3RRMC

S. cerevisiae dbp5 l327v bound to nup159, gle1 h337r, ip6 and adp
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
382
structure length
370
Chain Sequence
GASSLKDEVPTETSEDFGFKFLGQKQILPSFNEKLPFASLQNLDISNSKSLFVAASGSKAVVGELQLLRDHITSDSTPLTFKWEKEIPDVIFVCFHGDQVLVSTRNALYSLDLEELSEFRTVTSFEKPVFQLKNVNNTLVILNSVNDLSALDLRTKSTKQLAQNVTSFDVTNSQLAVLLKDRSFQSFAWRNGEMEKQFEFSLPSELEELPVEEYSPLSVTILSPQDFLAVFGNVISETDDEVSYDQKMYIIKHIDGSASFQETFDITPPFGQIVRFPYMYKVTLSGLIEPDANVNVLASSCSSEVSIWDSKQVIEPSQDSERAVLPISEETDKDTNPIGVAVDVVTSGTRLPLVYILNNEGSLQIVGLFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ATP-dependent RNA helicase DBP5
publication title A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP6 in mRNA export.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 81
structure length 370
sequence length 382
ec nomenclature
pdb deposition date 2011-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF16755 NUP214 Nucleoporin or Nuclear pore complex subunit NUP214=Nup159
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3rrmC00
2B4EA 3SCYA 2IURA 5FA5B 2P9LC 5JWZA 2OJYA 1K32A 2AH1A 4X60B 3U4YA 4OZUA 2IUQA 4BUJC 4A09A 3NVXA 2TRCB 4YVDA 2GNQA 5CYKA 2IAAA 3J81g 2OVPB 2HXCA 2BCJB 2BBKH 3MXXA 3JZNA 4CZYA 2GC7A 4CI2A 3RN1D 5GXHA 2HKMA 5IJ7E 5IGQA 2CNXA 2OK6A 2H9PA 4JSVC 3EI2A 2YNNA 4ZN4A 3IIWA 3B7FA 3GFCA 2AGWA 5HE2B 3E0CA 1N6DA 2YB8B 4A0AA 3L4OD 4J84A 5C2WB 2CN3A 4FA4D 4G56B 3PXSD 2H6QA 4XYIA 4A2LA 3IJCA 3AFCA 3ODTA 3MMYA 4L3GD 4FA5D 2CO0A 3EU7A 3JZGA 5K19A 1B9XA 4KFMB 4D0KA 5IT9g 2YBAA 4LG9A 5IGOA 1N6FA 4J0XA 4IMMA 2W18A 4LG8A 3F3FA 3EI3A 1SQJA 4NSXA 4X61B 4GM9A 4JXMA 4L1QD 2I0TA 2XL2A 4O9DA 5FKSA 2H14A 2IUPA 5TEEA 2P9NC 3N0DA 5B4WA 4R7AB 4CY2A 1GG2B 3SJLD 4QQEA 5FKQA 1R5MA 4FAND 4TZ4A 2G9AA 4GQBB 4JSPC 4J79A 3DSMA 3DWLC 2OVQB 1JJUB 4J73A 4PC0A 2I0RA 5CYKB 4J78A 4CZVA 3C9CA 3I7NA 5SXMA 2Z2OA 1MG3A 3AL9A 2OIZA 3RFHA 4CC9A 2OK4A 4EWRA 3OW8A 3I7OA 3V7DB 4JSNC 3HFQA 4OWRA 2IWFA 3PE7A 4A11A 2H3XA 3ORVD 4A0AB 2XL3A 1TYQC 4QT8A 2B5LA 4QRJA 3I7LA 5C9ZB 3F3PA 1OMWB 1JOFA 2YNPA 2HKRA 2GC4A 3SWSD 4J8GA 4BL0A 4PXWA 3N0EA 5CXBA 5HYNB 2AQ5A 4J77A 3F3GA 4A2MA 4A08A 5GSAA 3I7PA 3EI4A 3RMZD 3SXTD 1XKSA 5AJAA 5I5JA 3OKYA 3BG1A 4GQ2P 4L9OA 5FKRA 3PSLA 5EAPA 5H14A 3FGBA 1PI6A 2H9LA 3EI3B 5KDOB 5FQDA 3OKTA 4PSXB 3IIYA 4ERYA 2I3TA 3RFGA 5CXCA 5I5MA 4CY3A 4E54B 4A0BA 3JAMg 5TEFA 2HESX 3UKRC 4IA9A 1SHYB 3UVMA 3W15A 5EMLB 2CN2A 2XU7A 3IJ1A 2CO0C 1JMZB 4PBZA 4FA9D 2P9UC 1SQ9A 4U1EI 5GMKn 1B9YA 3OL2A 3KRWB 3UR4A 2Z2PA 3I8CA 2YNOA 3I7KA 4X63B 1GXRA 5EM2A 3DXKC 3OTTA 4E5ZA 4I79A 4ERQA 3AL8A 4O3UB 4JT5C 3JPXA 2QXVA 4PNKB 2B5MA 4Y5RD 3MZLA 4U7AA 1A0RB 4CY1A 5EMJB 4D6VA 4FHLA 3MZKA 3PVWB 2P9KC 3SBPA 5EMMB 1QNIA 4PSWB 3C5MA 2Q7QA 4J0WA 5AFU3 3C99A 3OKYB 4A09B 3DXMC 3JROA 4FB1D 3SBRA 5HE0B 3EG6A 2PM7B 3SVWD 5HE1B 2QC5A 5CXCB 2XYIA 3GREA 4GGDA 3MKSB 3V5WB 4XEIC 2HYEA 3SHFA 3NVQA 4K3JB 3UVOA 5C2VB 4CI3A 3EI2B 5A2Qg 3OKWA 5K1CC 3DM0A 2AGLA 5EMKB 3IKOA 1XIPA 5AMSA 3AH8B 4J87A 4Y7RA 4AEZA 1NR0A 4MK0B 4GGCA 1ERJA 2IWKA 4FA1D 1S4UX 3CFSB 4FWWA 5THAA 3J80g 3I89A 2AGXA 4LGNA 1PGUA 5EAMA 3UKUC 2MTAH 5EM2B 2EBSA 4XYHA 1JMXB 1PEVA 4E5ZB 3UVKA 3EMHA 2CE8A 3AL8B 3KRXB 4ESGA 1XHMA 3SBQA 1U2VC 5I5IA 3PXTD 1TBGA 3P4FA 2H68A 3C75H 4J8BA 1FWXA 1GOTB 2P9IC 2Z2NA 3I2NA 2H13A 2H47A 4A7JA 2H9NA 5FLXg 1RI6A 2I0SA 3BG0A 3A0FA 3K27A 4GM3A 3IJ0A 4N14A 5GXIA 1K8KC 3VA6A 3FRXA 4FAVD 3SFZA 3V9FA 4H5JA 2HJ4A 