3RRMC

S. cerevisiae dbp5 l327v bound to nup159, gle1 h337r, ip6 and adp
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
382
structure length
370
Chain Sequence
b'GASSLKDEVPTETSEDFGFKFLGQKQILPSFNEKLPFASLQNLDISNSKSLFVAASGSKAVVGELQLLRDHITSDSTPLTFKWEKEIPDVIFVCFHGDQVLVSTRNALYSLDLEELSEFRTVTSFEKPVFQLKNVNNTLVILNSVNDLSALDLRTKSTKQLAQNVTSFDVTNSQLAVLLKDRSFQSFAWRNGEMEKQFEFSLPSELEELPVEEYSPLSVTILSPQDFLAVFGNVISETDDEVSYDQKMYIIKHIDGSASFQETFDITPPFGQIVRFPYMYKVTLSGLIEPDANVNVLASSCSSEVSIWDSKQVIEPSQDSERAVLPISEETDKDTNPIGVAVDVVTSGTRLPLVYILNNEGSLQIVGLFH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent RNA helicase DBP5
publication title A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP6 in mRNA export.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 81
structure length 370
sequence length 382
ec nomenclature
pdb deposition date 2011-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF16755 NUP214 Nucleoporin or Nuclear pore complex subunit NUP214=Nup159
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3rrmC00
4J84A 2Q7QA 5JWZA 3DSMA 4IMMA 1XHMA 4FWWA 3RN0D 2OK4A 2H9PA 3IJ0A 1PEVA 2H6QA 5A2Qg 2GC7A 2B5NA 3IIYA 2J57G 3SVWD 3AH8B 3C9CA 4J0WA 4U7AA 3FRXA 3KRXB 4Y7RA 4LG9A 4J8GA 5TEFA 3PSCB 5TF2A 3EU7A 3F3GA 4QQEA 1K8KC 3A0FA 2AGXA 3E0CA 1MG2A 4E5ZB 4BUJC 2H14A 2MTAH 4BH6A 3NVQA 3UR4A 3I8EA 3RRMC 2I3TA 4A08B 3MZLA 3HFQA 4A09A 5IC7A 2P9UC 5C9ZB 4PNKB 5GSAA 4CZYA 3C5MA 1VYHC 3CFSB 2AQ5A 1ERJA 1NEXB 1OLZA 4HDJA 4TZ4A 4D0KA 4K3ID 3EWEA 1N6DA 4O1QD 4N14A 4ZOXA 4JSPC 3F3FA 3MZKA 4J86A 2B5MA 5EAMA 3AL8B 2AH1A 4A09B 4FB1D 4H5JA 2CN2A 3ODTA 3UVOA 5EMLB 1GP2B 2H13A 3IJ1A 2YNNA 2HKRA 4A2MA 5AMSA 3I7KA 3P4FA 2H9MA 4JT6C 3RSEC 4X3EA 4GGDA 2QXVA 4D6VA 3JAMg 3PXWD 4CZXA 2P9NC 5IGOA 1B9YA 5CXBA 3SHFA 5IGQA 3C99A 4AOWA 3EMHA 4QL1A 3EI2A 2IWKA 2H47A 4J73A 3JROA 3JRPA 4LGNA 4CY1A 3C75H 3SBQA 2CO0C 4K3JB 4NSXA 3SBRA 5HYNB 5GXIA 3OKTA 2G99A 2PM9A 1L0QA 3ORVD 3I89A 5HE1B 3EI1B 2XL2A 4L1QD 2AGLA 3EI2B 3BWSA 2BBKH 1SQJA 4ZOVA 2OVRB 3VGZA 2YBAA 5EALA 3UVNA 2O9KA 2Z2OA 3I8CA 4CI3A 5K1CC 3JPXA 1B9XA 3K26A 3OTTA 2IAAA 4O45A 2J55H 2PM6B 3NVNA 2PM9B 5THAA 1XIPA 4BL0A 4JSVC 1MG3A 3DXMC 1JMZB 3SBPA 1N6EA 1MDAH 2QC5A 3VA6A 3W15A 2I0TA 2P9IC 3I7OA 4PBZA 3OL2A 2OVPB 2OVQB 3V7DB 4CZVA 5CYKA 2IWFA 3GREA 3FGBA 3IKOA 4CY2A 3B7FA 1TBGA 2GC4A 4J8BA 4ERQA 2EBSA 3UVMA 3MKQA 4A0AA 2P9SC 5H14A 1U4CA 3J80g 3MMYA 5SXMA 2BCJB 5H17A 1GOTB 3BG1A 4FA1D 2UZXB 3UVLA 2OK6A 2XU7A 2UZYB 3JZHA 3UKUC 4YVDA 4R7AB 4CI2A 4Z8LA 1R5MA 5CYKB 3V9FA 3RFGA 5C2WB 3SMRA 5B4WA 2CO0A 4JSXC 3ZWLB 4ESGA 3I2NA 1YFQA 4XYIA 4A0AB 3OKWA 4JT5C 3JZGA 2TRCB 4PSWB 1JMXB 1P22A 1Q47A 5EM2A 3RLMD 3CFVA 4J82A 3PXTD 3V5WB 5CXCA 2W18A 4A11A 5EMKB 1GXRA 4J81A 4L3GD 4JSNC 3EI4A 3JZNA 4L9OA 2AGWA 2IUPA 5I5MA 5I5IA 4H5IA 3N0EA 3OW8A 1SQ9A 1U2VC 2HJBA 4GQBB 3IIWA 3JB9L 4XYHA 2P9KC 5I5JA 3I7HA 4J87A 4A7JA 2GNQA 4CI8A 2H3XA 5HE3B 4OZUA 1SHYB 5CXCB 3SXTD 4A11B 2IUVA 3PSLA 3SLED 3RN1D 2YNOA 4ZOZA 4ERZA 4FAVD 1JOFA 4PBYA 4PXWA 3UVKA 1QNIA 5TEEA 4GM9A 2AH0A 3PVWB 5HE0B 3J81g 4AEZA 5AFU3 2OIZA 5CXBB 4G56B 1PI6A 4GMBA 2HKMA 4X61B 3AFCA 3SFZA 2PM7B 1A0RB 4PC0A 2YMUA 2AGZA 4FA4D 2HXCA 2CE8A 2H9LA 5EMMB 4GQ2P 2CE9A 3N0DA 4CI1A 2YB8B 5EAPA 4GGCA 4GGAA 4FAND 4QRJA 1N6FA 5FKSA 3FM0A 2G9AA 2I3SA 5H1MA 4CY5A 2YNPA 5HE2B 2H9NA 3DM0A 4A08A 3L4MD 2B4EA 3I7NA 4L3HD 4LG8A 3EG6A 2XYIA 3K27A 4J77A 3VH0A 1OMWB 4J79A 4JXMA 3SWSD 3PXSD 4PSXB 4GZ8A 