3RRMC

S. cerevisiae dbp5 l327v bound to nup159, gle1 h337r, ip6 and adp
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
382
structure length
370
Chain Sequence
GASSLKDEVPTETSEDFGFKFLGQKQILPSFNEKLPFASLQNLDISNSKSLFVAASGSKAVVGELQLLRDHITSDSTPLTFKWEKEIPDVIFVCFHGDQVLVSTRNALYSLDLEELSEFRTVTSFEKPVFQLKNVNNTLVILNSVNDLSALDLRTKSTKQLAQNVTSFDVTNSQLAVLLKDRSFQSFAWRNGEMEKQFEFSLPSELEELPVEEYSPLSVTILSPQDFLAVFGNVISETDDEVSYDQKMYIIKHIDGSASFQETFDITPPFGQIVRFPYMYKVTLSGLIEPDANVNVLASSCSSEVSIWDSKQVIEPSQDSERAVLPISEETDKDTNPIGVAVDVVTSGTRLPLVYILNNEGSLQIVGLFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP6 in mRNA export.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords ATP-dependent RNA helicase DBP5
total genus 81
structure length 370
sequence length 382
ec nomenclature
pdb deposition date 2011-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF16755 NUP214 Nucleoporin or Nuclear pore complex subunit NUP214=Nup159
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3rrmC00
2IUVA 2I0SA 2PM7B 1S4UX 3EI1A 1OLZA 3CIKB 2CO0A 3SCYA 4J8BA 3I7OA 3OTTA 3ORVD 4OWRA 4GM3A 5H14A 3RSEC 3C99A 4E5ZB 5EMKB 3SJLD 4A09B 3MKSB 4A0AB 3L4OD 2O9KA 3OKTA 3UVNA 2H68A 1YFQA 3EMHA 3EI3A 4LG8A 3EI4B 5I5IA 2H3XA 4U7AA 4A11B 2HYEA 3PSCB 5JWZA 5FKSA 2CN2A 4LG9A 4J81A 3IIWA 5CYKA 5FA5B 4FA1D 3DWLC 4GMBA 2AGZA 2HKMA 5IJ8E 3I7HA 2P9LC 3VH0A 2H6KA 3N0DA 3ODTA 3EU7A 4ZOZA 2Z2NA 2H9LA 3EG6A 4PC0A 2H13A 3J81g 1GG2B 5EAMA 4QRJA 4QL1A 3SFZA 3U4YA 4J77A 3DXMC 4PSXB 3BG1A 5TEEA 4D6VA 2QXVA 5THAA 4XYIA 5GXIA 5FKTA 2GC4A 3PE7A 5EAPA 4GQ2P 2J56H 2H9PA 2BBKH 1XHMA 1A0RB 1XIPA 4IMMA 4K3ID 3K27A 3RFGA 4J82A 4O45A 4AEZA 5K1CC 4EWRA 3AL9A 3N0EA 3SVWD 4J87A 4CI8A 5FLXg 2P9UC 5CXBA 4A7JA 2W18A 2Z2OA 1GXRA 4L9OA 4JSPC 5H1MA 3NVQA 3V5WB 4Y5RD 5HE3B 4UI9R 3RFHA 3F3GA 1U4CA 2I0TA 4O3TB 2CNXA 1MG3A 4ERQA 4CI1A 4BH6A 4N14A 4JSVC 4OZUA 2J57G 2UZYB 2OK6A 3AH8B 4GGDA 4BUJC 3IJCA 4D0KA 5IC7A 3JZGA 2EBSA 2IWFA 2G9AA 4O9DA 4E54B 2YNNA 5AJAA 4J86A 1MDAH 1K8KC 4GM9A 4FA9D 3OKYB 4E5ZA 2IWKA 3IKOA 4AOWA 3JAMg 4FAND 3IIYA 3E0CA 3I7LA 5IGQA 3F3FA 4YVDA 1TBGA 3V7DB 5GMKn 4A0BA 4A09A 5B4WA 1PI6A 2PM9B 4CZYA 3RN0D 1ERJA 4E54A 3JRPA 2PBIB 4QT8A 3V9FA 1B9YA 4KFMB 3PXTD 3RMZD 2P9PC 4CY5A 2P9KC 4IA9A 2IUPA 3EI2A 4A0BB 4JT5C 2XYIA 2IAAA 4FA5D 2IUQA 3FGBA 5TEFA 1MG2A 4GZ8A 2H6QA 5EARA 4GGCA 5EALA 3ZWLB 1JOFA 3SXTD 2GNQA 1K32A 4R7AB 2H6NA 4PBZA 5EMMB 4ERYA 3BG0A 4FB1D 2P9SC 2UZXB 2Q7QA 3EI1B 4A08B 3UVLA 4LGNA 2OIZA 1NEXB 1TYQC 3NVNA 4J79A 4XYHA 5FQDA 2P9NC 2XL3A 1JJUB 3PVUB 1N6EA 5HYNB 3AL8A 3I7PA 2TRCB 4CY3A 3EI3B 4PNKB 4J8GA 2I0RA 2YB8B 3IJ1A 2AGLA 3CFSB 4NSXA 3K26A 5KDOB 3EI4A 4O1QD 2BCJB 4J78A 5IGOA 5I5MA 5A2Qg 4GGAA 4BL0A 3GREA 5EM2B 4GQBB 4XEIC 4J84A 3ULEC 5IT9g 3OL2A 4J0WA 2IURA 2CO0C 3RN1D 1P22A 4ERZA 1PEVA 1U2VC 1OMWB 3C75H 3SHFA 3UKRC 1GP2B 4A2MA 3VGZA 5HQGA 3PSLA 2HJBA 5TF2A 2HKRA 5C2VB 3EWEA 2B5MA 4L3GD 4X63B 4JT6C 3FRXA 2I3SA 4PSWB 3SWSD 4L3HD 4X3EA 3OL2B 4A11A 3JB9L 4J73A 5K19A 5EMLB 2CN3A 3F3PA 2OVQB 2H14A 3KRWB 4J0XA 3W15A 3UVOA 5TDHB 2MTAH 3OKYA 3UVKA 2CE8A 3MKQA 3MXXA 3DSMA 4H5JA 2XU7A 1NR0A 2G99A 4L1QD 4CC9A 4O3UB 4JSXC 1XKSA 3OKWA 3UKUC 4X61B 5IJ7E 2AGYA 2AGWA 3KRXB 3UVMA 4FAVD 2H47A 4ZOVA 2YBAA 2AQ5A 1SQ9A 5CXCB 5EM2A 1R5MA 2AH0A 3CFVA 1VYHC 4A0AA 2H9MA 3MMYA 3I8EA 4H5IA 5CXBB 4TZ4A 3PXWD 4K3JB 3DM0A 3C5MA 2B5NA 4ZOXA 3VA6A 3UR4A 2CE9A 5FXYA 3RRMC 4Y7RA 2B4EA 4CI2A 5H17A 2GC7A 3HFQA 4A08A 