3K26A 4GM8A 1U4CA 4GGAA 1OLZA 1PBYB 4A11B 4L3HD 3UVNA 1MDAH 2PBIB 2G99A 4GQ1A 3SN6B 2J56H 1GP2B 4ZOYA 4ERZA 3RRMC 3SMRA 4GMBA 1MG2A 2J57G 4ZOVA 3EI1A 4HDJA 4H5IA 2B5NA 4JSXC 2PM9A 5TF2A 4ZOXA 3NVNA 4CI8A 1NEXB 2AGZA 3JRPA 5CXBB 3SLED 4PBYA 4A08B 3I7HA 4QL1A 2P9PC 5FKTA 5HE3B 3EI4B 5H1MA 3JZHA 3ZWLB 3PVUB 1P22A 3CIKB 5HQGA 4AOWA 5EALA 2CE9A 2P9SC 4ZOZA 1L0QA 2UZXB 4GZ8A 3VGZA 4Z8LA 3ULEC 5EARA 2UZYB 3MKQA 4E54A 4JD2C 4A0BB 4CY5A 2J55H 2H9MA 4ES0A 4CI1A 4CZXA 4J82A 4X3EA 4K3ID 4O45A 2HJBA 4J81A 4O1QD 2I3SA 4O3TB 2IUVA 3FM0A 1N6EA 2PM6B 3RN0D 4J86A 4UI9R 5H17A 5IC7A 3OL2B 3VH0A 2YMUA 5FXYA 3RSEC 4JT6C 3UVLA 5TDHB 1Q47A 3PSCB 1YFQA 3I8EA 3BWSA 3EWEA 2H6NA 3PXWD 2OVRB 2AGYA 3L4MD 3CFVA 1VYHC 3EI1B 3JB9L 2AH0A 2O9KA 2PM9B 2H6KA 3RLMD 5IJ8E 4BH6A
chains in the Genus database with same CATH superfamily
2B4EA 3EQ7A 3SCYA 2IURA 1T2XA 5FA5B 5E6RA 2P9LC 5JWZA 5E6SA 3DDUA 4D9SA 2OJYA 1K32A 2AH1A 4X60B 2VDQA 3U4YA 1GOFA 4OZUA 2IUQA 4BUJC 4A09A 3NVXA 2TRCB 4YVDA 3ZE1A 3K6SA 2GNQA 4BP8A 1I2MB 5CYKA 2IAAA 3J81g 2OVPB 2HXCA 2BCJB 2BBKH 3MXXA 3JZNA 4CZYA 2GC7A 4CI2A 3RN1D 5GXHA 2HKMA 5IJ7E 5IGQA 1O6GA 2CNXA 2OK6A 2H9PA 4JSVC 3EI2A 2YNNA 4ZN4A 3IIWA 3B7FA 4JHPC 3GFCA 2AGWA 5HE2B 3E0CA 1N6DA 2YB8B 3QHYB 5FFGA 4A0AA 1E8NA 3L4OD 4J84A 5C2WB 4Z7OA 5M5SA 2CN3A 4FA4D 4G56B 4AN1A 2HU8A 3PXSD 2H6QA 4XYIA 4A2LA 3IJCA 3AFCA 3ODTA 4NENA 3MMYA 4L3GD 4FA5D 2CO0A 3EU7A 2EIDA 2VC2A 3JZGA 5K19A 1B9XA 4KFMB 1VZ2A 4D0KA 5IT9g 3K72A 2YBAA 4LG9A 5IGOA 1N6FA 4J0XA 4IMMA 5M5VA 3O4JA 2W18A 4LG8A 3F3FA 3EI3A 1SQJA 4NSXA 4X61B 4GM9A 4JXMA 4L1QD 3NIDA 2I0TA 2XL2A 4O9DA 5FKSA 2H14A 2IUPA 5TEEA 2P9NC 3N0DA 5B4WA 4R7AB 4CY2A 1GG2B 3SJLD 4QQEA 5FKQA 1R5MA 4FAND 4RE5A 4AMZA 4TZ4A 2G9AA 4GQBB 4JSPC 4J79A 3DSMA 3DWLC 4WJKA 1VZ3A 2OVQB 1JJUB 4J73A 4PC0A 2I0RA 5CYKB 4J78A 4CZVA 3C9CA 3I7NA 5SXMA 2Z2OA 1MG3A 3AL9A 2OIZA 3RFHA 4CC9A 2OK4A 4EWRA 3OW8A 3I7OA 3V7DB 2BKLA 4JSNC 4UM8A 3HFQA 4OWRA 2IWFA 3PE7A 4A11A 2H3XA 3ORVD 4A0AB 2XL3A 3O4GA 1TYQC 4QT8A 2B5LA 3IJEA 4QRJA 3I7LA 5C9ZB 3F3PA 4IRZA 1OMWB 1JOFA 3V4PA 2YNPA 4Z7QA 2HKRA 2GC4A 3SWSD 4J8GA 4BL0A 4PXWA 3N0EA 3ZDZA 5CXBA 5HYNB 2AQ5A 4J77A 3ZE2A 3F3GA 4A2MA 4A08A 5GSAA 3I7PA 3EI4A 3RMZD 3SXTD 1XKSA 3O4IA 5AJAA 5I5JA 3OKYA 1TYEA 3BG1A 3MUOA 4GQ2P 4L9OA 5FKRA 3PSLA 5EAPA 5H14A 3FGBA 1PI6A 2H9LA 3EI3B 5KDOB 5FQDA 1U8CA 3OKTA 3IIYA 4PSXB 4ERYA 4BP9A 4AX4A 2I3TA 3RFGA 1H2ZA 2HU5A 5CXCA 5I5MA 4CY3A 4E54B 4A0BA 3JAMg 5TEFA 2HESX 3UKRC 4IA9A 4UM9A 3ZE0A 1K3IA 1SHYB 1H2YA 3MUNA 3UVMA 3ZDYA 2QR5A 3KCIA 3W15A 5EMLB 2CN2A 2XU7A 3IJ1A 2CO0C 1JMZB 4PBZA 4FA9D 2P9UC 1SQ9A 4U1EI 5GMKn 1B9YA 3ZDXA 3OL2A 3KRWB 3UR4A 1E8MA 3IUNA 2Z2PA 3I8CA 4JHNA 3EQ9A 2YNOA 3I7KA 4X63B 1GXRA 1C9IA 2VZ1A 5EM2A 3DXKC 5M61A 4MMXA 3OTTA 4E5ZA 4I79A 1E5TA 3IUJA 4ERQA 3AL8A 4JT5C 4O3UB 3JPXA 1YR2A 2QXVA 5M5RA 4PNKB 2B5MA 2HU7A 4Y5RD 3MZLA 4U7AA 1A0RB 4BCCA 4CY1A 5EMJB 4D6VA 4FHLA 3MZKA 3PVWB 1VE6A 2P9KC 3SBPA 5EMMB 3IURA 4NC4A 1QNIA 4O02A 1GOHA 4PSWB 4DNWA 3C5MA 1JTDB 2Q7QA 4J0WA 5AFU3 3C99A 3OKYB 4A09B 4AN0A 3DXMC 4NBMA 3JROA 5FFOA 4FB1D 3SBRA 3OF7A 5HE0B 3EG6A 2PM7B 3SVWD 5HE1B 2QC5A 5CXCB 2XYIA 3GREA 4GGDA 3MKSB 3V5WB 4XEIC 1A12A 2HYEA 4MMZA 3SHFA 3NVQA 4K3JB 3UVOA 2XZGA 5C2VB 4CI3A 3EI2B 5A2Qg 3OKWA 5K1CC 2VDKA 3DM0A 2AGLA 5EMKB 3IKOA 1XIPA 5AMSA 3AH8B 4J87A 4Y7RA 4AEZA 1NR0A 3VI3A 4MK0B 4GGCA 1ERJA 2IWKA 2VDOA 4FA1D 2XDWA 1S4UX 3CFSB 4FWWA 5THAA 3J80g 3I89A 2AGXA 4LGNA 1PGUA 