4UI9R

Atomic structure of the human anaphase-promoting complex
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
452
structure length
387
Chain Sequence
SKHGDRFIPSRAGANWSVNFHRINENGLAYSALLKNELLGAGIEKVQKGLFTYSLSPYSLSPVSNKSQKLLRSSKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWNAEQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSLSPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSVSVLNLFTRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic Structure of the Apc and its Mechanism of Protein Ubiquitination
pubmed doi rcsb
molecule tags Cell cycle
molecule keywords ANAPHASE-PROMOTING COMPLEX SUBUNIT 1
total genus 77
structure length 387
sequence length 452
ec nomenclature
pdb deposition date 2015-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00400 WD40 WD domain, G-beta repeat
R PF12894 ANAPC4_WD40 Anaphase-promoting complex subunit 4 WD40 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4ui9R01
3I7NA 5HE0B 3AH8B 5KDOB 4U7AA 4J77A 4A0AB 2G99A 2AGWA 3SWSD 5FXYA 4CY5A 3PXWD 3F3GA 4BH6A 4PBYA 3RMZD 5FQDA 4CZVA 2AQ5A 3JZHA 4GQBB 3EI3A 3P4FA 4LG8A 2TRCB 4CY1A 1PEVA 2Z2NA 4JT6C 4A11B 3ODTA 3JRPA 4GGAA 5CXCA 4CY2A 4A2LA 4FAND 4A0BB 3KRWB 3AL8A 3IKOA 5CXBB 4MK0B 4BL0A 3I8EA 5C2WB 3MXXA 3DXKC 3PVUB 4JSXC 4OZUA 3UKRC 4A11A 1JJUB 1GXRA 2H14A 2OIZA 1GOTB 5IGQA 3EI4A 4ZOXA 4GGCA 3DWLC 4PXWA 5K1CC 3OKYA 2H6NA 4QQEA 1TYQC 4TZ4A 1RI6A 3MKQA 1SHYB 2J56H 4N14A 5IJ8E 2EBSA 4I79A 2J55H 2B5MA 5IC7A 5EARA 3K27A 3MZKA 2AH1A 4J8BA 1JMXB 3F3FA 1N6DA 2IUPA 4JSVC 3EU7A 3CIKB 4J82A 3C9CA 3MZLA 5IT9g 4ZOZA 4PSWB 4L9OA 4CI3A 4FA4D 3UKUC 3UVMA 2H3XA 1OLZA 3B7FA 1N6EA 3SN6B 4E54A 5HE3B 3SLED 4AOWA 5A2Qg 4GGDA 3DM0A 4CI1A 2HKRA 3C99A 4YVDA 3UVLA 3NVNA 3SXTD 3CFSB 4J79A 2UZYB 5JWZA 5TF2A 2P9UC 4A2MA 2HYEA 4H5IA 2OK6A 4ZOVA 3U4YA 2P9IC 4FA9D 1P22A 4GQ2P 4A08B 3SFZA 5AMSA 2XL3A 4O45A 4QRJA 3JZNA 4JXMA 4NSXA 3EI2A 1OMWB 3C5MA 4ERQA 3L4OD 2OVPB 2IWFA 2BCJB 4J84A 1PGUA 5I5MA 4XEIC 3EI4B 2I0SA 5EM2B 5C2VB 2H6QA 2O9KA 5SXMA 3SCYA 3E0CA 3BG1A 5EMKB 3UVNA 3OKWA 4JD2C 2PM6B 3UR4A 2IWKA 5FKRA 1N6FA 2HJ4A 2CE9A 3SBPA 5AFU3 3SJLD 2CO0A 2CN3A 1Q47A 4GM9A 5H14A 4ZOYA 2B5LA 4O3TB 1MG2A 2HKMA 2QXVA 4G56B 4J81A 3V5WB 4R7AB 3DSMA 2Z2PA 1NR0A 2XU7A 5GXHA 1YFQA 2YNOA 2I3TA 4Y5RD 3V7DB 4X61B 4FHLA 4A09A 3EMHA 3AFCA 5I5IA 4J86A 2H9NA 4K3ID 5C9ZB 1L0QA 3L4MD 4D6VA 1XIPA 4GM3A 5GSAA 4Z8LA 4FA1D 3I7PA 4JT5C 3K26A 3CFVA 1JOFA 2IUQA 1XKSA 2GNQA 3OL2B 3JPXA 3I2NA 1GP2B 2AH0A 5CXCB 5EMJB 5EMMB 4A7JA 4A0BA 2Z2OA 2YMUA 2H9LA 5FLXg 2BBKH 3PE7A 5FKQA 2PM9A 5HQGA 3DXMC 4Y7RA 1TBGA 3ZWLB 5EAMA 3FM0A 4A0AA 2J57G 3RN1D 1K32A 3EI3B 3VA6A 3FRXA 4A09B 4CZXA 4O1QD 3N0EA 3ULEC 2I0RA 5EMLB 4GQ1A 1U2VC 3FGBA 4CI2A 2QC5A 4XYHA 1MDAH 5CYKA 3PXSD 5EM2A 5CXBA 2CO0C 1NEXB 3AL8B 1VYHC 3ORVD 5TEEA 2P9LC 2IAAA 3F3PA 2GC4A 4FWWA 3EG6A 3I7OA 4L3GD 2CN2A 5FA5B 5K19A 1XHMA 4FAVD 3MKSB 5EAPA 1MG3A 5TEFA 4CY3A 2IUVA 4J78A 5THAA 4CC9A 3IIYA 3HFQA 1K8KC 4EWRA 4LG9A 4UI9R 2H9MA 2H47A 2OVRB 4X63B 3SMRA 3OW8A 2H13A 4PBZA 3I7HA 3UVOA 5H1MA 3I7LA 3I8CA 4JSPC 4FA5D 3C75H 3KRXB 5EALA 2AGYA 4BUJC 3SBQA 2P9NC 4X60B 3PVWB 1B9YA 4XYIA 5FKTA 3OKYB 3IIWA 4HDJA 1JMZB 3BG0A 3RLMD 4L3HD 4ESGA 4FB1D 5HE1B 3OKTA 2G9AA 2OJYA 3RFGA 1PI6A 3EI1B 2PM9B 1SQJA 5I5JA 3VGZA 3JB9L 3IJ0A 4L1QD 2H68A 3W15A 4OWRA 4H5JA 2CE8A 3PSCB 4CZYA 4PC0A 1FWXA 3V9FA 3EWEA 3RN0D 3I89A 5H17A 2OK4A 3EI1A 3PSLA 4PNKB 2AGXA 2I0TA 