3OKYA 4ZN4A 5GXHA 4CC9A 5FLXg 1PBYB 3OL2B 4Y5RD 3CIKB 3DXKC 3PE7A 1PGUA 5AJAA 5IJ8E 2P9LC 4A2LA 5FKTA 3MKSB 4O3TB 1S4UX 3AL8A 4XEIC 1NR0A 5IJ7E 2AGYA 3DWLC 5C2VB 5IT9g 1JJUB 4OWRA 1TYQC 2HJ4A 3IJCA 3OKYB 1FWXA 3RMZD 4MK0B 5HQGA 2CN3A 3PVUB 1RI6A 4JD2C 4CY3A 1XKSA 2H6NA 4ES0A 2XL3A 3EI3A 3NVXA 4A0BA 4O9DA 4GM8A 5KDOB 4ERYA 5K19A 3F3PA 5EM2B 2IUQA 5FKRA 3MXXA 3UKRC 2I0SA 4U1EI 3RFHA 3U4YA 3EI4B 4EWRA 4E54A 5EMJB 3EI1A 3L4OD 4I79A 4QT8A 3SN6B 3ULEC 4J78A 2Z2NA 4FHLA 4UI9R 3EI3B 5FKQA 5FXYA 5EARA 2J56H 4FA5D 3I7PA 3SCYA 3GFCA 4A0BB 3SJLD 2H6KA 2H68A 5TDHB 2PBIB 4GM3A 4O3UB 1K32A 3KRWB 2P9PC 2Z2PA 3BG0A 2B5LA 4FA9D 5FQDA 2CNXA 4X63B 4E54B 1GG2B 4ZOYA 2I0RA 2OJYA 4X60B 3AL9A 2HYEA 5GMKn 4IA9A 4KFMB 2HESX 4GQ1A 5FA5B 2IURA 4E5ZA 3I7LA 4J0XA
chains in the Genus database with same CATH superfamily
4J84A 1O6GA 2Q7QA 1JTDB 5JWZA 4G1EA 3DSMA 4IMMA 1XHMA 4FWWA 4JHPC 3RN0D 2OK4A 2H9PA 3IJ0A 3O4HA 1PEVA 2EIEA 2H6QA 5A2Qg 2GC7A 3FCUA 2B5NA 3IIYA 2J57G 3SVWD 3AH8B 3C9CA 1VE7A 4J0WA 3T3PA 4U7AA 3K71A 3FRXA 5C92A 3KRXB 4Y7RA 4LG9A 4J8GA 5TEFA 3PSCB 5TF2A 3EU7A 3F3GA 1H2XA 4QQEA 1K8KC 3A0FA 1E8NA 2AGXA 1MG2A 3E0CA 4E5ZB 4BUJC 2H14A 2MTAH 4BH6A 3NVQA 5HDBA 3UR4A 3MUOA 3I8EA 3RRMC 2I3TA 4A08B 3MZLA 3HFQA 4A09A 5IC7A 2P9UC 5C9ZB 4PNKB 5GSAA 4O2WA 5E6RA 4CZYA 1O6FA 3MVDK 3C5MA 4QAMA 1VYHC 3CFSB 3K6SA 2AQ5A 1ERJA 1NEXB 3O4IA 4BCCA 1UOPA 2XDWA 1OLZA 4HDJA 4TZ4A 4D0KA 4K3ID 3EWEA 1N6DA 3ZDZA 4O1QD 4WK0A 2VDNA 4N14A 4ZOXA 4JSPC 3F3FA 3MZKA 4J86A 2B5MA 5EAMA 3AL8B 2AH1A 4A09B 4FB1D 4H5JA 3T3MA 2CN2A 3ZDYA 4RE5A 3ODTA 3UVOA 2VZ3A 5EMLB 1GP2B 2H13A 3IJ1A 3OF7A 2YNNA 2HKRA 4A2MA 3O4GA 5AMSA 1UOOA 3I7KA 3P4FA 2H9MA 1VE6A 4NAAA 4JT6C 3RSEC 4X3EA 4GGDA 2QXVA 4D6VA 4Z7QA 3JAMg 1I2MB 3PXWD 4CZXA 2P9NC 5IGOA 1B9YA 5CXBA 3SHFA 5IGQA 3C99A 4AOWA 1TYEA 3EMHA 4QL1A 3EI2A 3O4JA 2IWKA 2H47A 4J73A 3JROA 3JRPA 4LGNA 2VDPA 4CY1A 3C75H 3SBQA 2CO0C 4K3JB 4NSXA 3SBRA 2QZPA 5HYNB 5GXIA 3V4VA 5E6SA 3OKTA 2G99A 3K72A 2PM9A 1L0QA 3ORVD 3I89A 4AX4A 5HE1B 3EI1B 2XL2A 3IURA 3DDUA 4L1QD 2AGLA 3EI2B 3BWSA 3IVMA 4O02A 1GOHA 2BBKH 1SQJA 4ZOVA 2OVRB 3VGZA 2YBAA 1M1XA 5EALA 3UVNA 2O9KA 2Z2OA 3I8CA 2WQ8A 4CI3A 5K1CC 3JPXA 1B9XA 3K26A 3OTTA 2IAAA 4O45A 4UM9A 2J55H 2PM6B 2VDRA 3NVNA 2HU7A 2PM9B 5THAA 1XIPA 4BL0A 5M5TA 4JSVC 4DNUA 1MG3A 3DXMC 3NIFA 3ZE0A 1JMZB 3SBPA 1A12A 4Z7OA 1N6EA 1MDAH 2QC5A 3VA6A 3W15A 4MMXA 4DNWA 1YR2A 2I0TA 2P9IC 3I7OA 4PBZA 3OL2A 2OVPB 2OVQB 3V7DB 4CZVA 5CYKA 2IWFA 3GREA 3FGBA 3IKOA 4CY2A 3B7FA 1TBGA 2GC4A 4J8BA 4BCBA 4ERQA 4NENA 2EBSA 3UVMA 3MKQA 4A0AA 4WJKA 2VDLA 2P9SC 5H14A 1U4CA 3J80g 3MMYA 5SXMA 2BCJB 5H17A 1GOTB 3BG1A 4FA1D 3FCSA 2UZXB 3EQ8A 3UVLA 2OK6A 2XU7A 3EQ7A 2UZYB 4BCDA 3JZHA 3UKUC 4YVDA 4R7AB 4CI2A 4Z8LA 1R5MA 5CYKB 3V9FA 3RFGA 5C2WB 3SMRA 1C9IA 2CO0A 4JSXC 5B4WA 3ZWLB 4ESGA 3I2NA 4D9SA 1YFQA 4XYIA 4A0AB 3OKWA 1GOFA 4JT5C 3JZGA 2TRCB 4NC4A 4PSWB 4Z7NA 5M5RA 1C9LA 1JMXB 3IUNA 4RE6A 1P22A 5M61A 1Q47A 5EM2A 3RLMD 3CFVA 2VDMA 4J82A 3PXTD 3V5WB 5CXCA 1QFMA 2W18A 4A11A 5EMKB 3IULA 1GXRA 1VZ2A 4J81A 4UM8A 4L3GD 4JSNC 4MMZA 3EI4A 1T2XA 3JZNA 4L9OA 2AGWA 2IUPA 5I5MA 3ZDXA 5FFOA 5I5IA 3IUJA 4H5IA 3N0EA 3OW8A 4BP9A 1SQ9A 1U2VC 2HJBA 4GQBB 3IIWA 3JB9L 4XYHA 2P9KC 5M5VA 5I5JA 3I7HA 4J87A 4A7JA 2GNQA 4CI8A 2H3XA 5M5SA 5HE3B 4DNVA 4OZUA 1GOGA 1VZ3A 1SHYB 5CXCB 3SXTD 4A11B 2IUVA 1BPOA 3PSLA 3SLED 3RN1D 2YNOA 4ZOZA 4ERZA 4FAVD 1JOFA 4PBYA 4PXWA 3UVKA 1QNIA 4AN1A 5TEEA 2EIBA 4GM9A 