5EAMA 3UKUC 2MTAH 2EIBA 5EM2B 2EBSA 4XYHA 1JMXB 1PEVA 4E5ZB 3UVKA 3EMHA 2CE8A 3AL8B 3KRXB 4ESGA 1XHMA 3V4VA 3SBQA 1M1XA 1U2VC 5I5IA 3PXTD 1TBGA 3P4FA 4NAAA 2H68A 3C75H 4J8BA 1FWXA 1GOTB 2P9IC 2Z2NA 4AMYA 3I2NA 2H13A 4BCBA 3VI4A 2VDPA 3FCUA 4L1MA 1UTCA 2H47A 4Z7NA 2VZ3A 4A7JA 2H9NA 5FLXg 1RI6A 2EIEA 1BPOA 2I0SA 3BG0A 3A0FA 3K27A 4GM3A 3IJ0A 4N14A 5GXIA 4DNVA 1K8KC 5M5UA 3VA6A 3FRXA 4FAVD 3SFZA 3V9FA 4H5JA 2HJ4A 3K26A 1JV2A 5HDBA 3IULA 4GM8A 1U4CA 4GGAA 1OLZA 1PBYB 2VDNA 4A11B 4L3HD 3UVNA 4BCDA 2JKXA 1MDAH 2PBIB 2G99A 4GQ1A 3SN6B 2J56H 1GP2B 4G55A 4ZOYA 4ERZA 3RRMC 3SMRA 4GMBA 4O2WA 1MG2A 2J57G 4ZOVA 2EICA 5C86A 3EI1A 1C9LA 4HDJA 4H5IA 2B5NA 4QAMA 4JSXC 2PM9A 3K71A 5TF2A 4ZOXA 3NVNA 4CI8A 1NEXB 2AGZA 3JRPA 4WK0A 5CXBB 3SLED 4PBYA 4A08B 3IVMA 3I7HA 4QL1A 2P9PC 5FKTA 2XE4A 5HE3B 3EI4B 2QZPA 5H1MA 3JZHA 4WK2A 3ZWLB 3PVUB 1P22A 3CIKB 5HQGA 4AOWA 5EALA 2CE9A 1QFMA 2P9SC 4ZOZA 1L0QA 2UZXB 3QI0A 4GZ8A 3NIGA 3VGZA 4Z8LA 2VDLA 3GD1I 3ULEC 5EARA 1VE7A 2UZYB 3MKQA 4JD2C 4E54A 4A0BB 3T3PA 4CY5A 3IUMA 2J55H 1H2WA 2H9MA 4ES0A 3IUQA 4CI1A 5M5TA 4CZXA 4J82A 4X3EA 4K3ID 4O45A 2HJBA 4J81A 4O1QD 1UOPA 2I3SA 4O3TB 2IUVA 3FM0A 1O6FA 1N6EA 2PM6B 3EQ8A 3RN0D 3MVDK 4J86A 1UOQA 1L5GA 4UI9R 5E6UA 5H17A 5IC7A 3OL2B 3VH0A 2YMUA 5FXYA 4WK4A 3RSEC 4JT6C 3UVLA 5TDHB 4MMYA 3T3MA 1GOGA 1Q47A 3NIFA 3PSCB 1YFQA 1QFSA 4DNUA 3GC3B 3I8EA 3BWSA 3EWEA 2H6NA 3PXWD 2OVRB 1H2XA 2AGYA 3L4MD 3CFVA 1VYHC 4RE6A 4G1MA 3EI1B 3O4HA 3FCSA 3JB9L 2AH0A 2O9KA 4G1EA 1UOOA 2PM9B 2H6KA 2WQ8A 2VDRA 2VDMA 3RLMD 5C92A 5IJ8E 4BH6A
chains in the Genus database with same CATH topology
2B4EA 3SCYA 2IURA 5FA5B 2P9LC 5JWZA 2OJYA 1K32A 2AH1A 4X60B 3U4YA 4OZUA 2IUQA 4BUJC 4A09A 3NVXA 2TRCB 4YVDA 2GNQA 5CYKA 2IAAA 3J81g 2OVPB 2HXCA 2BCJB 2BBKH 3MXXA 3JZNA 4CZYA 2GC7A 4CI2A 3RN1D 5GXHA 2HKMA 5IJ7E 5IGQA 2CNXA 2OK6A 2H9PA 4JSVC 3EI2A 2YNNA 4ZN4A 3IIWA 3B7FA 3GFCA 2AGWA 5HE2B 3E0CA 1N6DA 2YB8B 4A0AA 3L4OD 4J84A 5C2WB 2CN3A 4FA4D 4G56B 3PXSD 2H6QA 4XYIA 4A2LA 3IJCA 3AFCA 3ODTA 3MMYA 4L3GD 4FA5D 2CO0A 3EU7A 3JZGA 5K19A 1B9XA 4KFMB 4D0KA 5IT9g 2YBAA 4LG9A 5IGOA 1N6FA 4J0XA 4IMMA 2W18A 4LG8A 3F3FA 3EI3A 1SQJA 4NSXA 4X61B 4GM9A 4JXMA 4L1QD 2I0TA 2XL2A 4O9DA 5FKSA 2H14A 2IUPA 5TEEA 2P9NC 3N0DA 5B4WA 4R7AB 4CY2A 1GG2B 3SJLD 4QQEA 5FKQA 1R5MA 4FAND 4TZ4A 2G9AA 4GQBB 4JSPC 4J79A 3DSMA 3DWLC 2OVQB 1JJUB 4J73A 4PC0A 2I0RA 5CYKB 4J78A 4CZVA 3C9CA 3I7NA 5SXMA 2Z2OA 1MG3A 3AL9A 2OIZA 3RFHA 4CC9A 2OK4A 4EWRA 3OW8A 3I7OA 3V7DB 4JSNC 3HFQA 4OWRA 2IWFA 3PE7A 4A11A 2H3XA 3ORVD 4A0AB 2XL3A 1TYQC 4QT8A 2B5LA 4QRJA 3I7LA 5C9ZB 3F3PA 1OMWB 1JOFA 2YNPA 2HKRA 2GC4A 3SWSD 4J8GA 4BL0A 4PXWA 3N0EA 5CXBA 5HYNB 2AQ5A 4J77A 3F3GA 4A2MA 4A08A 5GSAA 3I7PA 3EI4A 3RMZD 3SXTD 1XKSA 5AJAA 5I5JA 3OKYA 3BG1A 4GQ2P 4L9OA 5FKRA 3PSLA 5EAPA 5H14A 3FGBA 1PI6A 2H9LA 3EI3B 5KDOB 5FQDA 3OKTA 4PSXB 3IIYA 4ERYA 2I3TA 3RFGA 5CXCA 5I5MA 4CY3A 4E54B 4A0BA 3JAMg 5TEFA 2HESX 3UKRC 4IA9A 1SHYB 3UVMA 3W15A 5EMLB 2CN2A 2XU7A 3IJ1A 2CO0C 1JMZB 4PBZA 4FA9D 2P9UC 1SQ9A 4U1EI 5GMKn 1B9YA 3OL2A 3KRWB 3UR4A 2Z2PA 3I8CA 2YNOA 3I7KA 4X63B 1GXRA 5EM2A 3DXKC 3OTTA 4E5ZA 4I79A 4ERQA 3AL8A 4O3UB 4JT5C 3JPXA 2QXVA 4PNKB 2B5MA 4Y5RD 3MZLA 4U7AA 1A0RB 4CY1A 5EMJB 4D6VA 4FHLA 3MZKA 3PVWB 2P9KC 3SBPA 5EMMB 1QNIA 4PSWB 3C5MA 2Q7QA 4J0WA 5AFU3 3C99A 3OKYB 4A09B 3DXMC 3JROA 4FB1D 3SBRA 5HE0B 3EG6A 2PM7B 3SVWD 5HE1B 2QC5A 5CXCB 2XYIA 3GREA 4GGDA 3MKSB 3V5WB 4XEIC 2HYEA 3SHFA 3NVQA 