3RRMC

S. cerevisiae dbp5 l327v bound to nup159, gle1 h337r, ip6 and adp
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
382
structure length
370
Chain Sequence
GASSLKDEVPTETSEDFGFKFLGQKQILPSFNEKLPFASLQNLDISNSKSLFVAASGSKAVVGELQLLRDHITSDSTPLTFKWEKEIPDVIFVCFHGDQVLVSTRNALYSLDLEELSEFRTVTSFEKPVFQLKNVNNTLVILNSVNDLSALDLRTKSTKQLAQNVTSFDVTNSQLAVLLKDRSFQSFAWRNGEMEKQFEFSLPSELEELPVEEYSPLSVTILSPQDFLAVFGNVISETDDEVSYDQKMYIIKHIDGSASFQETFDITPPFGQIVRFPYMYKVTLSGLIEPDANVNVLASSCSSEVSIWDSKQVIEPSQDSERAVLPISEETDKDTNPIGVAVDVVTSGTRLPLVYILNNEGSLQIVGLFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent RNA helicase DBP5
publication title A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP6 in mRNA export.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 81
structure length 370
sequence length 382
ec nomenclature
pdb deposition date 2011-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF16755 NUP214 Nucleoporin or Nuclear pore complex subunit NUP214=Nup159
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3rrmC00
2H9NA 5AMSA 2P9NC 3IKOA 3RN0D 5H1MA 3J81g 1XKSA 3MXXA 5FKRA 1S4UX 4J8BA 3NVQA 3FRXA 3K27A 4A0BB 4E5ZA 1JJUB 2HXCA 4CI2A 4A09A 4H5JA 4A0BA 2B4EA 5IC7A 3SWSD 4ZOXA 3J80g 3EU7A 4J84A 4J0WA 2Z2PA 2B5MA 4CI8A 4J78A 3W15A 3I8EA 5IGOA 3SBQA 2P9IC 4X63B 3VGZA 4E54B 1GOTB 5GSAA 2J56H 2GNQA 4E54A 1MDAH 1N6FA 4FHLA 3ODTA 3JZNA 3L4MD 5TEEA 5TDHB 3AH8B 1N6DA 1YFQA 4NSXA 4FA9D 4BH6A 3SCYA 4JSXC 4AEZA 3E0CA 3OL2A 3OKTA 2AGZA 1QNIA 5TEFA 4GM8A 4A08A 2XL3A 3PXWD 4CY5A 5SXMA 2G99A 1SQ9A 5EAPA 1SHYB 3EG6A 3PSCB 3EI1B 4Z8LA 1JOFA 1U2VC 3JZGA 4PBYA 4X61B 2YMUA 3EI1A 2BCJB 4CY1A 5AFU3 1XHMA 2Z2NA 3V7DB 2AGLA 4GM3A 3PXTD 2Q7QA 3SMRA 3RN1D 4J87A 4PSXB 3PE7A 2H9PA 3GREA 4MK0B 3I7HA 5HE2B 3JB9L 4FA5D 4QQEA 3P4FA 3GFCA 5C9ZB 4A2LA 4J8GA 4XEIC 4CZYA 5IJ7E 2PM6B 3UVNA 1PBYB 4CI1A 3L4OD 3V9FA 3JAMg 4CI3A 3NVXA 3I7NA 2BBKH 2W18A 4JXMA 2PM7B 3NVNA 4CC9A 4K3JB 3I7PA 5FXYA 3CFVA 4ES0A 4JSPC 2OVRB 2P9LC 3SXTD 1K32A 3I8CA 3JROA 2HESX 5EM2B 2IWKA 4GQ1A 4PC0A 2IUPA 4A11B 3OTTA 2H68A 1VYHC 3JPXA 5EAMA 5EM2A 3RFGA 2H13A 4FAND 3UR4A 1L0QA 1JMXB 4JD2C 4J73A 4GQ2P 4GGAA 5H17A 4A7JA 5TF2A 3F3FA 2AQ5A 3RRMC 1XIPA 4UI9R 1U4CA 4G56B 2P9KC 5FLXg 2O9KA 3PVUB 3CFSB 5CXCB 4LGNA 3EI4B 2XL2A 3KRWB 4J82A 4J81A 1P22A 2J57G 1RI6A 4J79A 3ZWLB 2PM9B 3U4YA 1OLZA 5EMLB 2I3TA 4CY2A 1TBGA 2I3SA 2YNNA 3MZKA 5GXIA 3F3PA 1MG3A 3DSMA 5IGQA 2H47A 5THAA 2CO0C 4N14A 4ZOYA 2QXVA 3IIWA 5KDOB 3VA6A 3V5WB 3N0DA 1B9YA 2HJ4A 4O3TB 3UKUC 2CE9A 4TZ4A 4EWRA 5EMJB 4QT8A 5GXHA 5A2Qg 2HYEA 4ZOVA 3ULEC 4CZVA 4ESGA 5IT9g 5AJAA 3C99A 3PSLA 3HFQA 1JMZB 4QL1A 4QRJA 5HE3B 3BG1A 5CYKB 2AH1A 4J77A 2OK4A 1PI6A 4J0XA 1MG2A 4FWWA 4A2MA 4IMMA 4LG9A 4Y5RD 1B9XA 5EMKB 2H9MA 3SBPA 4O45A 3DXMC 3SBRA 2PBIB 4OWRA 4ERQA 3KRXB 3EMHA 3AL8B 5K19A 3RSEC 4BUJC 3B7FA 5HE1B 5H14A 2IWFA 2YNPA 2CO0A 3AL8A 2IAAA 3SVWD 3C5MA 2TRCB 3SJLD 2GC4A 5EARA 4KFMB 5CXBB 4L3HD 3I7OA 4JT5C 4XYHA 3CIKB 3C75H 3EI2B 3N0EA 1ERJA 4CY3A 5C2WB 3IJCA 4ZOZA 3EI2A 3DWLC 3MKQA 2OK6A 2I0SA 2HKRA 4GQBB 2I0TA 3I7KA 5FKTA 2GC7A 4U1EI 4A11A 5FA5B 5FQDA 4Y7RA 5EMMB 5HYNB 2CE8A 5JWZA 2G9AA 4HDJA 5B4WA 4A0AB 3PXSD 1GXRA 2HKMA 4PXWA 5K1CC 4A0AA 2AGYA 5FKQA 3MKSB 4U7AA 3UVKA 4E5ZB 3AL9A 2P9UC 4FB1D 5I5IA 4A09B 4X60B 3PVWB 5CXCA 3RLMD 3AFCA 5EALA 3FGBA 3EI4A 2H14A 2YNOA 4OZUA 2UZXB 3IIYA 2CNXA 3JRPA 1GP2B 4ERZA 1NEXB 1FWXA 4JSNC 1PGUA 3ORVD 3EI3B 2B5LA 4I79A 2H6KA 2PM9A 