4IRZA 2AH0A 3PVWB 5HE0B 2XE4A 3QI0A 4AMYA 3J81g 1E5TA 4AEZA 5AFU3 3EQ9A 3ZE2A 2OIZA 5CXBB 2VDQA 2EICA 1H2YA 4G56B 1PI6A 4GMBA 4BP8A 2HKMA 4NBMA 4X61B 1JV2A 3AFCA 3SFZA 2PM7B 1A0RB 4PC0A 2YMUA 2AGZA 3IUMA 4FA4D 2HXCA 2CE8A 2H9LA 5EMMB 4GQ2P 2CE9A 3N0DA 4CI1A 2VZ1A 2YB8B 5EAPA 4GGCA 4GGAA 4FAND 4QRJA 1N6FA 4AN0A 5FKSA 3V4PA 3FM0A 5E6UA 2VDKA 2G9AA 2I3SA 5H1MA 4AMZA 4CY5A 2YNPA 5HE2B 2H9NA 3DM0A 4A08A 3L4MD 2B4EA 3NIGA 4G55A 3I7NA 4L3HD 3EG6A 4LG8A 2XYIA 3K27A 4J77A 3VH0A 2HU5A 1OMWB 4J79A 4JXMA 3SWSD 3PXSD 3ZE1A 4PSXB 4GZ8A 3OKYA 4ZN4A 5GXHA 4CC9A 5FLXg 1PBYB 3OL2B 4Y5RD 3CIKB 3DXKC 3PE7A 1PGUA 5AJAA 1U8CA 5IJ8E 2P9LC 4A2LA 5FKTA 3MKSB 4O3TB 1S4UX 3AL8A 4XEIC 1NR0A 5IJ7E 2AGYA 3DWLC 4G1MA 5C2VB 5IT9g 1JJUB 3IJEA 4OWRA 1TYQC 4WK2A 2BKLA 5C86A 3GC3B 2HJ4A 3IJCA 1H2ZA 3OKYB 3GD1I 1FWXA 3RMZD 4MK0B 5HQGA 5M5UA 2CN3A 2VDOA 3PVUB 2XZGA 1RI6A 4JD2C 1UOQA 4CY3A 1XKSA 2EIDA 2VC2A 2H6NA 4ES0A 3KCIA 2XL3A 1K3IA 2QR5A 3EI3A 1L5GA 3QHYB 3NVXA 4A0BA 4O9DA 4GM8A 5KDOB 4ERYA 5K19A 3F3PA 5EM2B 2IUQA 4L1MA 5FKRA 3MXXA 3UKRC 2I0SA 4U1EI 3RFHA 1UTCA 3U4YA 3EI4B 3VI3A 4EWRA 4E54A 5EMJB 3EI1A 3MUNA 3L4OD 4I79A 4QT8A 3SN6B 3ULEC 4J78A 2Z2NA 4FHLA 4UI9R 3EI3B 5FKQA 5FXYA 5EARA 3VI4A 2J56H 4FA5D 3I7PA 3SCYA 3GFCA 4A0BB 3SJLD 2H6KA 2H68A 5TDHB 2PBIB 1H2WA 4GM3A 4O3UB 1K32A 3KRWB 2P9PC 4JHNA 2Z2PA 3BG0A 2B5LA 4FA9D 5FQDA 2CNXA 4X63B 4E54B 1E8MA 1GG2B 4ZOYA 2I0RA 2OJYA 2HU8A 1QFSA 4MMYA 4X60B 3AL9A 2JKXA 3NIDA 2HYEA 5GMKn 4IA9A 4KFMB 2HESX 4GQ1A 3IUQA 5FA5B 2IURA 4WK4A 5FFGA 4E5ZA 3I7LA 4J0XA
chains in the Genus database with same CATH topology
4J84A 2Q7QA 5JWZA 3DSMA 4IMMA 1XHMA 4FWWA 3RN0D 2OK4A 2H9PA 3IJ0A 1PEVA 2H6QA 5A2Qg 2GC7A 2B5NA 3IIYA 2J57G 3SVWD 3AH8B 3C9CA 4J0WA 4U7AA 3FRXA 3KRXB 4Y7RA 4LG9A 4J8GA 5TEFA 3PSCB 5TF2A 3EU7A 3F3GA 4QQEA 1K8KC 3A0FA 2AGXA 3E0CA 1MG2A 4E5ZB 4BUJC 2H14A 2MTAH 4BH6A 3NVQA 3UR4A 3I8EA 3RRMC 2I3TA 4A08B 3MZLA 3HFQA 4A09A 5IC7A 2P9UC 5C9ZB 4PNKB 5GSAA 4CZYA 3C5MA 1VYHC 3CFSB 2AQ5A 1ERJA 1NEXB 1OLZA 4HDJA 4TZ4A 4D0KA 4K3ID 3EWEA 1N6DA 4O1QD 4N14A 4ZOXA 4JSPC 3F3FA 3MZKA 4J86A 2B5MA 5EAMA 3AL8B 2AH1A 4A09B 4FB1D 4H5JA 2CN2A 3ODTA 3UVOA 5EMLB 1GP2B 2H13A 3IJ1A 2YNNA 2HKRA 4A2MA 5AMSA 3I7KA 3P4FA 2H9MA 4JT6C 3RSEC 4X3EA 4GGDA 2QXVA 4D6VA 3JAMg 3PXWD 4CZXA 2P9NC 5IGOA 1B9YA 5CXBA 3SHFA 5IGQA 3C99A 4AOWA 3EMHA 4QL1A 3EI2A 2IWKA 2H47A 4J73A 3JROA 3JRPA 4LGNA 4CY1A 3C75H 3SBQA 2CO0C 4K3JB 4NSXA 3SBRA 5HYNB 5GXIA 3OKTA 2G99A 2PM9A 1L0QA 3ORVD 3I89A 5HE1B 3EI1B 2XL2A 4L1QD 2AGLA 3EI2B 3BWSA 2BBKH 1SQJA 4ZOVA 2OVRB 3VGZA 2YBAA 5EALA 3UVNA 2O9KA 2Z2OA 3I8CA 4CI3A 5K1CC 3JPXA 1B9XA 3K26A 3OTTA 2IAAA 4O45A 2J55H 2PM6B 3NVNA 2PM9B 5THAA 1XIPA 4BL0A 4JSVC 1MG3A 3DXMC 1JMZB 3SBPA 1N6EA 1MDAH 2QC5A 3VA6A 3W15A 2I0TA 2P9IC 3I7OA 4PBZA 3OL2A 2OVPB 2OVQB 3V7DB 4CZVA 5CYKA 2IWFA 3GREA 3FGBA 3IKOA 4CY2A 3B7FA 1TBGA 2GC4A 4J8BA 4ERQA 2EBSA 3UVMA 3MKQA 4A0AA 2P9SC 5H14A 1U4CA 3J80g 3MMYA 5SXMA 2BCJB 5H17A 1GOTB 3BG1A 4FA1D 2UZXB 3UVLA 2OK6A 2XU7A 2UZYB 3JZHA 3UKUC 4YVDA 4R7AB 4CI2A 4Z8LA 1R5MA 5CYKB 3V9FA 3RFGA 5C2WB 3SMRA 5B4WA 2CO0A 4JSXC 3ZWLB 4ESGA 3I2NA 1YFQA 4XYIA 4A0AB 3OKWA 4JT5C 3JZGA 2TRCB 4PSWB 1JMXB 1P22A 1Q47A 5EM2A 3RLMD 3CFVA 4J82A 3PXTD 3V5WB 5CXCA 2W18A 4A11A 5EMKB 1GXRA 4J81A 4L3GD 4JSNC 3EI4A 3JZNA 4L9OA 2AGWA 2IUPA 5I5MA 5I5IA 4H5IA 3N0EA 3OW8A 1SQ9A 1U2VC 2HJBA 4GQBB 3IIWA 3JB9L 4XYHA 2P9KC 5I5JA 3I7HA 4J87A 4A7JA 2GNQA 4CI8A 