4G56B 3I7KA 5I5JA 1RI6A 5FKQA 3I7NA 4CI3A 1QNIA 5C9ZB 5HE2B 5GSAA 1Q47A 4CZVA 3C9CA 4X60B 3SBRA 4ZOYA 2QC5A 2YNPA 4FA4D 2B5LA 1N6FA 2OVPB 4I79A 2I3TA 4GM8A 3PVWB 4GQ1A 2OJYA 3A0FA 3PXSD 4ES0A 4ZN4A 5AFU3 5CYKB 5EMJB 3P4FA 2PM6B 1JMZB 3SN6B 3JPXA 2J55H 5FKRA 2HESX 4CY1A 4A2LA 4Z8LA 3SLED 4CZXA 4QQEA 4U1EI 3JZNA 5HE0B 3DXKC 3NVXA 2OK4A 4PXWA 1PGUA 2AH1A 3I8CA 5GXHA 3SBPA 3J80g 1GOTB 2H9NA 1N6DA 3FM0A 3SMRA 1L0QA 3EI2B 3I89A 2Z2PA 3MZKA 2PM9A 5AMSA 3OW8A 1PBYB 4JD2C 1FWXA 1JMXB 3AL8B 1SHYB 3L4MD 4MK0B 3JROA 4JXMA 4ESGA 3B7FA 3AFCA 3SBQA 5SXMA 4FHLA 3MZLA 1SQJA 3I2NA 4CY2A 3BWSA 3IJ0A 5C2WB 2HJ4A 3RLMD 1B9XA 4HDJA 4PBYA 2YMUA 2HXCA 2P9IC 3JZHA 2YNOA 2AGXA 4JSNC 2OVRB 5HE1B 2XL2A 3GFCA 5CXCA 4FWWA
chains in the Genus database with same CATH superfamily
2IUVA 2I0SA 2PM7B 3QHYB 4NAAA 1S4UX 3IUJA 4UM9A 3EI1A 1OLZA 3CIKB 2CO0A 4WK4A 2VDKA 3SCYA 4J8BA 3I7OA 5M5TA 3OTTA 3ORVD 4OWRA 4GM3A 5H14A 3RSEC 3C99A 1L5GA 4E5ZB 5EMKB 3SJLD 3EQ9A 4A09B 3MKSB 4A0AB 3L4OD 1K3IA 2O9KA 1H2ZA 2BKLA 2H68A 1YFQA 3EMHA 3EI3A 3IJEA 3EI4B 3OKTA 2H3XA 4LG8A 4U7AA 3IURA 4A11B 2HYEA 5HDBA 3PSCB 5JWZA 5FKSA 2CN2A 2JKXA 4LG9A 4J81A 3IIWA 5CYKA 5FA5B 4FA1D 3DWLC 4GMBA 2AGZA 2HKMA 3FCSA 4G1EA 5IJ8E 3I7HA 2P9LC 4AN1A 2H6KA 3N0DA 3ODTA 3VH0A 3IUNA 3EU7A 1UTCA 4ZOZA 2Z2NA 2H9LA 3EG6A 4PC0A 2H13A 3J81g 1GG2B 5EAMA 3NIGA 2HU8A 3ZE1A 4QRJA 4QL1A 3SFZA 3U4YA 4J77A 3DXMC 4PSXB 4MMXA 3BG1A 5TEEA 3ZDYA 4D6VA 2QXVA 5THAA 4XYIA 5GXIA 5FKTA 2GC4A 3PE7A 2EICA 4BCCA 5EAPA 3ZE0A 3O4JA 4GQ2P 2J56H 2H9PA 2BBKH 3GD1I 1XHMA 1A0RB 1XIPA 4IMMA 4K3ID 3K27A 3RFGA 4J82A 4O45A 4AEZA 5K1CC 4EWRA 3AL9A 3N0EA 3SVWD 3DDUA 4J87A 4CI8A 5FLXg 5M5SA 2P9UC 5CXBA 3FCUA 4A7JA 2W18A 2Z2OA 1GXRA 4L9OA 3VI3A 4JSPC 5H1MA 1UOQA 3NVQA 2VZ1A 4Y5RD 2WQ8A 3V5WB 4DNWA 5HE3B 4UI9R 4NC4A 2VDLA 3RFHA 3F3GA 1U4CA 2I0TA 4O3TB 1H2YA 2CNXA 1MG3A 4ERQA 4CI1A 4BH6A 4N14A 4JSVC 4OZUA 2J57G 5E6UA 2UZYB 2OK6A 3AH8B 4GGDA 4BUJC 3IJCA 2VDQA 4D0KA 1VE6A 5IC7A 3JZGA 3ZE2A 4DNUA 2QR5A 2EBSA 2IWFA 2EIBA 2G9AA 4O9DA 4E54B 3O4HA 2YNNA 5AJAA 4J86A 4L1MA 1MDAH 1T2XA 2VDOA 1K8KC 4GM9A 4FA9D 3O4GA 3OKYB 4E5ZA 2IWKA 3IKOA 4AOWA 4AX4A 3JAMg 4FAND 5C86A 3IIYA 3E0CA 3I7LA 4D9SA 5IGQA 4WK2A 3F3FA 4YVDA 1TBGA 3V7DB 5GMKn 4A0BA 4A09A 5B4WA 1PI6A 2PM9B 4CZYA 3RN0D 4RE5A 1ERJA 4E54A 3JRPA 2PBIB 2VDPA 4QT8A 1B9YA 3V9FA 4KFMB 3PXTD 3RMZD 3IVMA 2P9PC 4CY5A 2P9KC 4NBMA 4IA9A 4RE6A 2IUPA 2EIDA 1H2WA 3EI2A 4A0BB 4JT5C 1C9LA 2XYIA 2IAAA 4FA5D 1TYEA 2IUQA 3FGBA 3V4PA 1M1XA 5TEFA 1MG2A 4GZ8A 3K71A 5FFOA 1E5TA 2H6QA 5EARA 4GGCA 1C9IA 5EALA 3ZWLB 1JOFA 3SXTD 2HU7A 2GNQA 1K32A 4R7AB 2H6NA 4PBZA 5EMMB 4ERYA 3BG0A 4G55A 4FB1D 2P9SC 3IULA 3IUMA 2UZXB 2Q7QA 3EI1B 4A08B 3KCIA 3UVLA 4LGNA 4AMZA 2OIZA 4IRZA 1UOPA 4O02A 1NEXB 1TYQC 3NVNA 4J79A 4XYHA 5FQDA 2P9NC 2XL3A 3NIFA 4G1MA 1JJUB 4AN0A 3PVUB 1N6EA 5HYNB 3AL8A 3I7PA 2TRCB 4CY3A 3EI3B 4PNKB 4J8GA 2I0RA 2YB8B 3ZDZA 3IJ1A 2AGLA 3CFSB 4MMZA 4NSXA 3K26A 5KDOB 3EI4A 4O1QD 2BCJB 4J78A 5IGOA 5I5MA 4BCDA 5M5VA 5A2Qg 4GGAA 4BL0A 3GREA 5EM2B 4GQBB 3UVNA 4XEIC 4J84A 3ULEC 5IT9g 3OL2A 4J0WA 3V4VA 2IURA 4BCBA 1I2MB 2CO0C 1O6FA 3RN1D 1P22A 4ERZA 1PEVA 1U2VC 1OMWB 3C75H 3MUNA 2XDWA 3SHFA 3UKRC 1GP2B 4A2MA 3VGZA 4BP8A 5C92A 1E8MA 5HQGA 3PSLA 2HJBA 3VI4A 1JV2A 2HKRA 5TF2A 5C2VB 3EWEA 2B5MA 3IUQA 4L3GD 4X63B 5E6RA 5M5RA 4JT6C 3FRXA 2I3SA 4PSWB 3SWSD 4L3HD 4X3EA 3OL2B 1H2XA 4A11A 3JB9L 4J73A 5K19A 5EMLB 2CN3A 3F3PA 2OVQB 2H14A 4O2WA 