1YR2A

Structural and mechanistic analysis of two prolyl endopeptidases: role of inter-domain dynamics in catalysis and specificity
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
701
structure length
680
Chain Sequence
PPYPASPQVPLVEDHFGEKVSDPWRWLEADVRTDAKVAAWVQAQSAYTAAYLKQLPERAALEKRMKALIDYERFGLPQRRGASVFYSWNSGLMNQSQLLVRPADAPVGTKGRVLLDPNTWATALDAWAASDDGRLLAYSVQDGGSDWRTVKFVGVADGKPLADELKWVKFSGLAWLGNDALLYSRFAEPLNYNQTVWLHRLGTPQSADQPVFATPELPKRGHGASVSSDGRWVVITSSEGTDPVNTVHVARVTNGKIGPVTALIPDLKAQWDFVDGVGDQLWFVSGDGAPLKKIVRVDLSGSTPRFDTVVPESKDNLESVGIAGNRLFASYIHDAKSQVLAFDLDGKPAGAVSLPGIGSASGLSGRPGDRHAYLSFSSFTQPATVLALDPATAKTTPWEPVHLTFDPADFRVEQVFYPSKDGTKVPMFIVRRKDAKGPLPTLLYGYGGFNVALTPWFSAGFMTWIDSGGAFALANLRGGGEYGDAWHDAGRRDKKQNVFDDFIAAGEWLIANGVTPRHGLAIEGGSNGGLLIGAVTNQRPDLFAAASPAVGVMDMLRFDQFTAGRYWVDDYGYPEKEADWRVLRRYSPYHNVRSGVDYPAILVTTADTDDRVVPGHSFKYTAALQTAAIGPKPHLIRIEPIDKQIEETADVQAFLAHFTGLTPRPWSSVDKLAAALEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords prolyl oligopeptidase
publication title Structural and Mechanistic Analysis of Two Prolyl Endopeptidases: Role of Interdomain Dynamics in Catalysis and Specificity
pubmed doi rcsb
source organism Novosphingobium capsulatum
total genus 199
structure length 680
sequence length 701
ec nomenclature ec 3.4.21.26: Prolyl oligopeptidase.
pdb deposition date 2005-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00326 Peptidase_S9 Prolyl oligopeptidase family
A PF02897 Peptidase_S9_N Prolyl oligopeptidase, N-terminal beta-propeller domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.120 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Prolyl oligopeptidase, N-terminal domain 1yr2A02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1yr2A01
1GGVA 3DL7A 4BRZA 4W1QA 5EIEA 2IX9A 5KBYA 4N5HX 4N8EA 1L7AA 2O2IA 3PFBA 1YA4A 1F0PA 4LHEA 2XUDA 5D7BA 1BU8A 4DMCA 4I3FA 2H9YA 3PUHA 4QDOA 3PUIA 1UZAA 3L1JA 1EX9A 2JIDA 1Z68A 5AM1A 3A2NA 1CUBA 2YASA 4U2EA 3WL8A 5K3BA 3R3YA 4H7FA 5HKAA 3GELA 5I7UA 3HYSA 3H2JA 3ESDA 4FBMA 4HTAA 4Y2SA 4BYMA 2OLEA 4J0DA 2QXTA 3QYJA 3HLKA 3JWEA 2YXPX 3C45A 2PX6A 3X3HA 5JAUA 1W76A 1VXRA 5CXUA 2XQIA 3CXUA 1G42A 2RGUA 3SX4A 1MAHA 2P8SA 4D9JA 4X85A 1FJ2A 3KSRA 4AXBA 5CT6A 1H2ZA 2Y6VA 5JAPA 1ETHA 2WIFA 4UBOA 2QUAA 4LXIA 4JH0A 4U2FA 3DL4A 5A7HA 3SK0A 2GBCA 3Q8WA 1DWPA 3F67A 4B9AA 4CG2A 3W05A 1A8QA 1QIHA 3STYA 4V2IA 5D3KA 4ARAA 3D59A 1DX4A 3BE8A 4KE9A 4AB1A 1CUUA 3NUZA 4H35A 4HS9A 4AO8A 1VA5A 2OQIA 4NS4A 1CPYA 4BCBA 4G8CA 5CT9A 4G5XA 2XI4A 2PSDA 4H7HA 5A7GA 1XQWA 3MGAA 4BCCA 1FSSA 4K2AA 4J7AA 5K5EA 2B4KA 4H7DA 2PSJA 3QMWA 4UHHA 5JD6A 2PKYX 3WK8A 1QTIA 4IH4A 1CEXA 5E2IA 4UBJA 1E66A 2OGTA 5ALWA 3RM3A 2BFNA 3JW8A 3V48A 4U2DA 2CUTA 1TCAA 2ACEA 5K3AA 4DTCA 1IUNA 1BRTA 1DQZA 4QE3A 1G4HA 2JEYA 1VLQA 1XRPA 2BJHA 4XX1A 3M83A 4ZWNA 4AX4A 1JMYA 3GUUA 1LPSA 2J3DA 3HRHA 4QLAA 1XZEA 5EI5A 4BZWA 2JGLA 1F0NA 1RP1A 1CUVA 2XLBA 1JU3A 4CCWA 4YK7A 2RIPA 1QIIA 1MNAA 4NZZA 4BVKA 2GYWA 1BEEA 5T4HA 1J1IA 1AKNA 4WCVA 5ESRA 4LXGA 3GZJA 3ANTA 1ODTC 3AFIA 1K8QA 5ALGA 1IUOA 2VAXA 3DJYA 5E4TA 5AKYA 3WIOA 2W6CX 1E8DA 2O7VA 4HAIA 1XRNA 1SOMA 4CIAA 2C5GA 1XZLA 4BAGA 1LBTA 4Q34A 5T4FA 3W04A 4KJXA 2WFZA 3ESAA 5LZ7A 3ZLUA 4JUIA 4DNQA 1P0QA 5CH5A 5E4YA 3G02A 2I03A 3R0VA 3UMJA 3VVLA 4Q3OA 2R11A 3FOBA 1AC5A 2B9VA 2WFLA 5ALHA 3NWOA 1HLGA 5DTIA 1AURA 5FLKA 1GQSA 4BP8A 2G4LA 5I9IA 1BCRA 1ZD3A 1SCKA 3V9AA 5AKLA 3D2CA 4X91A 1EVEA 2CEKA 5AM5A 4Q3LA 4U2CA 3WWCA 1XZFA 4UBLA 1ORVA 5CBKA 4FKBA 3RLIA 5A6VA 4ZI5A 4QDZA 2XUQA 3HXKA 2X8BA 1CUZA 4IHAA 4UFPA 3WIBA 4BTVA 4ETWA 1UOOA 3IA2A 2HDWA 4NMWA 5K3DA 3QH4A 3RK4A 5F4ZA 2Y6UA 1CUWA 2WU4A 3ZLTA 2X5XA 2JBWA 1CV2A 3AZOA 4XJVA 3WI7A 5CRIA 1BCSA 1KEZA 1HPLA 4YX9A 1JJBA 4Y2XA 1LLFA 1EB8A 1UK6A 1GKLA 3PICA 3C87A 2GYUA 3IIIA 1IMJA 4DSZA 3EF3A 4GLBA 2HADA 2J4FA 3HSSA 3G9TA 4BAZA 1YB6A 2XQJA 2BAGA 2C7BA 1YASA 3OURA 4MYDA 5AKGA 2HFKA 3CN9A 3KD2A 5DTJA 5JD4A 1PJAA 1QIGA 1EVQA 2Z3WA 5AIBA 1BN7A 4FMPA 3LCRA 2DHCA 3WK4A 5AJHA 4S0XA 4Y2QA 5HF8A 4XVCA 1ZD5A 4UFOA 1EINA 4HXGA 5AKHA 3C6BA 1XRQA 3DD5A 5ALFA 2CMFA 1W6RA 4TVKA 4KAFA 3PFCA 3DYVA 5DYWA 1TCBA 4PQEA 2WM2A 4QA9A 4RGYA 4FLEA 4QNNA 5AI8A 4QWMA 4CG3A 4GBGA 5JANA 1BS9A 1DT3A 3ZPXA 3H2IA 5BOVA 3IB3A 1S8OA 3HC7A 1AUOA 5HFAA 5DNUA 4GXNA 5JAHA 4JEIA 2I78A 3EBLA 4F21A 3MVEA 2AJBA 1LPNA 4E46A 1LZKA 3G0BA 3LIIA 1WHSA 5DWDA 3WMRA 3DLTA 3OG9A 3Q0TA 1BROA 4GHWA 3WA7A 5FKJA 4BP9A 1CUFA 4EB0A 1PFQA 5C8VA 3QITA 3N2ZB 5CH8A 4YPVA 4MWSA 1W1IA 5HK9A 2WHPB 3WL5A 1UWCA 1QIDA 2G63A 1TQHA 3VISA 1UKAA 2CZQA 3R3UA 2XQFA 3BIXA 4PW0A 5ALJA 5DNWA 5AK6A 1XZIA 2RHTA 2Z8XA 2XUIA 3TGLA 5KREA 2QJRA 2VJCA 4U2BA 2WILA 4E14A 4B80A 4KE8A 4UHFA 2ES4A 5ALYA 2ROQA 2DFPA 3KDAA 1HL7A 2XUFA 1U8EA 4HRXA 1IUPA 4AO7A 4Q05A 5AK3A 2FJPA 3QMMA 3FYUB 4M0FA 1WHTA 5JATA 4KAJA 4J03A 1XZHA 1PV1A 1NU8A 4AN1A 3I2IA 1L7QA 1P0MA 3I2KA 4PNZA 3ESBA 4OSEA 4GI1A 5IVHA 1EDDA 1TRHA 2J3QA 2WJ4A 4BDSA 5CH3A 1OCEA 5LYYA 5JARA 4X00A 5FP0A 3I6ZA 4H0CA 2DHEA 2IIVA 3E4DA 2GBIA 2EDCA 3H1BA 4L72A 1E5TA 3IBTA 5EHZA 4DM7A 1YA8A 3V1LA 2V9ZA 2W22A 4B81A 5AM3A 3YASA 3WJ1A 5EHXA 2PSHA 5HQ3B 1IVYA 4A5SA 2WHRA 2HL6A 2XMRA 4B0PA 3HJUA 1IZ8A 3I2HA 4M0EA 2GZRA 1AZWA 