1K8KC 2AGXA 3EI3A 5FKSA 2AGWA 3UVLA 2OVQB 4AOWA 3OKYB 4YVDA 1GG2B 4GGDA 2P9SC 4X3EA 3EWEA 3OKYA 4FA1D 4IA9A 4PBZA 5HE0B 2AH0A 2OIZA 3SHFA 3JZHA 4L9OA 3MZLA 2EBSA 2I0RA 4CZXA 4JSVC 4GMBA 3UKRC 2OJYA 3OL2B 3IJ1A 1PEVA 5GMKn 4A08B 4JT6C 3C9CA 4LG8A 4O1QD 2H6QA 3I2NA 1Q47A 3K26A 3DXKC 3OW8A 4XYIA 3UVOA 5IJ8E 2YB8B 2Z2OA 1R5MA 4O9DA 2B5NA 2XYIA 5CYKA 2CN2A 4H5IA 4GGCA 2CN3A 2UZYB 1A0RB 1N6EA 4FAVD 4J86A 2H3XA 4PSWB 4GZ8A 4GM9A 5I5MA 2MTAH 2J55H 3BWSA 3A0FA 2H6NA 3OKWA 4O3UB 4K3ID 1OMWB 3MMYA 4ZN4A 1NR0A 3BG0A 4R7AB 2P9PC 3F3GA 2OVPB 3SLED 1TYQC 5CXBA 3FM0A 4FA4D 2IUQA 5HQGA 4D0KA 2XU7A 3RFHA 4PNKB 4L3GD 5I5JA 3DM0A 3IJ0A 3I7LA 2IURA 4BL0A 2IUVA 3VH0A 3SN6B 3SFZA 3UVMA 2HJBA 4L1QD 5C2VB 2H9LA 3RMZD 1SQJA 3I89A 2YBAA 4D6VA 4ERYA 2QC5A
chains in the Genus database with same CATH superfamily
2H9NA 5AMSA 2P9NC 3IKOA 3RN0D 1GOFA 5H1MA 4BCCA 3J81g 1XKSA 3MXXA 3GC3B 5FKRA 1S4UX 4J8BA 3NVQA 3FRXA 3K27A 4A0BB 4E5ZA 1JJUB 2HXCA 4CI2A 4A09A 3NIGA 4H5JA 5E6RA 4A0BA 2B4EA 3O4GA 5IC7A 1T2XA 3SWSD 1UTCA 5M61A 2VZ1A 3OF7A 4ZOXA 3J80g 3EU7A 4J84A 4J0WA 1H2XA 2Z2PA 2B5MA 4CI8A 4BCDA 3K71A 4J78A 3W15A 3I8EA 5IGOA 3SBQA 1GOHA 1K3IA 2P9IC 4X63B 3VGZA 4E54B 1C9LA 2HU8A 1GOTB 5GSAA 2J56H 2GNQA 5M5UA 4E54A 1MDAH 1N6FA 4FHLA 3ODTA 3JZNA 3L4MD 5TEEA 5TDHB 4RE6A 4BP8A 3AH8B 1N6DA 1YFQA 4NSXA 4FA9D 4BH6A 3SCYA 4AN0A 4JSXC 4AEZA 3E0CA 1TYEA 2VDPA 3OL2A 2AGZA 1QNIA 3OKTA 5TEFA 4GM8A 2EIDA 4A08A 2XL3A 3PXWD 4CY5A 5SXMA 3VI4A 2G99A 1SQ9A 3IJEA 5EAPA 1SHYB 3EG6A 3PSCB 3EI1B 4Z8LA 4AMZA 1JOFA 1U2VC 3JZGA 4PBYA 4X61B 2YMUA 3EI1A 2BCJB 4CY1A 3IVMA 5AFU3 1XHMA 2Z2NA 3V7DB 2AGLA 1U8CA 4GM3A 3PXTD 2Q7QA 3SMRA 3RN1D 4J87A 4PSXB 3PE7A 2H9PA 2VDKA 3GREA 4MK0B 2JKXA 3I7HA 5HE2B 3JB9L 4FA5D 4JHNA 2VZ3A 4QQEA 4UM9A 3P4FA 3GFCA 5C9ZB 4A2LA 4J8GA 5C92A 4MMYA 4XEIC 2EIEA 4CZYA 5IJ7E 2PM6B 5FFOA 3UVNA 3EQ7A 1PBYB 4CI1A 1E8MA 3L4OD 3V9FA 3JAMg 3IULA 4BCBA 4CI3A 3NVXA 3I7NA 2BBKH 2W18A 2VDOA 4JXMA 4Z7NA 2PM7B 3NVNA 4CC9A 4K3JB 3I7PA 5FXYA 3K6SA 3CFVA 4ES0A 4JSPC 1O6FA 4G1EA 2OVRB 2P9LC 3SXTD 3VI3A 3T3PA 1K32A 3I8CA 3JROA 2HESX 1VZ3A 5EM2B 2IWKA 4GQ1A 4PC0A 2IUPA 4A11B 3OTTA 2H68A 1VYHC 3JPXA 5EAMA 5EM2A 3RFGA 1I2MB 2H13A 4FAND 3UR4A 3IUMA 1L0QA 1JMXB 4JD2C 4J73A 4GQ2P 4GGAA 5H17A 1L5GA 4A7JA 5TF2A 3F3FA 2AQ5A 3RRMC 3NIDA 1XIPA 4UI9R 5C86A 1U4CA 4G56B 2P9KC 5FLXg 2O9KA 3PVUB 3CFSB 5CXCB 4IRZA 4LGNA 3ZE0A 5M5RA 3EI4B 2XL2A 3KRWB 4J82A 2QZPA 4J81A 1P22A 2HU7A 2J57G 1RI6A 4J79A 2XDWA 4NBMA 3ZWLB 2PM9B 3U4YA 1VZ2A 1OLZA 5E6UA 5EMLB 3V4PA 2I3TA 4CY2A 1TBGA 2I3SA 2YNNA 3MZKA 5GXIA 3F3PA 1MG3A 3QHYB 3DSMA 1M1XA 1O6GA 4RE5A 5IGQA 4JHPC 2H47A 5THAA 2CO0C 4N14A 4ZOYA 2QXVA 3IIWA 5KDOB 3VA6A 3V5WB 3N0DA 1B9YA 2HJ4A 4O3TB 3UKUC 2CE9A 1C9IA 4TZ4A 4EWRA 5EMJB 4QT8A 5GXHA 4Z7OA 5A2Qg 2HYEA 4ZOVA 3ULEC 4CZVA 3FCUA 4ESGA 1BPOA 5IT9g 3IUQA 2VDMA 5AJAA 3C99A 3PSLA 3HFQA 3ZDZA 1JMZB 4QL1A 4QRJA 5HE3B 3O4HA 3BG1A 5CYKB 2AH1A 5M5SA 4J77A 2OK4A 4DNVA 3ZDYA 1PI6A 4J0XA 1QFSA 1MG2A 3ZDXA 4FWWA 1A12A 4A2MA 1VE6A 4WJKA 4IMMA 3EQ8A 3O4IA 4LG9A 1JV2A 4Y5RD 3MVDK 1B9XA 1GOGA 4QAMA 5EMKB 2H9MA 1JTDB 3SBPA 4O45A 3ZE1A 3DXMC 3SBRA 2PBIB 4OWRA 4ERQA 3KRXB 5E6SA 3EMHA 3AL8B 5K19A 3RSEC 4BUJC 3B7FA 2EICA 5HE1B 1UOPA 2IWFA 2YNPA 5H14A 2CO0A 3AL8A 2IAAA 3SVWD 3C5MA 2TRCB 3SJLD 2GC4A 5EARA 4O2WA 4KFMB 5CXBB 4L3HD 3I7OA 4UM8A 4JT5C 4XYHA 5HDBA 3CIKB 2XE4A 1VE7A 3MUOA 3C75H 2QR5A 3EI2B 3N0EA 1ERJA 4CY3A 5C2WB 3IJCA 4ZOZA 2VDRA 