3KRWB 2VDRA 4J0XA 3W15A 4UM8A 3UVOA 5TDHB 2MTAH 3OKYA 3UVKA 2CE8A 3MKQA 3MXXA 3DSMA 4H5JA 3T3PA 4Z7NA 1VZ2A 2VDMA 1NR0A 2XU7A 2G99A 4L1QD 1YR2A 4CC9A 4O3UB 4Z7QA 1VZ3A 4JSXC 1XKSA 1UOOA 2VDNA 3OKWA 3UKUC 4X61B 1QFMA 5IJ7E 2AGYA 2AGWA 3MUOA 3KRXB 3UVMA 4FAVD 5M61A 2H47A 3EQ8A 4ZOVA 2YBAA 2AQ5A 1SQ9A 5CXCB 5FFGA 3GC3B 5EM2A 1R5MA 2AH0A 3CFVA 1VYHC 4A0AA 1QFSA 2H9MA 3MMYA 4JHPC 3I8EA 1U8CA 4H5IA 4WJKA 5CXBB 4WK0A 1VE7A 4TZ4A 2EIEA 3PXWD 3DM0A 4K3JB 3C5MA 4NENA 2B5NA 4ZOXA 3VA6A 3UR4A 2CE9A 2XE4A 5FXYA 3RRMC 4Y7RA 2B4EA 4CI2A 5H17A 2GC7A 3HFQA 4A08A 4G56B 3I7KA 5I5JA 1RI6A 3OF7A 5FKQA 3I7NA 4CI3A 1QNIA 5C9ZB 5HE2B 5GSAA 1Q47A 4CZVA 3C9CA 4X60B 3SBRA 4ZOYA 2QC5A 1BPOA 2YNPA 5E6SA 4FA4D 4QAMA 3T3MA 2B5LA 5M5UA 1N6FA 2OVPB 4I79A 2I3TA 4GM8A 3PVWB 4GQ1A 2OJYA 3A0FA 3PXSD 4ES0A 1O6GA 4AMYA 1A12A 4ZN4A 5I5IA 3QI0A 5AFU3 1JTDB 5CYKB 5EMJB 3P4FA 2VZ3A 2XZGA 4BP9A 2PM6B 1JMZB 3SN6B 3JPXA 3O4IA 1GOFA 2J55H 5FKRA 2HESX 3K72A 4CY1A 4A2LA 4Z8LA 3SLED 4CZXA 2QZPA 4QQEA 4U1EI 3JZNA 5HE0B 3DXKC 3NVXA 2OK4A 4PXWA 1PGUA 2AH1A 3I8CA 5GXHA 3ZDXA 3SBPA 3J80g 1GOTB 2H9NA 1N6DA 3FM0A 3SMRA 1L0QA 3EI2B 3I89A 2Z2PA 3MZKA 2PM9A 5AMSA 3OW8A 1PBYB 2HU5A 4JD2C 1FWXA 1JMXB 3EQ7A 4MMYA 3AL8B 1SHYB 3L4MD 4MK0B 3JROA 4JXMA 4ESGA 3B7FA 4Z7OA 3AFCA 3SBQA 5SXMA 4FHLA 3MZLA 1SQJA 3I2NA 3K6SA 4CY2A 3BWSA 3IJ0A 5C2WB 2HJ4A 4DNVA 1E8NA 3RLMD 1B9XA 4HDJA 4JHNA 4PBYA 1GOGA 2YMUA 2HXCA 2P9IC 3JZHA 2YNOA 2AGXA 4JSNC 3MVDK 2OVRB 1GOHA 5HE1B 2VC2A 2XL2A 3GFCA 5CXCA 3NIDA 4FWWA
chains in the Genus database with same CATH topology
2IUVA 2I0SA 2PM7B 1S4UX 3EI1A 1OLZA 3CIKB 2CO0A 3SCYA 4J8BA 3I7OA 3OTTA 3ORVD 4OWRA 4GM3A 5H14A 3RSEC 3C99A 4E5ZB 5EMKB 3SJLD 4A09B 3MKSB 4A0AB 3L4OD 2O9KA 3OKTA 3UVNA 2H68A 1YFQA 3EMHA 3EI3A 4LG8A 3EI4B 5I5IA 2H3XA 4U7AA 4A11B 2HYEA 3PSCB 5JWZA 5FKSA 2CN2A 4LG9A 4J81A 3IIWA 5CYKA 5FA5B 4FA1D 3DWLC 4GMBA 2AGZA 2HKMA 5IJ8E 3I7HA 2P9LC 3VH0A 2H6KA 3N0DA 3ODTA 3EU7A 4ZOZA 2Z2NA 2H9LA 3EG6A 4PC0A 2H13A 3J81g 1GG2B 5EAMA 4QRJA 4QL1A 3SFZA 3U4YA 4J77A 3DXMC 4PSXB 3BG1A 5TEEA 4D6VA 2QXVA 5THAA 4XYIA 5GXIA 5FKTA 2GC4A 3PE7A 5EAPA 4GQ2P 2J56H 2H9PA 2BBKH 1XHMA 1A0RB 1XIPA 4IMMA 4K3ID 3K27A 3RFGA 4J82A 4O45A 4AEZA 5K1CC 4EWRA 3AL9A 3N0EA 3SVWD 4J87A 4CI8A 5FLXg 2P9UC 5CXBA 4A7JA 2W18A 2Z2OA 1GXRA 4L9OA 4JSPC 5H1MA 3NVQA 3V5WB 4Y5RD 5HE3B 4UI9R 3RFHA 3F3GA 1U4CA 2I0TA 4O3TB 2CNXA 1MG3A 4ERQA 4CI1A 4BH6A 4N14A 4JSVC 4OZUA 2J57G 2UZYB 2OK6A 3AH8B 4GGDA 4BUJC 3IJCA 4D0KA 5IC7A 3JZGA 2EBSA 2IWFA 2G9AA 4O9DA 4E54B 2YNNA 5AJAA 4J86A 1MDAH 1K8KC 4GM9A 4FA9D 3OKYB 4E5ZA 2IWKA 3IKOA 4AOWA 3JAMg 4FAND 3IIYA 3E0CA 3I7LA 5IGQA 3F3FA 4YVDA 1TBGA 3V7DB 5GMKn 4A0BA 4A09A 5B4WA 1PI6A 2PM9B 4CZYA 3RN0D 1ERJA 4E54A 3JRPA 2PBIB 4QT8A 3V9FA 1B9YA 4KFMB 3PXTD 3RMZD 2P9PC 4CY5A 2P9KC 4IA9A 2IUPA 3EI2A 4A0BB 4JT5C 2XYIA 2IAAA 4FA5D 2IUQA 3FGBA 5TEFA 1MG2A 4GZ8A 2H6QA 5EARA 4GGCA 5EALA 3ZWLB 1JOFA 3SXTD 2GNQA 1K32A 4R7AB 2H6NA 4PBZA 5EMMB 4ERYA 3BG0A 4FB1D 2P9SC 2UZXB 2Q7QA 3EI1B 4A08B 3UVLA 4LGNA 2OIZA 1NEXB 1TYQC 3NVNA 4J79A 4XYHA 5FQDA 2P9NC 2XL3A 1JJUB 3PVUB 1N6EA 5HYNB 3AL8A 3I7PA 2TRCB 4CY3A 3EI3B 4PNKB 4J8GA 2I0RA 2YB8B 3IJ1A 2AGLA 3CFSB 4NSXA 3K26A 5KDOB 3EI4A 4O1QD 2BCJB 4J78A 5IGOA 5I5MA 5A2Qg 4GGAA 4BL0A 3GREA 5EM2B 4GQBB 4XEIC 4J84A 3ULEC 5IT9g 3OL2A 4J0WA 2IURA 2CO0C 3RN1D 1P22A 4ERZA 1PEVA 1U2VC 1OMWB 3C75H 3SHFA 3UKRC 1GP2B 4A2MA 3VGZA 5HQGA 3PSLA 2HJBA 5TF2A 2HKRA 