5JZBA 4PV7A 2H7XA 3DKKA 2WIJA 3AUKA 3IVMA 5AKJA 2QJWA 5D3ZA 3FAKA 1IZ7A 1H22A 4BE9A 3DOHA 2EEPA 2D0DA 3E0XA 2OQVA 2LIPA 2Z8ZA 2GBFA 2GZSA 3B3QA 1ZI8A 4OD0A 4P08A 4AN0A 5ALSA 3HACA 2HA3A 1FFEA 2G5PA 1XZGA 2OCIA 5EIHA 1CUGA 3PE6A 5LZ9A 5AICA 3P2MA 2XUGA 3DKRA 2X76A 1ZGCA 4UHBA 4MYSA 1W4LA 1ODCA 4OB7A 4DMHA 4KRXA 2AJ8A 1YCDA 5EFZA 3BL8A 2VSQA 4QDUA 1MPXA 1Q84A 2CKMA 2OAGA 3D0KA 2VF2A 1Q83A 4P9NA 3LIPA 4EBBA 1XLVA 3I2GA 3PF8A 4BC1A 4FDMA 2RONA 3FYTA 2Y2VA 2DCMA 3UUEA 5AKIA 5AKZA 5BWCA 5JIBA 4QWWA 1ISPA 4G4IA 5CXXA 1N8SA 3ILSA 1CLEA 1GT6A 5AO9A 3BJMA 2FUKA 4FHZA 5AOBA 1AGYA 4Q1VA 3WK7A 4EA6A 1CUYA 5HKBA 2PL5A 1LPPA 4X94A 3IUNA 3D5EA 2XUAA 4Y7DA 4U2GA 3R3ZA 3DCNA 1TK3A 1JI3A 3H04A 4C6HA 2OGZA 3ANSA 3I1YA 1UXOA 1CR6A 1EK2A 4KAAA 1VJ5A 3H2HA 5YASA 3K9BA 5DYYA 1R3DA 1SCQA 2YH2A 6YASA 3C8DA 1G66A 4DMFA 1F6WA 1MX5A 3BWXA 1CUAA 2XDWA 4X93A 1C7JA 1X2BA 4G4GA 5EGNA 1CFJA 4WY8A 3WWDA 3FLEA 3M81A 2OXEA 5J3JA 1ZICA 4LKOA 2ECFA 1UOQA 2ACKA 3BIWA 3W06A 4W1SA 5CT4A 5A7FA 1MN6A 3H2GA 2V98A 5ALOA 1R4ZA 3I6MA 2XUHA 5AKXA 4Q3KA 1DWOA 5AM2A 3A2MA 4J3JA 3C5WP 3R41A 3B12A 3WKBA 4ZRDA 5AI4A 3V1NA 2NW6A 1VZ3A 3IUQA 4PF1A 1CUJA 2D5LA 1NX9A 3ED1A 3OOSA 4W63A 4I19A 1Q0ZA 4KYVA 4DIUA 3GFFA 5JYCA 1BE0A 4K6GA 4ARBA 2QM0A 1WB4A 5LLSA 1R9MA 3CN7A 4H7KA 1VZ2A 2PVSA 3BJRA 3C6YA 4BB0A 1T2NA 3A6ZA 3PI6A 5FPQA 1H23A 1EXWA 2VT6A 3BF8A 3G0DA 2I3DA 4UBNA 1C4XA 1QIMA 1AX9A 2PSFA 2WTNA 2XUOA 4BC0A 1LBSA 3VDXA 4BE4A 3O9MA 1EI9A 4AZ3A 3DYIA 4MXDA 3H19A 1DTEA 3AIKA 2J4CA 3BDIA 2PM8A 2ZYRA 3U1TA 1P0PA 3AINA 4BTLA 2CB9A 5LIPA 3STXA 1YB7A 3T4UA 1MAAA 4F0JA 1QIFA 2RHWA 5JALA 4BCDA 2XB6A 2WIGA 3QPDA 1I6WA 3QPCA 4BATA 4C4ZA 3C43A 1GZ7A 4FFWA 1VOTA 4ZV7A 4UFNA 2WFMA 3GA7A 1U2EA 2ORYA 5AOAA 3F9CA 4DSAA 3F97A 2XMQA 1JU4A 1ZGBA 3G9XA 5ALXA 4WFJA 3C8HA 3H2KA 5K3FA 1DX6A 2GYVA 3VJMA 4A23A 4HVTA 4JYMA 4IH9A 4W1RA 2WG2A 4L0CA 1NU6A 4JYPA 4OYLA 3LP5A 3PDCA 5AI0A 3WL6A 2JGJA 3STWA 1XZKA 2ZJ6A 3WKEA 2HU5A 1XQXA 2WTMA 4OB6A 3GROA 2WJ6A 4UBIA 4B85A 1GXSA 5AH0A 2H7CA 2ZSIA 3KXPA 3VJLA 4OU4A 2IITA 1A88A 4UPDA 2WFLB 4M0MA 1DINA 1EA5A 3HZOA 3QMVA 4G8BA 2XMBA 4HXFB 3NGMA 1MX9A 3BXPA 1CUSA 4FBLA 2VT7A 1HDEA 1UOPA 4J0GA 2XQKA 2WUGA 1VXOA 1CQWA 4Y2TA 3W9UA 4G4JA 4B84A 1SC9A 2VTVA 1MTZA 4C88A 3I6YA 5BWBA 4Y2YA 4CG1A 4CIBA 1XKLA 1ZOIA 4X6YA 1K6EA 2WIKA 2B61A 3QVMA 1FFCA 4RE5A 1THGA 1F8UA 1J07A 2WLSA 1UKBA 2WSLA 5T4BA 4ROTA 4B0OA 4C4YA 2XMZA 5T4EA 5JZSA 3WWOA 2VEOA 4DNOA 2YYSA 1KU0A 1CUXA 2Y1KA 3QM1A 1R1DA 5AKEA 4WDQA 2H7YA 3WL7A 1U65A 2HA2A 3WA6A 5AIAA 3AIMA 4IH1A 2HHAA 4CI9A 5ALEA 1DT5A 5KWJA 4PSDA 1WPXA 4BRSA 2OCGA 4RE6A 5HK8A 5CW2A 2WU3A 1XZCA 2HRQA 4DLNA 3AZPA 1Y7HA 3FCYA 3N0TA 4HXEB 2BGNA 1CUEA 1ZI9A 1CUIA 3WK9A 3STTA 1ODSA 1A8SA 4C89A 1WB5A 2HA0A 4BBZA 1XZBA 5FDFA 1QO9A 3R40A 1CIJA 2C58A 3TRDA 1LPAB 1MX1A 2XMCA 1UFOA 4CCYA 1MNQA 3D7RA 2ZYIA 2WIDA 5JD5A 3G9ZA 3EIOA 4Y2UA 4YASA 3D2AA 2WUDA 2WG1A 2QMQA 3WZLA 3F96A 3M3DA 1YSCA 1EH5A 1SCIA 4DMKA 4B9EA 5DLPA 1P0IA 4WDRA 2UZ0A 4OCZA 1O6FA 5BV7A 3WKAA 1CRLA 4B7ZA 4K6HA 1L7RA 3H18A 4DGQA 2PPLA 5IVDA 3KWFA 3ZWQA 1FFAA 1QO7A 3WK6A 3WYDA 1LPMA 4X95A 5K3CA 4C01A 3FNBA 1XQVA 1ZIXA 5LZ2A 1R50A 3I2FA 4BVJA 4OB8A 1JFRA 4QEKA 1HBJA 3A2LA 4OUKX 3VXKA 1UK7A 2QR5A 5AK5A 4RPCA 4BZZA 3U0VA 4H18A 5ISMA 2AJCA 5DNVA 1U4NA 3O0DA 2Q0XA 2JGFA 4GDMA 4MEAA 4F60A 3G0GA 1QIEA 1E8NA 3OTQA 2WJ3A 5EIAA 1WM1A 2QZPA 1DWQA 1MO2A 1J06A 4FFVA 2JEZA 2VJAA 3B5EA 4Y2PA 4X97A 4K6KA 3HI4A 5CTAA 4XWGA 5HFNA 2B20A 2BUCA 1WOMA 3CCCA 1MU0A 4G8DA 1KU6A 2V96A 1OXMA 4GWLA 2ZJFA 1YS1X 4WY5A 3R3XA 4EY4A 1QOZA 4Q82A 4MQLA 1ZJ5A 4DNPA 1XROA 5ALUA 3FLBA 1JMKC 3O4JA 3OPMA 2VATA 4UHEA 3DNMA 2BGRA 3T52A 3IURA 3FCXA 4C4XA 5AM4A 4PSCA 2PUHA 4ZXFA 1N5RA 5CURA 3VJKA 5K3EA 5C8ZA 3WKDA 4L9AA 1K63A 2RI6A 1BEZA 5DJ5A 3C70A 2GBGA 4UHCA 1FFDA 4A16A 2HU7A 3FWHA 3RKSA 5SYMA 1R88A 1YS2X 4ZREA 4UUQA 1XZJA 1TIBA 3WZMA 2BUAA 3AJAA 4DNFA 4EY6A 1XZDA 4BDTA 3C5VA 3GBSA 1E8MA 4X6UA 1JJIA 5LZ8A 2JGEA 3V1KA 2QVBA 4FNMA 3QBJA 1QE3A 5A62A 5FRDA 4B83A 3D2BA 4H7EA 2K2QB 3FVRA 3O4IA 1EHYA 2WQZA 2E3JA 1O6GA 3WLAA 2WUFA 1QJ4A 3A70A 1XLUA 5H3HA 4X71A 5HF9A 4UBMA 1QGED 2JGIA 4KE7A 3V1MA 4MEBA 5JZ9A 3AZQA 1EDEA 3SWWA 3H0CA 1R9NA 3STVA 4X90A 2ZYSA 2XMDA 2VAVA 2ZVDA 1XRMA 3TEJA 2ONCA 3K2IA 4E15A 1M33A 4JNCA 1ZI6A 2BUBA 3O95A 5AP9A 5HF5A 3EQ7A 2O2HA 4LYDA 4E11A 3F98A 1Y7IA 3SC2A 3PF9A 4TPKA 4WFKA 3UUFA 4KEAA 3STUA 2OCLA 1GPNA 3WJ2A 4G9GA 2RAUA 4N8SA 5HCUA 5ALTA 1THTA 4W1PA 5LZ5A 2H1IA 1LPBB 4EY7A 3LLCA 3R3VA 1FFBA 2OPHA 2XUJA 4J0JA 2DHDA 3FSGD 1QIKA 4H7IA 1B41A 5E4JA 2XE4A 1H2WA 1XFDA 1VA4A 3W9BA 5CT8A 1XLWA 3C6ZA 1Q0RA 2QT9A 4H77A 3MUNA 4P92A 2BKLA 2DQZA 2QKYA 1K5PA 2XLCA 3ICVA 4KACA 5ALRA 2O7RA 2HIHA 5JASA 3IUMA 4KRYA 3BF7A 1HKHA 1W52X 4NVRA 2Y2UA 2HM7A 3G0CA 4J0KA 2VJDA 5FUMA 1T4MA 3I1IA 2JGKA 1TCCA 1XQYA 5AI9A 5AI6A 3IUJA 5ALVA 5FPPA 4OPMA 4AO6A 1LZLA 1ORWA 3O4HA 5HZGA 1BN6A 4Z49A 5D6OA 5ALLA 1DU4A 1WPRA 2PU7A 4FLFA 4X3CA 4Y9SA 2AJLI 2I3ZA 2OGSA 2WUEA 1WB6A 3FYUC 4MQMA 3H17A 4GEGA 4J0IA 5C7YA 5ALDA 5ALNA 4PSUA 4EUSA 7YASA 1GQRA 1TKRA 3K6KA 3EQ8A 5CT5A 1VE6A 4AQDA 3FVTA 1J2EA 3OM8A 4J0CA 4X7BA 3ZLVA 3G8YA 3W2TA 5FV4A 3WWPA 5AOCA 1D07A 4W9RA 1X2EA 3FLAA 2BCEA 4FLMA 3M82A 1QONA 5KWIA 2QTBA 