4K3JB 3UVOA 5C2VB 4CI3A 3EI2B 5A2Qg 3OKWA 5K1CC 3DM0A 2AGLA 5EMKB 3IKOA 1XIPA 5AMSA 3AH8B 4J87A 4Y7RA 4AEZA 1NR0A 4MK0B 4GGCA 1ERJA 2IWKA 4FA1D 1S4UX 3CFSB 4FWWA 5THAA 3J80g 3I89A 2AGXA 4LGNA 1PGUA 5EAMA 3UKUC 2MTAH 5EM2B 2EBSA 4XYHA 1JMXB 1PEVA 4E5ZB 3UVKA 3EMHA 2CE8A 3AL8B 3KRXB 4ESGA 1XHMA 3SBQA 1U2VC 5I5IA 3PXTD 1TBGA 3P4FA 2H68A 3C75H 4J8BA 1FWXA 1GOTB 2P9IC 2Z2NA 3I2NA 2H13A 2H47A 4A7JA 2H9NA 5FLXg 1RI6A 2I0SA 3BG0A 3A0FA 3K27A 4GM3A 3IJ0A 4N14A 5GXIA 1K8KC 3VA6A 3FRXA 4FAVD 3SFZA 3V9FA 4H5JA 2HJ4A 3K26A 4GM8A 1U4CA 4GGAA 1OLZA 1PBYB 4A11B 4L3HD 3UVNA 1MDAH 2PBIB 2G99A 4GQ1A 3SN6B 2J56H 1GP2B 4ZOYA 4ERZA 3RRMC 3SMRA 4GMBA 1MG2A 2J57G 4ZOVA 3EI1A 4HDJA 4H5IA 2B5NA 4JSXC 2PM9A 5TF2A 4ZOXA 3NVNA 4CI8A 1NEXB 2AGZA 3JRPA 5CXBB 3SLED 4PBYA 4A08B 3I7HA 4QL1A 2P9PC 5FKTA 5HE3B 3EI4B 5H1MA 3JZHA 3ZWLB 3PVUB 1P22A 3CIKB 5HQGA 4AOWA 5EALA 2CE9A 2P9SC 4ZOZA 1L0QA 2UZXB 4GZ8A 3VGZA 4Z8LA 3ULEC 5EARA 2UZYB 3MKQA 4E54A 4JD2C 4A0BB 4CY5A 2J55H 2H9MA 4ES0A 4CI1A 4CZXA 4J82A 4X3EA 4K3ID 4O45A 2HJBA 4J81A 4O1QD 2I3SA 4O3TB 2IUVA 3FM0A 1N6EA 2PM6B 3RN0D 4J86A 4UI9R 5H17A 5IC7A 3OL2B 3VH0A 2YMUA 5FXYA 3RSEC 4JT6C 3UVLA 5TDHB 1Q47A 3PSCB 1YFQA 3I8EA 3BWSA 3EWEA 2H6NA 3PXWD 2OVRB 2AGYA 3L4MD 3CFVA 1VYHC 3EI1B 3JB9L 2AH0A 2O9KA 2PM9B 2H6KA 3RLMD 5IJ8E 4BH6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B4E A;  3SCY A;  2IUR A;  5FA5 B;  2P9L C;  5JWZ A;  2OJY A;  1K32 A;  2AH1 A;  4X60 B;  3U4Y A;  4OZU A;  2IUQ A;  4BUJ C;  4A09 A;  3NVX A;  2TRC B;  4YVD A;  2GNQ A;  5CYK A;  2IAA A;  3J81 g;  2OVP B;  2HXC A;  2BCJ B;  2BBK H;  3MXX A;  3JZN A;  4CZY A;  2GC7 A;  4CI2 A;  3RN1 D;  5GXH A;  2HKM A;  5IJ7 E;  5IGQ A;  2CNX A;  2OK6 A;  2H9P A;  4JSV C;  3EI2 A;  2YNN A;  4ZN4 A;  3IIW A;  3B7F A;  3GFC A;  2AGW A;  5HE2 B;  3E0C A;  1N6D A;  2YB8 B;  4A0A A;  3L4O D;  4J84 A;  5C2W B;  2CN3 A;  4FA4 D;  4G56 B;  3PXS D;  2H6Q A;  4XYI A;  4A2L A;  3IJC A;  3AFC A;  3ODT A;  3MMY A;  4L3G D;  4FA5 D;  2CO0 A;  3EU7 A;  3JZG A;  5K19 A;  1B9X A;  4KFM B;  4D0K A;  5IT9 g;  2YBA A;  4LG9 A;  5IGO A;  1N6F A;  4J0X A;  4IMM A;  2W18 A;  4LG8 A;  3F3F A;  3EI3 A;  1SQJ A;  4NSX A;  4X61 B;  4GM9 A;  4JXM A;  4L1Q D;  2I0T A;  2XL2 A;  4O9D A;  5FKS A;  2H14 A;  2IUP A;  5TEE A;  2P9N C;  3N0D A;  5B4W A;  4R7A B;  4CY2 A;  1GG2 B;  3SJL D;  4QQE A;  5FKQ A;  1R5M A;  4FAN D;  4TZ4 A;  2G9A A;  4GQB B;  4JSP C;  4J79 A;  3DSM A;  3DWL C;  2OVQ B;  1JJU B;  4J73 A;  4PC0 A;  2I0R A;  5CYK B;  4J78 A;  4CZV A;  3C9C A;  3I7N A;  5SXM A;  2Z2O A;  1MG3 A;  3AL9 A;  2OIZ A;  3RFH A;  4CC9 A;  2OK4 A;  4EWR A;  3OW8 A;  3I7O A;  3V7D B;  4JSN C;  3HFQ A;  4OWR A;  2IWF A;  3PE7 A;  4A11 A;  2H3X A;  3ORV D;  4A0A B;  2XL3 A;  1TYQ C;  4QT8 A;  2B5L A;  4QRJ A;  3I7L A;  5C9Z B;  3F3P A;  1OMW B;  1JOF A;  2YNP A;  2HKR A;  2GC4 A;  3SWS D;  4J8G A;  4BL0 A;  4PXW A;  3N0E A;  5CXB A;  5HYN B;  2AQ5 A;  4J77 A;  3F3G A;  4A2M A;  4A08 A;  5GSA A;  3I7P A;  3EI4 A;  3RMZ D;  3SXT D;  1XKS A;  5AJA A;  5I5J A;  3OKY A;  3BG1 A;  4GQ2 P;  4L9O A;  5FKR A;  3PSL A;  5EAP A;  5H14 A;  3FGB A;  1PI6 A;  2H9L A;  3EI3 B;  5KDO B;  5FQD A;  3OKT A;  4PSX B;  3IIY A;  4ERY A;  2I3T A;  3RFG A;  5CXC A;  5I5M A;  4CY3 A;  4E54 B;  4A0B A;  3JAM g;  5TEF A;  2HES X;  3UKR C;  4IA9 A;  1SHY B;  3UVM A;  3W15 A;  5EML B;  2CN2 A;  2XU7 A;  3IJ1 A;  2CO0 C;  1JMZ B;  