5C2VB 3EWEA 2B5MA 4L3GD 4X63B 4JT6C 3FRXA 2I3SA 4PSWB 3SWSD 4L3HD 4X3EA 3OL2B 4A11A 3JB9L 4J73A 5K19A 5EMLB 2CN3A 3F3PA 2OVQB 2H14A 3KRWB 4J0XA 3W15A 3UVOA 5TDHB 2MTAH 3OKYA 3UVKA 2CE8A 3MKQA 3MXXA 3DSMA 4H5JA 2XU7A 1NR0A 2G99A 4L1QD 4CC9A 4O3UB 4JSXC 1XKSA 3OKWA 3UKUC 4X61B 5IJ7E 2AGYA 2AGWA 3KRXB 3UVMA 4FAVD 2H47A 4ZOVA 2YBAA 2AQ5A 1SQ9A 5CXCB 5EM2A 1R5MA 2AH0A 3CFVA 1VYHC 4A0AA 2H9MA 3MMYA 3I8EA 4H5IA 5CXBB 4TZ4A 3PXWD 4K3JB 3DM0A 3C5MA 2B5NA 4ZOXA 3VA6A 3UR4A 2CE9A 5FXYA 3RRMC 4Y7RA 2B4EA 4CI2A 5H17A 2GC7A 3HFQA 4A08A 4G56B 3I7KA 5I5JA 1RI6A 5FKQA 3I7NA 4CI3A 1QNIA 5C9ZB 5HE2B 5GSAA 1Q47A 4CZVA 3C9CA 4X60B 3SBRA 4ZOYA 2QC5A 2YNPA 4FA4D 2B5LA 1N6FA 2OVPB 4I79A 2I3TA 4GM8A 3PVWB 4GQ1A 2OJYA 3A0FA 3PXSD 4ES0A 4ZN4A 5AFU3 5CYKB 5EMJB 3P4FA 2PM6B 1JMZB 3SN6B 3JPXA 2J55H 5FKRA 2HESX 4CY1A 4A2LA 4Z8LA 3SLED 4CZXA 4QQEA 4U1EI 3JZNA 5HE0B 3DXKC 3NVXA 2OK4A 4PXWA 1PGUA 2AH1A 3I8CA 5GXHA 3SBPA 3J80g 1GOTB 2H9NA 1N6DA 3FM0A 3SMRA 1L0QA 3EI2B 3I89A 2Z2PA 3MZKA 2PM9A 5AMSA 3OW8A 1PBYB 4JD2C 1FWXA 1JMXB 3AL8B 1SHYB 3L4MD 4MK0B 3JROA 4JXMA 4ESGA 3B7FA 3AFCA 3SBQA 5SXMA 4FHLA 3MZLA 1SQJA 3I2NA 4CY2A 3BWSA 3IJ0A 5C2WB 2HJ4A 3RLMD 1B9XA 4HDJA 4PBYA 2YMUA 2HXCA 2P9IC 3JZHA 2YNOA 2AGXA 4JSNC 2OVRB 5HE1B 2XL2A 3GFCA 5CXCA 4FWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IUV A;  2I0S A;  2PM7 B;  1S4U X;  3EI1 A;  1OLZ A;  3CIK B;  2CO0 A;  3SCY A;  4J8B A;  3I7O A;  3OTT A;  3ORV D;  4OWR A;  4GM3 A;  5H14 A;  3RSE C;  3C99 A;  4E5Z B;  5EMK B;  3SJL D;  4A09 B;  3MKS B;  4A0A B;  3L4O D;  2O9K A;  3OKT A;  3UVN A;  2H68 A;  1YFQ A;  3EMH A;  3EI3 A;  4LG8 A;  3EI4 B;  5I5I A;  2H3X A;  4U7A A;  4A11 B;  2HYE A;  3PSC B;  5JWZ A;  5FKS A;  2CN2 A;  4LG9 A;  4J81 A;  3IIW A;  5CYK A;  5FA5 B;  4FA1 D;  3DWL C;  4GMB A;  2AGZ A;  2HKM A;  5IJ8 E;  3I7H A;  2P9L C;  3VH0 A;  2H6K A;  3N0D A;  3ODT A;  3EU7 A;  4ZOZ A;  2Z2N A;  2H9L A;  3EG6 A;  4PC0 A;  2H13 A;  3J81 g;  1GG2 B;  5EAM A;  4QRJ A;  4QL1 A;  3SFZ A;  3U4Y A;  4J77 A;  3DXM C;  4PSX B;  3BG1 A;  5TEE A;  4D6V A;  2QXV A;  5THA A;  4XYI A;  5GXI A;  5FKT A;  2GC4 A;  3PE7 A;  5EAP A;  4GQ2 P;  2J56 H;  2H9P A;  2BBK H;  1XHM A;  1A0R B;  1XIP A;  4IMM A;  4K3I D;  3K27 A;  3RFG A;  4J82 A;  4O45 A;  4AEZ A;  5K1C C;  4EWR A;  3AL9 A;  3N0E A;  3SVW D;  4J87 A;  4CI8 A;  5FLX g;  2P9U C;  5CXB A;  4A7J A;  2W18 A;  2Z2O A;  1GXR A;  4L9O A;  4JSP C;  5H1M A;  3NVQ A;  3V5W B;  4Y5R D;  5HE3 B;  4UI9 R;  3RFH A;  3F3G A;  1U4C A;  2I0T A;  4O3T B;  2CNX A;  1MG3 A;  4ERQ A;  4CI1 A;  4BH6 A;  4N14 A;  4JSV C;  4OZU A;  2J57 G;  2UZY B;  2OK6 A;  3AH8 B;  4GGD A;  4BUJ C;  3IJC A;  4D0K A;  5IC7 A;  3JZG A;  2EBS A;  2IWF A;  2G9A A;  4O9D A;  4E54 B;  2YNN A;  5AJA A;  4J86 A;  1MDA H;  1K8K C;  4GM9 A;  4FA9 D;  3OKY B;  4E5Z A;  2IWK A;  3IKO A;  4AOW A;  3JAM g;  4FAN D;  3IIY A;  3E0C A;  3I7L A;  5IGQ A;  3F3F A;  4YVD A;  1TBG A;  3V7D B;  5GMK n;  4A0B A;  4A09 A;  5B4W A;  1PI6 A;  2PM9 B;  4CZY A;  3RN0 D;  1ERJ A;  4E54 A;  3JRP A;  2PBI B;  4QT8 A;  3V9F A;  1B9Y A;  4KFM B;  3PXT D;  3RMZ D;  2P9P C;  4CY5 A;  2P9K C;  4IA9 A;  2IUP A;  3EI2 A;  4A0B B;  4JT5 C;  2XYI A;  2IAA A;  4FA5 D;  2IUQ A;  3FGB A;  5TEF A;  1MG2 A;  4GZ8 A;  2H6Q A;  5EAR A;  4GGC A;  5EAL A;  3ZWL B;  1JOF A;  3SXT D;  2GNQ A;  1K32 A;  4R7A B;  2H6N A;  4PBZ A;  5EMM B;  4ERY A;  3BG0 A;  4FB1 