0A 2X2PA 3ZPXA 5L7YA 1KR5A 4OIMA 3T3EA 2F3SA 4DZRA 2CY0A 1JT9A 4KC0A 2QD4A 2QTGA 1E62A 1UTCA 4IXTA 4IJVA 3GJ0A 3NB0A 4DMRA 2HMWA 4KW7A 1C80A 4U2KA 1M1XA 5LB4A 4JI5B 3MT9A 2QG9A 1KMIY 1D09A 1T9GR 3RVKA 1AA9A 4ML3A 3U9LA 2D2VA 3RS4A 1SD2A 3GH1A 3L4KA 3MPUA 4GVLA 4MSUA 5DX1A 2IEGA 1F8UA 4ARZA 1Z2NX 3CVJA 4KQMA 4IH9A 4MP6A 2UYGA 3STUA 3THXA 1KE2A 2GWRA 1LK5A 3R0ZA 3U0BA 2XF8A 1VJRA 3UOAB 1U2EA 2OY0A 3DSRA 3S7ZA 1N8TA 2BJHA 1ADYA 4J16A 2BP7B 2WIGA 4NU5A 1N7GA 2NXCA 4IO1A 4AYTA 2PDAA 1JI3A 4H0CA 3O83A 4BDTA 3VNAA 4ADSG 4R5HA 3QSGA 4H7DA 1T24A 2G06A 3CSDA 1ZJ5A 2AG6A 4KR2A 2CWWA 4W8HA 2NU6B 1E6UA 4AN1A 2OYCA 3B51X 3BX1A 2WF7A 8ADHA 4KI0A 4OOFA 3P0EA 4FYWA 3F49S 3D3WA 1OF1A 3K70C 3OPQA 4PU0A 4AZVA 3EWAA 4IFIA 3ROGA 3C74A 4GR4A 2OHGA 2ZIXA 3RS3A 1FDVA 4FOLA 1H22A 5EXEA 3AETA 1ML4A 5LMUB 1GXSA 3AZQA 3GJ5A 2H3HA 4WL0A 3MB5A 3E5RA 4D9MA 1K8QA 3U7RA 4M0UA 2YHSA 1XTJA 3JQCA 5EXPA 3CONA 1AHNA 4ZO4A 1XTBA 3L4BC 4HB0A 3A70A 4NR0A 4M8SA 3GMSA 1Z12A 3K4PA 1QC5B 3I6BA 1YB2A 3EH1A 1CRLA 2P7HA 5JDCC 1GPBA 3PCXA 2I55A 3ICQB 3JQFC 4I9GA 2QQ5A 4OYLA 1PZFA 5CPBA 4KQWA 3O8BA 4IV8A 4RF4A 3ZNPA 4OXRA 3SQWA 4JBYA 1JMXB 4P1ZA 4H1TA 3FDXA 3BSYA 5KNLA 3IHKA 3UEOA 4MJ7A 5REQB 4U7GA 4AKSA 3O8LA 1PO7A 3OSZA 1VKZA 4YCJA 1C7QA 2EBSA 2WJGA 4G56B 3OBBA 1N2EA 1I24A 3TCNA 4WNCA 3Q2KA 1HNXB 1VG8A 5CU7A 5EYPA 1L8QA 1Y98A 4NMHA 5LN1A 4ZEVA 3LZ6A 1H1LB 1JHRA 2QRKA 4ZREA 1LF0A 3LTEA 3GFFA 3FFWA 4UZSA 4WKOA 4RDHA 4JLSA 2F2TA 2AOUB 1JL3A 1DOHA 3H7IA 2VDNB 3D59A 4FHZA 2N1BA 3DFIA 3NUGA 4Z0PA 5ALLA 4YN3A 3UMJA 5ICCA 3LFHA 3JWPA 2Y27A 3M4JA 1RI5A 2QQEA 5FA6A 1IFXA 2FMIA 1IEXA 4IHJA 1G21E 2UZYB 5IAGA 2CVPA 2OFOA 1FL9A 3O7MA 5LKRA 3JQAB 1T5SA 5FI0B 2FWRA 2JAQA 1WE2A 1VC2A 4I79A 4OSOA 2JFUA 3M70A 3JWHA 2OPHA 5A3SA 2HPHA 1J2YA 1BGXT 3FVQA 3OQHA 1T10A 3MCVA 1CBUA 2CNLA 1FFCA 2ZU6A 3ZZUA 1DG3A 2YW9A 1V35A 2XYVA 2R60A 4FKMA 3RRMC 3B3QA 5E8JA 1XQVA 3I9JA 5AT1A 2AOXA 3KNZA 3LUDA 1YL7A 1U1EA 5LP6F 4LJ7A 2DLCX 2AZ4A 2H9AA 5JJBA 2ZB3A 4MPPA 1MB0A 3HJHA 3SBXA 4XQEA 5IKOA 4BFUA 1GEGA 3Q98A 4PZUA 1BRMA 3OFVA 3LGAA 1ODFA 1CV2A 3CLUC 2GBCA 2N75A 3C98A 9MHTA 3DP9A 2QUIA 1GKUB 2X1MA 4QJBA 4BP3A 3QEJA 1RYZA 5AVYA 2PUAA 2H6KA 3SHFA 3AHIA 2RAFA 1HMYA 2WTMA 1QP0A 4DNWA 5TY0A 5IABA 4G8CA 2EGUA 3VR6A 5CXBA 5J2TA 4UASA 5B12A 4BGUA 1V8OA 2CCKA 1SHTX 3C8ZA 2PVSA 1EP2B 1LQ2A 1WMSA 2Q6KA 2HKMA 3U7FB 4AZ3B 4RXTA 1AUOA 2PGAA 2Q62A 3UGTA 3HRIA 4P3NA 5JAZA 4I4TF 1XNHA 1M6YA 4EUFA 4E6PA 3LDGA 3MLEA 1F8YA 2IIQA 2X0NA 4TRNA 2IS1A 3L0CA 2YNMD 2OBFA 2F3PA 3OX2A 3VO9A 3TK1A 5T4BA 3ZD8A 4DVGA 5IAOA 3GWGA 1XRLA 3GRZA 5ISMA 1R12A 3JQQA 1HEYA 2EX0A 3K9BA 4B76A 1M0SA 2CXHA 1OX4B 3SZUA 5ICSA 3FTQA 4LXIA 3LUCA 5E1OA 3GUUA 4H17A 3UWSA 5BRNA 2CBZA 4NOLA 4ZTBA 4PZPA 4M49A 2PRJA 2WICA 3JZDA 3PNQA 5ALQA 1BMFA 3L7OA 3EC7A 4ZCTA 3NJRA 4P22A 1HDZA 3R41A 4J75A 1NXVA 3UYKA 5D3QA 9ATCA 5GTDA 1XVIA 5DBHX 3RRNA 4NVRA 1GQFA 4L08A 3GIDA 1FSFA 3C3BA 3E2PA 4KGZA 3RMZD 5DI3A 4JBGA 3KVRA 2OB2A 4DG8A 2QNIA 1GZ3A 3DLIA 5ILGA 1VLMA 4HGOA 1COZA 2C0PA 3VR0A 2EL7A 3R8FA 2VDPA 5E6UA 2MSDB 2JVIA 2W7TA 3KEMA 3ZH2A 1JYEA 2BLLA 3BILA 3SZ3A 3H17A 1XWIA 1E66A 2OHVA 5ULLA 2QM3A 3VYWA 2P1RA 5K0FA 1SOVA 2OLJA 2ZBPA 3UB3A 2OZEA 2R47A 1U8CA 3BDIA 3TB4A 3AJEA 2HMVA 1DDGA 5FUXA 2D2XA 3M2PA 3B85A 1I3MA 3GX1A 3ZY2A 2P9NC 1AKWA 1DAEA 5CHYA 4ROTA 3F8TA 3WDLA 4X54A 3P4XA 1OROA 5LXTA 4HATA 2K7FA 2EFEB 4K9DA 4M7PA 3JQ9A 2V03A 4DABA 3L9WA 3VVLA 4F4JA 2YWHA 1YFQA 4BKPA 3KAPA 2BHNA 3DTTA 