4PBZ A;  4FA9 D;  2P9U C;  1SQ9 A;  4U1E I;  5GMK n;  1B9Y A;  3OL2 A;  3KRW B;  3UR4 A;  2Z2P A;  3I8C A;  2YNO A;  3I7K A;  4X63 B;  1GXR A;  5EM2 A;  3DXK C;  3OTT A;  4E5Z A;  4I79 A;  4ERQ A;  3AL8 A;  4O3U B;  4JT5 C;  3JPX A;  2QXV A;  4PNK B;  2B5M A;  4Y5R D;  3MZL A;  4U7A A;  1A0R B;  4CY1 A;  5EMJ B;  4D6V A;  4FHL A;  3MZK A;  3PVW B;  2P9K C;  3SBP A;  5EMM B;  1QNI A;  4PSW B;  3C5M A;  2Q7Q A;  4J0W A;  5AFU 3;  3C99 A;  3OKY B;  4A09 B;  3DXM C;  3JRO A;  4FB1 D;  3SBR A;  5HE0 B;  3EG6 A;  2PM7 B;  3SVW D;  5HE1 B;  2QC5 A;  5CXC B;  2XYI A;  3GRE A;  4GGD A;  3MKS B;  3V5W B;  4XEI C;  2HYE A;  3SHF A;  3NVQ A;  4K3J B;  3UVO A;  5C2V B;  4CI3 A;  3EI2 B;  5A2Q g;  3OKW A;  5K1C C;  3DM0 A;  2AGL A;  5EMK B;  3IKO A;  1XIP A;  5AMS A;  3AH8 B;  4J87 A;  4Y7R A;  4AEZ A;  1NR0 A;  4MK0 B;  4GGC A;  1ERJ A;  2IWK A;  4FA1 D;  1S4U X;  3CFS B;  4FWW A;  5THA A;  3J80 g;  3I89 A;  2AGX A;  4LGN A;  1PGU A;  5EAM A;  3UKU C;  2MTA H;  5EM2 B;  2EBS A;  4XYH A;  1JMX B;  1PEV A;  4E5Z B;  3UVK A;  3EMH A;  2CE8 A;  3AL8 B;  3KRX B;  4ESG A;  1XHM A;  3SBQ A;  1U2V C;  5I5I A;  3PXT D;  1TBG A;  3P4F A;  2H68 A;  3C75 H;  4J8B A;  1FWX A;  1GOT B;  2P9I C;  2Z2N A;  3I2N A;  2H13 A;  2H47 A;  4A7J A;  2H9N A;  5FLX g;  1RI6 A;  2I0S A;  3BG0 A;  3A0F A;  3K27 A;  4GM3 A;  3IJ0 A;  4N14 A;  5GXI A;  1K8K C;  3VA6 A;  3FRX A;  4FAV D;  3SFZ A;  3V9F A;  4H5J A;  2HJ4 A;  3K26 A;  4GM8 A;  1U4C A;  4GGA A;  1OLZ A;  1PBY B;  4A11 B;  4L3H D;  3UVN A;  1MDA H;  2PBI B;  2G99 A;  4GQ1 A;  3SN6 B;  2J56 H;  1GP2 B;  4ZOY A;  4ERZ A;  3RRM C;  3SMR A;  4GMB A;  1MG2 A;  2J57 G;  4ZOV A;  3EI1 A;  4HDJ A;  4H5I A;  2B5N A;  4JSX C;  2PM9 A;  5TF2 A;  4ZOX A;  3NVN A;  4CI8 A;  1NEX B;  2AGZ A;  3JRP A;  5CXB B;  3SLE D;  4PBY A;  4A08 B;  3I7H A;  4QL1 A;  2P9P C;  5FKT A;  5HE3 B;  3EI4 B;  5H1M A;  3JZH A;  3ZWL B;  3PVU B;  1P22 A;  3CIK B;  5HQG A;  4AOW A;  5EAL A;  2CE9 A;  2P9S C;  4ZOZ A;  1L0Q A;  2UZX B;  4GZ8 A;  3VGZ A;  4Z8L A;  3ULE C;  5EAR A;  2UZY B;  3MKQ A;  4E54 A;  4JD2 C;  4A0B B;  4CY5 A;  2J55 H;  2H9M A;  4ES0 A;  4CI1 A;  4CZX A;  4J82 A;  4X3E A;  4K3I D;  4O45 A;  2HJB A;  4J81 A;  4O1Q D;  2I3S A;  4O3T B;  2IUV A;  3FM0 A;  1N6E A;  2PM6 B;  3RN0 D;  4J86 A;  4UI9 R;  5H17 A;  5IC7 A;  3OL2 B;  3VH0 A;  2YMU A;  5FXY A;  3RSE C;  4JT6 C;  3UVL A;  5TDH B;  1Q47 A;  3PSC B;  1YFQ A;  3I8E A;  3BWS A;  3EWE A;  2H6N A;  3PXW D;  2OVR B;  2AGY A;  3L4M D;  3CFV A;  1VYH C;  3EI1 B;  3JB9 L;  2AH0 A;  2O9K A;  2PM9 B;  2H6K A;  3RLM D;  5IJ8 E;  4BH6 A; 
#chains in the Genus database with same CATH topology
 2B4E A;  3EQ7 A;  3SCY A;  2IUR A;  1T2X A;  5FA5 B;  5E6R A;  2P9L C;  5JWZ A;  5E6S A;  3DDU A;  4D9S A;  2OJY A;  1K32 A;  2AH1 A;  4X60 B;  2VDQ A;  3U4Y A;  1GOF A;  4OZU A;  2IUQ A;  4BUJ C;  4A09 A;  3NVX A;  2TRC B;  4YVD A;  3ZE1 A;  3K6S A;  2GNQ A;  4BP8 A;  1I2M B;  5CYK A;  2IAA A;  3J81 g;  2OVP B;  2HXC A;  2BCJ B;  2BBK H;  3MXX A;  3JZN A;  4CZY A;  2GC7 A;  4CI2 A;  3RN1 D;  5GXH A;  2HKM A;  5IJ7 E;  5IGQ A;  1O6G A;  2CNX A;  2OK6 A;  2H9P A;  4JSV C;  3EI2 A;  2YNN A;  4ZN4 A;  3IIW A;  3B7F A;  4JHP C;  3GFC A;  2AGW A;  5HE2 B;  3E0C A;  1N6D A;  2YB8 B;  3QHY B;  5FFG A;  4A0A A;  1E8N A;  3L4O D;  4J84 A;  5C2W B;  4Z7O A;  5M5S A;  2CN3 A;  4FA4 D;  4G56 B;  4AN1 A;  2HU8 A;  