3EI2A 3DWLC 3MKQA 2OK6A 2I0SA 2HKRA 1QFMA 4GQBB 2I0TA 3EQ9A 3I7KA 5FKTA 4L1MA 2GC7A 4U1EI 4A11A 5FA5B 5FQDA 4Y7RA 5EMMB 5HYNB 2CE8A 5JWZA 1E5TA 2G9AA 3IUJA 4HDJA 5B4WA 4A0AB 3PXSD 1GXRA 2HKMA 3ZE2A 4PXWA 5K1CC 4DNWA 4A0AA 2AGYA 5FKQA 3MKSB 4U7AA 3UVKA 4E5ZB 3IURA 3AL9A 2P9UC 4FB1D 5I5IA 4A09B 4X60B 3PVWB 5CXCA 3RLMD 3AFCA 5EALA 3FGBA 3EI4A 4WK0A 2H14A 2YNOA 4OZUA 2UZXB 3IIYA 2CNXA 3V4VA 3JRPA 1GP2B 4AX4A 4ERZA 4O02A 1NEXB 4AN1A 1FWXA 4JSNC 1PGUA 2WQ8A 3MUNA 3ORVD 3EI3B 2B5LA 4I79A 2H6KA 2VDLA 2PM9A 1K8KC 2AGXA 3EI3A 1H2WA 5FKSA 2AGWA 3UVLA 2OVQB 1UOOA 4AOWA 3FCSA 3OKYB 4YVDA 4G55A 1GG2B 4GGDA 1UOQA 4DNUA 2P9SC 4X3EA 3EWEA 3OKYA 4FA1D 4IA9A 3KCIA 4PBZA 5HE0B 2AH0A 2OIZA 3SHFA 3JZHA 4L9OA 3MZLA 2EBSA 2I0RA 4CZXA 4JSVC 3O4JA 4GMBA 3DDUA 5FFGA 3UKRC 2OJYA 3OL2B 3IJ1A 1PEVA 4WK2A 5GMKn 4A08B 4G1MA 4JT6C 3C9CA 4LG8A 2H6QA 4O1QD 3I2NA 1Q47A 3K26A 3DXKC 3OW8A 2BKLA 4XYIA 3QI0A 3UVOA 5IJ8E 2YB8B 4MMXA 4NENA 2Z2OA 1R5MA 4O9DA 2B5NA 2XYIA 5CYKA 4NC4A 2CN2A 4H5IA 4GGCA 1E8NA 2CN3A 3GD1I 2UZYB 5M5TA 1A0RB 1N6EA 4AMYA 1YR2A 4FAVD 4J86A 2H3XA 4PSWB 3NIFA 4GZ8A 4GM9A 5I5MA 2MTAH 2J55H 3BWSA 2HU5A 2VDNA 4D9SA 3A0FA 2H6NA 3OKWA 4O3UB 4K3ID 1OMWB 3MMYA 4ZN4A 1NR0A 5M5VA 3BG0A 4R7AB 2P9PC 4Z7QA 2EIBA 3F3GA 3K72A 2OVPB 3SLED 1TYQC 5CXBA 3FM0A 4FA4D 2VC2A 1H2ZA 2IUQA 4WK4A 5HQGA 4D0KA 3T3MA 2XU7A 3RFHA 4PNKB 4L3GD 5I5JA 3DM0A 3IJ0A 3I7LA 2IURA 4BL0A 2IUVA 3VH0A 3SN6B 3SFZA 4MMZA 3UVMA 4BP9A 2HJBA 2XZGA 4L1QD 5C2VB 2H9LA 3RMZD 4NAAA 1SQJA 3I89A 1H2YA 2YBAA 3IUNA 4D6VA 2VDQA 4ERYA 2QC5A
chains in the Genus database with same CATH topology
2H9NA 5AMSA 2P9NC 3IKOA 3RN0D 5H1MA 3J81g 1XKSA 3MXXA 5FKRA 1S4UX 4J8BA 3NVQA 3FRXA 3K27A 4A0BB 4E5ZA 1JJUB 2HXCA 4CI2A 4A09A 4H5JA 4A0BA 2B4EA 5IC7A 3SWSD 4ZOXA 3J80g 3EU7A 4J84A 4J0WA 2Z2PA 2B5MA 4CI8A 4J78A 3W15A 3I8EA 5IGOA 3SBQA 2P9IC 4X63B 3VGZA 4E54B 1GOTB 5GSAA 2J56H 2GNQA 4E54A 1MDAH 1N6FA 4FHLA 3ODTA 3JZNA 3L4MD 5TEEA 5TDHB 3AH8B 1N6DA 1YFQA 4NSXA 4FA9D 4BH6A 3SCYA 4JSXC 4AEZA 3E0CA 3OL2A 3OKTA 2AGZA 1QNIA 5TEFA 4GM8A 4A08A 2XL3A 3PXWD 4CY5A 5SXMA 2G99A 1SQ9A 5EAPA 1SHYB 3EG6A 3PSCB 3EI1B 4Z8LA 1JOFA 1U2VC 3JZGA 4PBYA 4X61B 2YMUA 3EI1A 2BCJB 4CY1A 5AFU3 1XHMA 2Z2NA 3V7DB 2AGLA 4GM3A 3PXTD 2Q7QA 3SMRA 3RN1D 4J87A 4PSXB 3PE7A 2H9PA 3GREA 4MK0B 3I7HA 5HE2B 3JB9L 4FA5D 4QQEA 3P4FA 3GFCA 5C9ZB 4A2LA 4J8GA 4XEIC 4CZYA 5IJ7E 2PM6B 3UVNA 1PBYB 4CI1A 3L4OD 3V9FA 3JAMg 4CI3A 3NVXA 3I7NA 2BBKH 2W18A 4JXMA 2PM7B 3NVNA 4CC9A 4K3JB 3I7PA 5FXYA 3CFVA 4ES0A 4JSPC 2OVRB 2P9LC 3SXTD 1K32A 3I8CA 3JROA 2HESX 5EM2B 2IWKA 4GQ1A 4PC0A 2IUPA 4A11B 3OTTA 2H68A 1VYHC 3JPXA 5EAMA 5EM2A 3RFGA 2H13A 4FAND 3UR4A 1L0QA 1JMXB 4JD2C 4J73A 4GQ2P 4GGAA 5H17A 4A7JA 5TF2A 3F3FA 2AQ5A 3RRMC 1XIPA 4UI9R 1U4CA 4G56B 2P9KC 5FLXg 2O9KA 3PVUB 3CFSB 5CXCB 4LGNA 3EI4B 2XL2A 3KRWB 4J82A 4J81A 1P22A 2J57G 1RI6A 4J79A 3ZWLB 2PM9B 3U4YA 1OLZA 5EMLB 2I3TA 4CY2A 1TBGA 2I3SA 2YNNA 3MZKA 5GXIA 3F3PA 1MG3A 3DSMA 5IGQA 2H47A 5THAA 2CO0C 4N14A 4ZOYA 2QXVA 3IIWA 5KDOB 3VA6A 3V5WB 3N0DA 1B9YA 2HJ4A 4O3TB 3UKUC 2CE9A 4TZ4A 4EWRA 5EMJB 4QT8A 5GXHA 5A2Qg 2HYEA 4ZOVA 3ULEC 4CZVA 4ESGA 5IT9g 5AJAA 3C99A 3PSLA 3HFQA 1JMZB 4QL1A 4QRJA 5HE3B 3BG1A 5CYKB 2AH1A 4J77A 2OK4A 1PI6A 4J0XA 1MG2A 4FWWA 4A2MA 4IMMA 4LG9A 4Y5RD 1B9XA 5EMKB 2H9MA 3SBPA 4O45A 3DXMC 3SBRA 2PBIB 4OWRA 4ERQA 3KRXB 3EMHA 3AL8B 5K19A 3RSEC 4BUJC 3B7FA 5HE1B 5H14A 2IWFA 2YNPA 2CO0A 3AL8A 2IAAA 3SVWD 3C5MA 2TRCB 