2YNPA 5TDHB 4A08A 4X3EA 4QL1A 4K3JB 2YBAA 2MTAH 4J73A 4IMMA 2OVQB 3GREA 3IJCA 5AJAA 3AL9A 3JROA 4ERYA 3SBRA 3IJ1A 4GM8A 4AEZA 2W18A 2B4EA 3MMYA 3OL2A 2IURA 1A0RB 2H6KA 2XL2A 3NVQA 1GG2B 4J0WA 3UVKA 2HXCA 3BWSA 4CI8A 3JAMg 3J80g 1PBYB 4E54B 2HJBA 5GXIA 2H9PA 4JSNC 3N0DA 5HYNB 3EI2B 5GMKn 4ZN4A 3I7KA 2I3SA 4ERZA 2UZXB 3NVXA 4GMBA 4E5ZB 1ERJA 4ES0A 2P9PC 4PSXB 4J8GA 2XYIA 4U1EI 2HESX 3J81g 2AGZA 3RSEC 3RRMC 4QT8A 4D0KA 1R5MA 1S4UX 2GC7A 3OTTA 3RFHA 3JZGA 3VH0A 3SVWD 4E5ZA 5CYKB 5FKSA 2B5NA 5IJ7E 2CNXA 3SHFA 3PXTD 4J0XA 5HE2B 4O9DA 1B9XA 2YB8B 4LGNA 4IA9A 1QNIA 4J87A 4GZ8A 2AGLA 2Q7QA 1U4CA 5B4WA 4KFMB 2PBIB 5IGOA 4O3UB 2PM7B 1SQ9A 2P9SC 2YNNA 2P9KC 3GFCA 3A0FA
chains in the Genus database with same CATH superfamily
3I7NA 5HE0B 3AH8B 4BCBA 5KDOB 1GOGA 4U7AA 4J77A 5C86A 4A0AB 2G99A 2AGWA 3SWSD 5FXYA 4CY5A 1H2WA 3PXWD 1L5GA 3F3GA 4DNUA 4BH6A 4PBYA 1M1XA 3RMZD 2EICA 5FQDA 4CZVA 2AQ5A 3JZHA 4GQBB 3EI3A 3P4FA 4LG8A 2TRCB 4CY1A 3OF7A 1PEVA 2Z2NA 4JT6C 2XE4A 4A11B 3ODTA 3JRPA 4GGAA 5CXCA 4CY2A 4A2LA 4FAND 4A0BB 3KRWB 3AL8A 3IKOA 5CXBB 4MK0B 4BL0A 3I8EA 5C2WB 3MXXA 3DXKC 3PVUB 4JSXC 4OZUA 3UKRC 4A11A 1JJUB 1GXRA 2H14A 2OIZA 1GOTB 3IULA 5IGQA 3EI4A 5M61A 4ZOXA 4GGCA 3DWLC 4PXWA 5K1CC 3OKYA 2H6NA 4QQEA 1TYQC 4TZ4A 1RI6A 3MKQA 2VDMA 1SHYB 2XZGA 3EQ7A 2J56H 4N14A 3T3PA 1VZ3A 4RE6A 5IJ8E 2EBSA 4I79A 2J55H 2B5MA 5IC7A 5EARA 3K27A 3MZKA 3IVMA 2AH1A 4JHNA 4J8BA 1JMXB 2VC2A 2VDPA 3F3FA 1N6DA 2IUPA 1UTCA 3VI4A 4JSVC 3EU7A 3CIKB 4J82A 3ZDZA 3C9CA 3VI3A 3MZLA 5IT9g 4ZOZA 4PSWB 4L9OA 3IURA 4CI3A 1I2MB 3NIDA 3UKUC 4FA4D 3UVMA 2H3XA 1OLZA 3B7FA 1N6EA 3SN6B 4E54A 5HE3B 3SLED 4MMZA 4AOWA 5A2Qg 4GGDA 2VZ3A 3DM0A 4CI1A 2HKRA 3C99A 4YVDA 3UVLA 3NIFA 1H2ZA 3NVNA 3SXTD 1GOHA 3CFSB 4RE5A 4J79A 2UZYB 4WK4A 5JWZA 5TF2A 2P9UC 4A2MA 1QFSA 4H5IA 2HYEA 4NAAA 2OK6A 4ZOVA 3U4YA 2P9IC 4FA9D 1P22A 4GQ2P 4A08B 3SFZA 5AMSA 2XL3A 4O45A 4QRJA 2EIDA 3JZNA 4IRZA 4JXMA 4NSXA 3EI2A 1OMWB 3C5MA 4ERQA 3L4OD 2OVPB 2IWFA 2BCJB 4J84A 1PGUA 5I5MA 4XEIC 3MVDK 3EI4B 2I0SA 5EM2B 2VDOA 4UM9A 5C2VB 1O6GA 1UOQA 3FCSA 4BCDA 2H6QA 2O9KA 4WK0A 5SXMA 3IUMA 3SCYA 3E0CA 3BG1A 1O6FA 2BKLA 5FFOA 1UOPA 5EMKB 3UVNA 3OKWA 4NENA 4JD2C 2PM6B 1C9LA 2IWKA 3UR4A 5FKRA 1N6FA 3T3MA 2HJ4A 2CE9A 3SBPA 5HDBA 5AFU3 3SJLD 4WJKA 2CO0A 2EIEA 2CN3A 1Q47A 4DNWA 4GM9A 5H14A 4Z7QA 4QAMA 4ZOYA 2B5LA 4O3TB 2WQ8A 1MG2A 2HKMA 2QXVA 3V4PA 4G56B 4J81A 3V5WB 4R7AB 3IUNA 3DSMA 1VZ2A 2Z2PA 1NR0A 2XU7A 5GXHA 1YFQA 2YNOA 1T2XA 2I3TA 4Y5RD 3V7DB 4X61B 4FHLA 3K6SA 4A09A 3EMHA 3AFCA 5I5IA 4J86A 3QI0A 2H9NA 4K3ID 2VDNA 5C9ZB 1L0QA 3L4MD 4D6VA 1XIPA 2XDWA 4GM3A 5GSAA 4Z8LA 3K71A 4FA1D 3I7PA 4JT5C 1U8CA 3K26A 1GOFA 3CFVA 1JOFA 2IUQA 1XKSA 2GNQA 3OL2B 1E5TA 3I2NA 1GP2B 3JPXA 2AH0A 5CXCB 5EMJB 5EMMB 4A7JA 4A0BA 2Z2OA 1JV2A 2VDLA 2YMUA 2H9LA 2HU8A 4G1EA 5FLXg 2BBKH 3PE7A 5FKQA 2PM9A 5HQGA 3DXMC 4Y7RA 1TBGA 5E6RA 3ZWLB 3KCIA 2VZ1A 5EAMA 3FM0A 4A0AA 5FFGA 2J57G 2QR5A 3RN1D 1K32A 3EI3B 3VA6A 3FRXA 4A09B 1VE7A 4CZXA 1C9IA 3N0EA 4O1QD 2I0RA 5EMLB 3ULEC 4GQ1A 4JHPC 1U2VC 3FGBA 3EQ9A 4CI2A 2QC5A 4XYHA 1K3IA 1E8NA 1MDAH 5CYKA 3PXSD 5EM2A 5CXBA 2CO0C 1NEXB 1E8MA 1VYHC 3AL8B 3ORVD 2QZPA 5TEEA 2P9LC 2IAAA 3F3PA 2GC4A 4FWWA 3EG6A 3FCUA 3I7OA 4L3GD 2CN2A 5FA5B 5K19A 1XHMA 4FAVD 3MKSB 5EAPA 1MG3A 4AMZA 5TEFA 4CY3A 4AMYA 3O4GA 2IUVA 4J78A 4AX4A 5THAA 3DDUA 4CC9A 3IIYA 3HFQA 1K8KC 4EWRA 4L1MA 2HU7A 4LG9A 4UI9R 2H9MA 2H47A 2OVRB 4G55A 4BP8A 2EIBA 4X63B 3SMRA 4DNVA 4MMXA 3OW8A 2H13A 4PBZA 3I7HA 3UVOA 4AN1A 2VDRA 3IUJA 5H1MA 3ZE2A 3I7LA 3I8CA 4JSPC 4FA5D 3C75H 3KRXB 5EALA 2AGYA 4BUJC 4Z7OA 3SBQA 2P9NC 4MMYA 4X60B 5E6UA 3GC3B 1B9YA 3PVWB 4XYIA 4WK2A 1A12A 4NC4A 5FKTA 3OKYB 3IIWA 3QHYB 2VDKA 4HDJA 1JMZB 3BG0A 3RLMD 4L3HD 4ESGA 4FB1D 5HE1B 3OKTA 2G9AA 2OJYA 3RFGA 4UM8A 1PI6A 2HU5A 3EI1B 2PM9B 1SQJA 5I5JA 1BPOA 3VGZA 1YR2A 3JB9L 5C92A 3IJ0A 3O4HA 4L1QD 2H68A 3W15A 4H5JA 4OWRA 4G1MA 2CE8A 3PSCB 3GD1I 4CZYA 4PC0A 1FWXA 3V9FA 3ZE0A 3EWEA 3RN0D 3K72A 3I89A 3MUNA 5H17A 2OK4A 3EI1A 1H2YA 3PSLA 4PNKB 2AGXA 2I0TA 2YNPA 5TDHB 4A08A 4X3EA 3V4VA 4QL1A 4K3JB 2YBAA 2MTAH 4J73A 4IMMA 2OVQB 3GREA 5M5VA 3IJCA 5AJAA 3AL9A 3JROA 4ERYA 5M5TA 3SBRA 3IJ1A 4GM8A 4AEZA 3O4IA 2W18A 2B4EA 3MMYA 3OL2A 2IURA 1A0RB 2H6KA 4O02A 2XL2A 3NVQA 1GG2B 3ZDYA 4J0WA 3UVKA 2HXCA 3BWSA 4CI8A 3JAMg 3J80g 1PBYB 4E54B 2HJBA 5GXIA 1VE6A 2H9PA 4JSNC 3N0DA 5HYNB 3EI2B 3O4JA 4O2WA 5GMKn 4ZN4A 3I7KA 1UOOA 5M5RA 3ZE1A 2I3SA 4ERZA 2UZXB 4AN0A 3NVXA 4GMBA 5M5SA 4E5ZB 1ERJA 4ES0A 1QFMA 2P9PC 4PSXB 4J8GA 2XYIA 3EQ8A 4U1EI 2HESX 3J81g 1TYEA 2AGZA 3RSEC 1H2XA 3MUOA 4QT8A 3RRMC 4D0KA 1R5MA 1S4UX 2GC7A 3OTTA 3RFHA 3JZGA 3VH0A 3SVWD 4E5ZA 2VDQA 5CYKB 5FKSA 2B5NA 5IJ7E 2CNXA 3SHFA 3PXTD 2JKXA 4J0XA 5HE2B 4O9DA 4BP9A 1B9XA 4NBMA 5M5UA 2YB8B 4LGNA 4IA9A 1QNIA 3IUQA 4Z7NA 5E6SA 4J87A 4GZ8A 2AGLA 3IJEA 1JTDB 2Q7QA 1U4CA 5B4WA 4KFMB 4BCCA 4D9SA 2PBIB 5IGOA 4O3UB 2PM7B 1SQ9A 2P9SC 2YNNA 2P9KC 3GFCA 3ZDXA 3A0FA 3NIGA
chains in the Genus database with same CATH topology
3I7NA 5HE0B 3AH8B 5KDOB 4U7AA 4J77A 4A0AB 2G99A 2AGWA 3SWSD 5FXYA 4CY5A 3PXWD 3F3GA 4BH6A 4PBYA 3RMZD 5FQDA 4CZVA 2AQ5A 3JZHA 4GQBB 3EI3A 3P4FA 4LG8A 2TRCB 4CY1A 1PEVA 2Z2NA 4JT6C 4A11B 3ODTA 3JRPA 4GGAA 5CXCA 4CY2A 4A2LA 4FAND 4A0BB 3KRWB 3AL8A 3IKOA 5CXBB 4MK0B 4BL0A 3I8EA 5C2WB 3MXXA 3DXKC 3PVUB 4JSXC 4OZUA 3UKRC 4A11A 1JJUB 1GXRA 2H14A 2OIZA 1GOTB 5IGQA 3EI4A 4ZOXA 4GGCA 3DWLC 4PXWA 5K1CC 3OKYA 2H6NA 4QQEA 1TYQC 4TZ4A 1RI6A 3MKQA 1SHYB 2J56H 4N14A 5IJ8E 2EBSA 4I79A 2J55H 2B5MA 5IC7A 5EARA 3K27A 3MZKA 2AH1A 4J8BA 1JMXB 3F3FA 1N6DA 2IUPA 4JSVC 3EU7A 3CIKB 4J82A 3C9CA 3MZLA 5IT9g 4ZOZA 4PSWB 4L9OA 4CI3A 4FA4D 3UKUC 3UVMA 2H3XA 1OLZA 3B7FA 1N6EA 3SN6B 4E54A 5HE3B 3SLED 4AOWA 5A2Qg 4GGDA 3DM0A 4CI1A 2HKRA 3C99A 4YVDA 3UVLA 3NVNA 3SXTD 3CFSB 4J79A 2UZYB 5JWZA 5TF2A 2P9UC 4A2MA 2HYEA 4H5IA 2OK6A 4ZOVA 3U4YA 2P9IC 4FA9D 1P22A 4GQ2P 4A08B 3SFZA 5AMSA 2XL3A 4O45A 4QRJA 3JZNA 4JXMA 4NSXA 3EI2A 1OMWB 3C5MA 4ERQA 3L4OD 2OVPB 2IWFA 2BCJB 4J84A 1PGUA 5I5MA 4XEIC 3EI4B 2I0SA 5EM2B 5C2VB 2H6QA 2O9KA 5SXMA 3SCYA 3E0CA 3BG1A 5EMKB 3UVNA 3OKWA 4JD2C 2PM6B 3UR4A 2IWKA 5FKRA 1N6FA 2HJ4A 2CE9A 3SBPA 5AFU3 3SJLD 2CO0A 2CN3A 1Q47A 4GM9A 5H14A 4ZOYA 2B5LA 4O3TB 1MG2A 2HKMA 2QXVA 4G56B 4J81A 3V5WB 4R7AB 3DSMA 2Z2PA 1NR0A 2XU7A 5GXHA 1YFQA 2YNOA 2I3TA 4Y5RD 3V7DB 4X61B 4FHLA 4A09A 3EMHA 3AFCA 5I5IA 4J86A 2H9NA 4K3ID 5C9ZB 1L0QA 3L4MD 4D6VA 1XIPA 4GM3A 5GSAA 4Z8LA 4FA1D 3I7PA 4JT5C 3K26A 3CFVA 1JOFA 2IUQA 1XKSA 2GNQA 3OL2B 3JPXA 3I2NA 1GP2B 2AH0A 5CXCB 5EMJB 5EMMB 4A7JA 4A0BA 2Z2OA 2YMUA 2H9LA 5FLXg 2BBKH 3PE7A 5FKQA 2PM9A 5HQGA 3DXMC 4Y7RA 1TBGA 3ZWLB 5EAMA 3FM0A 4A0AA 2J57G 3RN1D 1K32A 3EI3B 3VA6A 3FRXA 4A09B 4CZXA 4O1QD 3N0EA 3ULEC 2I0RA 5EMLB 4GQ1A 1U2VC 3FGBA 4CI2A 2QC5A 4XYHA 1MDAH 5CYKA 3PXSD 5EM2A 5CXBA 2CO0C 1NEXB 3AL8B 1VYHC 3ORVD 5TEEA 2P9LC 2IAAA 3F3PA 2GC4A 4FWWA 3EG6A 3I7OA 4L3GD 2CN2A 