1LSSA 4F7WA 4QREA 5C37A 1TMOA 5HR5A 3BE6A 2H1FA 5LQKA 4FSHA 2W4MA 4G63A 2BGWA 5DWQA 4NS4A 3M5WA 3GJ8A 3VPSA 3X1DA 4PVDA 1VGVA 1A8QA 4PYKA 3TINA 4RKFA 4PG7A 1PFUA 4KKXB 1YZQA 2GJAA 4UBLA 1Z3CA 2QR2A 1XCPA 3S1SA 4PXWA 3E22A 1U9IC 3GO4A 3K0CC 4NXMB 2OHJA 3PVWB 4XEHA 5JRDS 4MWTA 2XOEA 2IYWA 1JMZB 4AO6A 3HRHA 4FHGA 5EPUA 2YWJA 4L4XA 3PQ5A 4Q82A 2O2CA 4F12A 3LK6A 4V38A 1W52X 2GJ4A 2BMFA 4PX5A 1C3EA 4YX9A 1Y82A 4WIAA 3SCZA 1Y63A 3ACBA 4N47A 2WZQA 4FZ3A 2ONKA 3VTKA 2GTHA 2X3YA 4IZIA 1P9LA 3NHZA 2HLNA 3DE4X 4GR5A 1EP3B 3WQBA 2YV3A 5IVHA 4COOA 2JLRA 1CUIA 2QN3A 4P4TA 1KYVA 4O4LA 1E2LA 4FFSA 1T91A 1PL6A 3NBFA 5IVDA 1CEXA 2EGHA 3L0BA 2ZJ0A 3PUKA 4ZK6A 4FDAA 5CGZA 1AGPA 2B30A 5K3CA 3W9BA 4KH0A 4S35A 4YQEA 1NPYA 1PR1A 5FR2A 4C78A 4DLBA 1OIXA 1Y9EA 1E5QA 1ZOLA 2C99A 3T5GA 4W6QA 3KD3A 2ODWA 2A5LA 3N7UA 4LG8A 3RSFA 5KBYA 1E2JA 3NLLA 1ZQ9A 1WUKS 3VSAA 1VLLA 3V1YA 3OG9A 4B80A 5K2MA 1B2LA 3FKQA 2F9MA 1SUFA 2VWPA 3K31A 4Z2YA 4Z0NA 3INRA 4CY5A 1GCOA 1NW4A 1RWQA 2PGDA 2CFOA 1I0LA 4KMRA 3SVLA 1RPAA 3C6ZA 4EELA 2YWEA 2WD7A 1D6NA 4JLDA 3BFVA 3HG7A 2C2WA 1L8OA 3OZEA 5KQSA 2OBBA 1U1FA 3RKUA 3L93A 3NEAA 2WSYB 3CRZA 2XNDA 2NYAA 4IF4A 5E95A 1QZUA 4WZBA 1ENZA 4EHNA 4E54A 1F2UB 3V7NA 1YQQA 5ABPA 3CBGA 1CIJA 2CDAA 4UHDA 4CQMD 4RCVA 1WCV1 1JA9A 4B6OA 4JT9A 4RVFA 1Q22A 4WK4A 2FZGA 4M1OA 4D0SA 4GLBA 4HDNA 2HQBA 2YUIA 1SXJE 1QV6A 2CXSA 3OE1A 3H65A 7REQA 1C7EA 1SQ0A 5KWJA 5KPDA 5BVHA 2X4IA 1OYVA 1XEXB 4I50B 2POCA 4YMWA 2C5EA 2G40A 3SYLA 4MA5A 2QRNA 1C41A 1DINA 1RCTE 1JIKA 2DPMA 2NNLD 4HWSA 4RIFA 1P0CA 5EP3A 1LPSA 1WZEA 1QXSA 1XCBA 2VR1A 1BYUA 1XSEA 1R6TA 3ZGYA 4F72A 5IT0A 5LQJA 4PZYA 2VJPA 4KXYA 3FB4A 1ZMTA 4BJHB 5KOHB 3ELUA 1U0FA 1DJOA 2ZT5A 5TQ0A 3T1YB 2QVXX 