2H3XA 5HE3B 4OZUA 1SHYB 5CXCB 3SXTD 4A11B 2IUVA 3PSLA 3SLED 3RN1D 2YNOA 4ZOZA 4ERZA 4FAVD 1JOFA 4PBYA 4PXWA 3UVKA 1QNIA 5TEEA 4GM9A 2AH0A 3PVWB 5HE0B 3J81g 4AEZA 5AFU3 2OIZA 5CXBB 4G56B 1PI6A 4GMBA 2HKMA 4X61B 3AFCA 3SFZA 2PM7B 1A0RB 4PC0A 2YMUA 2AGZA 4FA4D 2HXCA 2CE8A 2H9LA 5EMMB 4GQ2P 2CE9A 3N0DA 4CI1A 2YB8B 5EAPA 4GGCA 4GGAA 4FAND 4QRJA 1N6FA 5FKSA 3FM0A 2G9AA 2I3SA 5H1MA 4CY5A 2YNPA 5HE2B 2H9NA 3DM0A 4A08A 3L4MD 2B4EA 3I7NA 4L3HD 4LG8A 3EG6A 2XYIA 3K27A 4J77A 3VH0A 1OMWB 4J79A 4JXMA 3SWSD 3PXSD 4PSXB 4GZ8A 3OKYA 4ZN4A 5GXHA 4CC9A 5FLXg 1PBYB 3OL2B 4Y5RD 3CIKB 3DXKC 3PE7A 1PGUA 5AJAA 5IJ8E 2P9LC 4A2LA 5FKTA 3MKSB 4O3TB 1S4UX 3AL8A 4XEIC 1NR0A 5IJ7E 2AGYA 3DWLC 5C2VB 5IT9g 1JJUB 4OWRA 1TYQC 2HJ4A 3IJCA 3OKYB 1FWXA 3RMZD 4MK0B 5HQGA 2CN3A 3PVUB 1RI6A 4JD2C 4CY3A 1XKSA 2H6NA 4ES0A 2XL3A 3EI3A 3NVXA 4A0BA 4O9DA 4GM8A 5KDOB 4ERYA 5K19A 3F3PA 5EM2B 2IUQA 5FKRA 3MXXA 3UKRC 2I0SA 4U1EI 3RFHA 3U4YA 3EI4B 4EWRA 4E54A 5EMJB 3EI1A 3L4OD 4I79A 4QT8A 3SN6B 3ULEC 4J78A 2Z2NA 4FHLA 4UI9R 3EI3B 5FKQA 5FXYA 5EARA 2J56H 4FA5D 3I7PA 3SCYA 3GFCA 4A0BB 3SJLD 2H6KA 2H68A 5TDHB 2PBIB 4GM3A 4O3UB 1K32A 3KRWB 2P9PC 2Z2PA 3BG0A 2B5LA 4FA9D 5FQDA 2CNXA 4X63B 4E54B 1GG2B 4ZOYA 2I0RA 2OJYA 4X60B 3AL9A 2HYEA 5GMKn 4IA9A 4KFMB 2HESX 4GQ1A 5FA5B 2IURA 4E5ZA 3I7LA 4J0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J84 A;  2Q7Q A;  5JWZ A;  3DSM A;  4IMM A;  1XHM A;  4FWW A;  3RN0 D;  2OK4 A;  2H9P A;  3IJ0 A;  1PEV A;  2H6Q A;  5A2Q g;  2GC7 A;  2B5N A;  3IIY A;  2J57 G;  3SVW D;  3AH8 B;  3C9C A;  4J0W A;  4U7A A;  3FRX A;  3KRX B;  4Y7R A;  4LG9 A;  4J8G A;  5TEF A;  3PSC B;  5TF2 A;  3EU7 A;  3F3G A;  4QQE A;  1K8K C;  3A0F A;  2AGX A;  3E0C A;  1MG2 A;  4E5Z B;  4BUJ C;  2H14 A;  2MTA H;  4BH6 A;  3NVQ A;  3UR4 A;  3I8E A;  3RRM C;  2I3T A;  4A08 B;  3MZL A;  3HFQ A;  4A09 A;  5IC7 A;  2P9U C;  5C9Z B;  4PNK B;  5GSA A;  4CZY A;  3C5M A;  1VYH C;  3CFS B;  2AQ5 A;  1ERJ A;  1NEX B;  1OLZ A;  4HDJ A;  4TZ4 A;  4D0K A;  4K3I D;  3EWE A;  1N6D A;  4O1Q D;  4N14 A;  4ZOX A;  4JSP C;  3F3F A;  3MZK A;  4J86 A;  2B5M A;  5EAM A;  3AL8 B;  2AH1 A;  4A09 B;  4FB1 D;  4H5J A;  2CN2 A;  3ODT A;  3UVO A;  5EML B;  1GP2 B;  2H13 A;  3IJ1 A;  2YNN A;  2HKR A;  4A2M A;  5AMS A;  3I7K A;  3P4F A;  2H9M A;  4JT6 C;  3RSE C;  4X3E A;  4GGD A;  2QXV A;  4D6V A;  3JAM g;  3PXW D;  4CZX A;  2P9N C;  5IGO A;  1B9Y A;  5CXB A;  3SHF A;  5IGQ A;  3C99 A;  4AOW A;  3EMH A;  4QL1 A;  3EI2 A;  2IWK A;  2H47 A;  4J73 A;  3JRO A;  3JRP A;  4LGN A;  4CY1 A;  3C75 H;  3SBQ A;  2CO0 C;  4K3J B;  4NSX A;  3SBR A;  5HYN B;  5GXI A;  3OKT A;  2G99 A;  2PM9 A;  1L0Q A;  3ORV D;  3I89 A;  5HE1 B;  3EI1 B;  2XL2 A;  4L1Q D;  2AGL A;  3EI2 B;  3BWS A;  2BBK H;  1SQJ A;  4ZOV A;  2OVR B;  3VGZ A;  2YBA A;  5EAL A;  3UVN A;  2O9K A;  2Z2O A;  3I8C A;  4CI3 A;  5K1C C;  3JPX A;  1B9X A;  3K26 A;  3OTT A;  2IAA A;  4O45 A;  2J55 H;  2PM6 B;  3NVN A;  2PM9 B;  5THA A;  1XIP A;  4BL0 A;  4JSV C;  1MG3 A;  3DXM C;  1JMZ B;  3SBP A;  1N6E A;  1MDA H;  2QC5 A;  3VA6 A;  3W15 A;  2I0T A;  2P9I C;  3I7O A;  4PBZ A;  3OL2 A;  2OVP B;  2OVQ B;  3V7D B;  4CZV A;  5CYK A;  2IWF A;  3GRE A;  3FGB A;  3IKO A;  4CY2 A;  3B7F A;  1TBG A;  2GC4 A;  4J8B A;  4ERQ A;  2EBS A;  3UVM A;  3MKQ A;  4A0A A;  2P9S C;  5H14 A;  1U4C A;  3J80 g;  3MMY A;  5SXM A;  2BCJ B;  5H17 A;  1GOT B;  3BG1 A;  4FA1 D;  2UZX B;  3UVL