3SJLD 2GC4A 5EARA 4KFMB 5CXBB 4L3HD 3I7OA 4JT5C 4XYHA 3CIKB 3C75H 3EI2B 3N0EA 1ERJA 4CY3A 5C2WB 3IJCA 4ZOZA 3EI2A 3DWLC 3MKQA 2OK6A 2I0SA 2HKRA 4GQBB 2I0TA 3I7KA 5FKTA 2GC7A 4U1EI 4A11A 5FA5B 5FQDA 4Y7RA 5EMMB 5HYNB 2CE8A 5JWZA 2G9AA 4HDJA 5B4WA 4A0AB 3PXSD 1GXRA 2HKMA 4PXWA 5K1CC 4A0AA 2AGYA 5FKQA 3MKSB 4U7AA 3UVKA 4E5ZB 3AL9A 2P9UC 4FB1D 5I5IA 4A09B 4X60B 3PVWB 5CXCA 3RLMD 3AFCA 5EALA 3FGBA 3EI4A 2H14A 2YNOA 4OZUA 2UZXB 3IIYA 2CNXA 3JRPA 1GP2B 4ERZA 1NEXB 1FWXA 4JSNC 1PGUA 3ORVD 3EI3B 2B5LA 4I79A 2H6KA 2PM9A 1K8KC 2AGXA 3EI3A 5FKSA 2AGWA 3UVLA 2OVQB 4AOWA 3OKYB 4YVDA 1GG2B 4GGDA 2P9SC 4X3EA 3EWEA 3OKYA 4FA1D 4IA9A 4PBZA 5HE0B 2AH0A 2OIZA 3SHFA 3JZHA 4L9OA 3MZLA 2EBSA 2I0RA 4CZXA 4JSVC 4GMBA 3UKRC 2OJYA 3OL2B 3IJ1A 1PEVA 5GMKn 4A08B 4JT6C 3C9CA 4LG8A 4O1QD 2H6QA 3I2NA 1Q47A 3K26A 3DXKC 3OW8A 4XYIA 3UVOA 5IJ8E 2YB8B 2Z2OA 1R5MA 4O9DA 2B5NA 2XYIA 5CYKA 2CN2A 4H5IA 4GGCA 2CN3A 2UZYB 1A0RB 1N6EA 4FAVD 4J86A 2H3XA 4PSWB 4GZ8A 4GM9A 5I5MA 2MTAH 2J55H 3BWSA 3A0FA 2H6NA 3OKWA 4O3UB 4K3ID 1OMWB 3MMYA 4ZN4A 1NR0A 3BG0A 4R7AB 2P9PC 3F3GA 2OVPB 3SLED 1TYQC 5CXBA 3FM0A 4FA4D 2IUQA 5HQGA 4D0KA 2XU7A 3RFHA 4PNKB 4L3GD 5I5JA 3DM0A 3IJ0A 3I7LA 2IURA 4BL0A 2IUVA 3VH0A 3SN6B 3SFZA 3UVMA 2HJBA 4L1QD 5C2VB 2H9LA 3RMZD 1SQJA 3I89A 2YBAA 4D6VA 4ERYA 2QC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H9N A;  5AMS A;  2P9N C;  3IKO A;  3RN0 D;  5H1M A;  3J81 g;  1XKS A;  3MXX A;  5FKR A;  1S4U X;  4J8B A;  3NVQ A;  3FRX A;  3K27 A;  4A0B B;  4E5Z A;  1JJU B;  2HXC A;  4CI2 A;  4A09 A;  4H5J A;  4A0B A;  2B4E A;  5IC7 A;  3SWS D;  4ZOX A;  3J80 g;  3EU7 A;  4J84 A;  4J0W A;  2Z2P A;  2B5M A;  4CI8 A;  4J78 A;  3W15 A;  3I8E A;  5IGO A;  3SBQ A;  2P9I C;  4X63 B;  3VGZ A;  4E54 B;  1GOT B;  5GSA A;  2J56 H;  2GNQ A;  4E54 A;  1MDA H;  1N6F A;  4FHL A;  3ODT A;  3JZN A;  3L4M D;  5TEE A;  5TDH B;  3AH8 B;  1N6D A;  1YFQ A;  4NSX A;  4FA9 D;  4BH6 A;  3SCY A;  4JSX C;  4AEZ A;  3E0C A;  3OL2 A;  3OKT A;  2AGZ A;  1QNI A;  5TEF A;  4GM8 A;  4A08 A;  2XL3 A;  3PXW D;  4CY5 A;  5SXM A;  2G99 A;  1SQ9 A;  5EAP A;  1SHY B;  3EG6 A;  3PSC B;  3EI1 B;  4Z8L A;  1JOF A;  1U2V C;  3JZG A;  4PBY A;  4X61 B;  2YMU A;  3EI1 A;  2BCJ B;  4CY1 A;  5AFU 3;  1XHM A;  2Z2N A;  3V7D B;  2AGL A;  4GM3 A;  3PXT D;  2Q7Q A;  3SMR A;  3RN1 D;  4J87 A;  4PSX B;  3PE7 A;  2H9P A;  3GRE A;  4MK0 B;  3I7H A;  5HE2 B;  3JB9 L;  4FA5 D;  4QQE A;  3P4F A;  3GFC A;  5C9Z B;  4A2L A;  4J8G A;  4XEI C;  4CZY A;  5IJ7 E;  2PM6 B;  3UVN A;  1PBY B;  4CI1 A;  3L4O D;  3V9F A;  3JAM g;  4CI3 A;  3NVX A;  3I7N A;  2BBK H;  2W18 A;  4JXM A;  2PM7 B;  3NVN A;  4CC9 A;  4K3J B;  3I7P A;  5FXY A;  3CFV A;  4ES0 A;  4JSP C;  2OVR B;  2P9L C;  3SXT D;  1K32 A;  3I8C A;  3JRO A;  2HES X;  5EM2 B;  2IWK A;  4GQ1 A;  4PC0 A;  2IUP A;  4A11 B;  3OTT A;  2H68 A;  1VYH C;  3JPX A;  5EAM A;  5EM2 A;  3RFG A;  2H13 A;  4FAN D;  3UR4 A;  1L0Q A;  1JMX B;  4JD2 C;  4J73 A;  4GQ2 P;  4GGA A;  5H17 A;  4A7J A;  5TF2 A;  3F3F A;  2AQ5 A;  3RRM C;  1XIP A;  4UI9 R;  1U4C A;  4G56 B;  2P9K C;  5FLX g;  2O9K A;  3PVU B;  3CFS B;  5CXC B;  4LGN A;  3EI4 B;  2XL2 A;  3KRW B;  4J82 A;  4J81 A;  1P22 A;  2J57 G;  1RI6 A;  4J79 A;  3ZWL B;  2PM9 B;  3U4Y A;  1OLZ A;  5EML B;  2I3T A;  4CY2 A;  1TBG A;  2I3S A;  2YNN A;  3MZK A;  5GXI A;  3F3P A;  1MG3 A;  3DSM A;  5IGQ A;  2H47 A;  5THA A;  2CO0 C;  4N14 A;  4ZOY