4UI9R

Atomic structure of the human anaphase-promoting complex
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
452
structure length
387
Chain Sequence
SKHGDRFIPSRAGANWSVNFHRINENGLAYSALLKNELLGAGIEKVQKGLFTYSLSPYSLSPVSNKSQKLLRSSKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWNAEQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSLSPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSVSVLNLFTRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords ANAPHASE-PROMOTING COMPLEX SUBUNIT 1
publication title Atomic Structure of the Apc and its Mechanism of Protein Ubiquitination
pubmed doi rcsb
total genus 77
structure length 387
sequence length 452
ec nomenclature
pdb deposition date 2015-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00400 WD40 WD domain, G-beta repeat
R PF12894 ANAPC4_WD40 Anaphase-promoting complex subunit 4 WD40 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4ui9R01
5TF2A 2BCJB 3EI3B 4D6VA 2B5LA 2OVPB 3C75H 3UVKA 4A7JA 3B7FA 1R5MA 4A2LA 4EWRA 2B5NA 4CZVA 3EI2B 2GC7A 4PSWB 3UVLA 2OVRB 3IIWA 4CI1A 1GXRA 1K8KC 1GG2B 5GXIA 4PNKB 2G99A 4ZOZA 4FWWA 1SQ9A 4QL1A 5AJAA 1PI6A 5HE0B 3UVNA 1SHYB 1XKSA 3EI4A 5FKQA 2J57G 3U4YA 4O45A 5IC7A 3P4FA 4ESGA 2H9LA 2UZXB 3SN6B 2IURA 5AFU3 1JJUB 5EMJB 2H6QA 3NVXA 2H9MA 4ES0A 3L4MD 4CI8A 3DM0A 3RFHA 5EMLB 3MMYA 4A0BB 5HE2B 4GQ1A 3V5WB 5CXBB 5CXCB 5GXHA 2AGXA 3PVWB 3C99A 4J0XA 2YNOA 3JB9L 5IGOA 3AL8A 3FGBA 4A08B 2I0TA 2J55H 3DSMA 3OL2B 2P9PC 4Y5RD 3W15A 5EMKB 3SBRA 4L9OA 4ZN4A 1MG3A 2P9KC 5I5JA 3I2NA 5CYKA 5IJ7E 5EM2B 3ZWLB 3SMRA 2XYIA 3MZLA 3EI1A 2CO0C 2P9LC 3L4OD 4CC9A 4X3EA 4Z8LA 4JSPC 2AQ5A 2I3SA 4LG8A 3F3FA 5FQDA 2GNQA 4YVDA 2QXVA 5FKRA 4JXMA 3I7PA 3KRXB 2HKRA 3F3PA 2OK4A 4J8GA 5H17A 4AOWA 5A2Qg 2HJBA 3NVNA 1N6FA 4QRJA 2O9KA 3V7DB 5FKTA 3UKUC 3IJ0A 3EI2A 1NEXB 1PBYB 2Z2PA 2HESX 4XYIA 3JPXA 3SLED 3ODTA 4A09B 4X61B 4GQBB 3I7LA 3A0FA 4U7AA 3RRMC 2PM6B 5EALA 2PM9B 4K3ID 2YBAA 5HE3B 3JRPA 2XL3A 4BL0A 2CE8A 3UR4A 3VH0A 2AGWA 3PSCB 2H13A 1S4UX 2YMUA 4J86A 2IAAA 3IIYA 1JMZB 3I7KA 4JSNC 2AGLA 3I89A 4JT6C 5JWZA 4E54A 4PXWA 5FKSA 3UVMA 2XL2A 3UVOA 5H14A 3RFGA 3I8EA 4FA1D 2BBKH 2H14A 4JT5C 2W18A 4FA9D 1ERJA 