5FA5B 5K19A 1XHMA 4FAVD 3MKSB 5EAPA 1MG3A 5TEFA 4CY3A 2IUVA 4J78A 5THAA 4CC9A 3IIYA 3HFQA 1K8KC 4EWRA 4LG9A 4UI9R 2H9MA 2H47A 2OVRB 4X63B 3SMRA 3OW8A 2H13A 4PBZA 3I7HA 3UVOA 5H1MA 3I7LA 3I8CA 4JSPC 4FA5D 3C75H 3KRXB 5EALA 2AGYA 4BUJC 3SBQA 2P9NC 4X60B 3PVWB 1B9YA 4XYIA 5FKTA 3OKYB 3IIWA 4HDJA 1JMZB 3BG0A 3RLMD 4L3HD 4ESGA 4FB1D 5HE1B 3OKTA 2G9AA 2OJYA 3RFGA 1PI6A 3EI1B 2PM9B 1SQJA 5I5JA 3VGZA 3JB9L 3IJ0A 4L1QD 2H68A 3W15A 4OWRA 4H5JA 2CE8A 3PSCB 4CZYA 4PC0A 1FWXA 3V9FA 3EWEA 3RN0D 3I89A 5H17A 2OK4A 3EI1A 3PSLA 4PNKB 2AGXA 2I0TA 2YNPA 5TDHB 4A08A 4X3EA 4QL1A 4K3JB 2YBAA 2MTAH 4J73A 4IMMA 2OVQB 3GREA 3IJCA 5AJAA 3AL9A 3JROA 4ERYA 3SBRA 3IJ1A 4GM8A 4AEZA 2W18A 2B4EA 3MMYA 3OL2A 2IURA 1A0RB 2H6KA 2XL2A 3NVQA 1GG2B 4J0WA 3UVKA 2HXCA 3BWSA 4CI8A 3JAMg 3J80g 1PBYB 4E54B 2HJBA 5GXIA 2H9PA 4JSNC 3N0DA 5HYNB 3EI2B 5GMKn 4ZN4A 3I7KA 2I3SA 4ERZA 2UZXB 3NVXA 4GMBA 4E5ZB 1ERJA 4ES0A 2P9PC 4PSXB 4J8GA 2XYIA 4U1EI 2HESX 3J81g 2AGZA 3RSEC 3RRMC 4QT8A 4D0KA 1R5MA 1S4UX 2GC7A 3OTTA 3RFHA 3JZGA 3VH0A 3SVWD 4E5ZA 5CYKB 5FKSA 2B5NA 5IJ7E 2CNXA 3SHFA 3PXTD 4J0XA 5HE2B 4O9DA 1B9XA 2YB8B 4LGNA 4IA9A 1QNIA 4J87A 4GZ8A 2AGLA 2Q7QA 1U4CA 5B4WA 4KFMB 2PBIB 5IGOA 4O3UB 2PM7B 1SQ9A 2P9SC 2YNNA 2P9KC 3GFCA 3A0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I7N A;  5HE0 B;  3AH8 B;  5KDO B;  4U7A A;  4J77 A;  4A0A B;  2G99 A;  2AGW A;  3SWS D;  5FXY A;  4CY5 A;  3PXW D;  3F3G A;  4BH6 A;  4PBY A;  3RMZ D;  5FQD A;  4CZV A;  2AQ5 A;  3JZH A;  4GQB B;  3EI3 A;  3P4F A;  4LG8 A;  2TRC B;  4CY1 A;  1PEV A;  2Z2N A;  4JT6 C;  4A11 B;  3ODT A;  3JRP A;  4GGA A;  5CXC A;  4CY2 A;  4A2L A;  4FAN D;  4A0B B;  3KRW B;  3AL8 A;  3IKO A;  5CXB B;  4MK0 B;  4BL0 A;  3I8E A;  5C2W B;  3MXX A;  3DXK C;  3PVU B;  4JSX C;  4OZU A;  3UKR C;  4A11 A;  1JJU B;  1GXR A;  2H14 A;  2OIZ A;  1GOT B;  5IGQ A;  3EI4 A;  4ZOX A;  4GGC A;  3DWL C;  4PXW A;  5K1C C;  3OKY A;  2H6N A;  4QQE A;  1TYQ C;  4TZ4 A;  1RI6 A;  3MKQ A;  1SHY B;  2J56 H;  4N14 A;  5IJ8 E;  2EBS A;  4I79 A;  2J55 H;  2B5M A;  5IC7 A;  5EAR A;  3K27 A;  3MZK A;  2AH1 A;  4J8B A;  1JMX B;  3F3F A;  1N6D A;  2IUP A;  4JSV C;  3EU7 A;  3CIK B;  4J82 A;  3C9C A;  3MZL A;  5IT9 g;  4ZOZ A;  4PSW B;  4L9O A;  4CI3 A;  4FA4 D;  3UKU C;  3UVM A;  2H3X A;  1OLZ A;  3B7F A;  1N6E A;  3SN6 B;  4E54 A;  5HE3 B;  3SLE D;  4AOW A;  5A2Q g;  4GGD A;  3DM0 A;  4CI1 A;  2HKR A;  3C99 A;  4YVD A;  3UVL A;  3NVN A;  3SXT D;  3CFS B;  4J79 A;  2UZY B;  5JWZ A;  5TF2 A;  2P9U C;  4A2M A;  2HYE A;  4H5I A;  2OK6 A;  4ZOV A;  3U4Y A;  2P9I C;  4FA9 D;  1P22 A;  4GQ2 P;  4A08 B;  3SFZ A;  5AMS A;  2XL3 A;  4O45 A;  4QRJ A;  3JZN A;  4JXM A;  4NSX A;  3EI2 A;  1OMW B;  3C5M A;  4ERQ A;  3L4O D;  2OVP B;  2IWF A;  2BCJ B;  4J84 A;  1PGU A;  5I5M A;  4XEI C;  3EI4 B;  2I0S A;  5EM2 B;  5C2V B;  2H6Q A;  2O9K A;  5SXM A;  3SCY A;  3E0C A;  3BG1 A;  5EMK B;  3UVN A;  3OKW A;  4JD2 C;  2PM6 B;  3UR4 A;  2IWK A;  5FKR A;  1N6F A;  2HJ4 A;  2CE9 A;  3SBP A;  5AFU 3;  3SJL D;  2CO0 A;  2CN3 A;  1Q47 A;  4GM9 A;  5H14 A;  4ZOY A;  2B5L A;  4O3T B;  1MG2 A;  2HKM A;  2QXV A;  4G56 B;  4J81 A;  3V5W B;  4R7A B;  3DSM A;  2Z2P A;  1NR0 A;  2XU7 A;  5GXH A;  1YFQ A;  2YNO A;  2I3T A;  4Y5R D;  3V7D B;  4X61 B;  4FHL A;  4A09 A;  3EMH A;  3AFC A;  5I5I A;  4J86 A;  2H9N A;  4K3I D;  5C9Z B;  1L0Q A;  3L4M D;  4D6V A;  1XIP A;  4GM3 A;  5GSA