A;  2QXV A;  3IIW A;  5KDO B;  3VA6 A;  3V5W B;  3N0D A;  1B9Y A;  2HJ4 A;  4O3T B;  3UKU C;  2CE9 A;  4TZ4 A;  4EWR A;  5EMJ B;  4QT8 A;  5GXH A;  5A2Q g;  2HYE A;  4ZOV A;  3ULE C;  4CZV A;  4ESG A;  5IT9 g;  5AJA A;  3C99 A;  3PSL A;  3HFQ A;  1JMZ B;  4QL1 A;  4QRJ A;  5HE3 B;  3BG1 A;  5CYK B;  2AH1 A;  4J77 A;  2OK4 A;  1PI6 A;  4J0X A;  1MG2 A;  4FWW A;  4A2M A;  4IMM A;  4LG9 A;  4Y5R D;  1B9X A;  5EMK B;  2H9M A;  3SBP A;  4O45 A;  3DXM C;  3SBR A;  2PBI B;  4OWR A;  4ERQ A;  3KRX B;  3EMH A;  3AL8 B;  5K19 A;  3RSE C;  4BUJ C;  3B7F A;  5HE1 B;  5H14 A;  2IWF A;  2YNP A;  2CO0 A;  3AL8 A;  2IAA A;  3SVW D;  3C5M A;  2TRC B;  3SJL D;  2GC4 A;  5EAR A;  4KFM B;  5CXB B;  4L3H D;  3I7O A;  4JT5 C;  4XYH A;  3CIK B;  3C75 H;  3EI2 B;  3N0E A;  1ERJ A;  4CY3 A;  5C2W B;  3IJC A;  4ZOZ A;  3EI2 A;  3DWL C;  3MKQ A;  2OK6 A;  2I0S A;  2HKR A;  4GQB B;  2I0T A;  3I7K A;  5FKT A;  2GC7 A;  4U1E I;  4A11 A;  5FA5 B;  5FQD A;  4Y7R A;  5EMM B;  5HYN B;  2CE8 A;  5JWZ A;  2G9A A;  4HDJ A;  5B4W A;  4A0A B;  3PXS D;  1GXR A;  2HKM A;  4PXW A;  5K1C C;  4A0A A;  2AGY A;  5FKQ A;  3MKS B;  4U7A A;  3UVK A;  4E5Z B;  3AL9 A;  2P9U C;  4FB1 D;  5I5I A;  4A09 B;  4X60 B;  3PVW B;  5CXC A;  3RLM D;  3AFC A;  5EAL A;  3FGB A;  3EI4 A;  2H14 A;  2YNO A;  4OZU A;  2UZX B;  3IIY A;  2CNX A;  3JRP A;  1GP2 B;  4ERZ A;  1NEX B;  1FWX A;  4JSN C;  1PGU A;  3ORV D;  3EI3 B;  2B5L A;  4I79 A;  2H6K A;  2PM9 A;  1K8K C;  2AGX A;  3EI3 A;  5FKS A;  2AGW A;  3UVL A;  2OVQ B;  4AOW A;  3OKY B;  4YVD A;  1GG2 B;  4GGD A;  2P9S C;  4X3E A;  3EWE A;  3OKY A;  4FA1 D;  4IA9 A;  4PBZ A;  5HE0 B;  2AH0 A;  2OIZ A;  3SHF A;  3JZH A;  4L9O A;  3MZL A;  2EBS A;  2I0R A;  4CZX A;  4JSV C;  4GMB A;  3UKR C;  2OJY A;  3OL2 B;  3IJ1 A;  1PEV A;  5GMK n;  4A08 B;  4JT6 C;  3C9C A;  4LG8 A;  4O1Q D;  2H6Q A;  3I2N A;  1Q47 A;  3K26 A;  3DXK C;  3OW8 A;  4XYI A;  3UVO A;  5IJ8 E;  2YB8 B;  2Z2O A;  1R5M A;  4O9D A;  2B5N A;  2XYI A;  5CYK A;  2CN2 A;  4H5I A;  4GGC A;  2CN3 A;  2UZY B;  1A0R B;  1N6E A;  4FAV D;  4J86 A;  2H3X A;  4PSW B;  4GZ8 A;  4GM9 A;  5I5M A;  2MTA H;  2J55 H;  3BWS A;  3A0F A;  2H6N A;  3OKW A;  4O3U B;  4K3I D;  1OMW B;  3MMY A;  4ZN4 A;  1NR0 A;  3BG0 A;  4R7A B;  2P9P C;  3F3G A;  2OVP B;  3SLE D;  1TYQ C;  5CXB A;  3FM0 A;  4FA4 D;  2IUQ A;  5HQG A;  4D0K A;  2XU7 A;  3RFH A;  4PNK B;  4L3G D;  5I5J A;  3DM0 A;  3IJ0 A;  3I7L A;  2IUR A;  4BL0 A;  2IUV A;  3VH0 A;  3SN6 B;  3SFZ A;  3UVM A;  2HJB A;  4L1Q D;  5C2V B;  2H9L A;  3RMZ D;  1SQJ A;  3I89 A;  2YBA A;  4D6V A;  4ERY A;  2QC5 A; 
#chains in the Genus database with same CATH topology
 2H9N A;  5AMS A;  2P9N C;  3IKO A;  3RN0 D;  1GOF A;  5H1M A;  4BCC A;  3J81 g;  1XKS A;  3MXX A;  3GC3 B;  5FKR A;  1S4U X;  4J8B A;  3NVQ A;  3FRX A;  3K27 A;  4A0B B;  4E5Z A;  1JJU B;  2HXC A;  4CI2 A;  4A09 A;  3NIG A;  4H5J A;  5E6R A;  4A0B A;  2B4E A;  3O4G A;  5IC7 A;  1T2X A;  3SWS D;  1UTC A;  5M61 A;  2VZ1 A;  3OF7 A;  4ZOX A;  3J80 g;  3EU7 A;  4J84 A;  4J0W A;  1H2X A;  2Z2P A;  2B5M A;  4CI8 A;  4BCD A;  3K71 A;  4J78 A;  3W15 A;  3I8E A;  5IGO A;  3SBQ A;  1GOH A;  1K3I A;  2P9I C;  4X63 B;  3VGZ A;  4E54 B;  1C9L A;  2HU8 A;  1GOT B;  5GSA A;  2J56 H;  2GNQ A;  5M5U A;  4E54 A;  1MDA H;  1N6F A;  4FHL A;  3ODT A;  3JZN A;  3L4M D;  5TEE A;  5TDH B;  4RE6 A;  4BP8 A;  3AH8 B;  1N6D A;  1YFQ A;  4NSX A;  4FA9 D;  4BH6 A;  3SCY A;  4AN0 A;  4JSX C;  4AEZ A;  3E0C A;  1TYE A;  2VDP A;  3OL2 A;  2AGZ A;  1QNI A;  3OKT A;  5TEF A;  4GM8 A;  2EID A;  4A08 A;  2XL3 A;  3PXW D;  4CY5 A;  5SXM A;  3VI4 A;  2G99 A;  1SQ9 A;  3IJE A;  5EAP A;  1SHY B;  3EG6 A;  3PSC B;  3EI1 B;  4Z8L A;  4AMZ A;  1JOF A;  1U2V C;  3JZG A;  4PBY A;  4X61 B;  2YMU A;  3EI1 A;  2BCJ B;  4CY1 A;  3IVM A;  5AFU 3;  1XHM A;  2Z2N A;  3V7D B;  2AGL A;  1U8C A;  4GM3 A;  3PXT D;  2Q7Q A;  3SMR A;  3RN1 D;  4J87 A;  4PSX B;  3PE7 A;  2H9P A;  2VDK A;  3GRE A;  4MK0 B;  2JKX A;  3I7H A;  5HE2 B;  3JB9 L;  4FA5 D;  4JHN A;  2VZ3 A;  4QQE A;  4UM9 A;  3P4F A;  3GFC A;  5C9Z B;  4A2L A;  4J8G A;  5C92 A;  4MMY A;  4XEI C;  2EIE A;  4CZY A;  5IJ7 E;  2PM6 B;  5FFO A;  3UVN A;  3EQ7 A;  1PBY B;  4CI1 A;  1E8M A;  3L4O D;  3V9F A;  3JAM g;  3IUL A;  4BCB A;  4CI3 A;  3NVX A;  3I7N A;  2BBK H;  2W18 A;  2VDO A;  4JXM A;  4Z7N A;  2PM7 B;  3NVN A;  4CC9 A;  4K3J B;  3I7P A;  5FXY A;  3K6S A;  3CFV A;  4ES0 A;  4JSP C;  1O6F A;  4G1E A;  2OVR B;  2P9L C;  3SXT D;  3VI3 A;  3T3P A;  1K32 A;  3I8C A;  3JRO A;  2HES X;  1VZ3 A;  5EM2 B;  2IWK A;  4GQ1 A;  4PC0 A;  2IUP A;  4A11 B;  3OTT A;  2H68 A;  1VYH C;  3JPX A;  5EAM A;  5EM2 A;  3RFG A;  1I2M B;  2H13 A;  4FAN D;  3UR4 A;  3IUM A;  1L0Q A;  1JMX B;  4JD2 C;  4J73 A;  4GQ2 P;  4GGA A;  5H17 A;  1L5G A;  4A7J A;  5TF2 A;  3F3F A;  2AQ5 A;  3RRM C;  3NID A;  1XIP A;  4UI9 R;  5C86 A;  1U4C A;  4G56 B;  2P9K C;  5FLX g;  2O9K A;  3PVU B;  3CFS B;  5CXC B;  4IRZ A;  4LGN A;  3ZE0 A;  5M5R A;  3EI4 B;  2XL2 A;  3KRW B;  4J82 A;  2QZP A;  4J81 A;  1P22 A;  2HU7 A;  2J57 G;  1RI6 A;  4J79 A;  2XDW A;  4NBM A;  3ZWL B;  2PM9 B;  3U4Y A;  1VZ2 A;  1OLZ A;  5E6U A;  5EML B;  3V4P A;  2I3T A;  4CY2 A;  1TBG A;  2I3S A;  2YNN A;  3MZK A;  5GXI A;  3F3P A;  1MG3 A;  3QHY B;  3DSM A;  1M1X A;  1O6G A;  4RE5 A;  5IGQ A;  4JHP C;  2H47 A;  5THA A;  2CO0 C;  4N14 A;  4ZOY A;  2QXV A;  3IIW A;  5KDO B;  3VA6 A;  3V5W B;  3N0D A;  1B9Y A;  2HJ4 A;  4O3T B;  3UKU C;  2CE9 A;  1C9I A;  4TZ4 A;  4EWR A;  5EMJ B;  4QT8 A;  5GXH A;  4Z7O A;  5A2Q g;  2HYE A;  4ZOV A;  3ULE C;  4CZV A;  3FCU A;  4ESG A;  1BPO A;  5IT9 g;  3IUQ A;  2VDM A;  5AJA A;  3C99 A;  3PSL A;  3HFQ A;  3ZDZ A;  1JMZ B;  4QL1 A;  4QRJ A;  5HE3 B;  3O4H A;  3BG1 A;  5CYK B;  2AH1 A;  5M5S A;  4J77 A;  2OK4 A;  4DNV A;  3ZDY A;  1PI6 A;  4J0X A;  1QFS A;  1MG2 A;  3ZDX A;  4FWW A;  1A12 A;  4A2M A;  1VE6 A;  4WJK A;  4IMM A;  3EQ8 A;  3O4I A;  4LG9 A;  1JV2 A;  4Y5R D;  3MVD K;  1B9X A;  1GOG A;  4QAM A;  5EMK B;  2H9M A;  1JTD B;  3SBP A;  4O45 A;  3ZE1 A;  3DXM C;  3SBR A;  2PBI B;  4OWR A;  4ERQ A;  3KRX B;  5E6S A;  3EMH A;  3AL8 B;  5K19 A;  3RSE C;  4BUJ C;  3B7F A;  2EIC A;  5HE1 B;  1UOP A;  2IWF A;  2YNP A;  5H14 A;  2CO0 A;  3AL8 A;  2IAA A;  3SVW D;  3C5M A;  2TRC B;  3SJL D;  2GC4 A;  5EAR A;  4O2W A;  4KFM B;  5CXB B;  4L3H D;  3I7O A;  4UM8 A;  4JT5 C;  4XYH A;  5HDB A;  3CIK B;  2XE4 A;  1VE7 A;  3MUO A;  3C75 H;  2QR5 A;  3EI2 B;  3N0E A;  1ERJ A;  4CY3 A;  5C2W B;  3IJC A;  4ZOZ A;  2VDR A;  3EI2 A;  3DWL C;  3MKQ A;  2OK6 A;  2I0S A;  2HKR A;  1QFM A;  4GQB B;  2I0T A;  3EQ9 A;  3I7K A;  5FKT A;  4L1M A;  2GC7 A;  4U1E I;  4A11 A;  5FA5 B;  5FQD A;  4Y7R A;  5EMM B;  5HYN B;  2CE8 A;  5JWZ A;  1E5T A;  2G9A A;  3IUJ A;  4HDJ A;  5B4W A;  4A0A B;  