D;  2P9S C;  2UZX B;  2Q7Q A;  3EI1 B;  4A08 B;  3UVL A;  4LGN A;  2OIZ A;  1NEX B;  1TYQ C;  3NVN A;  4J79 A;  4XYH A;  5FQD A;  2P9N C;  2XL3 A;  1JJU B;  3PVU B;  1N6E A;  5HYN B;  3AL8 A;  3I7P A;  2TRC B;  4CY3 A;  3EI3 B;  4PNK B;  4J8G A;  2I0R A;  2YB8 B;  3IJ1 A;  2AGL A;  3CFS B;  4NSX A;  3K26 A;  5KDO B;  3EI4 A;  4O1Q D;  2BCJ B;  4J78 A;  5IGO A;  5I5M A;  5A2Q g;  4GGA A;  4BL0 A;  3GRE A;  5EM2 B;  4GQB B;  4XEI C;  4J84 A;  3ULE C;  5IT9 g;  3OL2 A;  4J0W A;  2IUR A;  2CO0 C;  3RN1 D;  1P22 A;  4ERZ A;  1PEV A;  1U2V C;  1OMW B;  3C75 H;  3SHF A;  3UKR C;  1GP2 B;  4A2M A;  3VGZ A;  5HQG A;  3PSL A;  2HJB A;  5TF2 A;  2HKR A;  5C2V B;  3EWE A;  2B5M A;  4L3G D;  4X63 B;  4JT6 C;  3FRX A;  2I3S A;  4PSW B;  3SWS D;  4L3H D;  4X3E A;  3OL2 B;  4A11 A;  3JB9 L;  4J73 A;  5K19 A;  5EML B;  2CN3 A;  3F3P A;  2OVQ B;  2H14 A;  3KRW B;  4J0X A;  3W15 A;  3UVO A;  5TDH B;  2MTA H;  3OKY A;  3UVK A;  2CE8 A;  3MKQ A;  3MXX A;  3DSM A;  4H5J A;  2XU7 A;  1NR0 A;  2G99 A;  4L1Q D;  4CC9 A;  4O3U B;  4JSX C;  1XKS A;  3OKW A;  3UKU C;  4X61 B;  5IJ7 E;  2AGY A;  2AGW A;  3KRX B;  3UVM A;  4FAV D;  2H47 A;  4ZOV A;  2YBA A;  2AQ5 A;  1SQ9 A;  5CXC B;  5EM2 A;  1R5M A;  2AH0 A;  3CFV A;  1VYH C;  4A0A A;  2H9M A;  3MMY A;  3I8E A;  4H5I A;  5CXB B;  4TZ4 A;  3PXW D;  4K3J B;  3DM0 A;  3C5M A;  2B5N A;  4ZOX A;  3VA6 A;  3UR4 A;  2CE9 A;  5FXY A;  3RRM C;  4Y7R A;  2B4E A;  4CI2 A;  5H17 A;  2GC7 A;  3HFQ A;  4A08 A;  4G56 B;  3I7K A;  5I5J A;  1RI6 A;  5FKQ A;  3I7N A;  4CI3 A;  1QNI A;  5C9Z B;  5HE2 B;  5GSA A;  1Q47 A;  4CZV A;  3C9C A;  4X60 B;  3SBR A;  4ZOY A;  2QC5 A;  2YNP A;  4FA4 D;  2B5L A;  1N6F A;  2OVP B;  4I79 A;  2I3T A;  4GM8 A;  3PVW B;  4GQ1 A;  2OJY A;  3A0F A;  3PXS D;  4ES0 A;  4ZN4 A;  5AFU 3;  5CYK B;  5EMJ B;  3P4F A;  2PM6 B;  1JMZ B;  3SN6 B;  3JPX A;  2J55 H;  5FKR A;  2HES X;  4CY1 A;  4A2L A;  4Z8L A;  3SLE D;  4CZX A;  4QQE A;  4U1E I;  3JZN A;  5HE0 B;  3DXK C;  3NVX A;  2OK4 A;  4PXW A;  1PGU A;  2AH1 A;  3I8C A;  5GXH A;  3SBP A;  3J80 g;  1GOT B;  2H9N A;  1N6D A;  3FM0 A;  3SMR A;  1L0Q A;  3EI2 B;  3I89 A;  2Z2P A;  3MZK A;  2PM9 A;  5AMS A;  3OW8 A;  1PBY B;  4JD2 C;  1FWX A;  1JMX B;  3AL8 B;  1SHY B;  3L4M D;  4MK0 B;  3JRO A;  4JXM A;  4ESG A;  3B7F A;  3AFC A;  3SBQ A;  5SXM A;  4FHL A;  3MZL A;  1SQJ A;  3I2N A;  4CY2 A;  3BWS A;  3IJ0 A;  5C2W B;  2HJ4 A;  3RLM D;  1B9X A;  4HDJ A;  4PBY A;  2YMU A;  2HXC A;  2P9I C;  3JZH A;  2YNO A;  2AGX A;  4JSN C;  2OVR B;  5HE1 B;  2XL2 A;  3GFC A;  5CXC A;  4FWW A; 
#chains in the Genus database with same CATH topology
 2IUV A;  2I0S A;  2PM7 B;  3QHY B;  4NAA A;  1S4U X;  3IUJ A;  4UM9 A;  3EI1 A;  1OLZ A;  3CIK B;  2CO0 A;  4WK4 A;  2VDK A;  3SCY A;  4J8B A;  3I7O A;  5M5T A;  3OTT A;  3ORV D;  4OWR A;  4GM3 A;  5H14 A;  3RSE C;  3C99 A;  1L5G A;  4E5Z B;  5EMK B;  3SJL D;  3EQ9 A;  4A09 B;  3MKS B;  4A0A B;  3L4O D;  1K3I A;  2O9K A;  1H2Z A;  2BKL A;  2H68 A;  1YFQ A;  3EMH A;  3EI3 A;  3IJE A;  3EI4 B;  3OKT A;  2H3X A;  4LG8 A;  4U7A A;  3IUR A;  4A11 B;  2HYE A;  5HDB A;  3PSC B;  5JWZ A;  5FKS A;  2CN2 A;  2JKX A;  4LG9 A;  4J81 A;  3IIW A;  5CYK A;  5FA5 B;  4FA1 D;  3DWL C;  4GMB A;  2AGZ A;  2HKM A;  3FCS A;  4G1E A;  5IJ8 E;  3I7H A;  2P9L C;  4AN1 A;  2H6K A;  3N0D A;  3ODT A;  3VH0 A;  3IUN A;  3EU7 A;  1UTC A;  4ZOZ A;  2Z2N