3PXS D;  2H6Q A;  4XYI A;  4A2L A;  3IJC A;  3AFC A;  3ODT A;  4NEN A;  3MMY A;  4L3G D;  4FA5 D;  2CO0 A;  3EU7 A;  2EID A;  2VC2 A;  3JZG A;  5K19 A;  1B9X A;  4KFM B;  1VZ2 A;  4D0K A;  5IT9 g;  3K72 A;  2YBA A;  4LG9 A;  5IGO A;  1N6F A;  4J0X A;  4IMM A;  5M5V A;  3O4J A;  2W18 A;  4LG8 A;  3F3F A;  3EI3 A;  1SQJ A;  4NSX A;  4X61 B;  4GM9 A;  4JXM A;  4L1Q D;  3NID A;  2I0T A;  2XL2 A;  4O9D A;  5FKS A;  2H14 A;  2IUP A;  5TEE A;  2P9N C;  3N0D A;  5B4W A;  4R7A B;  4CY2 A;  1GG2 B;  3SJL D;  4QQE A;  5FKQ A;  1R5M A;  4FAN D;  4RE5 A;  4AMZ A;  4TZ4 A;  2G9A A;  4GQB B;  4JSP C;  4J79 A;  3DSM A;  3DWL C;  4WJK A;  1VZ3 A;  2OVQ B;  1JJU B;  4J73 A;  4PC0 A;  2I0R A;  5CYK B;  4J78 A;  4CZV A;  3C9C A;  3I7N A;  5SXM A;  2Z2O A;  1MG3 A;  3AL9 A;  2OIZ A;  3RFH A;  4CC9 A;  2OK4 A;  4EWR A;  3OW8 A;  3I7O A;  3V7D B;  2BKL A;  4JSN C;  4UM8 A;  3HFQ A;  4OWR A;  2IWF A;  3PE7 A;  4A11 A;  2H3X A;  3ORV D;  4A0A B;  2XL3 A;  3O4G A;  1TYQ C;  4QT8 A;  2B5L A;  3IJE A;  4QRJ A;  3I7L A;  5C9Z B;  3F3P A;  4IRZ A;  1OMW B;  1JOF A;  3V4P A;  2YNP A;  4Z7Q A;  2HKR A;  2GC4 A;  3SWS D;  4J8G A;  4BL0 A;  4PXW A;  3N0E A;  3ZDZ A;  5CXB A;  5HYN B;  2AQ5 A;  4J77 A;  3ZE2 A;  3F3G A;  4A2M A;  4A08 A;  5GSA A;  3I7P A;  3EI4 A;  3RMZ D;  3SXT D;  1XKS A;  3O4I A;  5AJA A;  5I5J A;  3OKY A;  1TYE A;  3BG1 A;  3MUO A;  4GQ2 P;  4L9O A;  5FKR A;  3PSL A;  5EAP A;  5H14 A;  3FGB A;  1PI6 A;  2H9L A;  3EI3 B;  5KDO B;  5FQD A;  1U8C A;  3OKT A;  3IIY A;  4PSX B;  4ERY A;  4BP9 A;  4AX4 A;  2I3T A;  3RFG A;  1H2Z A;  2HU5 A;  5CXC A;  5I5M A;  4CY3 A;  4E54 B;  4A0B A;  3JAM g;  5TEF A;  2HES X;  3UKR C;  4IA9 A;  4UM9 A;  3ZE0 A;  1K3I A;  1SHY B;  1H2Y A;  3MUN A;  3UVM A;  3ZDY A;  2QR5 A;  3KCI A;  3W15 A;  5EML B;  2CN2 A;  2XU7 A;  3IJ1 A;  2CO0 C;  1JMZ B;  4PBZ A;  4FA9 D;  2P9U C;  1SQ9 A;  4U1E I;  5GMK n;  1B9Y A;  3ZDX A;  3OL2 A;  3KRW B;  3UR4 A;  1E8M A;  3IUN A;  2Z2P A;  3I8C A;  4JHN A;  3EQ9 A;  2YNO A;  3I7K A;  4X63 B;  1GXR A;  1C9I A;  2VZ1 A;  5EM2 A;  3DXK C;  5M61 A;  4MMX A;  3OTT A;  4E5Z A;  4I79 A;  1E5T A;  3IUJ A;  4ERQ A;  3AL8 A;  4JT5 C;  4O3U B;  3JPX A;  1YR2 A;  2QXV A;  5M5R A;  4PNK B;  2B5M A;  2HU7 A;  4Y5R D;  3MZL A;  4U7A A;  1A0R B;  4BCC A;  4CY1 A;  5EMJ B;  4D6V A;  4FHL A;  3MZK A;  3PVW B;  1VE6 A;  2P9K C;  3SBP A;  5EMM B;  3IUR A;  4NC4 A;  1QNI A;  4O02 A;  1GOH A;  4PSW B;  4DNW A;  3C5M A;  1JTD B;  2Q7Q A;  4J0W A;  5AFU 3;  3C99 A;  3OKY B;  4A09 B;  4AN0 A;  3DXM C;  4NBM A;  3JRO A;  5FFO A;  4FB1 D;  3SBR A;  3OF7 A;  5HE0 B;  3EG6 A;  2PM7 B;  3SVW D;  5HE1 B;  2QC5 A;  5CXC B;  2XYI A;  3GRE A;  4GGD A;  3MKS B;  3V5W B;  4XEI C;  1A12 A;  2HYE A;  4MMZ A;  3SHF A;  3NVQ A;  4K3J B;  3UVO A;  2XZG A;  5C2V B;  4CI3 A;  3EI2 B;  5A2Q g;  3OKW A;  5K1C C;  2VDK A;  3DM0 A;  2AGL A;  5EMK B;  3IKO A;  1XIP A;  5AMS A;  3AH8 B;  4J87 A;  4Y7R A;  4AEZ A;  1NR0 A;  3VI3 A;  4MK0 B;  4GGC A;  1ERJ A;  2IWK A;  2VDO A;  4FA1 D;  2XDW A;  1S4U X;  3CFS B;  4FWW A;  5THA A;  3J80 g;  3I89 A;  2AGX A;  4LGN A;  1PGU A;  5EAM A;  3UKU C;  2MTA H;  2EIB A;  5EM2 B;  2EBS A;  4XYH A;  1JMX B;  1PEV A;  4E5Z B;  3UVK A;  3EMH A;  2CE8 A;  3AL8 B;  3KRX B;  4ESG A;  1XHM A;  3V4V A;  3SBQ A;  1M1X A;  1U2V C;  5I5I A;  3PXT D;  1TBG A;  3P4F A;  4NAA A;  2H68 A;  3C75 H;  4J8B A;  1FWX A;  