A;  2OK6 A;  2XU7 A;  2UZY B;  3JZH A;  3UKU C;  4YVD A;  4R7A B;  4CI2 A;  4Z8L A;  1R5M A;  5CYK B;  3V9F A;  3RFG A;  5C2W B;  3SMR A;  5B4W A;  2CO0 A;  4JSX C;  3ZWL B;  4ESG A;  3I2N A;  1YFQ A;  4XYI A;  4A0A B;  3OKW A;  4JT5 C;  3JZG A;  2TRC B;  4PSW B;  1JMX B;  1P22 A;  1Q47 A;  5EM2 A;  3RLM D;  3CFV A;  4J82 A;  3PXT D;  3V5W B;  5CXC A;  2W18 A;  4A11 A;  5EMK B;  1GXR A;  4J81 A;  4L3G D;  4JSN C;  3EI4 A;  3JZN A;  4L9O A;  2AGW A;  2IUP A;  5I5M A;  5I5I A;  4H5I A;  3N0E A;  3OW8 A;  1SQ9 A;  1U2V C;  2HJB A;  4GQB B;  3IIW A;  3JB9 L;  4XYH A;  2P9K C;  5I5J A;  3I7H A;  4J87 A;  4A7J A;  2GNQ A;  4CI8 A;  2H3X A;  5HE3 B;  4OZU A;  1SHY B;  5CXC B;  3SXT D;  4A11 B;  2IUV A;  3PSL A;  3SLE D;  3RN1 D;  2YNO A;  4ZOZ A;  4ERZ A;  4FAV D;  1JOF A;  4PBY A;  4PXW A;  3UVK A;  1QNI A;  5TEE A;  4GM9 A;  2AH0 A;  3PVW B;  5HE0 B;  3J81 g;  4AEZ A;  5AFU 3;  2OIZ A;  5CXB B;  4G56 B;  1PI6 A;  4GMB A;  2HKM A;  4X61 B;  3AFC A;  3SFZ A;  2PM7 B;  1A0R B;  4PC0 A;  2YMU A;  2AGZ A;  4FA4 D;  2HXC A;  2CE8 A;  2H9L A;  5EMM B;  4GQ2 P;  2CE9 A;  3N0D A;  4CI1 A;  2YB8 B;  5EAP A;  4GGC A;  4GGA A;  4FAN D;  4QRJ A;  1N6F A;  5FKS A;  3FM0 A;  2G9A A;  2I3S A;  5H1M A;  4CY5 A;  2YNP A;  5HE2 B;  2H9N A;  3DM0 A;  4A08 A;  3L4M D;  2B4E A;  3I7N A;  4L3H D;  4LG8 A;  3EG6 A;  2XYI A;  3K27 A;  4J77 A;  3VH0 A;  1OMW B;  4J79 A;  4JXM A;  3SWS D;  3PXS D;  4PSX B;  4GZ8 A;  3OKY A;  4ZN4 A;  5GXH A;  4CC9 A;  5FLX g;  1PBY B;  3OL2 B;  4Y5R D;  3CIK B;  3DXK C;  3PE7 A;  1PGU A;  5AJA A;  5IJ8 E;  2P9L C;  4A2L A;  5FKT A;  3MKS B;  4O3T B;  1S4U X;  3AL8 A;  4XEI C;  1NR0 A;  5IJ7 E;  2AGY A;  3DWL C;  5C2V B;  5IT9 g;  1JJU B;  4OWR A;  1TYQ C;  2HJ4 A;  3IJC A;  3OKY B;  1FWX A;  3RMZ D;  4MK0 B;  5HQG A;  2CN3 A;  3PVU B;  1RI6 A;  4JD2 C;  4CY3 A;  1XKS A;  2H6N A;  4ES0 A;  2XL3 A;  3EI3 A;  3NVX A;  4A0B A;  4O9D A;  4GM8 A;  5KDO B;  4ERY A;  5K19 A;  3F3P A;  5EM2 B;  2IUQ A;  5FKR A;  3MXX A;  3UKR C;  2I0S A;  4U1E I;  3RFH A;  3U4Y A;  3EI4 B;  4EWR A;  4E54 A;  5EMJ B;  3EI1 A;  3L4O D;  4I79 A;  4QT8 A;  3SN6 B;  3ULE C;  4J78 A;  2Z2N A;  4FHL A;  4UI9 R;  3EI3 B;  5FKQ A;  5FXY A;  5EAR A;  2J56 H;  4FA5 D;  3I7P A;  3SCY A;  3GFC A;  4A0B B;  3SJL D;  2H6K A;  2H68 A;  5TDH B;  2PBI B;  4GM3 A;  4O3U B;  1K32 A;  3KRW B;  2P9P C;  2Z2P A;  3BG0 A;  2B5L A;  4FA9 D;  5FQD A;  2CNX A;  4X63 B;  4E54 B;  1GG2 B;  4ZOY A;  2I0R A;  2OJY A;  4X60 B;  3AL9 A;  2HYE A;  5GMK n;  4IA9 A;  4KFM B;  2HES X;  4GQ1 A;  5FA5 B;  2IUR A;  4E5Z A;  3I7L A;  4J0X A; 
#chains in the Genus database with same CATH topology
 4J84 A;  1O6G A;  2Q7Q A;  1JTD B;  5JWZ A;  4G1E A;  3DSM A;  4IMM A;  1XHM A;  4FWW A;  4JHP C;  3RN0 D;  2OK4 A;  2H9P A;  3IJ0 A;  3O4H A;  1PEV A;  2EIE A;  2H6Q A;  5A2Q g;  2GC7 A;  3FCU A;  2B5N A;  3IIY A;  2J57 G;  3SVW D;  3AH8 B;  3C9C A;  1VE7 A;  4J0W A;  3T3P A;  4U7A A;  3K71 A;  3FRX A;  5C92 A;  3KRX B;  4Y7R A;  4LG9 A;  4J8G A;  5TEF A;  3PSC B;  5TF2 A;  3EU7 A;  3F3G A;  1H2X A;  4QQE A;  1K8K C;  3A0F A;  1E8N A;  2AGX A;  1MG2 A;  3E0C A;  4E5Z B;  4BUJ C;  2H14 A;  2MTA H;  4BH6 A;  3NVQ A;  5HDB A;  3UR4 A;  3MUO A;  3I8E A;  3RRM C;  2I3T A;  4A08 B;  3MZL A;  3HFQ A;  4A09 A;  5IC7 A;  2P9U C;  5C9Z B;  4PNK B;  5GSA A;  4O2W A;  5E6R A;  4CZY A;  1O6F A;  3MVD K;  3C5M A;  4QAM