A;  2H9L A;  3EG6 A;  4PC0 A;  2H13 A;  3J81 g;  1GG2 B;  5EAM A;  3NIG A;  2HU8 A;  3ZE1 A;  4QRJ A;  4QL1 A;  3SFZ A;  3U4Y A;  4J77 A;  3DXM C;  4PSX B;  4MMX A;  3BG1 A;  5TEE A;  3ZDY A;  4D6V A;  2QXV A;  5THA A;  4XYI A;  5GXI A;  5FKT A;  2GC4 A;  3PE7 A;  2EIC A;  4BCC A;  5EAP A;  3ZE0 A;  3O4J A;  4GQ2 P;  2J56 H;  2H9P A;  2BBK H;  3GD1 I;  1XHM A;  1A0R B;  1XIP A;  4IMM A;  4K3I D;  3K27 A;  3RFG A;  4J82 A;  4O45 A;  4AEZ A;  5K1C C;  4EWR A;  3AL9 A;  3N0E A;  3SVW D;  3DDU A;  4J87 A;  4CI8 A;  5FLX g;  5M5S A;  2P9U C;  5CXB A;  3FCU A;  4A7J A;  2W18 A;  2Z2O A;  1GXR A;  4L9O A;  3VI3 A;  4JSP C;  5H1M A;  1UOQ A;  3NVQ A;  2VZ1 A;  4Y5R D;  2WQ8 A;  3V5W B;  4DNW A;  5HE3 B;  4UI9 R;  4NC4 A;  2VDL A;  3RFH A;  3F3G A;  1U4C A;  2I0T A;  4O3T B;  1H2Y A;  2CNX A;  1MG3 A;  4ERQ A;  4CI1 A;  4BH6 A;  4N14 A;  4JSV C;  4OZU A;  2J57 G;  5E6U A;  2UZY B;  2OK6 A;  3AH8 B;  4GGD A;  4BUJ C;  3IJC A;  2VDQ A;  4D0K A;  1VE6 A;  5IC7 A;  3JZG A;  3ZE2 A;  4DNU A;  2QR5 A;  2EBS A;  2IWF A;  2EIB A;  2G9A A;  4O9D A;  4E54 B;  3O4H A;  2YNN A;  5AJA A;  4J86 A;  4L1M A;  1MDA H;  1T2X A;  2VDO A;  1K8K C;  4GM9 A;  4FA9 D;  3O4G A;  3OKY B;  4E5Z A;  2IWK A;  3IKO A;  4AOW A;  4AX4 A;  3JAM g;  4FAN D;  5C86 A;  3IIY A;  3E0C A;  3I7L A;  4D9S A;  5IGQ A;  4WK2 A;  3F3F A;  4YVD A;  1TBG A;  3V7D B;  5GMK n;  4A0B A;  4A09 A;  5B4W A;  1PI6 A;  2PM9 B;  4CZY A;  3RN0 D;  4RE5 A;  1ERJ A;  4E54 A;  3JRP A;  2PBI B;  2VDP A;  4QT8 A;  1B9Y A;  3V9F A;  4KFM B;  3PXT D;  3RMZ D;  3IVM A;  2P9P C;  4CY5 A;  2P9K C;  4NBM A;  4IA9 A;  4RE6 A;  2IUP A;  2EID A;  1H2W A;  3EI2 A;  4A0B B;  4JT5 C;  1C9L A;  2XYI A;  2IAA A;  4FA5 D;  1TYE A;  2IUQ A;  3FGB A;  3V4P A;  1M1X A;  5TEF A;  1MG2 A;  4GZ8 A;  3K71 A;  5FFO A;  1E5T A;  2H6Q A;  5EAR A;  4GGC A;  1C9I A;  5EAL A;  3ZWL B;  1JOF A;  3SXT D;  2HU7 A;  2GNQ A;  1K32 A;  4R7A B;  2H6N A;  4PBZ A;  5EMM B;  4ERY A;  3BG0 A;  4G55 A;  4FB1 D;  2P9S C;  3IUL A;  3IUM A;  2UZX B;  2Q7Q A;  3EI1 B;  4A08 B;  3KCI A;  3UVL A;  4LGN A;  4AMZ A;  2OIZ A;  4IRZ A;  1UOP A;  4O02 A;  1NEX B;  1TYQ C;  3NVN A;  4J79 A;  4XYH A;  5FQD A;  2P9N C;  2XL3 A;  3NIF A;  4G1M A;  1JJU B;  4AN0 A;  3PVU B;  1N6E A;  5HYN B;  3AL8 A;  3I7P A;  2TRC B;  4CY3 A;  3EI3 B;  4PNK B;  4J8G A;  2I0R A;  2YB8 B;  3ZDZ A;  3IJ1 A;  2AGL A;  3CFS B;  4MMZ A;  4NSX A;  3K26 A;  5KDO B;  3EI4 A;  4O1Q D;  2BCJ B;  4J78 A;  5IGO A;  5I5M A;  4BCD A;  5M5V A;  5A2Q g;  4GGA A;  4BL0 A;  3GRE A;  5EM2 B;  4GQB B;  3UVN A;  4XEI C;  4J84 A;  3ULE C;  5IT9 g;  3OL2 A;  4J0W A;  3V4V A;  2IUR A;  4BCB A;  1I2M B;  2CO0 C;  1O6F A;  3RN1 D;  1P22 A;  4ERZ A;  1PEV A;  1U2V C;  1OMW B;  3C75 H;  3MUN A;  2XDW A;  3SHF A;  3UKR C;  1GP2 B;  4A2M A;  3VGZ A;  4BP8 A;  5C92 A;  1E8M A;  5HQG A;  3PSL A;  2HJB A;  3VI4 A;  1JV2 A;  2HKR A;  5TF2 A;  5C2V B;  3EWE A;  2B5M A;  3IUQ A;  4L3G D;  4X63 B;  5E6R A;  5M5R A;  4JT6 C;  3FRX A;  2I3S A;  4PSW B;  3SWS D;  4L3H D;  4X3E A;  3OL2 B;  1H2X A;  4A11 A;  3JB9 L;  4J73 A;  5K19 A;  5EML B;  2CN3 A;  3F3P A;  2OVQ B;  2H14 A;  4O2W A;  3KRW B;  2VDR A;  4J0X A;  3W15 A;  4UM8 A;  3UVO A;  5TDH B;  2MTA H;  3OKY A;  3UVK A;  2CE8 A;  3MKQ A;  3MXX A;  3DSM A;  4H5J A;  3T3P A;  4Z7N A;  1VZ2 A;  2VDM A;  1NR0 A;  2XU7 A;  2G99 A;  4L1Q D;  1YR2 A;  4CC9 