A;  4Z8L A;  4FA1 D;  3I7P A;  4JT5 C;  3K26 A;  3CFV A;  1JOF A;  2IUQ A;  1XKS A;  2GNQ A;  3OL2 B;  3JPX A;  3I2N A;  1GP2 B;  2AH0 A;  5CXC B;  5EMJ B;  5EMM B;  4A7J A;  4A0B A;  2Z2O A;  2YMU A;  2H9L A;  5FLX g;  2BBK H;  3PE7 A;  5FKQ A;  2PM9 A;  5HQG A;  3DXM C;  4Y7R A;  1TBG A;  3ZWL B;  5EAM A;  3FM0 A;  4A0A A;  2J57 G;  3RN1 D;  1K32 A;  3EI3 B;  3VA6 A;  3FRX A;  4A09 B;  4CZX A;  4O1Q D;  3N0E A;  3ULE C;  2I0R A;  5EML B;  4GQ1 A;  1U2V C;  3FGB A;  4CI2 A;  2QC5 A;  4XYH A;  1MDA H;  5CYK A;  3PXS D;  5EM2 A;  5CXB A;  2CO0 C;  1NEX B;  3AL8 B;  1VYH C;  3ORV D;  5TEE A;  2P9L C;  2IAA A;  3F3P A;  2GC4 A;  4FWW A;  3EG6 A;  3I7O A;  4L3G D;  2CN2 A;  5FA5 B;  5K19 A;  1XHM A;  4FAV D;  3MKS B;  5EAP A;  1MG3 A;  5TEF A;  4CY3 A;  2IUV A;  4J78 A;  5THA A;  4CC9 A;  3IIY A;  3HFQ A;  1K8K C;  4EWR A;  4LG9 A;  4UI9 R;  2H9M A;  2H47 A;  2OVR B;  4X63 B;  3SMR A;  3OW8 A;  2H13 A;  4PBZ A;  3I7H A;  3UVO A;  5H1M A;  3I7L A;  3I8C A;  4JSP C;  4FA5 D;  3C75 H;  3KRX B;  5EAL A;  2AGY A;  4BUJ C;  3SBQ A;  2P9N C;  4X60 B;  3PVW B;  1B9Y A;  4XYI A;  5FKT A;  3OKY B;  3IIW A;  4HDJ A;  1JMZ B;  3BG0 A;  3RLM D;  4L3H D;  4ESG A;  4FB1 D;  5HE1 B;  3OKT A;  2G9A A;  2OJY A;  3RFG A;  1PI6 A;  3EI1 B;  2PM9 B;  1SQJ A;  5I5J A;  3VGZ A;  3JB9 L;  3IJ0 A;  4L1Q D;  2H68 A;  3W15 A;  4OWR A;  4H5J A;  2CE8 A;  3PSC B;  4CZY A;  4PC0 A;  1FWX A;  3V9F A;  3EWE A;  3RN0 D;  3I89 A;  5H17 A;  2OK4 A;  3EI1 A;  3PSL A;  4PNK B;  2AGX A;  2I0T A;  2YNP A;  5TDH B;  4A08 A;  4X3E A;  4QL1 A;  4K3J B;  2YBA A;  2MTA H;  4J73 A;  4IMM A;  2OVQ B;  3GRE A;  3IJC A;  5AJA A;  3AL9 A;  3JRO A;  4ERY A;  3SBR A;  3IJ1 A;  4GM8 A;  4AEZ A;  2W18 A;  2B4E A;  3MMY A;  3OL2 A;  2IUR A;  1A0R B;  2H6K A;  2XL2 A;  3NVQ A;  1GG2 B;  4J0W A;  3UVK A;  2HXC A;  3BWS A;  4CI8 A;  3JAM g;  3J80 g;  1PBY B;  4E54 B;  2HJB A;  5GXI A;  2H9P A;  4JSN C;  3N0D A;  5HYN B;  3EI2 B;  5GMK n;  4ZN4 A;  3I7K A;  2I3S A;  4ERZ A;  2UZX B;  3NVX A;  4GMB A;  4E5Z B;  1ERJ A;  4ES0 A;  2P9P C;  4PSX B;  4J8G A;  2XYI A;  4U1E I;  2HES X;  3J81 g;  2AGZ A;  3RSE C;  3RRM C;  4QT8 A;  4D0K A;  1R5M A;  1S4U X;  2GC7 A;  3OTT A;  3RFH A;  3JZG A;  3VH0 A;  3SVW D;  4E5Z A;  5CYK B;  5FKS A;  2B5N A;  5IJ7 E;  2CNX A;  3SHF A;  3PXT D;  4J0X A;  5HE2 B;  4O9D A;  1B9X A;  2YB8 B;  4LGN A;  4IA9 A;  1QNI A;  4J87 A;  4GZ8 A;  2AGL A;  2Q7Q A;  1U4C A;  5B4W A;  4KFM B;  2PBI B;  5IGO A;  4O3U B;  2PM7 B;  1SQ9 A;  2P9S C;  2YNN A;  2P9K C;  3GFC A;  3A0F A; 
#chains in the Genus database with same CATH topology
 3I7N A;  5HE0 B;  3AH8 B;  4BCB A;  5KDO B;  1GOG A;  4U7A A;  4J77 A;  5C86 A;  4A0A B;  2G99 A;  2AGW A;  3SWS D;  5FXY A;  4CY5 A;  1H2W A;  3PXW D;  1L5G A;  3F3G A;  4DNU A;  4BH6 A;  4PBY A;  1M1X A;  3RMZ D;  2EIC A;  5FQD A;  4CZV A;  2AQ5 A;  3JZH A;  4GQB B;  3EI3 A;  3P4F A;  4LG8 A;  2TRC B;  4CY1 A;  3OF7 A;  1PEV A;  2Z2N A;  4JT6 C;  2XE4 A;  4A11 B;  3ODT A;  3JRP A;  4GGA A;  5CXC A;  4CY2 A;  4A2L A;  4FAN D;  4A0B B;  3KRW B;  3AL8 A;  3IKO A;  5CXB B;  4MK0 B;  4BL0 A;  3I8E A;  5C2W B;  3MXX A;  3DXK C;  3PVU B;  4JSX C;  4OZU A;  3UKR C;  4A11 A;  1JJU B;  1GXR A;  2H14 A;  2OIZ A;  1GOT B;  3IUL A;  5IGQ A;  3EI4 A;  5M61 A;  4ZOX A;  4GGC A;  3DWL C;  4PXW A;  5K1C C;  3OKY A;  2H6N A;  4QQE A;  1TYQ C;  4TZ4 A;  