3CRMA 2V1XA 1RJEA 3H5RA 2FMUA 3O8OB 2OXRA 4XAQA 2JKVA 1G3MA 2IBMA 2QTFA 1FU7A 3DZCA 2GPBA 4Q9NA 3C9CA 3ZGLA 1Q92A 4RK4A 4ASUA 2IF0A 5CH5A 1DQPA 3FTCA 2VHTA 2QZ4A 3NTQA 2PANA 2QQFA 1FU8A 4Q1CA 3JATB 2GYWA 3DA8A 1LEHA 3KOWA 4RVNA 1EX6A 1SG0A 3F9IA 1AQJA 2H29A 4RZQA 1J9EA 3HJRA 1I7PA 1O95C 2C7BA 1FDIA 4QAJA 4OYRA 4EG6A 1YZNA 5FNVB 4JELA 1XRSB 4JXJA 1D2GA 1E2QA 1NY5A 4RTSA 2VRCA 4ZJYA 3ILSA 3GLKA 5DULA 1QYRA 2FPPB 4M1SA 4J7XA 1VP9A 5CLQA 3T9DA 1XD8A 4G0VA 4U6NA 2REQA 1C1YA 6AT1A 3L7YA 1SC1A 1RYMA 1ZOIA 4HX5A 2I0SA 3DCJA 4D4IA 2LBPA 3KUCA 2GN0A 3OIDA 5CDFA 4QYIB 1ZBDA 5CTJA 1YF3A 1SEVA 2PXHA 4I1SA 4Q21A 2AH0A 5FTKA 2H17A 4FDMA 4HFJA 1MX3A 3JV7A 1KR2A 3UF0A 1P0PA 4UEKA 3ER8A 3CN9A 2C07A 4P53A 4HK4A 3B1WA 1N0HA 1U9JA 4CKCA 2MMGA 1PVDA 4ZT3A 2GESA 4YRTA 2HMSA 2IYQA 4IUDS 4EKIA 3T4EA 1OWPA 4DQDA 3GPIA 2QTZA 3PFWO 3ICPA 2Z5VA 4BV3A 2C4WA 4OQPA 5C1IA 3FNGA 3EISA 1ZOSA 3VO1A 3IV7A 3GJ4A 2VATA 4INZA 5J4HA 3GLFB 2GK7A 2PWAA 2EHDA 3KYIB 4CLOB 2CUZA 4GWGA 3F74A 4K46A 1T8PA 5L7WA 5AW0A 2Z8ZA 3ZJTA 4ZQEA 1KP3A 5L3VA 2QLTA 2ZVJA 3UBTA 4FVTA 3GRPA 2RHRA 4KFTA 2IUFA 1NX6A 3KFLA 3KB6A 1K7YA 2QE7A 1EEHA 4DLVA 1SXPA 5BN4A 4CXMA 3E1SA 1NYLA 3K8OE 1WXDA 1PEVA 2WEKA 5H17A 2H7YA 4IIYA 3FY4A 3KZKA 3EPJA 3IVMA 4JNKA 5LBTA 2GBFA 5CFRA 4MK0B 4TUYA 4W1RA 4DIUA 2JFWA 4I8XA 3VR4A 1MGOA 2G76A 4BZXA 4RNCA 3WL3A 2PT9A 2M1ZA 2AGLA 4QXPA 4JXXA 3EDOA 1YFZA 3O4FA 5B6IA 5K3FA 5JMWA 2EEZA 3T41A 3VMMA 4ZDIA 2W5UA 4YACA 4MKRA 3G5AA 4A6DA 3U56A 3WY9A 1Y7HA 4Q7EA 3F73A 5TGZA 2TMKA 4E32A 4LYYA 4ZXFA 4G1UC 4K9MA 3AT1A 4MRMB 2MSEB 3BCHA 1JMYA 4CIXA 2YVLA 1NKSA 2RGEA 4XVCA 3EU7A 4YUXA 3EVDA 4WACA 2BKUA 4J0HA 3ZWNA 4NE2A 4OYYA 3E0CA 2IK8A 5AP9A 2C9DA 1DC6A 2XITA 1R5JA 2V96A 