A;  4O3U B;  4Z7Q A;  1VZ3 A;  4JSX C;  1XKS A;  1UOO A;  2VDN A;  3OKW A;  3UKU C;  4X61 B;  1QFM A;  5IJ7 E;  2AGY A;  2AGW A;  3MUO A;  3KRX B;  3UVM A;  4FAV D;  5M61 A;  2H47 A;  3EQ8 A;  4ZOV A;  2YBA A;  2AQ5 A;  1SQ9 A;  5CXC B;  5FFG A;  3GC3 B;  5EM2 A;  1R5M A;  2AH0 A;  3CFV A;  1VYH C;  4A0A A;  1QFS A;  2H9M A;  3MMY A;  4JHP C;  3I8E A;  1U8C A;  4H5I A;  4WJK A;  5CXB B;  4WK0 A;  1VE7 A;  4TZ4 A;  2EIE A;  3PXW D;  3DM0 A;  4K3J B;  3C5M A;  4NEN A;  2B5N A;  4ZOX A;  3VA6 A;  3UR4 A;  2CE9 A;  2XE4 A;  5FXY A;  3RRM C;  4Y7R A;  2B4E A;  4CI2 A;  5H17 A;  2GC7 A;  3HFQ A;  4A08 A;  4G56 B;  3I7K A;  5I5J A;  1RI6 A;  3OF7 A;  5FKQ A;  3I7N A;  4CI3 A;  1QNI A;  5C9Z B;  5HE2 B;  5GSA A;  1Q47 A;  4CZV A;  3C9C A;  4X60 B;  3SBR A;  4ZOY A;  2QC5 A;  1BPO A;  2YNP A;  5E6S A;  4FA4 D;  4QAM A;  3T3M A;  2B5L A;  5M5U A;  1N6F A;  2OVP B;  4I79 A;  2I3T A;  4GM8 A;  3PVW B;  4GQ1 A;  2OJY A;  3A0F A;  3PXS D;  4ES0 A;  1O6G A;  4AMY A;  1A12 A;  4ZN4 A;  5I5I A;  3QI0 A;  5AFU 3;  1JTD B;  5CYK B;  5EMJ B;  3P4F A;  2VZ3 A;  2XZG A;  4BP9 A;  2PM6 B;  1JMZ B;  3SN6 B;  3JPX A;  3O4I A;  1GOF A;  2J55 H;  5FKR A;  2HES X;  3K72 A;  4CY1 A;  4A2L A;  4Z8L A;  3SLE D;  4CZX A;  2QZP A;  4QQE A;  4U1E I;  3JZN A;  5HE0 B;  3DXK C;  3NVX A;  2OK4 A;  4PXW A;  1PGU A;  2AH1 A;  3I8C A;  5GXH A;  3ZDX A;  3SBP A;  3J80 g;  1GOT B;  2H9N A;  1N6D A;  3FM0 A;  3SMR A;  1L0Q A;  3EI2 B;  3I89 A;  2Z2P A;  3MZK A;  2PM9 A;  5AMS A;  3OW8 A;  1PBY B;  2HU5 A;  4JD2 C;  1FWX A;  1JMX B;  3EQ7 A;  4MMY A;  3AL8 B;  1SHY B;  3L4M D;  4MK0 B;  3JRO A;  4JXM A;  4ESG A;  3B7F A;  4Z7O A;  3AFC A;  3SBQ A;  5SXM A;  4FHL A;  3MZL A;  1SQJ A;  3I2N A;  3K6S A;  4CY2 A;  3BWS A;  3IJ0 A;  5C2W B;  2HJ4 A;  4DNV A;  1E8N A;  3RLM D;  1B9X A;  4HDJ A;  4JHN A;  4PBY A;  1GOG A;  2YMU A;  2HXC A;  2P9I C;  3JZH A;  2YNO A;  2AGX A;  4JSN C;  3MVD K;  2OVR B;  1GOH A;  5HE1 B;  2VC2 A;  2XL2 A;  3GFC A;  5CXC A;  3NID A;  4FWW A; 
#chains in the Genus database with same CATH homology
 2IUV A;  2I0S A;  2PM7 B;  1S4U X;  3EI1 A;  1OLZ A;  3CIK B;  2CO0 A;  3SCY A;  4J8B A;  3I7O A;  3OTT A;  3ORV D;  4OWR A;  4GM3 A;  5H14 A;  3RSE C;  3C99 A;  4E5Z B;  5EMK B;  3SJL D;  4A09 B;  3MKS B;  4A0A B;  3L4O D;  2O9K A;  3OKT A;  3UVN A;  2H68 A;  1YFQ A;  3EMH A;  3EI3 A;  4LG8 A;  3EI4 B;  5I5I A;  2H3X A;  4U7A A;  4A11 B;  2HYE A;  3PSC B;  5JWZ A;  5FKS A;  2CN2 A;  4LG9 A;  4J81 A;  3IIW A;  5CYK A;  5FA5 B;  4FA1 D;  3DWL C;  4GMB A;  2AGZ A;  2HKM A;  5IJ8 E;  3I7H A;  2P9L C;  3VH0 A;  2H6K A;  3N0D A;  3ODT A;  3EU7 A;  4ZOZ A;  2Z2N A;  2H9L A;  3EG6 A;  4PC0 A;  2H13 A;  3J81 g;  1GG2 B;  5EAM A;  4QRJ A;  4QL1 A;  3SFZ A;  3U4Y A;  4J77 A;  3DXM C;  4PSX B;  3BG1 A;  5TEE A;  4D6V A;  2QXV A;  5THA A;  4XYI A;  5GXI A;  5FKT A;  2GC4 A;  3PE7 A;  5EAP A;  4GQ2 P;  2J56 H;  2H9P A;  2BBK H;  1XHM A;  1A0R B;  1XIP A;  4IMM A;  4K3I D;  3K27 A;  3RFG A;  4J82 A;  4O45 A;  4AEZ A;  5K1C C;  4EWR A;  3AL9 A;  3N0E A;  3SVW D;  4J87 A;  4CI8 A;  5FLX g;  2P9U C;  5CXB A;  4A7J A;  2W18 A;  2Z2O A;  1GXR A;  4L9O A;  4JSP C;  5H1M A;  3NVQ A;  3V5W B;  4Y5R D;  5HE3 B;  4UI9 R;  3RFH A;  3F3G A;  1U4C A;  2I0T A;  4O3T B;  2CNX A;  1MG3 A;  4ERQ A;  4CI1 A;  4BH6 A;  4N14 A;  4JSV C;  4OZU A;  2J57 G;  2UZY B;  2OK6 A;  3AH8 B;  4GGD