1RI6 A;  3MKQ A;  2VDM A;  1SHY B;  2XZG A;  3EQ7 A;  2J56 H;  4N14 A;  3T3P A;  1VZ3 A;  4RE6 A;  5IJ8 E;  2EBS A;  4I79 A;  2J55 H;  2B5M A;  5IC7 A;  5EAR A;  3K27 A;  3MZK A;  3IVM A;  2AH1 A;  4JHN A;  4J8B A;  1JMX B;  2VC2 A;  2VDP A;  3F3F A;  1N6D A;  2IUP A;  1UTC A;  3VI4 A;  4JSV C;  3EU7 A;  3CIK B;  4J82 A;  3ZDZ A;  3C9C A;  3VI3 A;  3MZL A;  5IT9 g;  4ZOZ A;  4PSW B;  4L9O A;  3IUR A;  4CI3 A;  1I2M B;  3NID A;  3UKU C;  4FA4 D;  3UVM A;  2H3X A;  1OLZ A;  3B7F A;  1N6E A;  3SN6 B;  4E54 A;  5HE3 B;  3SLE D;  4MMZ A;  4AOW A;  5A2Q g;  4GGD A;  2VZ3 A;  3DM0 A;  4CI1 A;  2HKR A;  3C99 A;  4YVD A;  3UVL A;  3NIF A;  1H2Z A;  3NVN A;  3SXT D;  1GOH A;  3CFS B;  4RE5 A;  4J79 A;  2UZY B;  4WK4 A;  5JWZ A;  5TF2 A;  2P9U C;  4A2M A;  1QFS A;  4H5I A;  2HYE A;  4NAA A;  2OK6 A;  4ZOV A;  3U4Y A;  2P9I C;  4FA9 D;  1P22 A;  4GQ2 P;  4A08 B;  3SFZ A;  5AMS A;  2XL3 A;  4O45 A;  4QRJ A;  2EID A;  3JZN A;  4IRZ A;  4JXM A;  4NSX A;  3EI2 A;  1OMW B;  3C5M A;  4ERQ A;  3L4O D;  2OVP B;  2IWF A;  2BCJ B;  4J84 A;  1PGU A;  5I5M A;  4XEI C;  3MVD K;  3EI4 B;  2I0S A;  5EM2 B;  2VDO A;  4UM9 A;  5C2V B;  1O6G A;  1UOQ A;  3FCS A;  4BCD A;  2H6Q A;  2O9K A;  4WK0 A;  5SXM A;  3IUM A;  3SCY A;  3E0C A;  3BG1 A;  1O6F A;  2BKL A;  5FFO A;  1UOP A;  5EMK B;  3UVN A;  3OKW A;  4NEN A;  4JD2 C;  2PM6 B;  1C9L A;  2IWK A;  3UR4 A;  5FKR A;  1N6F A;  3T3M A;  2HJ4 A;  2CE9 A;  3SBP A;  5HDB A;  5AFU 3;  3SJL D;  4WJK A;  2CO0 A;  2EIE A;  2CN3 A;  1Q47 A;  4DNW A;  4GM9 A;  5H14 A;  4Z7Q A;  4QAM A;  4ZOY A;  2B5L A;  4O3T B;  2WQ8 A;  1MG2 A;  2HKM A;  2QXV A;  3V4P A;  4G56 B;  4J81 A;  3V5W B;  4R7A B;  3IUN A;  3DSM A;  1VZ2 A;  2Z2P A;  1NR0 A;  2XU7 A;  5GXH A;  1YFQ A;  2YNO A;  1T2X A;  2I3T A;  4Y5R D;  3V7D B;  4X61 B;  4FHL A;  3K6S A;  4A09 A;  3EMH A;  3AFC A;  5I5I A;  4J86 A;  3QI0 A;  2H9N A;  4K3I D;  2VDN A;  5C9Z B;  1L0Q A;  3L4M D;  4D6V A;  1XIP A;  2XDW A;  4GM3 A;  5GSA A;  4Z8L A;  3K71 A;  4FA1 D;  3I7P A;  4JT5 C;  1U8C A;  3K26 A;  1GOF A;  3CFV A;  1JOF A;  2IUQ A;  1XKS A;  2GNQ A;  3OL2 B;  1E5T A;  3I2N A;  1GP2 B;  3JPX A;  2AH0 A;  5CXC B;  5EMJ B;  5EMM B;  4A7J A;  4A0B A;  2Z2O A;  1JV2 A;  2VDL A;  2YMU A;  2H9L A;  2HU8 A;  4G1E A;  5FLX g;  2BBK H;  3PE7 A;  5FKQ A;  2PM9 A;  5HQG A;  3DXM C;  4Y7R A;  1TBG A;  5E6R A;  3ZWL B;  3KCI A;  2VZ1 A;  5EAM A;  3FM0 A;  4A0A A;  5FFG A;  2J57 G;  2QR5 A;  3RN1 D;  1K32 A;  3EI3 B;  3VA6 A;  3FRX A;  4A09 B;  1VE7 A;  4CZX A;  1C9I A;  3N0E A;  4O1Q D;  2I0R A;  5EML B;  3ULE C;  4GQ1 A;  4JHP C;  1U2V C;  3FGB A;  3EQ9 A;  4CI2 A;  2QC5 A;  4XYH A;  1K3I A;  1E8N A;  1MDA H;  5CYK A;  3PXS D;  5EM2 A;  5CXB A;  2CO0 C;  1NEX B;  1E8M A;  1VYH C;  3AL8 B;  3ORV D;  2QZP A;  5TEE A;  2P9L C;  2IAA A;  3F3P A;  2GC4 A;  4FWW A;  3EG6 A;  3FCU A;  3I7O A;  4L3G D;  2CN2 A;  5FA5 B;  5K19 A;  1XHM A;  4FAV D;  3MKS B;  5EAP A;  1MG3 A;  4AMZ A;  5TEF A;  4CY3 A;  4AMY A;  3O4G A;  2IUV A;  4J78 A;  4AX4 A;  5THA A;  3DDU A;  4CC9 A;  3IIY A;  3HFQ A;  1K8K C;  4EWR A;  4L1M A;  2HU7 A;  4LG9 A;  4UI9 R;  2H9M A;  2H47 A;  2OVR B;  4G55 A;  4BP8 A;  2EIB A;  4X63 B;  3SMR A;  4DNV A;  4MMX A;  3OW8 A;  2H13 A;  4PBZ A;  3I7H A;  3UVO A;  4AN1 A;  2VDR A;  3IUJ A;  5H1M A;  3ZE2 A;  3I7L A;  3I8C A;  4JSP C;  4FA5 D;  3C75 H;  3KRX B;  5EAL A;  2AGY