4N5IX 3EQ9A 4ITVA 4EHBA 1RYYA 2FX5A 1USWA 4UHDA 3ICWA 4OU5A 4FTWA 4P93A 4DYHA 3L1HA 4ZGBA 3I2JA 2Z3ZA 4N8DA 4TGLA 4QLOA 2O2GA 4HZGA 1A7UA 2PU5A 3FSGA 3QPAA 4FOLA 4LIPD 2V97A 5LKRA 4QZVA 5LKAA 2PBLA 4LXHA 5SYNA 1EB9A 4Y2JA 2C4HA 3O4GA 1MJ5A 4CFSA 2EDAA 3WKCA 4Y2RA 1XRRA 2DSNA 3WQHA 1W75A 1EK1A 4I4CA 5AM0A 5LZ4A 1N5MA 4RNCA 1VE7A 5C8XA 1YR2A 4FNGA 3QZUA 4L3WA 1LGYA 1E3QA 2HFJA 4EY5A 4QDXA 1A8UA 1UKCA 2XMGA 3RARA 2XUPA 5CMLA 3HEAA 3LS2A 3NOXA 2C0QA 1AMNA 3D3NA 1TAHA 5FOQA 1GKKA 2HU8A 5K3FB 1QFSA 1ACJA 1AQLA 1CVLA 1GPLA 2HA6A 2QRUA 1QIJA 2QOEA 2OAEA 1UK9A 2WHPA 3IULA 4G1FA 3WYNA 5ALQA 3G0IA 4PO3X 1ZJ4A 2JF0A 3VVMA 2FJ0A 2AXEA 4Y2VA 1G5FA 1QTRA 3ZI7A 1XKTA 3F8SA 5AI5A 3D4LA 3S8YA 3DS8A 3WWEA 1HQDA 1CUCA 1ZIYA 4AMZA 2CBGA 2CJPA 3AILA 5AHXA 5ALMA 4C87A 2XT0A 4BAUA 2ZYHA 2DQYA 2QUBA 1LPOA 5EHQA 2QS9A 3S2ZA 4XIIA 3H1AA 2OG1A 3IDAA 1ZD4A 5IH7A 1N1MA 5AKKA 5ALKA 1CUDA 1XZMA 4MJ3A 4J0HA 2QXUA 1Y37A 4GW3A 4IQ4A 1YAHA 3VKFA 2VQ6A 4G9EA 5ALIA 3FYUA 5IVIA 1LNSA 1QZ3A 1DQYA 4ZV9A 2AJDA 3R3WA 1UK8A 2VJBA 1OILA 1RWQA 4HRYA 3CCBA 4AMYA 1EDBA 5FXMA 4X92A 1ACLA 4WJLA 3G9UA 5A71A 4X6XA 4AZ0A 4MWTA 5JAOA 3E3AA 2WHQA 4BVLA 2WG0A 2HA5A 2OCKA 3L1IA 2R8BA 5EHNA 5ALPA 5A2GA 5HF6A 3OC0A 5I8PA 5C81A 3O9VA 1QFMA 1CUHA 2ZJ7A 5LP1A 4B82A 2Z5GA 2PSEA 1B6GA 3C6XA 4WFIA 2ZSHA 3ESCA 5AK4A 4O08A 5HQ3A 5IVKA 4K5QA 3JYHA 4LYEA 3G7NA 3I28A 1XZAA 1SFRA 3FBWA 1JT2A 2DR0A 4QDTA 4KR0A 2XUKA 1E89A 5ALZA 1ZD2P 4B6GA 3E1GA 4OYYA 5DYTA 2JGMA 3ZV7A 3DOIA 4EY8A 1MT3A 1H2YA 3DDUA 1X70A 2WKWA 4IO0A 2VA9A 3DEAA 3WK5A 2XMSA 3KOOA 4H7JA 1XRLA 1UT6A 3TJMA 4CCYB 1CQZA 2C5FA 3BDVA 1VKHA 1H2XA 1JJFA 2G5TA 3KWJA 2HA4A 4INZA 2HA7A 3HABA 3DQZA 4UBKA 5IKXA 1JKMA 2HRRA 4KE6A 1QLWA 4GECA 2C0PA 3AIOA 4F5ZA 1C7IA 1YAJA 1GPKA 4FWBA 2XQGA 1K4YA 1WCYA 3MUOA 5JADA 4EZIA 2PUJA
chains in the Genus database with same CATH superfamily
3MXOA 4DMMA 3V3KA 4F4IA 3F6RA 1JI0A 2IX9A 2EWWA 1L7AA 2O2IA 4N8EA 2YJNA 3L5KA 2WHYA 5JJIA 1R0ZA 1RYEA 1T4DA 4NFLA 5IJXA 1OIXA 3EIXA 1M8KA 3DMPA 1YR1A 2GC4A 5IXSA 3UY4A 4Q7JB 4P33A 3T5DA 2QQEA 3V8MA 3ESDA 3U7FB 5ICGA 2L42A 3HLKA 1AVTA 4YCAA 5AMXA 1DQRA 1NJ2A 2HXGA 4R0VA 2UVQA 1FTSA 4DSOA 5AW7A 2X15A 1RZRA 2I6UA 5IJ9B 4A2MA 3MQ4A 1ETHA 4M9XA 3AHJA 4K0KB 4CL0A 4CMEC 2DUJA 4KQCA 2G9RA 3I0ZA 3L7AA 3SK0A 1RXVA 1QV6A 2Y1WA 2GBCA 4IIJA 2D4AA 1HG0A 2FAXA 1MEOA 1Y3BE 4EB6A 4UCFA 2B99A 4LZJA 2X9QA 1YR8A 3RSEC 1N2CE 1BHJA 1M2HA 4AO8A 7ABPA 3ONDA 1UJNA 4FK8A 4CL2A 1SHKA 2XI4A 1Q1NA 1WSBA 1YZNA 1KZHA 4L95C 1FSSA 3N3AC 4J76A 3F4KA 4S2UA 4NZMA 4RF3A 1WCV1 3QVXA 2XJ9A 4J3FA 3V8PA 1UPCA 3ZWXA 4G0QA 2IYOA 5JV5A 1J22A 4Q1CA 4WJKB 4FHDA 2DFNA 3ZH9B 3OH8A 1II8B 4DJDC 2FSPA 2E4WA 1VRVA 4TS3A 1DC6A 5E1BA 1KVTA 1K9SA 2CV1A 4RQTA 5ECGC 2RIPA 1QIIA 5KDOB 1T4CB 2B5OA 2HQSA 3MF4A 3TLKA 4MWBA 2VDLB 2NXCA 3PYLA 2G67A 1U6IA 1JHVA 2VPYA 3TW0A 2YHBA 3PEFA 4XVRA 3GJ8A 4RTSA 3UCEA 3NAZA 5TF4A 2NUAA 2QUKA 2PZJA 5K8IA 2GTIA 1SHZA 3KKPA 3SZLA 3REFA 2PT6A 4ZOXA 3LDGA 5LZ7A 3ZD8A 2W6NA 3TMAA 2F8TA 5FTLA 1KRWA 2I1WA 4MV4A 3LA8A 5KI6A 4MP3A 2R11A 2HPVA 1S7CA 5JNLA 3I3SR 3EZXA 4IV8A 1SD2A 3ZKWB 1U6JA 2HCFA 2UZXB 4K9DA 3ULKA 4PRYA 1AKEA 3BMNA 3PHJA 5L51A 2AXNA 4W6QA 3I30X 2FPGB 3QV2A 1XVAA 3RQIA 2JI7A 2NSHA 2ZI6A 3C3JA 4ER6A 2HC9A 5AM5A 2P9TA 1H05A 1Z34A 3WWCA 1U1CA 4YS6A 4KO1S 1C1DB 4P84A 4HWTA 4E08A 4ZI5A 5JCZA 4GP6A 3OIUA 4O59O 1K6IA 2FPLA 3E03A 2RHHA 3U7QA 3EZYA 1W36C 4FMDB 1Y9ZA 2Y6UA 2O8EB 1CUWA 1VBFA 2JBWA 1TQ6A 4EW2A 4Q4JA 4YQFA 4M49A 3KJEA 1TU0A 3K0FB 3EXIA 3B9RA 3K5PA 4F91B 3P4UA 4TKVA 4LE2A 2R7MA 1KYZA 3QWAA 1BU5A 5AJXA 3UK1A 3SG0A 3OZAA 3OLYA 3A25A 4BAZA 2GT1A 5KNDH 1YB6A 2NAFA 5CK5A 2GD2A 4CIDA 1OWPA 2XQVA 1QRAA 4NJMB 3Q4GA 3KD2A 1BH6A 1CY8A 3LK7A 4L4RA 2NO1A 1OQAA 1N0WA 4RBNA 3WLOA 2REXB 3LWDA 2P8JA 1ORRA 3AC0A 5HJ5A 4IXWA 3UT0A 3MSXA 1EINA 5IU6A 1PK9A 4MPDA 3MAJA 2CMFA 3AEXA 4IIVA 4A3SA 1H93A 5JANA 1RDFA 4JSNC 3E6AA 3H2IA 1UMBA 4TMYA 1KOLA 1W4BA 1X19A 1W5BA 1FXWA 5CDUA 1Q92A 4G0NA 1VE9A 4CC9A 3DZIA 2AMVA 3FUXA 2O8BA 1P2SA 2VI5A 3IJCA 3ZE0A 5CXBB 3D8TA 1X80B 1H2BA 3GFGA 2W4QA 5K8VA 1JILA 4MWSA 4LFCB 1L9XA 4Z5XA 5KQLA 4Q19A 4CIXA 4Z4FA 3I37X 3C7AA 3G2KA 3R8XA 3SJ7A 4Z53A 1KSGA 4KXNA 1O7JA 2HI0A 3CVWA 3QWBA 5C1DA 4OLBA 3BIXA 4BNVA 1A5SB 2JGAA 1NLFA 4CHGA 2YHSA 4TV8B 5B2ZA 1OX4B 5ERXA 3VNBA 3D4OA 3AEKB 3CYFA 4WNAA 1U7DA 4EVIA 2G4VA 3SKYA 4RTNA 3BULA 4F3YA 3WL4A 4GS5A 4HRXA 2GHRA 3CF6R 2C61A 4MA0A 3N2EA 2PVPA 2Q5HA 1ZJWA 1OZFA 1D4FA 2ZYGA 2R6CA 3CZMA 1KVRA 3R8FA 3JV7A 5C9ZA 1GPBA 1ZJ6A 4RD2A 5D5HA 3MTGA 2ZUBA 3PX2A 4Q4LA 1P29A 4O4LF 4M54A 4A2LA 1DUIA 2B5WA 3DCIA 2DHEA 3OCUA 3TXYA 4L72A 4CLRA 4E1AA 2VF7A 1TJNA 1QHSA 6LDHA 2OWEA 1U8CA 3GLTA 3EF1A 3B7FA 2GZRA 4EG7A 4CM9A 4HTFA 1KMHB 4YP1A 1UPXA 3FHTA 2AMYA 2Q45A 1BQ3A 4BE9A 3BCSA 2Z8ZA 3Q8MA 3GLHB 1E1CB 1XP5A 3L0PA 1WUJS 4G2NA 4GMKA 4H27A 3KOMA 5CYKA 5EIHA 4FI3C 3DV0B 1I0LA 1KPGA 4CR8A 4EI7A 1AK2A 5J63A 1W4LA 3AL2A 1D2CA 5FOWA 2PUAA 5IW8A 2AJ8A 1HEYA 2QBYB 1Q84A 2J6BA 1N5KA 2H48A 4KFRA 1OPRA 1MXHA 3AFOA 3KWLA 1LK5A 1QVVA 4TTSA 5FUWA 5ES4B 2W90A 3TQRA 1DC5A 3R23A 5DH9A 1U1IA 2OYRA 3KQKA 3ILSA 4B3BA 2LBPA 1D0IA 4Q1VA 2C9DA 2FY8A 4A11B 5EWLB 4NPCA 3K35A 2QSJA 2W83A 1G8FA 4QT8A 2CN2A 2NO5A 3RVDA 3DYBA 1X7ZA 3I73A 