3PXS D;  1GXR A;  2HKM A;  3ZE2 A;  4PXW A;  5K1C C;  4DNW A;  4A0A A;  2AGY A;  5FKQ A;  3MKS B;  4U7A A;  3UVK A;  4E5Z B;  3IUR A;  3AL9 A;  2P9U C;  4FB1 D;  5I5I A;  4A09 B;  4X60 B;  3PVW B;  5CXC A;  3RLM D;  3AFC A;  5EAL A;  3FGB A;  3EI4 A;  4WK0 A;  2H14 A;  2YNO A;  4OZU A;  2UZX B;  3IIY A;  2CNX A;  3V4V A;  3JRP A;  1GP2 B;  4AX4 A;  4ERZ A;  4O02 A;  1NEX B;  4AN1 A;  1FWX A;  4JSN C;  1PGU A;  2WQ8 A;  3MUN A;  3ORV D;  3EI3 B;  2B5L A;  4I79 A;  2H6K A;  2VDL A;  2PM9 A;  1K8K C;  2AGX A;  3EI3 A;  1H2W A;  5FKS A;  2AGW A;  3UVL A;  2OVQ B;  1UOO A;  4AOW A;  3FCS A;  3OKY B;  4YVD A;  4G55 A;  1GG2 B;  4GGD A;  1UOQ A;  4DNU A;  2P9S C;  4X3E A;  3EWE A;  3OKY A;  4FA1 D;  4IA9 A;  3KCI A;  4PBZ A;  5HE0 B;  2AH0 A;  2OIZ A;  3SHF A;  3JZH A;  4L9O A;  3MZL A;  2EBS A;  2I0R A;  4CZX A;  4JSV C;  3O4J A;  4GMB A;  3DDU A;  5FFG A;  3UKR C;  2OJY A;  3OL2 B;  3IJ1 A;  1PEV A;  4WK2 A;  5GMK n;  4A08 B;  4G1M A;  4JT6 C;  3C9C A;  4LG8 A;  2H6Q A;  4O1Q D;  3I2N A;  1Q47 A;  3K26 A;  3DXK C;  3OW8 A;  2BKL A;  4XYI A;  3QI0 A;  3UVO A;  5IJ8 E;  2YB8 B;  4MMX A;  4NEN A;  2Z2O A;  1R5M A;  4O9D A;  2B5N A;  2XYI A;  5CYK A;  4NC4 A;  2CN2 A;  4H5I A;  4GGC A;  1E8N A;  2CN3 A;  3GD1 I;  2UZY B;  5M5T A;  1A0R B;  1N6E A;  4AMY A;  1YR2 A;  4FAV D;  4J86 A;  2H3X A;  4PSW B;  3NIF A;  4GZ8 A;  4GM9 A;  5I5M A;  2MTA H;  2J55 H;  3BWS A;  2HU5 A;  2VDN A;  4D9S A;  3A0F A;  2H6N A;  3OKW A;  4O3U B;  4K3I D;  1OMW B;  3MMY A;  4ZN4 A;  1NR0 A;  5M5V A;  3BG0 A;  4R7A B;  2P9P C;  4Z7Q A;  2EIB A;  3F3G A;  3K72 A;  2OVP B;  3SLE D;  1TYQ C;  5CXB A;  3FM0 A;  4FA4 D;  2VC2 A;  1H2Z A;  2IUQ A;  4WK4 A;  5HQG A;  4D0K A;  3T3M A;  2XU7 A;  3RFH A;  4PNK B;  4L3G D;  5I5J A;  3DM0 A;  3IJ0 A;  3I7L A;  2IUR A;  4BL0 A;  2IUV A;  3VH0 A;  3SN6 B;  3SFZ A;  4MMZ A;  3UVM A;  4BP9 A;  2HJB A;  2XZG A;  4L1Q D;  5C2V B;  2H9L A;  3RMZ D;  4NAA A;  1SQJ A;  3I89 A;  1H2Y A;  2YBA A;  3IUN A;  4D6V A;  2VDQ A;  4ERY A;  2QC5 A; 
#chains in the Genus database with same CATH homology
 2H9N A;  5AMS A;  2P9N C;  3IKO A;  3RN0 D;  5H1M A;  3J81 g;  1XKS A;  3MXX A;  5FKR A;  1S4U X;  4J8B A;  3NVQ A;  3FRX A;  3K27 A;  4A0B B;  4E5Z A;  1JJU B;  2HXC A;  4CI2 A;  4A09 A;  4H5J A;  4A0B A;  2B4E A;  5IC7 A;  3SWS D;  4ZOX A;  3J80 g;  3EU7 A;  4J84 A;  4J0W A;  2Z2P A;  2B5M A;  4CI8 A;  4J78 A;  3W15 A;  3I8E A;  5IGO A;  3SBQ A;  2P9I C;  4X63 B;  3VGZ A;  4E54 B;  1GOT B;  5GSA A;  2J56 H;  2GNQ A;  4E54 A;  1MDA H;  1N6F A;  4FHL A;  3ODT A;  3JZN A;  3L4M D;  5TEE A;  5TDH B;  3AH8 B;  1N6D A;  1YFQ A;  4NSX A;  4FA9 D;  4BH6 A;  3SCY A;  4JSX C;  4AEZ A;  3E0C A;  3OL2 A;  3OKT A;  2AGZ A;  1QNI A;  5TEF A;  4GM8 A;  4A08 A;  2XL3 A;  3PXW D;  4CY5 A;  5SXM A;  2G99 A;  1SQ9 A;  5EAP A;  1SHY B;  3EG6 A;  3PSC B;  3EI1 B;  4Z8L A;  1JOF A;  1U2V C;  3JZG A;  4PBY A;  4X61 B;  2YMU A;  3EI1 A;  2BCJ B;  4CY1 A;  5AFU 3;  1XHM A;  2Z2N A;  3V7D B;  2AGL A;  4GM3 A;  3PXT D;  2Q7Q A;  3SMR A;  3RN1 D;  4J87 A;  4PSX B;  3PE7 A;  2H9P A;  3GRE A;  4MK0 B;  3I7H A;  5HE2 B;  3JB9 L;  4FA5 D;  4QQE A;  3P4F A;  3GFC A;  5C9Z B;  4A2L A;  4J8G A;  4XEI C;  4CZY A;  5IJ7 E;  2PM6 B;  3UVN A;  1PBY B;  4CI1 A;  3L4O D;  3V9F A;  3JAM g;  4CI3 A;  3NVX A;  3I7N A;  2BBK H;  2W18 A;  4JXM A;  2PM7 B;  3NVN A;  4CC9 A;  4K3J B;  3I7P A;  