1JX6A 5JTTA 2OE2A 5JBIA 2AQHA 2OXTA 1HR0B 5I7FA 1UP6A 5DOVA 5JAMA 1OZAA 2YZ7A 2ZQ5A 4B6JA 3Q8MA 1QNIA 2OVPB 4Y0AA 5B53A 1AUXA 8ABPA 2FZ5A 5B1DA 4FGUA 4BNKA 5LB2A 3VH0A 3OH8A 3O8DA 3V7DB 2CJPA 1VYTA 2W83A 4HUQA 3M4YA 5DLYA 5DTJA 3IGFA 4H3KB 4GNRA 4GIBA 4R83A 3D6AA 4QDJA 4Z7QB 1QNFA 2Q0XA 5A03A 1D1PA 1LPPA 4DHEA 3PC8A 2DKOA 2HCBA 1U2PA 1EK1A 1LI7A 1GKIA 1L3CA 2K6GA 2H68A 2CMGA 5LWQA 1DBWA 2B2CA 1TZKA 3NHLA 5I3ZA 1TL7C 4EDHA 2XD9A 1P19A 3QKTA 2GF0A 2ZTSA 1JQKA 1RM3A 4TTPA 1NJSA 3PPXA 1NVVR 3PYMA 4B7ZA 4RL6A 4YXWA 2WSMA 3FVRA 2RGUA 3I53A 4PWZA 1NTRA 4XQ0A 4HBGA 3F3MA 5SZKB 4D3XA 2EJCA 4CLRB 1E5XA 5DSTA 5IYZF 1ZXXA 4A8HA 2RHCA 3Q2IA 4IZ6A 4YCCA 5TDHA 1QGDA 3CXUA 3L9XA 2JI7A 2F1OA 1I5RA 3AXTA 1B7GO 2AG5A 1CZUA 4BATA 3ASYA 2GCIA 2ZT8A 3C3MA 3VC3A 2XMDA 4MB6A 5G0WA 4MUKA 5JISA 2HM7A 4BX0A 3FRHA 3EI4A 3F7OA 3FCYA 1P4HA 3RC1A 3PE6A 1G16A 8LDHA 1CF9A 2X8WA 1AHHA 5EC8A 3PIIA 1MN6A 5D5HA 3F6PA 5JAOA 4ESGA 5FAXA 1QJCA 1P6QA 2E5LB 3GG2A 4XQGA 4CEJB 2ONJA 4RSRA 1X8LA 4RTRA 1KRWA 1L9KA 4E2FA 2CFRA 3N0DA 5JECA 1YZHA 3RK4A 4WFIA 4PW0A 1BXKA 2CBGA 2D7DA 2DWQA 4DTIA 3NETA 1CFZA 2BH9A 4UREA 2IVFA 2C8LA 1Y81A 4C43A 4MS4B 3HDTA 2FLVA 4ZDKA 1X80A 2YBEA 1PJLA 3F4LA 1ZHFA 1P44A 3KEGA 3EG9A 5BSEA 5BYBA 4AKGA 3JQRA 5BUQA 3G0IA 4KFCA 4IDPA 5BN3A 2FEMA 2VH1A 4DCMA 4ACAA 1ZC3A 3DB2A 2WKSA 2VDQB 3JQBC 1SOUA 3C45A 2ZAIA 1JR2A 1LJLA 3HABA 1Y4SA 3X43A 4HH3C 3H2GA 1M1NA 4M1EA 5AVKA 1DBVO 3B1KA 3MOSA 1V45E 1PEAA 4YH1A 2VP4A 2XWJI 4YAUA 3L1UA 4EUKA 3QVKA 2D1TA 2QZJA 4Q7QA 3HR7A 3IDAA 3FYUA 1GXRA 5AOVA 4NSXA 4FOPA 4D80A 1FJXA 1EK6A 1V7QA 3F7MA 3KSMA 3WDSA 1W4BA 4C6HA 1T3LA 2EWMA 3R76A 1LTQA 5DRYA 4G67A 2JI9A 3DCYA 2RGXA 3GRRA 2EP7A 4QSMA 4TVSA 5CDTA 3OUZA 5T3UA 