3VPXA 1EG7A 1CR6A 4TUYB 5K8CA 3ZCRA 3PTAA 2P0AA 3KQWA 4RDIA 2JFOA 2PMCA 3L0ZA 3VUFA 2LTAA 2FN4A 1UMDA 4OI2A 4RIIA 1AXEA 3Q11A 1H2RS 4HUJA 3A0UA 1ZICA 1PJBA 3HN2A 3UFXB 4DR2B 4GEKA 1RVDA 3I6MA 3KL2A 5JH7F 1TW2A 3HWX1 3EODA 5ARCA 4J3JA 3X1JA 4HQFA 2R7LA 2JKZA 1QMGA 4W5OA 5JS1A 2YNMC 2D5LA 1P2GA 4WA8A 1Q0ZA 4FHFA 2FR8A 4DIUA 2PNFA 4XD7A 1BE0A 1JH8A 2JZOA 3AVWA 4MIYA 1F4VA 4H1TA 4MCHA 2JATA 4H7KA 4GM0A 2A9JA 2CD9A 1DS6A 4O0LA 1ISIA 3I04M 4EABA 3INYA 1BX1A 3OIDA 4RM2A 1BJKA 1VECA 3FMVA 3C9CA 2AFVA 4G56A 3ETLA 1RIFA 3BHJA 1I3OA 2OK8A 1K6XA 3WWYA 4GF5A 2CB9A 3SIXA 1YFQA 3LYLA 3RKRA 1YB7A 3T4UA 1MAAA 4ZVLA 2V59A 2ASEA 4FNAA 4M8KA 3QPDA 3A1FA 2FH5B 3C43A 4ZAYA 4Q47A 3IAS6 3GEIA 1U2EA 4JU9A 3FJOA 2C7QA 3F97A 1HETA 1WBJB 1OV6A 1ILEA 4IZ6A 3GR6A 1UBHS 3O8BA 1H2AS 1IHOA 1DRUA 3OQIB 4BV3A 4Y6RA 3ZHZA 1NU6A 3V4FA 2PZLA 2EBHX 4MINA 2J4DA 3LVBA 4B48A 5IJZA 2PFGA 4EZEA 4J0XA 3G82C 2YC4C 3R5KA 4R2HA 1DINA 3A9RA 3M6UA 3DL0A 3WNBA 3NHWA 3HKBB 4QYSA 4PPFA 1U31A 1QDEA 1VMAA 3KSUA 3W9UA 4G4JA 4YY3B 1SC9A 2F7SA 2MINB 2J59A 4RIHA 3KVNA 3H0EA 2ZVQX 1VLJA 4ZDJA 4C3ZA 5D86A 1T43A 2BR5A 1W7AA 1K6EA 4ZC8A 3W7BA 1L5OA 1DADA 5FWYB 1C4KA 4EG3A 1OLSA 4HOYA 5F7ZA 4Z7QA 3OCJA 4U3JB 2O5VA 2VRCA 5IWCA 2K7ZA 1A8HA 1JR4A 1O97D 2C54A 1FJGB 2CF5A 1Q1EA 3LP6A 3VPFA 3VR5A 3CPEA 3WB2A 2OCGA 4WWHA 1QYWA 2VDPA 1S9HA 4WPGA 4GH5A 4OL0A 1F20A 3N70A 4G0UA 1CUIA 3WK9A 3WIEA 1AO3A 3I7KA 4EGCB 3ZWVA 2ZWVA 3HCEA 4XPIA 4ND6A 4J73A 4QU0A 4YASA 2WUDA 1GFSA 1X7XB 5K1ZA 3WDLA 2ODTX 1ZCFA 4DMKA 2OLKA 1U2PA 1T9BA 3SIWA 1CY6A 5SZHB 1G41A 3RTBA 3L6RA 1A9OA 4F4DA 4RGBA 4A2CA 1RLJA 4CZXA 1L0QA 3HN7A 5F9HA 2B35A 4C01A 1NBHA 2FPUA 3I2FA 4X8OA 4BGUA 4H1WA 3EXG1 2W6PA 1E2DA 1NN3A 3UTCA 1NKSA 3VXKA 3RVPA 3WYFA 4DUGA 4DRZA 3CWQA 5TF0A 1SM4A 2Z2IA 3U0VA 4QDKA 1NN1A 4TZKA 1QRSA 2OBXA 2OAQ1 4F60A 2YJ3A 3O1LA 2BF4A 4RHYA 2XNCA 2PM9A 3ZE1B 1Q16A 3WLRA 3BJIC 2RJOA 2B8JA 3ZR4B 1QG2A 1JSCA 1NHGA 2JEZA 2ODEA 1RRGA 4JLAA 1IM5A 4TKUA 2WM9B 4L8WB 4PINA 2BPOA 2QPTA 4OI1A 3EULA 2AD5A 4PO8A 1NUUA 4ZOVA 3A6JA 1EFPA 1T34A 3IKLA 3QKTA 1OI4A 4DNPA 1K7SN 2V7QA 3DE3X 1TKCA 2RGWA 2V65A 4HNQA 3DLPX 4DZZA 3REQB 2NZYA 5AM4A 1EUDA 4US1R 3RFUA 4BNDA 3L5OA 3ZV3A 1BG6A 3NH9A 4XCQA 1Y98A 1GFIA 1Z5PA 2IRWA 2R86A 1V3QE 1WETA 5BURA 4QTTB 3T0GA 3RDPA 4JI8B 3Q3EA 1WDKA 1UXHA 4OQNA 5A9RA 4XFJA 3DA8A 4DV1B 4IG4A 4QG7A 3MOSA 1BH2A 3JD2A 1Y4UA 4FNMA 4XKJA 4BN5A 4DADA 1JVSA 4F5DA 4AKIA 2ZUUA 4FE3A 5P21A 1O6GA 2HGZA 4BO7A 4E94A 4EGSA 1L4BA 1V7QA 3V1MA 2GNAA 4WZAE 1ZNYA 4ZCQA 4IIDA 3PNQA 4IILA 1JTFA 1H6DA 2JCYA 2X1HA 4Z8YA 3G5LA 2XRMA 4YCJA 1H4VB 4URUR 4QUIA 3QEMB 4M86A 5CA1F 3JS5A 2PTGA 4CN8A 1E2QA 4YP0A 3FDJA 4OAOA 1TA4A 2FSHA 2P9KC 4J6FA 2JHPA 4MDYA 4G9GA 3UTDA 4BVGA 2W42A 4ZHSA 3NPMA 2I8LA 2IK8A 3I7PA 1RPTA 1HR0B 4OYHA 4X44A 1KDTA 1CSEE 2PAAA 3L6EA 2FWIA 2IHTA 4BO2A 2AS0A 1MC1A 1Y5RA 1OFUA 3UJ6A 1OXKB 4G97A 3BWDD 4KRYA 2J07A 4FPXA 1GUFA 4PNHA 3CZ9A 4I79A 3PGVA 3BK2A 2QMYA 1N8KA 3QIAA 1PX2A 3X1WA 1TCCA 1ZH6A 4M38A 2XXJA 5FPPA 3RVQA 1CNEA 3CUUA 2H0RA 1FX1A 3VPGA 4DQUA 5REQA 3U3RA 4Y1FA 1WMEA 1QGDA 3H17A 2ZTUA 2OMEA 2D8MA 4BKUA 3S1AB 2QJTA 1ILWA 3HR8A 3M9WA 4AQDA 1KI7A 5IABA 4X7BA 3UMRA 5KVCA 1SA0B 4IJ6A 3VYRB 2KSQA 3TW8B 4BEVA 4XRGA 4A09A 4EKEA 3G1TA 2LWIA 1J0EA 2G25A 4OU5A 3PXSD 4FTWA 4QBIA 5HIJA 1HYQA 3I2JA 1XPOA 1XCJA 2NU7B 1NATA 1ZMXA 2AVNA 1YFZA 1PFVA 4FYPA 2IWHA 4HH0A 2KI5A 2Z4RA 2P11A 3EDCA 1HNXB 1R0YA 1EZ1A 5EVCA 2ODPA 2EDAA 4TXJA 4M89A 4MO2A 3DXMC 3IAXA 3LCMA 4KWHA 5LM3A 3JASB 1M6HA 3R5JA 2FLKA 4PQYA 4KFCA 4QDXA 4I55F 2G1AA 1A8UA 2VDQA 3ETJA 2GK4A 4YRBA 1FMFA 1NR7A 3PNVA 4LBVA 1APBA 1I30A 1DEHA 4RK5A 3CPHA 1GJRA 2H63A 5BWNA 1WXFA 4EPXA 1AKMA 3UWDA 4Z7NA 1PR3A 2YJZA 3VYSB 3VVMA 3QHQA 1CY2A 3RAFC 3WWEA 3L0CA 4WLOA 4L8LA 3OICA 2Q5CA 2WINI 1AQ6A 5FJIA 3SZGA 3WDSA 2H92A 2G70A 3C5HA 2EW2A 3B6KA 3IDAA 5DNAA 5CVCA 3HM9A 1U90A 4NZYA 3M6VA 2E0IA 2H68A 1HORA 3JQFC 2ATVA 5K51A 3VKFA 1QKIA 1XMPA 3K72A 4BPRA 3ZG6A 1OILA 3TRFA 1QAMA 3UT5A 1EGVB 1V95A 2II6A 2JLZA 4JHNA 1Q44A 4TYPA 1M2VB 2WIBA 2VH5R 1A71A 3UEOA 4OO3A 2Y0PA 1J21A 2D2EA 3V80A 3VNAA 5C81A 2O8CB 3ZBPA 4I1IA 5LP1A 3LQ1A 3IT1A 1P2BA 3RRNA 4O33A 3T3DA 2BC9A 3T7DA 4UTZA 3PNMA 4RENA 1M54A 5JEDA 1MXFA 5IJAA 1FSPA 1JT2A 2XUKA 3QYPA 2GYYA 5JPIA 4PGHA 3S7TA 4GPZA 4WAUA 4RM3A 1H2YA 1R12A 2PQ6A 1QQBA 3TUJC 4JCCA 3DP9A 5AUOB 3MIZA 2G6TA 1AQYA 3M70A 3CNNA 4E4YA 3EY9A 5FOVA 1C9YA 1I1QB 3HABA 4IYRA 4EYQA 1GUAA 3N6XA 4KITB 2X6QA 5K0BA 4F5ZA 3BTVA 3DZJA 5FV7A 2OO3A 3QEBZ 5HQGA 2Y9PB 2OBBA 5EN4A 4B6EA 3MTBA 1N0VC 5L3SB 2LZ0A 1DUSA 2OXCA 2W2KB 3KL4A 1QHEA 5KWVA 4QDOA 1UZAA 2GEFA 3MFYA 3VV3A 3AG6A 2QV7A 1AKUA 4Y6PA 3DONA 3UYKA 4XYLA 3DOCA 4DYDA 4HTAA 4PX5A 2QXTA 5CXUA 1BA2A 5F4BA 3FJYA 1JBQA 3C3PA 1O1YA 3GO4A 3KE8A 1XK7A 2ZSUA 4HNHA 4X9XA 3L84A 3VSEA 1J39A 2B7CA 4GAEA 3TGWA 4WBNA 4IJMA 3P96A 1P33A 5IH3A 1I3MA 4KYTA 5LDDC 1MR3F 3DBHB 3TG8A 4XDHA 2YY6A 5EAPA 5BQ3A 3MGAA 4J1TA 3AVVA 2G1PA 5H4HA 2CN3A 1VMEA 3WGLA 3U7RA 3BJEA 5M5VA 4WL0A 4D3XA 1P1RA 4GI2A 3HVJA 1E66A 3W2IA 2YWJA 3FCOA 3GEHA 3OEEA 1TCAA 3QNUA 3TB4A 1ZL0A 1F0KA 1N2EA 3AR7A 2BDTA 4OZUA 4DKJA 3D4BA 5DLEA 5B2FA 2G71A 1XZEA 5EI5A 3ZH2A 2OHHA 1KYXA 2YFHA 2AG0A 3LDHA 4OM7A 3L6OO 4YA6A 3UC9A 5C0OE 