A;  4BUJ C;  4Z7O A;  3SBQ A;  2P9N C;  4MMY A;  4X60 B;  5E6U A;  3GC3 B;  1B9Y A;  3PVW B;  4XYI A;  4WK2 A;  1A12 A;  4NC4 A;  5FKT A;  3OKY B;  3IIW A;  3QHY B;  2VDK A;  4HDJ A;  1JMZ B;  3BG0 A;  3RLM D;  4L3H D;  4ESG A;  4FB1 D;  5HE1 B;  3OKT A;  2G9A A;  2OJY A;  3RFG A;  4UM8 A;  1PI6 A;  2HU5 A;  3EI1 B;  2PM9 B;  1SQJ A;  5I5J A;  1BPO A;  3VGZ A;  1YR2 A;  3JB9 L;  5C92 A;  3IJ0 A;  3O4H A;  4L1Q D;  2H68 A;  3W15 A;  4H5J A;  4OWR A;  4G1M A;  2CE8 A;  3PSC B;  3GD1 I;  4CZY A;  4PC0 A;  1FWX A;  3V9F A;  3ZE0 A;  3EWE A;  3RN0 D;  3K72 A;  3I89 A;  3MUN A;  5H17 A;  2OK4 A;  3EI1 A;  1H2Y A;  3PSL A;  4PNK B;  2AGX A;  2I0T A;  2YNP A;  5TDH B;  4A08 A;  4X3E A;  3V4V A;  4QL1 A;  4K3J B;  2YBA A;  2MTA H;  4J73 A;  4IMM A;  2OVQ B;  3GRE A;  5M5V A;  3IJC A;  5AJA A;  3AL9 A;  3JRO A;  4ERY A;  5M5T A;  3SBR A;  3IJ1 A;  4GM8 A;  4AEZ A;  3O4I A;  2W18 A;  2B4E A;  3MMY A;  3OL2 A;  2IUR A;  1A0R B;  2H6K A;  4O02 A;  2XL2 A;  3NVQ A;  1GG2 B;  3ZDY A;  4J0W A;  3UVK A;  2HXC A;  3BWS A;  4CI8 A;  3JAM g;  3J80 g;  1PBY B;  4E54 B;  2HJB A;  5GXI A;  1VE6 A;  2H9P A;  4JSN C;  3N0D A;  5HYN B;  3EI2 B;  3O4J A;  4O2W A;  5GMK n;  4ZN4 A;  3I7K A;  1UOO A;  5M5R A;  3ZE1 A;  2I3S A;  4ERZ A;  2UZX B;  4AN0 A;  3NVX A;  4GMB A;  5M5S A;  4E5Z B;  1ERJ A;  4ES0 A;  1QFM A;  2P9P C;  4PSX B;  4J8G A;  2XYI A;  3EQ8 A;  4U1E I;  2HES X;  3J81 g;  1TYE A;  2AGZ A;  3RSE C;  1H2X A;  3MUO A;  4QT8 A;  3RRM C;  4D0K A;  1R5M A;  1S4U X;  2GC7 A;  3OTT A;  3RFH A;  3JZG A;  3VH0 A;  3SVW D;  4E5Z A;  2VDQ A;  5CYK B;  5FKS A;  2B5N A;  5IJ7 E;  2CNX A;  3SHF A;  3PXT D;  2JKX A;  4J0X A;  5HE2 B;  4O9D A;  4BP9 A;  1B9X A;  4NBM A;  5M5U A;  2YB8 B;  4LGN A;  4IA9 A;  1QNI A;  3IUQ A;  4Z7N A;  5E6S A;  4J87 A;  4GZ8 A;  2AGL A;  3IJE A;  1JTD B;  2Q7Q A;  1U4C A;  5B4W A;  4KFM B;  4BCC A;  4D9S A;  2PBI B;  5IGO A;  4O3U B;  2PM7 B;  1SQ9 A;  2P9S C;  2YNN A;  2P9K C;  3GFC A;  3ZDX A;  3A0F A;  3NIG A; 
#chains in the Genus database with same CATH homology
 3I7N A;  5HE0 B;  3AH8 B;  5KDO B;  4U7A A;  4J77 A;  4A0A B;  2G99 A;  2AGW A;  3SWS D;  5FXY A;  4CY5 A;  3PXW D;  3F3G A;  4BH6 A;  4PBY A;  3RMZ D;  5FQD A;  4CZV A;  2AQ5 A;  3JZH A;  4GQB B;  3EI3 A;  3P4F A;  4LG8 A;  2TRC B;  4CY1 A;  1PEV A;  2Z2N A;  4JT6 C;  4A11 B;  3ODT A;  3JRP A;  4GGA A;  5CXC A;  4CY2 A;  4A2L A;  4FAN D;  4A0B B;  3KRW B;  3AL8 A;  3IKO A;  5CXB B;  4MK0 B;  4BL0 A;  3I8E A;  5C2W B;  3MXX A;  3DXK C;  3PVU B;  4JSX C;  4OZU A;  3UKR C;  4A11 A;  1JJU B;  1GXR A;  2H14 A;  2OIZ A;  1GOT B;  5IGQ A;  3EI4 A;  4ZOX A;  4GGC A;  3DWL C;  4PXW A;  5K1C C;  3OKY A;  2H6N A;  4QQE A;  1TYQ C;  4TZ4 A;  1RI6 A;  3MKQ A;  1SHY B;  2J56 H;  4N14 A;  5IJ8 E;  2EBS A;  4I79 A;  2J55 H;  2B5M A;  5IC7 A;  5EAR A;  3K27 A;  3MZK A;  2AH1 A;  4J8B A;  1JMX B;  3F3F A;  1N6D A;  2IUP A;  4JSV C;  3EU7 A;  3CIK B;  4J82 A;  3C9C A;  3MZL A;  5IT9 g;  4ZOZ A;  4PSW B;  4L9O A;  4CI3 A;  4FA4 D;  3UKU C;  3UVM A;  2H3X A;  1OLZ A;  3B7F A;  1N6E A;  3SN6 B;  4E54 A;  5HE3 B;  3SLE D;  4AOW A;  5A2Q g;  4GGD A;  3DM0 A;  4CI1 A;  2HKR A;  3C99 A;  4YVD A;  3UVL A;  3NVN A;  3SXT D;  3CFS B;  4J79 A;  2UZY B;  5JWZ A;  5TF2 A;  2P9U C;  4A2M A;  2HYE A;  4H5I A;  2OK6 A;  4ZOV A;  3U4Y A;  2P9I C;  4FA9 D;  1P22 A;  4GQ2 P;  4A08 B;  3SFZ A;  