5FTJA 3PBKA 2KB0A 4BV9A 4YS6A 3PQFA 4JJGA 1EVIA 4MGHA 2OKGA 2RAUA 5TT0A 5GV8A 3QYJA 3OIUA 4YRDA 1OFGA 2A1TR 4M9ZA 2GBLC 4C7VA 5C3MA 1XJQA 2IPXA 4RJKA 4JLAA 2CLIB 2FN7A 1UH5A 3TRDA 3U6BA 3D1LA 4MX8A 2PO5A 3A58B 3NTLA 1O77A 4PLYA 1KAMA 3Q9UA 1O8BA 1LBIA 3K70D 4FJ2A 4J8GA 3B1XA 4G5HA 4IMPA 4I99A 2K87A 3IJEB 5FBHA 4JITA 1OWMA 5G3YA 3AUUA 4TMKA 4MVJD 3CLTC 3KWLA 4DSAA 2HHJA 3BORA 5G2OA 4MWGA 2I7CA 3JRWA 3VOSA 1CJBA 1FDTA 2W2QA 3OICA 3VGJA 1NVWQ 2G09A 3ISTA 3SEZA 3D43A 4R7ZA 3GRKA 2ZZNA 3SEAA 3EPHA 3AUKA 3VYTB 1YC5A 1GQYA 5CCDA 1IJFA 4TLBA 3TM5A 4GOOD 4CUJA 1Y3IA 3O84A 4GR9A 2XYHA 3LWZA 3WRXA 3SYRA 1CY6A 4MCJA 1XZAA 3R5HA 2BW0A 2QC5A 3C3DA 3IE2A 1R88A 4U2CA 3IRVA 5TX7A 4PHTA 4XARA 3ZDEA 2IYNA 2H2WA 3BJZA 1E5LA 2YWRA 4IDQA 1WIWA 4V03A 1HYGA 1D6MA 1P73A 3Q5GA 2HA5A 4PQEA 4X8HA 1IN7A 2DFLA 1KIAA 4M98A 3UV7A 3G7UA 1Z28A 1O1YA 3NOXA 3DMRA 5LQDA 2BDUA 3ELYA 1RRPA 4OP3A 3MWEB 4XOUA 4NL4H 1UWCA 3WLRA 1Z47A 4IJ5A 1VIYA 2O1WA 2ZJFA 3CNOA 2A9OA 4IQ0A 2R11A 4QUBA 4XJTA 2CKDA 4ZYUA 4LF6B 2W2PA 3RB8A 2HOQA 3OAAD 1GZHB 3QTTA 1SBNE 1MX1A 4BNXA 1M1YB 1CNEA 3AM4A 3LLMA 1U90A 5TE9A 3GCDA 5KJFA 1VA4A 5ETJA 4U9HS 4BLQA 4BO8A 3NKFA 4ZYXA 3ZCPA 3KR2A 2OJYA 5CXCB 1ES9A 4Q3EA 3GC6A 3SMVA 1E7WA 4LHZA 4A2LA 1XU4A 3SE0A 2Y1DA 1RXEA 4S0XA 5AI9A 1KI3A 2WJAA 1E60A 3DQQA 1VMEA 4KE9A 2BFCA 3RWMB 2V7VA 3N53A 1JHMA 2VDRA 3K1JA 3ZWAA 3MCWA 1ISPA 1KAOA 4MYUA 5JMTA 4YJFB 2GF9A 4HRVA 1WL8A 4BWFB 3OWOA 1TMYA 4OGWA 3OZXA 4PSKA 3STVA 2VTKA 4KACA 4RK5A 1XMQB 2XIJA 3VV2A 4G26A 4BEVA 4A0BA 2JFYA 1QO0D 2GQ0A 5K8LA 1YUBA 1L7DA 1E9RA 5DHPA 4EMTA 1X1SA 5JXGA 3MGAA 4Z3OA 4PN7A 4CF4A 5JY1A 4YRZA 1C3XA 3I28A 3Q87B 2ZBEA 1H1DA 2YASA 2B25A 1CQXA 4TVBA 5AESA 1N6EA 2VZ9A 4URHA 1LDYA 