1K3FA 2PK3A 3CT6A 1Y3DE 4ZKDA 3EC2A 2RHMA 5JSFA 4CI8A 4X60B 3I8SA 3AFIA 3LNCA 2WAOA 4MRPA 3TNLA 4DLXA 1C1XB 3GJ5A 3DJYA 2BGMA 4MLPA 1AF7A 4AG3A 1Z06A 1ML3A 2YY5A 4BAGA 3OX4A 4Q34A 5T4FA 1DAFA 3B5JA 3ZLUA 4DNQA 2Z8YM 3EGXA 3SC2B 1UBJS 3MAGA 5EALA 4Q1FA 3SE7A 1XMVA 3EXEB 1AC5A 1GGHA 4H3VA 1DO0A 4YBRA 4OEHA 1YR3A 4CMEA 1KS9A 4NCBA 2Q4RA 2VHQA 4P4SB 1BCRA 5JS6A 3MJ4A 4AUEA 3DSRA 3KLMX 3ROFA 3C6MA 1MEJA 2GCIA 2CWWA 5H02A 5FB3A 4TXHA 3N2NA 5IYZF 1P2TA 3HXKA 3R7DA 1N2SA 4KFSA 4YJHB 2HDWA 4NABA 1VKRA 3I9NA 2GWRA 4EZBA 5JS7A 2XTMA 4YDHB 4ZK2A 2NVUA 4Z3OA 5CDFA 5CXCB 4HQKA 2G9NA 2QM8A 4LX8A 1C14A 1P2UA 3MXXA 1EFRD 4UAUA 3ETEA 2AKAB 4FWWA 1UEIA 1GYQA 1JSRA 2E4ZA 3AUAA 1RXYA 4NAAA 4DSZA 3NJ8A 1W9HA 2WWXA 5KDDA 4NKRA 2ZAIA 1NTOA 2BFEB 3F1KA 3TB6A 3H4IA 1G0OA 3B1ZA 4P1ZA 3PNPA 1B6SA 4S0XA 1WB9A 1QHHB 5B3LA 2VDUE 5TMEA 1V35A 5LN1A 5FFGA 1U63A 4DABA 4BQSA 4KWIA 4YP9A 3C6BA 5ALFA 4LX0A 2V45A 1JF8A 1RKUA 3OF5A 3IDOA 1SBIA 1Y48E 4YQYA 3A6FA 2AR9A 2IQIA 3HC7A 4PYKA 1AKVA 2VVTA 2VNAA 1EESA 1O2DA 3F7MA 4LV6A 5PNTA 4C2BA 4LHZA 2PT9A 5IM4F 2C99A 4IS3A 4NMXB 1X1RA 3QVSA 5F76A 4XB6B 3LY8A 2IWKA 3T94A 3K0KA 2A1UB 2MTBA 4LW8A 1H85A 4NONA 1RXUA 1UC8A 5DIZA 1KGSA 4ND8A 2P77A 2JASA 5KYUB 1NMSA 1H3NA 3ZX4A 3W8FA 6NULA 4FCWA 1D6MA 1K2VN 2PZGA 2HTEA 1KYQA 3R3UA 2HLNA 3L8HA 3WFZA 1G5RA 2K6GA 1OXVA 3ILYA 3MJEA 4LYGA 3TGLA 5K0FA 5KEIA 3M89A 4QUAA 4U2BA 4U5QA 2VF4X 1N9GB 3G8CA 4MKZA 1TF7A 3KDAA 2XUFA 4KL8S 2CBXA 4XJXA 2FG5A 3Q3VA 3R0XA 1S6YA 1X9HA 3FYUB 2IT1A 4QFDA 3QLVC 3PC8C 1CW2B 1N2JA 4AC9A 5CW1A 4F85A 4R2XA 3LY7A 3A7DA 1Z36A 3EQZA 2OUIA 2PE5A 4AF8A 1I13A 5K2OA 1OXUA 3RRYA 4PCAA 2QVYX 4LJ4A 3W7VA 4QLBA 3NKFA 5K3SA 3LFHA 3KZMA 4HPJB 1TJ4A 4XLTA 1CULC 3TR5A 3RN0D 1BYIA 1RABA 3LGSA 3B89A 4IZIA 1K5DA 2QRHA 3HY6A 3SBPA 3OZRA 1OYVA 5EPOA 5DCYA 2EEPA 1W1UA 1KF0A 3QFTA 4R5MA 4O3UB 1JSXA 3L7BA 1CHNA 1UFVA 1U8AA 3P2MA 2MMGA 3DKRA 1HTTA 4UHBA 2GPSA 3NIDB 5EFZA 3BL8A 2DY1A 2OAGA 4ZVMA 1OV4A 3MWKA 1Q83A 3IEVA 1YTUA 2C4TA 2EKDA 4CVNA 3E7DA 2VUTA 5BNFA 2Z6AA 3KJGA 2YDYA 5IBRA 1SXJD 1WUKS 4RSGA 4M37A 1A7KA 1VI5A 4MS1A 1P5ZB 4GI7A 3W3ZB 4JBHA 4HBGA 5K01A 3OKCA 3A4IA 3VR3A 2EIXA 4U2GA 3T38A 4MQFA 4EMTA 1PYGA 1EM8A 4G86A 2VHEA 3F3KA 4YV0A 3REOA 3TOVA 3AEQA 2J9ZB 3TECE 3N58A 3U6BA 2P3OA 3SAJA 3C8DA 2Z1MA 3BG0A 4F06A 3R7BA 4L7QA 1EQUA 2PR2A 4JITA 4D43A 4RD6A 4IIJB 3M81A 2OXEA 5J3JA 2YXLA 4D02A 4EB6B 4NDAA 1GRQA 4W1SA 3A1SA 4L2IA 4B4KA 3I5XA 2TMGA 3DDWA 4R41A 1E3IA 5DWVA 3GRZA 1NRJB 1PBNA 5BMOA 2F3SA 4RH3A 4CIYA 1NXSA 1HDGO 1H2EA 1NP6A 4OMFG 4B4UA 3E27A 2NQ2C 3O5AA 3G0OA 3K7EA 3WNDA 2JH9A 2LXNA 2C03A 4JJ6A 3HHEA 4DLYA 4HZIA 1JTDB 3GW8A 4P0PB 2X2EA 5EPEA 1H2FA 2Q7QA 3ZIDA 1Z17A 4DC9A 2YZ2A 4WXRA 4N03A 3TOSA 5JSKA 2DQ4A 1ICIA 3TSAA 5LD2B 3NHRA 4AURA 5FI5A 2H0QA 3RN1D 2J4CA 4L8GA 1HX7A 4HEQA 3I76A 4CM1A 4H2DA 3UMVA 2DF8A 1ZS9A 3FM0A 1RQXA 1V71A 2BZ0A 1Q7GA 3EISA 3ZZMA 2R1UA 3LT0A 5DBOA 4R1PA 4BMYA 1Y80A 3HDQA 2A9OA 5J43A 1ZKMA 1N5IA 3KT6A 5EVJA 2XKKA 1IN1A 3MCTA 4NAHA 2WFMA 3PX3A 4C43A 6REQA 1B8PA 4QX6A 5G53C 1JU4A 5JG7A 4MVJI 4YDSA 3ZCSA 5INTA 2NUAB 4PRLA 2Q5JA 1Z63A 5EIOA 3V7DB 1VLMA 1M0SA 1DRJA 4UOZA 2LCFA 1QHGA 4GXQA 1SD5A 1GUZA 2PWYA 4YJFA 1FX0A 3STWA 2ZJ6A 1HC7A 5J4LA 4N4AA 4D3YA 3QFRA 2FYTA 2WTMA 3QVLA 1XYGA 4FDAA 2ZSIA 3HNRA 3DHVA 1SZJG 2D1TA 2I1LA 4HYEA 2Y71A 2WTBA 2VZ0A 2R5NA 3E9NA 2WHEA 3IKJA 3BMNB 1YB2A 1HI9A 3TX2A 2J41A 3N8KA 1UAYA 1NWHA 3E48A 3RSLA 5A9SA 4RELA 1Z8NA 1ML4A 1MTZA 2I1VB 5CX4A 4BMXA 2H47A 1XKLA 4AIIA 4G5SA 1WXQA 5K19A 2RB5A 2XAAA 4PU0A 1UJ6A 1FFCA 3QFSA 1TTPB 4IKOA 3OIVA 3U7QB 2YNMA 4YDRA 1NQVA 4R7ZA 3L92A 4MNTA 4NICA 3G8AA 4Q4JB 1D8TA 4U0JA 4XVQA 4QSHA 3IE2A 3EXIB 4IH1A 4LG8A 5B7NA 4TKVB 1KFEB 3MQFA 1MOPA 2LCIA 5H80A 2A2ZA 4UAVA 3CH7A 3CV3A 1KTIA 2X6RA 4FXOA 2A0UA 4I6JA 1JDSA 5L7WA 5E9AA 1TYQC 1X9GA 3UYLA 1KIFA 1ODSA 3C1UA 3KB8A 4E13A 4TTPA 1TGYA 4MVYA 4MRNA 5AMSA 1PYOA 3PNYA 5MN4A 4JEHA 3FHLA 3P0RA 4W82A 3D7RA 5ERGB 1FYEA 1UM9A 3K9GA 4UATA 3PEWA 3F96A 5BNTA 1YSCA 4Z7OA 4RF5A 2FNAA 5K0ZA 4OHMA 1L4MA 4C0QC 1SVKA 4HX9A 1CRLA 3H18A 4HKTA 3JVEA 1IPEA 1LPMA 4G1UC 4M1MA 1DDIA 4MUKA 1DSSG 5LSAA 1XQVA 1X15A 5EZSA 4YAGA 2ADOA 2O8BB 3A2LA 1E0JA 3ZE0B 3LY9A 4BZZA 4OQMA 1T2VA 2NXWA 2VOJA 3UPTA 3TIFA 4HP8A 1U3CA 5FYDA 4QASA 2JFXA 4MJXA 3UVMA 1VIDA 2DC1A 3ZE2B 1RLIA 3LQQA 5T3YA 2NQTA 3OTQA 3E8XA 1NQTA 1J06A 4E22A 2VZ3A 3BH0A 2VJAA 3CO5A 1E5VA 1DIAA 1O8BA 3KT0A 1MLDA 4ENSA 2DBVO 2VP4A 1YQDA 2R6R1 5GOZA 4KQ6A 5H1MA 3HA5A 4ZD6A 4WNAB 1A9YA 4P0QB 2CKDA 3HCDA 4R16A 2CZCA 4BLTA 3EY4A 2UZ4A 3MNFA 1OHHD 2PAFA 3AY6A 2BEUA 1QMPA 4Y5RD 1VLHA 1YD7A 1KH2A 3KUUA 1RJFA 3W8EA 5C9ZB 5FOTA 1T1EA 4ZALA 1XMJA 1LLUA 4RPHA 4O2RA 3OQBA 2OV1A 2QN7A 2H1FA 4I1OA 3FWHA 4BV9A 1L7MA 1TLLA 4WKCA 5GIOE 2QE7D 2ZE6A 1Z2PX 3D7KA 4PX2A 6ABPA 3SSOA 3B1KA 2ZKLA 3FDXA 4F6CA 1MHPA 1SD1A 1ZONA 2CFTA 3MTIA 2J45A 1N7HA 4HTFB 2HZ7A 4GLJA 3E9ZA 4L4XA 4X71A 1JLHA 4I5GA 1LUAA 4QRIA 3E0CA 1DGQA 3PHCA 2A33A 1RI6A 3AZQA 2X9NA 5CYKB 4YUZA 3RGWS 3STVA 4O3FA 3WAGA 4UNPA 4OBWA 4K6MA 4RPLA 1IB0A 3LCJA 4C04A 4OQFA 5DTQA 4ZVPA 2PWBA 2O0KA 1C8BA 2BYTA 1KZ4A 2FUG1 4QXAA 2Q3HA 3DVRX 4Q1BA 2QRLA 3D6UA 4CW7A 2VNIA 2RAUA 3F8TA 3BK7A 1L5ZA 5CVTA 3U56A 2FZ5A 1M2GA 4DPKA 2BBTA 1O03A 