A;  1VYH C;  3CFS B;  3K6S A;  2AQ5 A;  1ERJ A;  1NEX B;  3O4I A;  4BCC A;  1UOP A;  2XDW A;  1OLZ A;  4HDJ A;  4TZ4 A;  4D0K A;  4K3I D;  3EWE A;  1N6D A;  3ZDZ A;  4O1Q D;  4WK0 A;  2VDN A;  4N14 A;  4ZOX A;  4JSP C;  3F3F A;  3MZK A;  4J86 A;  2B5M A;  5EAM A;  3AL8 B;  2AH1 A;  4A09 B;  4FB1 D;  4H5J A;  3T3M A;  2CN2 A;  3ZDY A;  4RE5 A;  3ODT A;  3UVO A;  2VZ3 A;  5EML B;  1GP2 B;  2H13 A;  3IJ1 A;  3OF7 A;  2YNN A;  2HKR A;  4A2M A;  3O4G A;  5AMS A;  1UOO A;  3I7K A;  3P4F A;  2H9M A;  1VE6 A;  4NAA A;  4JT6 C;  3RSE C;  4X3E A;  4GGD A;  2QXV A;  4D6V A;  4Z7Q A;  3JAM g;  1I2M B;  3PXW D;  4CZX A;  2P9N C;  5IGO A;  1B9Y A;  5CXB A;  3SHF A;  5IGQ A;  3C99 A;  4AOW A;  1TYE A;  3EMH A;  4QL1 A;  3EI2 A;  3O4J A;  2IWK A;  2H47 A;  4J73 A;  3JRO A;  3JRP A;  4LGN A;  2VDP A;  4CY1 A;  3C75 H;  3SBQ A;  2CO0 C;  4K3J B;  4NSX A;  3SBR A;  2QZP A;  5HYN B;  5GXI A;  3V4V A;  5E6S A;  3OKT A;  2G99 A;  3K72 A;  2PM9 A;  1L0Q A;  3ORV D;  3I89 A;  4AX4 A;  5HE1 B;  3EI1 B;  2XL2 A;  3IUR A;  3DDU A;  4L1Q D;  2AGL A;  3EI2 B;  3BWS A;  3IVM A;  4O02 A;  1GOH A;  2BBK H;  1SQJ A;  4ZOV A;  2OVR B;  3VGZ A;  2YBA A;  1M1X A;  5EAL A;  3UVN A;  2O9K A;  2Z2O A;  3I8C A;  2WQ8 A;  4CI3 A;  5K1C C;  3JPX A;  1B9X A;  3K26 A;  3OTT A;  2IAA A;  4O45 A;  4UM9 A;  2J55 H;  2PM6 B;  2VDR A;  3NVN A;  2HU7 A;  2PM9 B;  5THA A;  1XIP A;  4BL0 A;  5M5T A;  4JSV C;  4DNU A;  1MG3 A;  3DXM C;  3NIF A;  3ZE0 A;  1JMZ B;  3SBP A;  1A12 A;  4Z7O A;  1N6E A;  1MDA H;  2QC5 A;  3VA6 A;  3W15 A;  4MMX A;  4DNW A;  1YR2 A;  2I0T A;  2P9I C;  3I7O A;  4PBZ A;  3OL2 A;  2OVP B;  2OVQ B;  3V7D B;  4CZV A;  5CYK A;  2IWF A;  3GRE A;  3FGB A;  3IKO A;  4CY2 A;  3B7F A;  1TBG A;  2GC4 A;  4J8B A;  4BCB A;  4ERQ A;  4NEN A;  2EBS A;  3UVM A;  3MKQ A;  4A0A A;  4WJK A;  2VDL A;  2P9S C;  5H14 A;  1U4C A;  3J80 g;  3MMY A;  5SXM A;  2BCJ B;  5H17 A;  1GOT B;  3BG1 A;  4FA1 D;  3FCS A;  2UZX B;  3EQ8 A;  3UVL A;  2OK6 A;  2XU7 A;  3EQ7 A;  2UZY B;  4BCD A;  3JZH A;  3UKU C;  4YVD A;  4R7A B;  4CI2 A;  4Z8L A;  1R5M A;  5CYK B;  3V9F A;  3RFG A;  5C2W B;  3SMR A;  1C9I A;  2CO0 A;  4JSX C;  5B4W A;  3ZWL B;  4ESG A;  3I2N A;  4D9S A;  1YFQ A;  4XYI A;  4A0A B;  3OKW A;  1GOF A;  4JT5 C;  3JZG A;  2TRC B;  4NC4 A;  4PSW B;  4Z7N A;  5M5R A;  1C9L A;  1JMX B;  3IUN A;  4RE6 A;  1P22 A;  5M61 A;  1Q47 A;  5EM2 A;  3RLM D;  3CFV A;  2VDM A;  4J82 A;  3PXT D;  3V5W B;  5CXC A;  1QFM A;  2W18 A;  4A11 A;  5EMK B;  3IUL A;  1GXR A;  1VZ2 A;  4J81 A;  4UM8 A;  4L3G D;  4JSN C;  4MMZ A;  3EI4 A;  1T2X A;  3JZN A;  4L9O A;  2AGW A;  2IUP A;  5I5M A;  3ZDX A;  5FFO A;  5I5I A;  3IUJ A;  4H5I A;  3N0E A;  3OW8 A;  4BP9 A;  1SQ9 A;  1U2V C;  2HJB A;  4GQB B;  3IIW A;  3JB9 L;  4XYH A;  2P9K C;  5M5V A;  5I5J A;  3I7H A;  4J87 A;  4A7J A;  2GNQ A;  4CI8 A;  2H3X A;  5M5S A;  5HE3 B;  4DNV A;  4OZU A;  1GOG A;  1VZ3 A;  1SHY B;  5CXC B;  3SXT D;  4A11 B;  2IUV A;  1BPO A;  3PSL A;  3SLE D;  3RN1 D;  2YNO A;  4ZOZ A;  4ERZ A;  4FAV D;  1JOF A;  4PBY A;  4PXW A;  3UVK A;  1QNI A;  4AN1 A;  5TEE A;  2EIB A;  4GM9 A;  4IRZ A;  2AH0 A;  3PVW B;  5HE0 B;  2XE4 A;  3QI0 A;  4AMY A;  3J81 g;  1E5T A;  4AEZ A;  5AFU 3;  3EQ9 A;  3ZE2 A;  2OIZ A;  5CXB B;  2VDQ A;  2EIC A;  1H2Y A;  4G56 B;  1PI6 A;  4GMB A;  4BP8 A;  2HKM A;  4NBM A;  4X61 B;  1JV2 A;  3AFC A;  3SFZ A;  2PM7 B;  