4Z51A 2ZWPA 2AR9A 3WGTA 5IBRA 3AW9A 4N39A 5EERA 3T7EA 3DLCA 2Z5LA 1GLVA 3DW3X 4TTQA 1BWQA 1BDHA 5AW6A 2EQAA 4K9OA 1BMTA 4HNGA 3CCCA 2RBGA 2YXDA 4PFSA 5JCJD 2JCGA 1UZMA 1LCIA 3B3GA 1VJ1A 4Q03A 3IP9A 3U0VA 1ZGCA 2BZ1A 1EVJA 1AMNA 5IW8A 1F51E 1QH1B 3H5LA 1R66A 4HH1A 5H02A 3H86A 3GZTB 2C2XA 1BDJA 4GYWA 4B5LA 4B6EA 5I7WA 3B1JA 3PHHA 1H6BA 4AJPA 3HCNA 3PTZA 1BJTA 3LLSA 2GETA 2JJYA 2Y0BA 3V4SA 1W5EA 1HA3A 4RFLA 4DJDC 5LBUA 3DDOA 3K15A 4D74A 5FEUA 1M33A 5CT6A 2CJXA 1F6BA 1KFKB 2QQGA 3LRPA 2XZTA 1E98A 3F3SA 1RPNA 3OEHD 5FF9A 1UXIA 2P4QA 3N0EA 3JU3A 4GI2A 3LWBA 1AK1A 3M49A 4R1PA 2RJOA 4G5RA 1QMPA 1E1KA 3EYWA 4PR0A 4HX2A 1ZO8A 3DE5X 1IQ0A 2I2FA 5EP2A 4ALNA 3B6IA 2HZBA 4RZ3A 2VUUA 3DL2A 2VT6A 1YU6A 3LVBA 3AF1A 4KVZA 1R4NA 4O2BB 1KARA 2Z4SA 5EUQB 2B82A 4D9GA 3OE7D 1E9EA 2AC4A 5A4JA 4JBNA 1RWOA 5CX1A 2J48A 2G28A 4OQXA 2DH6A 3NVAA 5M5TA 4QUHA 4MMZB 2PZGA 3RC7A 1PGUA 2J31A 4IKOA 1RJGA 5T5QA 3IQGX 4IIFA 4L5YA 1Y3CE 4TZTA 2WTBA 3W2GA 5ICMA 2Z9DA 3NHSA 5DK6A 4DNVA 4PHHA 1CY8A 3C3CA 2R8XA 3L4EA 4UKDA 4C2BA 1H5QA 4M8LA 4KE7A 4K1XA 5KPJA 4AMVA 1SK8A 1U2DA 4Y9UA 5DWVA 2YXNA 2WM2A 2D2EA 1Q15A 2CL6X 3TTWA 4BO5A 3ZV6A 5JWZA 1ZI9A 1FBTA 1WDLA 5JSZB 2AQ8A 3STYA 3UGKA 7YASA 1VBMA 2PV7A 3P2JA 3AESB 5EHNA 1TW3A 4QBIA 3M2TA 2E1PA 1A0OA 1NJ1A 4CM5A 1ZUNB 2PX4A 3EODA 3ZHVA 2QRUA 4CMIB 1OUMA 1E89A 4YECA 3X2EA 1G19A 4ZQHA 3K5WA 3SIWA 5HDQA 4IDHA 4I6GA 4YRJA 1XRRA 2J9FB 1B8OA 3HCEA 1P4RA 1DEKA 4L74A 2CVOA 1DV2A 1C1HA 3ROFA 2NO1A 3N59A 4RLFA 2HK7A 4UM9A 5FUVA 1W19A 1SO8A 1E1YA 2O2GA 3L8GA 2BMJA 5E7JA 4GU5A 4FINA 4JLNA 2IXFA 1JS1X 1SU6A 3R74A 3SFTA 1JU3A 5TF4A 3UT0A 1VJ5A 5BO5A 4D46A 2MMCA 1HDXA 2FG5A 2L69A 1RPJA 1H94A 3L1JA 3PRJA 2IDKA 3BB3A 4ARIA 2H57A 4LSWA 3E70C 