2OVFA 1QPGA 1Q50A 2N42A 2WIAA 5CITA 4MGZR 2NVOA 1I7QB 4BQRA 3I7OA 4KKVA 3FSGD 1ZRNA 5AVXA 3W5VA 4TYQA 3VV2A 2FLWA 1X7ZB 4B2LA 3W9BA 3MUNA 3VX3A 2CFSA 4S12A 2Z6UA 4B3GA 5ALRA 1NONA 1RI3A 3VR6D 1HKHA 1AQNA 4O4HA 4NE2A 4BB5A 4JI3B 2FFHA 1ESZA 4A91A 1UMDB 3DE6X 2GARA 2GPYA 2GSDA 5DNDA 3QE3A 4ESHA 2PU7A 3M6MD 4GMBA 4CTJA 2VQEB 1JPVA 1L7BA 3LRXA 5ALDA 4G5GA 3SEZA 2AQIA 2Q5FA 2C31A 3W8RA 1V4VA 1OBVA 2EIHA 2IYUA 3ZLVA 3AR2A 4W9RA 3FRHA 3L0BA 4ITVA 1USWA 1KZGB 3IP8A 1AQJA 2PWAA 1LLQA 4B3SB 4Y9TA 3HN6A 5KQSA 2JW5A 4G56B 4YECA 3E5HA 2WZQA 4UCXA 1M1YA 1GZUA 2IA5A 5EUMA 4CUZA 1XNGA 1XXLA 5G0VA 3A3NA 4R6WA 1Z15A 2QMOA 3NI2A 1QC5B 2I2WA 2ZIZA 4HUTA 3I52A 3QOFA 4OHKA 5JAIA 1IEVA 1ZM7A 1VCHA 3TFOA 4O4JA 3AI3A 3LQKA 2FVYA 1R8SA 5E7QA 5HA5A 3V8EA 3SHOA 2SBTA 3COWA 2HU8A 4ZK6A 5FAXA 1FDIA 1LTQA 3ZTYA 3FFWA 1QIJA 2B4QA 2YWFA 1AM4D 1T2DA 4FEEA 4PX3A 3LXMA 1P77A 3EAGA 5BW4A 4QOEA 3ZWCA 4FAND 5DE3A 2PX8A 3GL9A 4OGLA 1AK1A 3I32A 1HYGA 2QN1A 1Z2EA 3GUHA 2QG4A 4FT2A 4QJIA 1ZINA 2QTLA 4GMGA 3DJFA 3EGDA 3E58A 5FH9A 3M3HA 2OG1A 3BTOA 1IXRC 2CXQA 4WX2B 1UH5A 4YAIA 1XJCA 2P6MA 1CYDA 1QTNA 4MJ3A 1KP9A 5CD1A 1T5OA 5JY1A 4CGYA 1Z4QA 3PJEA 3FJ1A 5DBGA 5EQDA 2O59A 1J56A 3O1JC 1A1SA 5EHGA 2FUG6 4A4DA 2BTEA 4FIZA 2QNIA 3N2LA 1UK8A 2QVGA 3EU7A 1OLSB 5HM6A 4B45A 5HUQA 3TLMA 3N2GA 5DXFA 2PX2A 1X7DA 1P0FA 5EA2A 3AF5A 3RTEA 3UJDA 2OCKA 5CNMA 3E1KA 4WNIA 1N8TA 2G28A 1ZK3A 5J2TA 4N6GA 3AKZA 4ER3A 2H18A 2QTHA 5JY6A 2ZJBA 3C6XA 3Q3JB 2VDPB 3FPBA 1GL7A 4DV4B 4B74A 4HF7A 2XKAA 3R6LA 4KH0A 2BT4A 4MRRA 1NURA 2FPIA 5BUQA 2H57A 1W2GA 3IMCA 4QYWA 1J2UA 3N39C 3RAEC 3PUZA 4XPIB 4OXQA 5JNRA 4TRJA 3DEAA 3JU3A 4ROSA 1BVHA 2G5TA 4AF7A 1ZW6A 3R0ZA 2OJYA 2AMJA 2PZKA 2YJ4A 1Z4OA 3TL2A 3T3PA 2GXQA 2ORWA 1R6XA 1BHQ1 3AIIA 1SCUA 1P73A 4WJZA 4ZU6X 3NOVA 4Z9FA 1EKXA 1B3BA 1RQPA 4I3FA 3NX4A 3MERA 4MGHA 3FFAA 1I7DA 1N2OA 2YFKA 3W2EA 3CUKA 3WL8A 1KK3A 4GRDA 4LY3A 2OLEA 3BXXA 4IFBA 3CEAA 3E61A 2G76A 1XPRA 2HSWA 4H17A 3SX4A 2PUGA 2PM9B 3JQFA 4LV5B 5ELLA 2KLHA 4TKLA 2R0QC 1UAGA 1FJ2A 4C5BA 2WIFA 4LRSB 1DCTA 1IY9A 3ZEAA 2OT3B 5EMLA 3I1FA 4TKUB 4OLJA 5E1OA 3U37A 1PQWA 3L49A 2FFRA 5D3KA 1NSFA 1J5PA 1SEVA 1EFPB 1TZMA 4Q9LA 4AB1A 1PNRA 3LFUA 1SWVA 1T5SA 2E5LB 4C7VA 2XOKD 4NS4A 1CPYA 3IA7A 1XEXA 3K6SA 4JDPA 2PSDA 2B8WA 4NHOA 1LW6E 3BRWA 4K2AA 1MOZA 4Q5IA 1EUDB 3VO9A 1P5RA 1EQ2A 2Q4TA 5CFLA 4BNDB 1QYDA 2NO7A 4QKQA 3K9NA 2G0TA 3HO1A 3W90A 4AJNA 1LC0A 1TPZA 4AP5A 5HZHA 1E7YA 4CV3A 3U0BA 3CNEA 4EAAA 4PHFA 3KAJA 4QE3A 2OV2A 3HU2A 3NP7A 4ZWNA 2PZAA 3BXFA 1PFYA 3M4YA 2ATCA 1T9ZA 2YMUA 2PKRA 1VKOA 3R0QA 5EJ9A 4XM2A 4DT1A 1YUBA 1OH7A 2Q0HA 3PQ5A 1B8VA 1BS1A 3UF0A 1G1MA 2G17A 1GADO 1LBHA 1NXVA 4LXGA 4J8GA 5JXJA 2XY4A 2GHIA 4CG0A 4B8WA 3QTTA 3H84A 5FR2A 1PS9A 4HK4A 1Y82A 1RPNA 1SOMA 2BGGA 5BOSA 2QPLA 1DJNA 1OX6A 1FP2A 3O31A 2I03A 4MAAA 3ZY4A 4Q3OA 3ZDEA 2Q1WA 3PEEA 4DR5B 4NSNA 3B9PA 4IDBA 1ZK2A 1GQSA 1MIHA 3PQFA 3FMIA 2HV8A 3VVCA 1L5WA 2VUIB 3H5TA 5FKQA 1S1CA 5FTKA 2FCRA 3WAKA 1BO6A 4QXPA 1V2GA 4AVYA 1I2CA 4NE7A 1XMIA 1DAOA 4JYBA 3K8OE 5LWQA 3DNPA 4MVXA 5BV8A 1UOOA 3EMHA 5E95A 1N6KA 2P90A 2XMPA 3QH4A 3NMUF 1AA6A 4BKRA 2UUBB 5DI3A 4FU0A 2Q6KA 3AZOA 5I4BA 3OTTA 1T5HX 4JYCA 2BWJA 3VM6A 1EWRA 5K8TA 3AP1A 3AETA 4J77A 1QLHA 3R24A 3PICA 4LXUA 3C87A 1A27A 5REQB 4K9MA 2GYUA 3JYLA 4OBEA 3RG8A 2VDOA 5JCJD 2CXPA 1ADBA 1GITA 2MSCB 5FO1A 2NT4A 2GA9A 1M0EA 4M46A 3HXMA 3L7KA 2TMYA 2X1MA 3PCTA 4OKNA 1FFWA 4A27A 5H9WA 3ZWMA 2HFKA 5KVQA 1L4EA 1E7QA 3ZK8A 4A09B 4FZVA 3JAMg 5AJHA 2C83A 1Z9BA 4KSCA 5DNCA 4NZNA 2O05A 1UBFA 1YKSA 3VYVA 1ZP6A 2V58A 1E2KA 4RWZA 4BLWA 3DOUA 3QOXA 5I7EA 1CY4A 4EG4A 2Q4DA 3GH3A 3Q0EA 1SBNE 1A2BA 2VZ8A 2N9UA 1T8TA 4BQPA 3T8YA 5CA0A 3GF4A 3MCVA 3C8MA 3MW8A 3N0VA 3IAFA 1L4YA 4RIGA 2H6KA 3IB3A 3FMOB 4QPNA 2PQMA 2ZFUA 4IS2A 3D9QX 4IMRA 1OLXA 1RXIA 3LIIA 5F1KA 3CRRA 1SKBA 1F2UA 2VDQB 4AF6A 2F17A 4FGKA 4PYNA 4D9MA 1D7OA 1FIUA 1CUFA 2Q29A 5E1DA 1AH2A 4YPVA 1LI5A 5GZ3A 2AX3A 4GZ6A 3USZA 2C77A 4Q6BA 1OB5A 4Y6LA 4Z7NB 1F5NA 1Y3IA 3DTVA 4LHXA 1UP4A 4GX0A 3ROKA 1I94B 1KMMA 3T1YB 5FUVA 2ET6A 5DNWA 3SMRA 3UA3A 4JT9A 3SMVA 1HY3A 4IDCA 2P0EA 1O0CA 3AOEC 1Y0BA 4L6AA 4EKYA 4V1CI 5M5SA 3AFGA 2YWRA 3E5MA 4OXRA 3DVAA 3B1YA 4AO7A 2IF2A 1A98A 2C0CA 2OV4A 1PZFA 1YZKA 3K72B 2Y0BA 4PTLA 3VRHA 4G41A 1R0CA 3P94A 4G1EA 3KJXA 2XF2A 2ID4A 3I2KA 3T7IA 3UT5B 3JD4A 3HBNA 3BCHA 4RO0A 2AG8A 1VJDA 4WCFC 3FYSA 4PIVA 4KUEA 4LVUA 3MGGA 4IEEA 3PQ4A 4X00A 5L3ZA 2HSZA 4IWXA 5C51B 1JBKA 2CCKA 1IM8A 4Y0AA 1CIPA 3NVQA 2I2FA 2MJLA 2PSHA 3S99A 2R1ZA 4P2GA 5IXYA 3TZQA 2CXXA 5GWXA 5IUJC 3NBMA 3OFND 4KGXA 3IR7A 5D3QA 3DZDA 4PV7A 4KHPB 4AJ1A 3EZ7A 4BASA 1I2AA 1NE2A 5ADHA 1R8QA 3BDAA 2C2YA 3EVAA 3FTFA 3OHMA 4PBRA 1TT5A 3IP7A 5DCLA 4MVJD 3SLGA 4M4SA 1YQEA 2X3YA 3A06A 3SN6A 1M2EA 1MPXA 1ZSVA 2CFCA 3D0KA 4Y1RA 1TEVA 4JC4A 4XWAA 2R6AA 4S2EA 1WUYA 3IRVA 5JAZA 4L3VA 2D0PB 4OOEA 3ZNOA 3NIGA 4BKQA 1YJ5A 3WB9A 2TRCB 4CN9A 1QVZA 3S40A 2P2SA 2YNOA 2CLHB 3G7SA 1QDUA 4AJPA 4C76A 3P32A 4JI4B 1KYTA 1NVBA 2Q0SA 2VNSA 2FVXA 1N36B 3VTZA 1W0JD 1PVVA 2OB1A 1GPAA 2FMFA 3I1YA 4UZEA 1P7VA 4BEBA 3HFJA 4S1OA 1FDUA 2B2XA 1H4SA 1Z33A 4MVJG 3QK7A 3I45A 4JLDA 3QLVA 2GJKA 2YH2A 3PC8A 2XOXA 5DGDA 3CURA 3PV0A 3FGNA 2I80A 4MQ5A 3F4BA 1X2BA 2GVDC 