1GOT B;  2P9I C;  2Z2N A;  4AMY A;  3I2N A;  2H13 A;  4BCB A;  3VI4 A;  2VDP A;  3FCU A;  4L1M A;  1UTC A;  2H47 A;  4Z7N A;  2VZ3 A;  4A7J A;  2H9N A;  5FLX g;  1RI6 A;  2EIE A;  1BPO A;  2I0S A;  3BG0 A;  3A0F A;  3K27 A;  4GM3 A;  3IJ0 A;  4N14 A;  5GXI A;  4DNV A;  1K8K C;  5M5U A;  3VA6 A;  3FRX A;  4FAV D;  3SFZ A;  3V9F A;  4H5J A;  2HJ4 A;  3K26 A;  1JV2 A;  5HDB A;  3IUL A;  4GM8 A;  1U4C A;  4GGA A;  1OLZ A;  1PBY B;  2VDN A;  4A11 B;  4L3H D;  3UVN A;  4BCD A;  2JKX A;  1MDA H;  2PBI B;  2G99 A;  4GQ1 A;  3SN6 B;  2J56 H;  1GP2 B;  4G55 A;  4ZOY A;  4ERZ A;  3RRM C;  3SMR A;  4GMB A;  4O2W A;  1MG2 A;  2J57 G;  4ZOV A;  2EIC A;  5C86 A;  3EI1 A;  1C9L A;  4HDJ A;  4H5I A;  2B5N A;  4QAM A;  4JSX C;  2PM9 A;  3K71 A;  5TF2 A;  4ZOX A;  3NVN A;  4CI8 A;  1NEX B;  2AGZ A;  3JRP A;  4WK0 A;  5CXB B;  3SLE D;  4PBY A;  4A08 B;  3IVM A;  3I7H A;  4QL1 A;  2P9P C;  5FKT A;  2XE4 A;  5HE3 B;  3EI4 B;  2QZP A;  5H1M A;  3JZH A;  4WK2 A;  3ZWL B;  3PVU B;  1P22 A;  3CIK B;  5HQG A;  4AOW A;  5EAL A;  2CE9 A;  1QFM A;  2P9S C;  4ZOZ A;  1L0Q A;  2UZX B;  3QI0 A;  4GZ8 A;  3NIG A;  3VGZ A;  4Z8L A;  2VDL A;  3GD1 I;  3ULE C;  5EAR A;  1VE7 A;  2UZY B;  3MKQ A;  4JD2 C;  4E54 A;  4A0B B;  3T3P A;  4CY5 A;  3IUM A;  2J55 H;  1H2W A;  2H9M A;  4ES0 A;  3IUQ A;  4CI1 A;  5M5T A;  4CZX A;  4J82 A;  4X3E A;  4K3I D;  4O45 A;  2HJB A;  4J81 A;  4O1Q D;  1UOP A;  2I3S A;  4O3T B;  2IUV A;  3FM0 A;  1O6F A;  1N6E A;  2PM6 B;  3EQ8 A;  3RN0 D;  3MVD K;  4J86 A;  1UOQ A;  1L5G A;  4UI9 R;  5E6U A;  5H17 A;  5IC7 A;  3OL2 B;  3VH0 A;  2YMU A;  5FXY A;  4WK4 A;  3RSE C;  4JT6 C;  3UVL A;  5TDH B;  4MMY A;  3T3M A;  1GOG A;  1Q47 A;  3NIF A;  3PSC B;  1YFQ A;  1QFS A;  4DNU A;  3GC3 B;  3I8E A;  3BWS A;  3EWE A;  2H6N A;  3PXW D;  2OVR B;  1H2X A;  2AGY A;  3L4M D;  3CFV A;  1VYH C;  4RE6 A;  4G1M A;  3EI1 B;  3O4H A;  3FCS A;  3JB9 L;  2AH0 A;  2O9K A;  4G1E A;  1UOO A;  2PM9 B;  2H6K A;  2WQ8 A;  2VDR A;  2VDM A;  3RLM D;  5C92 A;  5IJ8 E;  4BH6 A; 
#chains in the Genus database with same CATH homology
 2B4E A;  3SCY A;  2IUR A;  5FA5 B;  2P9L C;  5JWZ A;  2OJY A;  1K32 A;  2AH1 A;  4X60 B;  3U4Y A;  4OZU A;  2IUQ A;  4BUJ C;  4A09 A;  3NVX A;  2TRC B;  4YVD A;  2GNQ A;  5CYK A;  2IAA A;  3J81 g;  2OVP B;  2HXC A;  2BCJ B;  2BBK H;  3MXX A;  3JZN A;  4CZY A;  2GC7 A;  4CI2 A;  3RN1 D;  5GXH A;  2HKM A;  5IJ7 E;  5IGQ A;  2CNX A;  2OK6 A;  2H9P A;  4JSV C;  3EI2 A;  2YNN A;  4ZN4 A;  3IIW A;  3B7F A;  3GFC A;  2AGW A;  5HE2 B;  3E0C A;  1N6D A;  2YB8 B;  4A0A A;  3L4O D;  4J84 A;  5C2W B;  2CN3 A;  4FA4 D;  4G56 B;  3PXS D;  2H6Q A;  4XYI A;  4A2L A;  3IJC A;  3AFC A;  3ODT A;  3MMY A;  4L3G D;  4FA5 D;  2CO0 A;  3EU7 A;  3JZG A;  5K19 A;  1B9X A;  4KFM B;  4D0K A;  5IT9 g;  2YBA A;  4LG9 A;  5IGO A;  1N6F A;  4J0X A;  4IMM A;  2W18 A;  4LG8 A;  3F3F A;  3EI3 A;  1SQJ A;  4NSX A;  4X61 B;  4GM9 A;  4JXM A;  4L1Q D;  2I0T A;  2XL2 A;  4O9D A;  5FKS A;  2H14 A;  2IUP A;  5TEE A;  2P9N C;  3N0D A;  5B4W A;  4R7A B;  4CY2 A;  1GG2 B;  3SJL D;  4QQE A;  5FKQ A;  1R5M A;  4FAN D;  4TZ4 A;  2G9A A;  4GQB B;  4JSP C;  4J79 A;  3DSM A;  3DWL C;  2OVQ B;  1JJU B;  4J73 A;  4PC0 A;  2I0R A;  5CYK B;  4J78 A;  4CZV A;  3C9C A;  3I7N A;  5SXM A;  2Z2O A;  1MG3 A;  3AL9 A;  2OIZ A;  3RFH A;  4CC9 A;  2OK4 A;  4EWR A;  3OW8 A;  3I7O A;  3V7D B;  4JSN C;  3HFQ A;  4OWR A;  2IWF A;  3PE7 A;  4A11 A;  2H3X A;  3ORV D;  4A0A B;  2XL3 A;  1TYQ C;  4QT8 A;  2B5L A;  4QRJ A;  3I7L A;  5C9Z B;  3F3P A;  1OMW B;  1JOF A;  2YNP A;  2HKR A;  2GC4 A;  3SWS D;  4J8G A;  4BL0 A;  4PXW A;  3N0E A;  5CXB A;  5HYN B;  2AQ5 A;  4J77 A;  3F3G A;  4A2M A;  4A08 A;  5GSA A;  3I7P A;  3EI4 A;  3RMZ D;  3SXT D;  1XKS A;  5AJA A;  5I5J A;  3OKY A;  3BG1 A;  4GQ2 P;  4L9O A;  5FKR A;  3PSL A;  5EAP A;  5H14 A;  3FGB A;  1PI6 A;  2H9L A;  3EI3 B;  5KDO B;  5FQD A;  3OKT A;  4PSX B;  3IIY A;  4ERY A;  2I3T A;  3RFG A;  5CXC A;  5I5M A;  4CY3 A;  4E54 B;  4A0B A;  3JAM g;  5TEF A;  2HES X;  3UKR C;  4IA9 A;  1SHY B;  3UVM A;  3W15 A;  5EML B;  2CN2 A;  2XU7 A;  3IJ1 A;  2CO0 C;  1JMZ B;  4PBZ A;  4FA9 D;  2P9U C;  1SQ9 A;  4U1E I;  5GMK n;  1B9Y A;  3OL2 A;  3KRW B;  3UR4 A;  2Z2P A;  3I8C A;  2YNO A;  3I7K A;  4X63 B;  1GXR A;  5EM2 A;  3DXK C;  3OTT A;  4E5Z A;  4I79 A;  4ERQ A;  3AL8 A;  4O3U B;  4JT5 C;  3JPX A;  2QXV A;  4PNK B;  2B5M A;  4Y5R D;  3MZL A;  4U7A A;  1A0R B;  4CY1 A;  5EMJ B;  4D6V A;  4FHL A;  3MZK A;  3PVW B;  2P9K C;  3SBP A;  5EMM B;  1QNI A;  4PSW B;  3C5M A;  2Q7Q A;  4J0W A;  5AFU 3;  3C99 A;  3OKY B;  4A09 B;  3DXM C;  3JRO A;  4FB1 D;  3SBR A;  5HE0 B;  3EG6 A;  2PM7 B;  3SVW D;  5HE1 B;  2QC5 A;  5CXC B;  2XYI A;  3GRE A;  4GGD A;  3MKS B;  3V5W B;  4XEI C;  2HYE A;  3SHF A;  3NVQ A;  4K3J B;  3UVO A;  5C2V B;  4CI3 A;  3EI2 B;  5A2Q g;  3OKW A;  5K1C C;  3DM0 A;  2AGL A;  5EMK B;  3IKO A;  1XIP A;  5AMS A;  3AH8 B;  4J87 A;  4Y7R A;  4AEZ A;  1NR0 A;  4MK0 B;  4GGC A;  1ERJ A;  2IWK A;  4FA1 D;  1S4U X;  3CFS B;  4FWW A;  5THA A;  3J80 g;  3I89 A;  2AGX A;  4LGN A;  1PGU A;  5EAM A;  3UKU C;  2MTA H;  5EM2 B;  2EBS A;  4XYH A;  1JMX B;  1PEV A;  4E5Z B;  3UVK A;  3EMH A;  2CE8 A;  3AL8 B;  3KRX B;  4ESG A;  1XHM A;  3SBQ A;  1U2V C;  5I5I A;  3PXT D;  1TBG A;  3P4F A;  2H68 A;  3C75 H;  4J8B A;  1FWX A;  1GOT B;  2P9I C;  2Z2N A;  3I2N A;  2H13 A;  2H47 A;  4A7J A;  2H9N A;  5FLX g;  1RI6 A;  2I0S A;  3BG0 A;  3A0F A;  3K27 A;  4GM3 A;  3IJ0 A;  4N14 A;  5GXI A;  1K8K C;  3VA6 A;  3FRX A;  4FAV D;  3SFZ A;  3V9F A;  4H5J A;  2HJ4 A;  3K26 A;  4GM8 A;  1U4C A;  4GGA A;  1OLZ A;  1PBY B;  4A11 B;  4L3H D;  3UVN A;  1MDA H;  2PBI B;  2G99 A;  4GQ1 A;  3SN6 B;  2J56 H;  1GP2 B;  4ZOY A;  4ERZ A;  3RRM C;  3SMR A;  4GMB A;  1MG2 A;  2J57 G;  4ZOV A;  3EI1 A;  4HDJ A;  4H5I A;  2B5N A;  4JSX C;  2PM9 A;  5TF2 A;  4ZOX A;  3NVN A;  4CI8 A;  1NEX B;  2AGZ A;  3JRP A;  5CXB B;  3SLE D;  4PBY A;  4A08 B;  3I7H A;  4QL1 A;  2P9P C;  5FKT A;  5HE3 B;  3EI4 B;  5H1M A;  3JZH A;  3ZWL B;  3PVU B;  1P22 A;  3CIK B;  5HQG A;  4AOW A;  5EAL A;  2CE9 A;  2P9S C;  4ZOZ A;  1L0Q A;  2UZX B;  4GZ8 A;  3VGZ A;  4Z8L A;  3ULE C;  5EAR A;  2UZY B;  3MKQ A;  4E54 A;  4JD2 C;  4A0B B;  4CY5 A;  2J55 H;  2H9M A;  4ES0 A;  4CI1 A;  4CZX A;  4J82 A;  4X3E A;  4K3I D;  4O45 A;  2HJB A;  4J81 A;  4O1Q D;  2I3S A;  4O3T B;  2IUV A;  3FM0 A;  1N6E A;  2PM6 B;  3RN0 D;  4J86 A;  4UI9 R;  5H17 A;  5IC7 A;  3OL2 B;  3VH0 A;  2YMU A;  5FXY A;  3RSE C;  4JT6 C;  3UVL A;  5TDH B;  1Q47 A;  3PSC B;  1YFQ A;  3I8E A;  3BWS A;  3EWE A;  2H6N A;  3PXW D;  2OVR B;  2AGY A;  3L4M D;  3CFV A;  1VYH C;  3EI1 B;  3JB9 L;  2AH0 A;  2O9K A;  2PM9 B;  2H6K A;  3RLM D;  5IJ8 E;  4BH6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...