1IOZA 4PAQA 4D8XA 1KJ9A 5K4GA 1DUIA 5I47A 3Q72A 1SCIA 3JCZA 3HYRA 3VZRA 1ZXBA 3PD0A 2RSLA 1FX0B 3RS5A 1M2GA 2I78A 5FBKA 1KDZA 1NUPA 4WW0A 1ODTC 1KVRA 1SU7A 2XUJA 4TLDA 1GP2A 1N1GA 4X1IB 1T8SA 2UKDA 2AJ8A 3S0JA 4RE6A 2IV7A 5DN6A 3SC6A 3ESZA 3WLJA 1UADA 3X1MA 5LWHA 3JTEA 4Z9AA 3DMGA 4CODB 5DB4A 4O4HF 2CLEB 4KPUA 2J1LA 4HLUA 1G5QA 1WUHS 2ZUDA 1NPDA 2V7QA 1QQ6A 2OHXA 1N8SA 4Q47A 4XFDA 2IPAB 5D3KA 4GO1A 3V7YA 3TW0A 2C8VA 1NC3A 3E3OA 2BUCA 5T7BA 1SBIA 1OWOA 3ZXSA 4MXDA 1QIGA 4BKRA 4YJ2A 3VRHA 1QANA 2IXEA 1DQZA 2EKQA 2Q2NA 4HC4A 4R2IA 3BIOA 3ZOKA 4D6VA 2NZJA 2WT8A 1KIFA 4G5SA 3H11A 5IN4A 3AKYA 2JVKA 1HYQA 5LQAA 5HZKA 4JFRA 2ATIA 1LH0A 1DZ3A 1FP1D 1YD7A 1PW7A 3ABRB 4PPFA 4WJLA 4WINA 4D8YA 1QHHB 4AJLA 1XKSA 1JEDA 2FDCA 1BEEA 2XAAA 4YP7A 1DI0A 5C8ZA 2IYYA 1Z38A 2KYRA 3CPEA 2DM6A 4KR0A 5KWIA 1QDLB 2Q5JA 3SOPA 1GG8A 3OE5A 3VOAA 5IDYA 3WLAA 1OZ0A 2JS7A 1JOFA 5C1DA 4PFJA 1WA5A 1UOPA 2JFZA 1Y5LA 2WQ6A 4MW7A 4J3FA 2AFIB 3FSRA 3R23A 1ORHA 3I9OA 2QN1A 4H2DA 3BICA 1LNSA 1RXCA 1NR7A 5IC5A 2P2LA 3MWGA 1PNVA 4FIDA 5SYAA 3VV3A 1CUBA 3KYCB 4HRYA 4MKXA 3FWNA 3RKSA 1GOTA 2A78A 5KTYA 1NZJA 1M76A 4ZT6A 4UHJA 5T67A 4DYDA 4W1SA 4DQ0A 1FY2A 1WD5A 2QMZA 3MFYA 4P33A 2VHQA 1EUQA 1BD4A 3PXAA 5H4GA 1SVOA 4P5EA 4OHFA 1JHUA 5DP2A 2B83A 1FP6A 3LY8A 1DIGA 2V3WA 4WY5A 1KQGA 2IODA 3CTPA 4A2QA 4BNHA 3SQXA 4HQ0A 5BXYA 5BWOA 2V4UA 4OEHA 2VTEA 2IOFK 5AM5A 1XDUA 1EH5A 4F3YA 1T0JB 1E8DA 4MQEA 2P4HX 2FRDA 1QNLA 1WSBA 1U3VA 3DLPX 3W1EA 4U5XA 5IARA 5AKHA 4GVXA 3TNYA 1E2NA 3H19A 1K7FB 3ZX5A 2HU5A 4M1KA 1EQAA 3GLGB 4DJ5X 2P3QA 4KR3A 1OT3A 2G6BA 4XSHA 1RHKA 4B75A 1SY7A 5KYNA 3RJMA 3IOEA 4FS8A 4C6TA 3TX2A 3K9FC 4IV0A 4PBTA 1X0VA 3IUNA 5JNVA 4BKUA 1KQOA 1CQPA 3PDHA 5B1YA 4KDCA