1A0R B;  4PC0 A;  2YMU A;  2AGZ A;  3IUM A;  4FA4 D;  2HXC A;  2CE8 A;  2H9L A;  5EMM B;  4GQ2 P;  2CE9 A;  3N0D A;  4CI1 A;  2VZ1 A;  2YB8 B;  5EAP A;  4GGC A;  4GGA A;  4FAN D;  4QRJ A;  1N6F A;  4AN0 A;  5FKS A;  3V4P A;  3FM0 A;  5E6U A;  2VDK A;  2G9A A;  2I3S A;  5H1M A;  4AMZ A;  4CY5 A;  2YNP A;  5HE2 B;  2H9N A;  3DM0 A;  4A08 A;  3L4M D;  2B4E A;  3NIG A;  4G55 A;  3I7N A;  4L3H D;  3EG6 A;  4LG8 A;  2XYI A;  3K27 A;  4J77 A;  3VH0 A;  2HU5 A;  1OMW B;  4J79 A;  4JXM A;  3SWS D;  3PXS D;  3ZE1 A;  4PSX B;  4GZ8 A;  3OKY A;  4ZN4 A;  5GXH A;  4CC9 A;  5FLX g;  1PBY B;  3OL2 B;  4Y5R D;  3CIK B;  3DXK C;  3PE7 A;  1PGU A;  5AJA A;  1U8C A;  5IJ8 E;  2P9L C;  4A2L A;  5FKT A;  3MKS B;  4O3T B;  1S4U X;  3AL8 A;  4XEI C;  1NR0 A;  5IJ7 E;  2AGY A;  3DWL C;  4G1M A;  5C2V B;  5IT9 g;  1JJU B;  3IJE A;  4OWR A;  1TYQ C;  4WK2 A;  2BKL A;  5C86 A;  3GC3 B;  2HJ4 A;  3IJC A;  1H2Z A;  3OKY B;  3GD1 I;  1FWX A;  3RMZ D;  4MK0 B;  5HQG A;  5M5U A;  2CN3 A;  2VDO A;  3PVU B;  2XZG A;  1RI6 A;  4JD2 C;  1UOQ A;  4CY3 A;  1XKS A;  2EID A;  2VC2 A;  2H6N A;  4ES0 A;  3KCI A;  2XL3 A;  1K3I A;  2QR5 A;  3EI3 A;  1L5G A;  3QHY B;  3NVX A;  4A0B A;  4O9D A;  4GM8 A;  5KDO B;  4ERY A;  5K19 A;  3F3P A;  5EM2 B;  2IUQ A;  4L1M A;  5FKR A;  3MXX A;  3UKR C;  2I0S A;  4U1E I;  3RFH A;  1UTC A;  3U4Y A;  3EI4 B;  3VI3 A;  4EWR A;  4E54 A;  5EMJ B;  3EI1 A;  3MUN A;  3L4O D;  4I79 A;  4QT8 A;  3SN6 B;  3ULE C;  4J78 A;  2Z2N A;  4FHL A;  4UI9 R;  3EI3 B;  5FKQ A;  5FXY A;  5EAR A;  3VI4 A;  2J56 H;  4FA5 D;  3I7P A;  3SCY A;  3GFC A;  4A0B B;  3SJL D;  2H6K A;  2H68 A;  5TDH B;  2PBI B;  1H2W A;  4GM3 A;  4O3U B;  1K32 A;  3KRW B;  2P9P C;  4JHN A;  2Z2P A;  3BG0 A;  2B5L A;  4FA9 D;  5FQD A;  2CNX A;  4X63 B;  4E54 B;  1E8M A;  1GG2 B;  4ZOY A;  2I0R A;  2OJY A;  2HU8 A;  1QFS A;  4MMY A;  4X60 B;  3AL9 A;  2JKX A;  3NID A;  2HYE A;  5GMK n;  4IA9 A;  4KFM B;  2HES X;  4GQ1 A;  3IUQ A;  5FA5 B;  2IUR A;  4WK4 A;  5FFG A;  4E5Z A;  3I7L A;  4J0X A; 
#chains in the Genus database with same CATH homology
 4J84 A;  2Q7Q A;  5JWZ A;  3DSM A;  4IMM A;  1XHM A;  4FWW A;  3RN0 D;  2OK4 A;  2H9P A;  3IJ0 A;  1PEV A;  2H6Q A;  5A2Q g;  2GC7 A;  2B5N A;  3IIY A;  2J57 G;  3SVW D;  3AH8 B;  3C9C A;  4J0W A;  4U7A A;  3FRX A;  3KRX B;  4Y7R A;  4LG9 A;  4J8G A;  5TEF A;  3PSC B;  5TF2 A;  3EU7 A;  3F3G A;  4QQE A;  1K8K C;  3A0F A;  2AGX A;  3E0C A;  1MG2 A;  4E5Z B;  4BUJ C;  2H14 A;  2MTA H;  4BH6 A;  3NVQ A;  3UR4 A;  3I8E A;  3RRM C;  2I3T A;  4A08 B;  3MZL A;  3HFQ A;  4A09 A;  5IC7 A;  2P9U C;  5C9Z B;  4PNK B;  5GSA A;  4CZY A;  3C5M A;  1VYH C;  3CFS B;  2AQ5 A;  1ERJ A;  1NEX B;  1OLZ A;  4HDJ A;  4TZ4 A;  4D0K A;  4K3I D;  3EWE A;  1N6D A;  4O1Q D;  4N14 A;  4ZOX A;  4JSP C;  3F3F A;  3MZK A;  4J86 A;  2B5M A;  5EAM A;  3AL8 B;  2AH1 A;  4A09 B;  4FB1 D;  4H5J A;  2CN2 A;  3ODT A;  3UVO A;  5EML B;  1GP2 B;  2H13 A;  3IJ1 A;  2YNN A;  2HKR A;  4A2M A;  5AMS A;  3I7K A;  3P4F A;  2H9M A;  4JT6 C;  3RSE C;  4X3E A;  4GGD A;  2QXV A;  4D6V A;  3JAM g;  3PXW D;  4CZX A;  2P9N C;  5IGO A;  1B9Y A;  5CXB A;  3SHF A;  5IGQ A;  3C99 A;  4AOW A;  3EMH A;  4QL1 A;  3EI2 A;  2IWK A;  2H47 A;  4J73 A;  3JRO A;  3JRP A;  4LGN A;  4CY1 A;  3C75 H;  3SBQ A;  2CO0 C;  4K3J B;  4NSX A;  3SBR A;  5HYN B;  5GXI A;  3OKT A;  2G99 A;  2PM9 A;  1L0Q A;  3ORV D;  3I89 