5FXY A;  3CFV A;  4ES0 A;  4JSP C;  2OVR B;  2P9L C;  3SXT D;  1K32 A;  3I8C A;  3JRO A;  2HES X;  5EM2 B;  2IWK A;  4GQ1 A;  4PC0 A;  2IUP A;  4A11 B;  3OTT A;  2H68 A;  1VYH C;  3JPX A;  5EAM A;  5EM2 A;  3RFG A;  2H13 A;  4FAN D;  3UR4 A;  1L0Q A;  1JMX B;  4JD2 C;  4J73 A;  4GQ2 P;  4GGA A;  5H17 A;  4A7J A;  5TF2 A;  3F3F A;  2AQ5 A;  3RRM C;  1XIP A;  4UI9 R;  1U4C A;  4G56 B;  2P9K C;  5FLX g;  2O9K A;  3PVU B;  3CFS B;  5CXC B;  4LGN A;  3EI4 B;  2XL2 A;  3KRW B;  4J82 A;  4J81 A;  1P22 A;  2J57 G;  1RI6 A;  4J79 A;  3ZWL B;  2PM9 B;  3U4Y A;  1OLZ A;  5EML B;  2I3T A;  4CY2 A;  1TBG A;  2I3S A;  2YNN A;  3MZK A;  5GXI A;  3F3P A;  1MG3 A;  3DSM A;  5IGQ A;  2H47 A;  5THA A;  2CO0 C;  4N14 A;  4ZOY A;  2QXV A;  3IIW A;  5KDO B;  3VA6 A;  3V5W B;  3N0D A;  1B9Y A;  2HJ4 A;  4O3T B;  3UKU C;  2CE9 A;  4TZ4 A;  4EWR A;  5EMJ B;  4QT8 A;  5GXH A;  5A2Q g;  2HYE A;  4ZOV A;  3ULE C;  4CZV A;  4ESG A;  5IT9 g;  5AJA A;  3C99 A;  3PSL A;  3HFQ A;  1JMZ B;  4QL1 A;  4QRJ A;  5HE3 B;  3BG1 A;  5CYK B;  2AH1 A;  4J77 A;  2OK4 A;  1PI6 A;  4J0X A;  1MG2 A;  4FWW A;  4A2M A;  4IMM A;  4LG9 A;  4Y5R D;  1B9X A;  5EMK B;  2H9M A;  3SBP A;  4O45 A;  3DXM C;  3SBR A;  2PBI B;  4OWR A;  4ERQ A;  3KRX B;  3EMH A;  3AL8 B;  5K19 A;  3RSE C;  4BUJ C;  3B7F A;  5HE1 B;  5H14 A;  2IWF A;  2YNP A;  2CO0 A;  3AL8 A;  2IAA A;  3SVW D;  3C5M A;  2TRC B;  3SJL D;  2GC4 A;  5EAR A;  4KFM B;  5CXB B;  4L3H D;  3I7O A;  4JT5 C;  4XYH A;  3CIK B;  3C75 H;  3EI2 B;  3N0E A;  1ERJ A;  4CY3 A;  5C2W B;  3IJC A;  4ZOZ A;  3EI2 A;  3DWL C;  3MKQ A;  2OK6 A;  2I0S A;  2HKR A;  4GQB B;  2I0T A;  3I7K A;  5FKT A;  2GC7 A;  4U1E I;  4A11 A;  5FA5 B;  5FQD A;  4Y7R A;  5EMM B;  5HYN B;  2CE8 A;  5JWZ A;  2G9A A;  4HDJ A;  5B4W A;  4A0A B;  3PXS D;  1GXR A;  2HKM A;  4PXW A;  5K1C C;  4A0A A;  2AGY A;  5FKQ A;  3MKS B;  4U7A A;  3UVK A;  4E5Z B;  3AL9 A;  2P9U C;  4FB1 D;  5I5I A;  4A09 B;  4X60 B;  3PVW B;  5CXC A;  3RLM D;  3AFC A;  5EAL A;  3FGB A;  3EI4 A;  2H14 A;  2YNO A;  4OZU A;  2UZX B;  3IIY A;  2CNX A;  3JRP A;  1GP2 B;  4ERZ A;  1NEX B;  1FWX A;  4JSN C;  1PGU A;  3ORV D;  3EI3 B;  2B5L A;  4I79 A;  2H6K A;  2PM9 A;  1K8K C;  2AGX A;  3EI3 A;  5FKS A;  2AGW A;  3UVL A;  2OVQ B;  4AOW A;  3OKY B;  4YVD A;  1GG2 B;  4GGD A;  2P9S C;  4X3E A;  3EWE A;  3OKY A;  4FA1 D;  4IA9 A;  4PBZ A;  5HE0 B;  2AH0 A;  2OIZ A;  3SHF A;  3JZH A;  4L9O A;  3MZL A;  2EBS A;  2I0R A;  4CZX A;  4JSV C;  4GMB A;  3UKR C;  2OJY A;  3OL2 B;  3IJ1 A;  1PEV A;  5GMK n;  4A08 B;  4JT6 C;  3C9C A;  4LG8 A;  4O1Q D;  2H6Q A;  3I2N A;  1Q47 A;  3K26 A;  3DXK C;  3OW8 A;  4XYI A;  3UVO A;  5IJ8 E;  2YB8 B;  2Z2O A;  1R5M A;  4O9D A;  2B5N A;  2XYI A;  5CYK A;  2CN2 A;  4H5I A;  4GGC A;  2CN3 A;  2UZY B;  1A0R B;  1N6E A;  4FAV D;  4J86 A;  2H3X A;  4PSW B;  4GZ8 A;  4GM9 A;  5I5M A;  2MTA H;  2J55 H;  3BWS A;  3A0F A;  2H6N A;  3OKW A;  4O3U B;  4K3I D;  1OMW B;  3MMY A;  4ZN4 A;  1NR0 A;  3BG0 A;  4R7A B;  2P9P C;  3F3G A;  2OVP B;  3SLE D;  1TYQ C;  5CXB A;  3FM0 A;  4FA4 D;  2IUQ A;  5HQG A;  4D0K A;  2XU7 A;  3RFH A;  4PNK B;  4L3G D;  5I5J A;  3DM0 A;  3IJ0 A;  3I7L A;  2IUR A;  4BL0 A;  2IUV A;  3VH0 A;  3SN6 B;  3SFZ A;  3UVM A;  2HJB A;  4L1Q D;  5C2V B;  2H9L A;  3RMZ D;  1SQJ A;  3I89 A;  2YBA A;  4D6V A;  4ERY A;  2QC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...