4J0QA 1QQ7A 5F5NA 5LQNA 1E3DA 4WBNB 3IHKA 1GOTA 4AMGA 5CD9A 5B6PA 2H31A 5ALOA 2V98A 1XR3A 2NOAA 3ZDDA 4UUPA 4N5LA 5AM2A 4CLOA 2EQ5A 5ETJA 1Q0SA 3DXYA 2XCLA 2A8YA 3CB2A 5JBNA 4HDNA 3HVRA 1KZ7B 1LB1B 4FW8A 2DPLA 2HSJA 1HUQA 2I3SA 1Z0SA 3A6ZA 2WWYA 4KQGA 1JJVA 3OKPA 3BF8A 5JDCC 4KWEA 2PSFA 4YRPA 1NJ5A 3WLKX 3AL8A 3KJQA 4QIHA 1WV1A 3K8YA 4MA4A 2Q6TA 3W2GA 5ES3A 4YMGA 5KNCD 4CMIA 2G4CA 3N0RA 1YRLA 3SKVA 1FYVA 3MELA 4IQ0A 3VDQA 4F93B 3CKKA 2YIMA 1LDYA 1O9GA 4LWQA 5CXQA 2C4WA 4CM8A 2DAPA 3EEOA 4MLZA 2AGXA 5LC1A 1V6CA 4D96A 3MKSB 3RI3A 3D02A 4JMLA 3I9MA 5JPDA 2GYVA 4PM4A 3O8NA 3WMGA 5F5LA 1SKAA 5AJVB 4EGJA 3P2JA 2DFDA 2JLXA 3UICA 3EGXB 4DNUA 1R15A 2H7CA 3W15A 1N7GA 3SOZA 2IITA 4ESGA 4JY7A 4ZHQF 1NPDA 3G5MA 4RY0A 4J7XA 2X86A 1CUSA 2PA0A 3UANA 1VI6A 3KCIA 3UJCA 1H66A 4JL6A 5D5PA 1U8ZA 1IY1A 4A0FA 1DAIA 1OBOA 3KYCA 3SQLA 4LJAA 3VTAA 4ML3A 4KXMA 2YHUA 2P65A 4CG1A 4CIBA 2QRMA 2XB4A 2AZTA 3FOAA 4E2FA 2X5NA 4ZO6A 1P9OA 2EFCB 5EIBC 4DY6A 5JZSA 3WWOA 2NVUB 1EFVA 4Q1EA 3PQDA 1KSFX 2VS1A 3T5BA 4AW9A 5LBUA 4F3KA 3G6KA 2C98A 3THYA 5I8ZA 2IHNA 3IS3A 3IX7A 2A58A 1WWKA 2UZIR 3P4YA 5KWJA 1PJ4A 4RE6A 5DNEA 5FBKA 3UGTA 3CZQA 5F1YA 2YOHA 1KSHA 1MENA 1A4UA 3KVOA 1UWLA 2GK3A 2OZLA 4MZXA 1ZI9A 2RHRA 4PHGA 1AMOA 2JBAA 5CPBA 1TZKA 1UPUA 4UOEA 4OQYA 4MUAA 4EJSC 1UFOA 2PRZA 4JEMA 7ADHA 4IV0A 5JNTA 1QG0A 1SCIA 221PA 4LWOA 2ZKIA 5GXIA 2CDAA 1AN0A 4OWRA 1ISSA 3W5DA 3SHFA 1FUKA 4ND3A 3PIIA 3HA7A 4KIFA 1L7RA 1WOYA 3HL0A 4C0BA 4U9UA 2R751 3R5SA 4GX1A 3R75A 5HOQA 4RJJA 5KHLB 3AB7A 1OY1A 2FE1A 1OA0A 2XB2A 1VLVA 4N76A 5LMNB 2W2LA 3ZVMA 4GE0A 3HB0A 4N82A 1M75A 3N8NA 2KB0A 1VPEA 2OV3A 5BVGA 2TS1A 1I7NA 4ND8B 4GDMA 3DM9B 4PZZA 4RSMA 5CVUA 2O8VA 1U3TA 5EINA 2H52A 1WL8A 3DOFA 4GDFA 9LDTA 1SUDA 3RS0A 3MA0A 4L16A 4DIKA 3MWGA 1JWBB 2GCEA 1KERA 5BSUA 1W36B 4QPDA 2P5SA 1XRSB 2I91A 3M49A 2VDNB 1IHPA 2JAXA 1ZIOA 4EY4A 2XSZA 3E1SA 1ZKDA 3PRHA 1GR1A 5C34B 2OKGA 2H1OA 3K0BA 2IOFK 1Y1QA 1N6NA 1S02A 3H1TA 5I5GA 1QX4A 4P7KA 1E1LA 1FLNA 3ILXA 3VSDA 3TI7A 3ELBA 3OPYI 2BJWA 4UHCA 1XCPA 2R4TA 4YV1A 2IHKA 2C59A 5FPHA 4LOJA 1GGFA 1C29B 4PAGA 3WZMA 2FF5A 5EE5B 3HWWA 1XZDA 4KIJA 2MSDB 1ZFNA 2NVWA 4B76A 1ECGA 2CVFA 3CZCA 3ZQJA 4TQUS 4HLQB 4FFOA 2EW1A 3W2HA 1TUGA 2K4MA 3S8EA 3G49A 2O7QA 3OQ1A 4BV8A 5LJIA 3UJAA 4N0QA 2G8NA 2QL9A 4IZOA 4MW5A 4PANA 4H6WA 2DTXA 4OYRA 3M6AA 3PSLA 1UC9A 3VR5H 2X5KO 1SCDA 3ECCA 3I01A 2RHOA 2GZ3A 3D3EA 1SU8A 5KHOC 1VYUA 1VIMA 1RRMA 4BE7B 1GV1A 3V55A 4ZJUA 4E5ZA 2Y68A 1ZY2A 2EFHB 2JIZA 5JI2E 2IZ1A 1CC1S 5TQVA 1ECBA 1V45E 4DC0A 3G5AA 1XCOA 4MS1B 4B6QA 5K6TA 1RQ2A 4O2AA 3E7FA 4JC0A 4J84A 4MYUA 1NV9A 2CYAA 2YWXA 1D2AA 3WFIA 4D4MA 4KVFA 1Y3CE 2QN8A 1K3UB 1YB5A 4HB2A 2QK4A 5E4JA 2XE4A 4MQFB 1EM8B 3MRTA 2IWRA 4F38A 2QE6A 3BKXA 3UKRC 5JJKA 1BGWA 1M0TA 3UPUA 3AEQB 3O38A 2B34A 3PP8A 1E5DA 4BFCA 4WRRA 4I4TA 4GLFA 1H8HD 2ZIAA 3L3BA 2V6JA 1BVRA 4TRMA 5DULA 4UMVA 2AG1A 2YN4A 4L2IB 4GMHA 4BGEA 1YVEI 2W6OA 3EWSA 4WK4B 3E8MA 1OXXK 5HJ7A 2FW8A 5LA6F 4TN1A 4OQEA 4EUSA 4R7TA 1FVHA 1RQ7A 3IB6A 9GPBA 2NO4A 4NBKA 3M4NA 3BD7A 4ERNA 3RG2A 3TVDA 1DHRA 4KP7A 4RA9A 4RAOA 7MDHA 2P9BA 3WADA 2CNOA 3ICWA 4LFAB 1KEWA 2XUZA 5KKCA 3W5CA 1WQ3A 3BSYA 4CL8A 2G04A 3S1LA 1MH1A 2HDOA 3KKKA 4K9QA 5F9MA 3OTIA 1T6YA 3VYUB 5CCEA 4A92A 2C7VA 3CB4A 3MG9A 5EERA 3T9BA 3MMXA 2EFJA 4U4AA 1S8FA 4L3WA 2HFJA 5F7JA 5E8RA 4REQA 1GEGA 4AULA 3RO7A 1E7RA 5AW0A 1YIOA 6REQB 1N6DA 1S2NA 1HE1C 3NBFA 4G84A 4MVWA 2JIQA 1CNFA 2GPJA 2CLFB 1O96A 4X5OA 1PK8A 1ZNXA 1JDTA 2VWHA 1Z4KA 1DEKA 3RS9A 1N3BA 4F97A 3T61A 4BO5A 3G0IA 1ZJ4A 2R96A 2FJ0A 2ZRDA 3UUGA 1X8KA 1FX0B 3PFIA 1N33B 3DS8A 1MFPA 4XR9A 5CU7A 1RHKA 2CBGA 3KEOA 4BMNA 3AF0A 4EWRA 3TTWA 4YGYA 3GIWA 3WMEA 5EHQA 2HWKA 3I5MA 4XM0A 3I6BA 1UOEA 1ZUHA 1G9TA 3BWEA 2NYRA 3KBBA 3X1ZA 3RVBA 2EP5A 4KO3S 2PJUA 1ISJA 5FX2A 3GQVA 2BMDA 4IICA 5A9SB 4FFDA 1G20A 1YAHA 5BQPA 1LX7A 2DUMA 4PFJA 4OV6B 1EDBA 1Z6ZA 3EI3A 3H42B 4QQNA 3N5KA 5A1TA 2G77B 2FQYA 2VPXA 4JP5A 1Q3HA 2FKAA 1TZJA 3IERA 4QPPA 1V9SA 3WHIA 2PLFA 5IT9A 4DZRA 3IJEA 3BBPA 2GUGA 1IM2A 2DY0A 5FT9A 3RJTA 1U28C 2JFHA 3AM5A 3UC5A 2DXIA 4C0HA 3DOIA 4EARA 4E31A 1G2QA 2WKWA 1GZ4A 2VA9A 3JY6A 1UC4B 4JS0A 4FA9D 2WB4A 2P9NC 4HNAA 1UM9B 4EYEA 3GN2A 3FVQA 2HBRA 2Z58A 1QLWA 1UM8A 4Z7OB 3AIOA 2GD0A 1RBYA 4ZEVA 2GDZA 5HXAA 1A1VA 5LU8A 3DL7A 2CFIA 2GERA 5K8LA 1C7EA 4GGMX 3IELA 3PE7A 1P72A 1JFFA 1B8OA 4QEDA 1O54A 4DMCA 5FPKA 3OCWA 3MHTA 3RADC 2FSVC 4XDYA 3EWIA 4D7AA 2QD5A 4QO7A 1O89A 4FONA 2YMMA 3R3YA 3HYSA 5CYPA 4FBMA 3ZUGA 2N3ZA 3MWFA 1Z74A 2XITA 5GPBA 3JWEA 4TKMA 2YVQA 3UHJA 3ZJTA 3V4ZA 2X8WA 2I7VA 5CT6A 2YWDA 3Q7RA 4MB0A 1RRVA 3WNZA 2E4VA 1LI4A 3DT6A 4E0BA 1KDZA 1NXTA 5L6MB 2IEGA 5IX8A 2H9NA 1RXSA 5G0UA 4O1HA 1QIHA 3O74A 1R6VA 4DL9A 3ZXYA 3K9WA 5HMMA 4LY9A 2P4HX 3KQQA 1DLJA 5E3JA 4BUJC 2O2SA 1XQWA 3F4LA 1U2GC 2AIRA 2YXBA 4K3UA 3QU9A 4BRWA 4FWIB 1ENOA 1IJKA 2HKIA 1RAIA 3P2YA 5E2IA 4UBJA 4UUNA 4PNKB 2ZCVA 5GZ6A 3AOGA 4U2DA 4QRDA 1EVKA 3OAAA 2GPAA 1T9AA 2HUNA 5BXQC 1QSGA 1PJQA 4G5RA 1Y7PA 1ZX1A 3I2NA 4O25A 3EBOA 2H1SA 4NPHA 5I5JA 4O8CA 1F51E 1LLDA 1JMYA 2Q27A 4JT5C 4A0QA 4X1KA 5DRTA 1B6TA 3MOIA 3HJBA 1ZJJA 4P36A 1I4TD 2H5EA 4LTNA 2Z2YA 3Q3CA 1RHJA 4Y2HA 1J1IA 1OTXA 2OC4A 3DGFC 2DSTA 2F1RA 2RBEA 1M1NA 1XEWX 