5AMS A;  2XL3 A;  4O45 A;  4QRJ A;  3JZN A;  4JXM A;  4NSX A;  3EI2 A;  1OMW B;  3C5M A;  4ERQ A;  3L4O D;  2OVP B;  2IWF A;  2BCJ B;  4J84 A;  1PGU A;  5I5M A;  4XEI C;  3EI4 B;  2I0S A;  5EM2 B;  5C2V B;  2H6Q A;  2O9K A;  5SXM A;  3SCY A;  3E0C A;  3BG1 A;  5EMK B;  3UVN A;  3OKW A;  4JD2 C;  2PM6 B;  3UR4 A;  2IWK A;  5FKR A;  1N6F A;  2HJ4 A;  2CE9 A;  3SBP A;  5AFU 3;  3SJL D;  2CO0 A;  2CN3 A;  1Q47 A;  4GM9 A;  5H14 A;  4ZOY A;  2B5L A;  4O3T B;  1MG2 A;  2HKM A;  2QXV A;  4G56 B;  4J81 A;  3V5W B;  4R7A B;  3DSM A;  2Z2P A;  1NR0 A;  2XU7 A;  5GXH A;  1YFQ A;  2YNO A;  2I3T A;  4Y5R D;  3V7D B;  4X61 B;  4FHL A;  4A09 A;  3EMH A;  3AFC A;  5I5I A;  4J86 A;  2H9N A;  4K3I D;  5C9Z B;  1L0Q A;  3L4M D;  4D6V A;  1XIP A;  4GM3 A;  5GSA A;  4Z8L A;  4FA1 D;  3I7P A;  4JT5 C;  3K26 A;  3CFV A;  1JOF A;  2IUQ A;  1XKS A;  2GNQ A;  3OL2 B;  3JPX A;  3I2N A;  1GP2 B;  2AH0 A;  5CXC B;  5EMJ B;  5EMM B;  4A7J A;  4A0B A;  2Z2O A;  2YMU A;  2H9L A;  5FLX g;  2BBK H;  3PE7 A;  5FKQ A;  2PM9 A;  5HQG A;  3DXM C;  4Y7R A;  1TBG A;  3ZWL B;  5EAM A;  3FM0 A;  4A0A A;  2J57 G;  3RN1 D;  1K32 A;  3EI3 B;  3VA6 A;  3FRX A;  4A09 B;  4CZX A;  4O1Q D;  3N0E A;  3ULE C;  2I0R A;  5EML B;  4GQ1 A;  1U2V C;  3FGB A;  4CI2 A;  2QC5 A;  4XYH A;  1MDA H;  5CYK A;  3PXS D;  5EM2 A;  5CXB A;  2CO0 C;  1NEX B;  3AL8 B;  1VYH C;  3ORV D;  5TEE A;  2P9L C;  2IAA A;  3F3P A;  2GC4 A;  4FWW A;  3EG6 A;  3I7O A;  4L3G D;  2CN2 A;  5FA5 B;  5K19 A;  1XHM A;  4FAV D;  3MKS B;  5EAP A;  1MG3 A;  5TEF A;  4CY3 A;  2IUV A;  4J78 A;  5THA A;  4CC9 A;  3IIY A;  3HFQ A;  1K8K C;  4EWR A;  4LG9 A;  4UI9 R;  2H9M A;  2H47 A;  2OVR B;  4X63 B;  3SMR A;  3OW8 A;  2H13 A;  4PBZ A;  3I7H A;  3UVO A;  5H1M A;  3I7L A;  3I8C A;  4JSP C;  4FA5 D;  3C75 H;  3KRX B;  5EAL A;  2AGY A;  4BUJ C;  3SBQ A;  2P9N C;  4X60 B;  3PVW B;  1B9Y A;  4XYI A;  5FKT A;  3OKY B;  3IIW A;  4HDJ A;  1JMZ B;  3BG0 A;  3RLM D;  4L3H D;  4ESG A;  4FB1 D;  5HE1 B;  3OKT A;  2G9A A;  2OJY A;  3RFG A;  1PI6 A;  3EI1 B;  2PM9 B;  1SQJ A;  5I5J A;  3VGZ A;  3JB9 L;  3IJ0 A;  4L1Q D;  2H68 A;  3W15 A;  4OWR A;  4H5J A;  2CE8 A;  3PSC B;  4CZY A;  4PC0 A;  1FWX A;  3V9F A;  3EWE A;  3RN0 D;  3I89 A;  5H17 A;  2OK4 A;  3EI1 A;  3PSL A;  4PNK B;  2AGX A;  2I0T A;  2YNP A;  5TDH B;  4A08 A;  4X3E A;  4QL1 A;  4K3J B;  2YBA A;  2MTA H;  4J73 A;  4IMM A;  2OVQ B;  3GRE A;  3IJC A;  5AJA A;  3AL9 A;  3JRO A;  4ERY A;  3SBR A;  3IJ1 A;  4GM8 A;  4AEZ A;  2W18 A;  2B4E A;  3MMY A;  3OL2 A;  2IUR A;  1A0R B;  2H6K A;  2XL2 A;  3NVQ A;  1GG2 B;  4J0W A;  3UVK A;  2HXC A;  3BWS A;  4CI8 A;  3JAM g;  3J80 g;  1PBY B;  4E54 B;  2HJB A;  5GXI A;  2H9P A;  4JSN C;  3N0D A;  5HYN B;  3EI2 B;  5GMK n;  4ZN4 A;  3I7K A;  2I3S A;  4ERZ A;  2UZX B;  3NVX A;  4GMB A;  4E5Z B;  1ERJ A;  4ES0 A;  2P9P C;  4PSX B;  4J8G A;  2XYI A;  4U1E I;  2HES X;  3J81 g;  2AGZ A;  3RSE C;  3RRM C;  4QT8 A;  4D0K A;  1R5M A;  1S4U X;  2GC7 A;  3OTT A;  3RFH A;  3JZG A;  3VH0 A;  3SVW D;  4E5Z A;  5CYK B;  5FKS A;  2B5N A;  5IJ7 E;  2CNX A;  3SHF A;  3PXT D;  4J0X A;  5HE2 B;  4O9D A;  1B9X A;  2YB8 B;  4LGN A;  4IA9 A;  1QNI A;  4J87 A;  4GZ8 A;  2AGL A;  2Q7Q A;  1U4C A;  5B4W A;  4KFM B;  2PBI B;  5IGO A;  4O3U B;  2PM7 B;  1SQ9 A;  2P9S C;  2YNN A;  2P9K C;  3GFC A;  3A0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...