A;  5HE1 B;  3EI1 B;  2XL2 A;  4L1Q D;  2AGL A;  3EI2 B;  3BWS A;  2BBK H;  1SQJ A;  4ZOV A;  2OVR B;  3VGZ A;  2YBA A;  5EAL A;  3UVN A;  2O9K A;  2Z2O A;  3I8C A;  4CI3 A;  5K1C C;  3JPX A;  1B9X A;  3K26 A;  3OTT A;  2IAA A;  4O45 A;  2J55 H;  2PM6 B;  3NVN A;  2PM9 B;  5THA A;  1XIP A;  4BL0 A;  4JSV C;  1MG3 A;  3DXM C;  1JMZ B;  3SBP A;  1N6E A;  1MDA H;  2QC5 A;  3VA6 A;  3W15 A;  2I0T A;  2P9I C;  3I7O A;  4PBZ A;  3OL2 A;  2OVP B;  2OVQ B;  3V7D B;  4CZV A;  5CYK A;  2IWF A;  3GRE A;  3FGB A;  3IKO A;  4CY2 A;  3B7F A;  1TBG A;  2GC4 A;  4J8B A;  4ERQ A;  2EBS A;  3UVM A;  3MKQ A;  4A0A A;  2P9S C;  5H14 A;  1U4C A;  3J80 g;  3MMY A;  5SXM A;  2BCJ B;  5H17 A;  1GOT B;  3BG1 A;  4FA1 D;  2UZX B;  3UVL A;  2OK6 A;  2XU7 A;  2UZY B;  3JZH A;  3UKU C;  4YVD A;  4R7A B;  4CI2 A;  4Z8L A;  1R5M A;  5CYK B;  3V9F A;  3RFG A;  5C2W B;  3SMR A;  5B4W A;  2CO0 A;  4JSX C;  3ZWL B;  4ESG A;  3I2N A;  1YFQ A;  4XYI A;  4A0A B;  3OKW A;  4JT5 C;  3JZG A;  2TRC B;  4PSW B;  1JMX B;  1P22 A;  1Q47 A;  5EM2 A;  3RLM D;  3CFV A;  4J82 A;  3PXT D;  3V5W B;  5CXC A;  2W18 A;  4A11 A;  5EMK B;  1GXR A;  4J81 A;  4L3G D;  4JSN C;  3EI4 A;  3JZN A;  4L9O A;  2AGW A;  2IUP A;  5I5M A;  5I5I A;  4H5I A;  3N0E A;  3OW8 A;  1SQ9 A;  1U2V C;  2HJB A;  4GQB B;  3IIW A;  3JB9 L;  4XYH A;  2P9K C;  5I5J A;  3I7H A;  4J87 A;  4A7J A;  2GNQ A;  4CI8 A;  2H3X A;  5HE3 B;  4OZU A;  1SHY B;  5CXC B;  3SXT D;  4A11 B;  2IUV A;  3PSL A;  3SLE D;  3RN1 D;  2YNO A;  4ZOZ A;  4ERZ A;  4FAV D;  1JOF A;  4PBY A;  4PXW A;  3UVK A;  1QNI A;  5TEE A;  4GM9 A;  2AH0 A;  3PVW B;  5HE0 B;  3J81 g;  4AEZ A;  5AFU 3;  2OIZ A;  5CXB B;  4G56 B;  1PI6 A;  4GMB A;  2HKM A;  4X61 B;  3AFC A;  3SFZ A;  2PM7 B;  1A0R B;  4PC0 A;  2YMU A;  2AGZ A;  4FA4 D;  2HXC A;  2CE8 A;  2H9L A;  5EMM B;  4GQ2 P;  2CE9 A;  3N0D A;  4CI1 A;  2YB8 B;  5EAP A;  4GGC A;  4GGA A;  4FAN D;  4QRJ A;  1N6F A;  5FKS A;  3FM0 A;  2G9A A;  2I3S A;  5H1M A;  4CY5 A;  2YNP A;  5HE2 B;  2H9N A;  3DM0 A;  4A08 A;  3L4M D;  2B4E A;  3I7N A;  4L3H D;  4LG8 A;  3EG6 A;  2XYI A;  3K27 A;  4J77 A;  3VH0 A;  1OMW B;  4J79 A;  4JXM A;  3SWS D;  3PXS D;  4PSX B;  4GZ8 A;  3OKY A;  4ZN4 A;  5GXH A;  4CC9 A;  5FLX g;  1PBY B;  3OL2 B;  4Y5R D;  3CIK B;  3DXK C;  3PE7 A;  1PGU A;  5AJA A;  5IJ8 E;  2P9L C;  4A2L A;  5FKT A;  3MKS B;  4O3T B;  1S4U X;  3AL8 A;  4XEI C;  1NR0 A;  5IJ7 E;  2AGY A;  3DWL C;  5C2V B;  5IT9 g;  1JJU B;  4OWR A;  1TYQ C;  2HJ4 A;  3IJC A;  3OKY B;  1FWX A;  3RMZ D;  4MK0 B;  5HQG A;  2CN3 A;  3PVU B;  1RI6 A;  4JD2 C;  4CY3 A;  1XKS A;  2H6N A;  4ES0 A;  2XL3 A;  3EI3 A;  3NVX A;  4A0B A;  4O9D A;  4GM8 A;  5KDO B;  4ERY A;  5K19 A;  3F3P A;  5EM2 B;  2IUQ A;  5FKR A;  3MXX A;  3UKR C;  2I0S A;  4U1E I;  3RFH A;  3U4Y A;  3EI4 B;  4EWR A;  4E54 A;  5EMJ B;  3EI1 A;  3L4O D;  4I79 A;  4QT8 A;  3SN6 B;  3ULE C;  4J78 A;  2Z2N A;  4FHL A;  4UI9 R;  3EI3 B;  5FKQ A;  5FXY A;  5EAR A;  2J56 H;  4FA5 D;  3I7P A;  3SCY A;  3GFC A;  4A0B B;  3SJL D;  2H6K A;  2H68 A;  5TDH B;  2PBI B;  4GM3 A;  4O3U B;  1K32 A;  3KRW B;  2P9P C;  2Z2P A;  3BG0 A;  2B5L A;  4FA9 D;  5FQD A;  2CNX A;  4X63 B;  4E54 B;  1GG2 B;  4ZOY A;  2I0R A;  2OJY A;  4X60 B;  3AL9 A;  2HYE A;  5GMK n;  4IA9 A;  4KFM B;  2HES X;  4GQ1 A;  5FA5 B;  2IUR A;  4E5Z A;  3I7L A;  4J0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...