3NIBA 2AN4A 4IDEA 1SXGA 4NDNE 1MO6A 2RCYA 1AE1A 2E85A 3RFXA 3AHCA 1P80A 4UNQA 5KJ1A 2VK2A 4BV2A 2W6CX 5BUSA 2GCOA 1EUQA 4IJKA 3ZNNA 5D8DA 3PVWB 5CH5A 5TY0A 3OL2A 3H97A 1YGYA 5J4YA 1Z07A 1RWVA 3KAPA 1PL7A 2PGXA 3IHTA 2ZYAA 1EPUA 3RIXA 2XZTA 3IEPA 1HQKA 1W6UA 1Y6GA 4TN5A 3D2CA 4X91A 1RPZA 5EY5B 1A69A 4M22A 4NULA 2DH5A 2XU7A 4U2CA 4RMHA 2ZUCA 3TD9A 3ORRA 4ZTZB 5M61A 4KRGA 2HSEA 4EJMA 2A0XA 4O4HB 3IA2A 2IY7A 1Q0UA 2XIJA 5DGIA 4H5JA 2QPOA 2HK7A 4JC5A 1L1FA 3F7TA 4E51A 4J7UA 5KC9A 1Y1PA 3H9GA 1CJUC 1JEQA 4N6OA 2KQUA 5SYAA 3B48A 1I2BA 1SPBS 3IIIA 5CDHA 3H13A 3I4FA 2HH9A 2RGBA 1QQ6A 5GMKn 4P54A 4L5CA 3RC8A 3OEYA 4OKIA 1AV7A 3T9AA 2H1VA 1ND5A 1EVQA 1NW6A 4BMSA 5C5EA 1AZLA 4TTVA 2YQZA 2D2XA 3M3PA 4GYWA 3R6DA 1PG0A 3A8TA 1H9BA 1WCWA 4JLUA 1PDOA 2O6HA 5KCMA 3CF0A 4HXGA 5DPMA 2FHPA 3W4IA 1IEWA 3KQOA 3L7NA 1JJUB 1PBTA 5HKLA 3K5HA 4FLEA 2OCAA 1LJUA 1M1YB 4NBVA 4ZCLA 3RAJA 5ICEA 5B30A 1JIIA 2EV9A 1LQUA 5BOVA 5TPZD 3CVYA 2A4KA 4RMGA 4XZ3A 4F21A 3IE0A 3T1VA 4NRDA 4L4YA 1E1KA 1QHYA 4O4JB 2OFPA 3TKYA 1Y7LA 5DTMA 3V7WA 3ODGA 4BQFA 4P7FA 1PDWA 1PFQA 4JQYA 3R5HA 5C8VA 4CM4A 4BFYA 3JQQA 3WG9A 5HK9A 3QSYA 3PWTA 2XRYA 1E94E 2NSLA 1SG6A 5HE9A 2LV8A 2RDMA 1XDSA 4J49A 4JBYA 2OCYC 4KQJA 3DR3A 1E7SA 2CZQA 4NCJA 1XU9A 2QX6A 3W2FA 1VC2A 1RLOA 3EGDB 1VIAA 4AAYA 4N40A 2WI8A 1UMBB 5TB5A 3WYBA 5I3CA 4IP0A 1MGPA 3BN3A 2BR4A 3V9PA 3SVZA 1QGUA 2VTKA 1WHTA 4QGGA 1F8XA 1SBYA 2BM9A 3WE7A 3I2IA 2FI1A 3N2GB 3T9CA 2NO9A 2XE8A 3EEYA 2ZIUB 1V7PC 2QLFA 5JMOA 5JDIC 4W99A 1K8XB 4MGYR 2VSFA 3IUSA 1PAUA 3I6ZA 5J2TB 2HYIC 4KQMA 1CYEA 3Q5EA 1O94D 3BG5A 1YA8A 3HCNA 4OHWA 4UTPA 4Z3KA 4U9IS 3EJ6A 2CNKA 3ROEA 4KR6A 3EX7C 4KK4A 4RTJA 4GM3A 3LT1A 2DLCX 3BIJA 4IM7A 4GWGA 4H1VA 3A04A 3L8ZA 2FPIB 2C97A 4WEOA 4X64B 1P22A 1E6LA 5FQDA 3VYTB 5FEUA 2GBFA 1C9JA 1C8KA 1I3CA 3B6EA 1QP0A 2M6KA 4ARUA 3M2PA 5C53B 4JYZA 3KZXA 4MZDA 5JD3A 5AICA 1N57A 1YCDA 1ZK4A 1QPBA 2IF0A 2CNLA 2E37A 2M32A 1ULAA 4RZHA 2VF2A 3T3PB 3H9CA 3HBMA 1SIWA 2ZUWA 4N7BA 1IU9A 1CZKA 1SCUB 3IQHX 3UUEA 4CLRB 1WVMA 4BNFA 2IYFA 3T7JA 3FWPA 1QFYA 1U8CB 5LQSA 3C3YA 5K0TA 5CBPA 1FVXA 4TQAA 2P3QA 3UMSA 2WICA 4MRAA 3G1UA 3EVDA 3B36A 4KLAA 1N7IA 1G63A 1IZYA 1URPA 3AOEA 3UWKA 4RFLA 4O2BF 2J9GA 2PYDA 1OVGA 2QRVA 4NU8X 1ZM3A 2ZM5A 4HV4A 1IY2A 1F1BA 1PL8A 3QE0A 4KLZA 4EKIA 4QICA 3WQQA 3GC6A 3AXTA 1WY5A 4GGOA 2GM4A 5JAQA 2VTBA 3SSAA 5ITSA 4WCFA 1EAMA 4LKOA 3CUVA 5I45A 3C8UA 3NTVA 2BCGY 4NBRA 3FPHA 5KVVA 1J8FA 1DWOA 4P8RA 4DFDA 1G6HA 1QHXA 2R6DA 1XEXB 5IN4A 5KOYA 3K6SB 3OTOB 3HU3A 2V74B 4B2PA 3FWYA 2NW6A 1FDSA 5JXGA 2V1UA 4YRCA 4GSLA 3URMA 1UMKA 4KYVA 4A2PA 3G8BA 1E2GA 1AU9A 4ONEA 1KR2A 5KTRA 2QR3A 2NSJA 3O84A 3IEKA 2PVSA 2LNDA 1RHUA 3BJRA 4Q39A 3TTSA 2WSMA 1YI1A 2EQBA 3MYRA 3DDHA 3EHEA 1PNTA 1UXJA 1DQPA 1PYDA 3DYIA 3GQBA 4L6CA 3KJIA 4QEZA 3BAZA 3RK0A 5H14A 3ICPA 1OIWA 5DHTA 4CDRA 5J2UA 1SAYA 4QSMA 1KBOA 4B3FX 2GPBA 3UHPA 4DT1B 3VNUA 3EG6A 3K70B 1U04A 2PYIA 1QR6A 3GVIA 3I5UA 1U0LA 2WNSA 2ZRKA 5DCWA 3UWSA 4AIRA 2XMQA 2Z2OA 1V8DA 1ZJZA 2V5VA 1JTVA 2QN9A 5I51A 1FTYA 3SEAA 2XDQA 4BXOA 4C7MA 2ENWA 5BOSB 1JR6A 1B2LA 1K6MA 5CFMA 1N9KA 2XTNA 2JNWA 3GZ4A 3NQ41 1KRHA 4DZTA 1WABA 1U6KA 2Q3LA 3W6UA 4HGRA 4OATA 3KOXA 3T5TA 4IHJF 1WEKA 2F2TA 4PO1A 2RG7A 1ZK1A 3FTNA 1UWKA 4F4HA 4AUKA 1Z28A 1O97C 4PICA 2TMKA 4GMXA 4AD8A 1T2UA 4DCCA 1LK7A 4HXFB 1ZRSA 3FPSA 3IQFA 3DSMA 3H5OA 4XARA 4Y2TA 4BFTA 3KQPA 5CB6A 3I6YA 3ZJUA 3R9WA 1PJZA 2ZQYA 2ZXFA 1JIVA 2BTOA 5H70A 3OE4A 2JJ1A 3BWYA 3QVMA 4ZVRA 1QV7A 4JR1A 2BBSA 1T13A 1L7VC 5BSHA 1GXRA 4YAJA 1PT7A 5DI3B 3OZTA 4EPTA 2QIPA 1R1DA 1XWFA 2DQKA 4RF4A 2H7YA 4PLFA 3AETB 4HYQA 4MGEA 5A2QA 3CGWA 2JFWA 5JDCA 2VDOB 5IDVA 3ZK9A 2WU3A 5NLLA 2B3TA 2KBFA 2NZUG 4HXEB 3U3ZA 1QCYA 2OK7A 3O94A 2B8NA 2C5LA 4ZAFA 4F9EA 4PE5B 4FYJA 2OR3A 2VJMA 3VR4A 2XYQA 4HYTA 4UW9A 4GKJB 1LPAB 5T3UA 2ZT5A 5EUQB 3ZHXA 2J57G 2A9VA 4IQGA 4Z7QB 3WYAA 1Z2OX 5C2WB 2WE8A 1P0IA 4WDRA 3AHHA 5CA0B 2VQDA 1GN9A 3F2IA 1HYHA 4Q7LA 3Q9NA 1L6RA 3RC7A 3A6DA 2GRUA 3KWFA 5L45A 2J0EA 5FUYA 4OGWA 3AUXA 1OLXB 1Y4ZA 4ZU3A 2EKPA 1SVWA 3AM1A 2CFRA 2Z9BA 2QR5A 2WMYA 3G23A 1KI1A 1W9MA 3I92A 1N75A 3A4MA 3DM0A 2O07A 4UDXX 3O0DA 1G2PA 3STHA 5AVJA 2ODBA 3G0GA 3DTVB 3GNSA 3H5AA 1DWQA 3K2EA 4FDVA 5G40A 3NHJA 1VTKA 2XVMA 1MQ8B 4FFVA 3OLVA 1N2BA 2GO1A 2P7HA 4TLDA 4ZCSA 3TR6A 3N8IA 1U7TA 4MK0B 3GEDA 2FHSA 3QXXA 4R4JA 3VFDA 3KRWB 1ETUA 3H11A 1WOMA 3SJLD 2JZNA 5E6UA 2IEBA 1JDBC 2VPZA 1F17A 3OX1A 1MORA 1U0RA 4R1MA 2CXHA 2WTEA 3PGJA 2L0XA 1XROA 1RAHA 1JMKC 2Q5LA 521PA 3KFVA 2IWFA 3DVAB 3DNMA 4Q9NA 4M98A 1G5IA 4ZT4A 3LY5A 1XLTC 3CG4A 5I7SA 4G1EB 1KRXA 5K3EA 3WS7A 1EBFA 2GBGA 5G0SA 1NT4A 4KQKA 4NE9A 3IR5A 3RKSA 2ZYTX 3A3KA 1P60A 4U6SA 4EJSA 3QWHA 4ZVNA 3AI1A 4F2WA 1NUTA 3GLIA 2BBWA 3PR2B 2QB5A 3QBJA 5CNJA 3LPAA 1PJRA 3SHQA 1F3OA 4M3NA 4JOSA 2XT6A 4B79A 1MBZA 1V1JA 4RTRA 3GMIA 2O3RA 1DQNA 4WLNA 2BLNA 4LJ6A 2LDBA 5LQMA 3OFVA 3H8VA 2P6RA 5ABPA 1V41E 1QH0A 2D00A 3I34X 2P5TB 1UBTS 3ZD9A 3SWWA 4RJLA 1OT3A 1F14A 3EGEA 4LZWA 1TT5B 3LT5A 3BGSA 3UK0A 3DFFA 3SN6B 1SUCA 4H0NA 3U9LA 4V02A 4Y1RB 3VU3A 2DPMA 2BMWA 4KB5A 3MLBA 5KAPA 3NIGB 1Q5PA 1HEUA 2WM8A 1FNCA 1MPTA 3PGA1 1THTA 2F9FA 1HT0A 4JIMA 1JSLA 2H1IA 2V3WA 4LPSA 1K27A 5JS2A 3FCAA 1LTHR 3OY7A 1XMQB 4ZANA