A;  4BUJ C;  3IJC A;  4D0K A;  5IC7 A;  3JZG A;  2EBS A;  2IWF A;  2G9A A;  4O9D A;  4E54 B;  2YNN A;  5AJA A;  4J86 A;  1MDA H;  1K8K C;  4GM9 A;  4FA9 D;  3OKY B;  4E5Z A;  2IWK A;  3IKO A;  4AOW A;  3JAM g;  4FAN D;  3IIY A;  3E0C A;  3I7L A;  5IGQ A;  3F3F A;  4YVD A;  1TBG A;  3V7D B;  5GMK n;  4A0B A;  4A09 A;  5B4W A;  1PI6 A;  2PM9 B;  4CZY A;  3RN0 D;  1ERJ A;  4E54 A;  3JRP A;  2PBI B;  4QT8 A;  3V9F A;  1B9Y A;  4KFM B;  3PXT D;  3RMZ D;  2P9P C;  4CY5 A;  2P9K C;  4IA9 A;  2IUP A;  3EI2 A;  4A0B B;  4JT5 C;  2XYI A;  2IAA A;  4FA5 D;  2IUQ A;  3FGB A;  5TEF A;  1MG2 A;  4GZ8 A;  2H6Q A;  5EAR A;  4GGC A;  5EAL A;  3ZWL B;  1JOF A;  3SXT D;  2GNQ A;  1K32 A;  4R7A B;  2H6N A;  4PBZ A;  5EMM B;  4ERY A;  3BG0 A;  4FB1 D;  2P9S C;  2UZX B;  2Q7Q A;  3EI1 B;  4A08 B;  3UVL A;  4LGN A;  2OIZ A;  1NEX B;  1TYQ C;  3NVN A;  4J79 A;  4XYH A;  5FQD A;  2P9N C;  2XL3 A;  1JJU B;  3PVU B;  1N6E A;  5HYN B;  3AL8 A;  3I7P A;  2TRC B;  4CY3 A;  3EI3 B;  4PNK B;  4J8G A;  2I0R A;  2YB8 B;  3IJ1 A;  2AGL A;  3CFS B;  4NSX A;  3K26 A;  5KDO B;  3EI4 A;  4O1Q D;  2BCJ B;  4J78 A;  5IGO A;  5I5M A;  5A2Q g;  4GGA A;  4BL0 A;  3GRE A;  5EM2 B;  4GQB B;  4XEI C;  4J84 A;  3ULE C;  5IT9 g;  3OL2 A;  4J0W A;  2IUR A;  2CO0 C;  3RN1 D;  1P22 A;  4ERZ A;  1PEV A;  1U2V C;  1OMW B;  3C75 H;  3SHF A;  3UKR C;  1GP2 B;  4A2M A;  3VGZ A;  5HQG A;  3PSL A;  2HJB A;  5TF2 A;  2HKR A;  5C2V B;  3EWE A;  2B5M A;  4L3G D;  4X63 B;  4JT6 C;  3FRX A;  2I3S A;  4PSW B;  3SWS D;  4L3H D;  4X3E A;  3OL2 B;  4A11 A;  3JB9 L;  4J73 A;  5K19 A;  5EML B;  2CN3 A;  3F3P A;  2OVQ B;  2H14 A;  3KRW B;  4J0X A;  3W15 A;  3UVO A;  5TDH B;  2MTA H;  3OKY A;  3UVK A;  2CE8 A;  3MKQ A;  3MXX A;  3DSM A;  4H5J A;  2XU7 A;  1NR0 A;  2G99 A;  4L1Q D;  4CC9 A;  4O3U B;  4JSX C;  1XKS A;  3OKW A;  3UKU C;  4X61 B;  5IJ7 E;  2AGY A;  2AGW A;  3KRX B;  3UVM A;  4FAV D;  2H47 A;  4ZOV A;  2YBA A;  2AQ5 A;  1SQ9 A;  5CXC B;  5EM2 A;  1R5M A;  2AH0 A;  3CFV A;  1VYH C;  4A0A A;  2H9M A;  3MMY A;  3I8E A;  4H5I A;  5CXB B;  4TZ4 A;  3PXW D;  4K3J B;  3DM0 A;  3C5M A;  2B5N A;  4ZOX A;  3VA6 A;  3UR4 A;  2CE9 A;  5FXY A;  3RRM C;  4Y7R A;  2B4E A;  4CI2 A;  5H17 A;  2GC7 A;  3HFQ A;  4A08 A;  4G56 B;  3I7K A;  5I5J A;  1RI6 A;  5FKQ A;  3I7N A;  4CI3 A;  1QNI A;  5C9Z B;  5HE2 B;  5GSA A;  1Q47 A;  4CZV A;  3C9C A;  4X60 B;  3SBR A;  4ZOY A;  2QC5 A;  2YNP A;  4FA4 D;  2B5L A;  1N6F A;  2OVP B;  4I79 A;  2I3T A;  4GM8 A;  3PVW B;  4GQ1 A;  2OJY A;  3A0F A;  3PXS D;  4ES0 A;  4ZN4 A;  5AFU 3;  5CYK B;  5EMJ B;  3P4F A;  2PM6 B;  1JMZ B;  3SN6 B;  3JPX A;  2J55 H;  5FKR A;  2HES X;  4CY1 A;  4A2L A;  4Z8L A;  3SLE D;  4CZX A;  4QQE A;  4U1E I;  3JZN A;  5HE0 B;  3DXK C;  3NVX A;  2OK4 A;  4PXW A;  1PGU A;  2AH1 A;  3I8C A;  5GXH A;  3SBP A;  3J80 g;  1GOT B;  2H9N A;  1N6D A;  3FM0 A;  3SMR A;  1L0Q A;  3EI2 B;  3I89 A;  2Z2P A;  3MZK A;  2PM9 A;  5AMS A;  3OW8 A;  1PBY B;  4JD2 C;  1FWX A;  1JMX B;  3AL8 B;  1SHY B;  3L4M D;  4MK0 B;  3JRO A;  4JXM A;  4ESG A;  3B7F A;  3AFC A;  3SBQ A;  5SXM A;  4FHL A;  3MZL A;  1SQJ A;  3I2N A;  4CY2 A;  3BWS A;  3IJ0 A;  5C2W B;  2HJ4 A;  3RLM D;  1B9X A;  4HDJ A;  4PBY A;  2YMU A;  2HXC A;  2P9I C;  3JZH A;  2YNO A;  2AGX A;  4JSN C;  2OVR B;  5HE1 B;  2XL2 A;  3GFC A;  5CXC A;  4FWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...