4GGAA 4ERYA 5CXCA 4CI2A 2YB8B 3SCYA 3EI4B 5B4WA 5EARA 1GP2B 5TDHB 1K32A 3SWSD 4A08A 3JROA 3PE7A 4J0WA 3OL2A 2I0RA 3C5MA 4G56B 2PM7B 1OLZA 2H68A 4R7AB 4GM8A 5C2WB 4QT8A 3MKQA 4A11B 2PBIB 3IJCA 4ZOYA 5HYNB 3E0CA 4LGNA 2HYEA 5C9ZB 1YFQA 4CZXA 5GMKn 1B9XA 1L0QA 4J84A 4J81A 5HE1B 3I7NA 4GQ2P 4O9DA 1XIPA 3I7OA 1TBGA 3GREA 3CFSB 2H47A 5EAPA 1QNIA 3SBQA 3OKYB 2AGYA 2Z2NA 3I7HA 3SVWD 4CY2A 5FLXg 3K26A 3JZGA 4E5ZA 5K19A 1JMXB 5HQGA 5THAA 4A0AA 2G9AA 3FRXA 5CYKB 4JSVC 5I5MA 4JD2C 4TZ4A 5FXYA 3PXWD 4ZOXA 3FM0A 3NVQA 3C9CA 3EI3A 3RN0D 3AFCA 2IWFA 5SXMA 2XU7A 4AEZA 4X63B 4FAND 3SHFA 3CIKB 4A2MA 2OJYA 3DXKC 2H3XA 4A09A 3IKOA 4H5JA 2IUVA 3OTTA 5GSAA 3N0DA 3J81g 4J77A 3CFVA 4CI3A 1N6DA 5EMMB 3EG6A 2CN3A 2IUPA 4LG9A 5K1CC 4U1EI 4HDJA 3F3GA 3SBPA 4X60B 2AH1A 2H9NA 4N14A 4OWRA 2IUQA 3DWLC 4O1QD 2H6KA 2OK6A 4L1QD 4Y7RA 5AMSA 2HJ4A 2AGZA 3I8CA 3MKSB 2UZYB 3MXXA 4JSXC 4BH6A 4FAVD 5KDOB 3SXTD 2CE9A 4FA4D 4GM9A 3JZNA 5I5IA 1RI6A 4A0BA 2B5MA 3GFCA 4J79A 4GZ8A 4L3GD 2TRCB 4GM3A 3RMZD 2P9NC 5CXBA 1P22A 5TEFA 3N0EA 2HXCA 4L3HD 4BUJC 3BG0A 3SFZA 2EBSA 1MG2A 3HFQA 3K27A 3OKTA 1PGUA 3JAMg 2B4EA 1U4CA 3OKWA 4H5IA 4E54B 5H1MA 3UKRC 3VA6A 3PVUB 3ORVD 3AH8B 4ERZA 4J87A 2AH0A 2I0SA 4A11A 2CNXA 2QC5A 3VGZA 1TYQC 2GC4A 4CY1A 5TEEA 3EMHA 4GMBA 3MZKA 4IMMA 2MTAH 3KRWB 5EAMA 3IJ1A 5EM2A 4K3JB 4PBZA 4XEIC 1U2VC 3AL9A 3PXSD 3EWEA 4CY3A 4ZOVA 4ERQA 4FB1D 4PC0A 1N6EA 4UI9R 1SQJA 3AL8B 1OMWB 3SJLD 3EU7A 1JOFA 3RSEC 3OKYA 1Q47A 1XHMA 3DXMC 2OVQB 5IJ8E 1MDAH 2P9SC 4KFMB 3PXTD 5FA5B 3JZHA 2I3TA 3OW8A 1GOTB 4D0KA 2H6NA 4QQEA 5IGQA 4XYHA 4I79A 3EI1B 2YNNA 4GGCA 3RN1D 2HKMA 4FHLA 4O3TB 2J56H 2OIZA 3BG1A 4O3UB 2Q7QA 2CN2A 1A0RB 2IWKA 2YNPA 2P9UC 4OZUA 1VYHC 4PBYA 3ULEC 2CO0A 5C2VB 3J80g 5IT9g 4PSXB 1B9YA 4E5ZB 1FWXA 3RLMD 2Z2OA 4FA5D 4A0AB 4GGDA 4IA9A 3V9FA 4J78A 1PEVA 2P9IC 2PM9A 4MK0B 4J8BA 4CY5A 2H9PA 3BWSA 4J82A 4CZYA 4NSXA 4J73A 1NR0A 3PSLA
chains in the Genus database with same CATH superfamily
5TF2A 4JHPC 2BCJB 3EI3B 4D6VA 2B5LA 2EIBA 2OVPB 3C75H 3UVKA 4A7JA 3B7FA 4BCDA 1R5MA 4A2LA 4EWRA 2B5NA 4CZVA 3EI2B 2GC7A 1QFSA 4PSWB 4WK0A 3O4GA 3UVLA 1K3IA 1E8MA 2OVRB 3IIWA 4CI1A 1GXRA 1K8KC 1BPOA 1GG2B 5GXIA 4PNKB 2G99A 4ZOZA 4FWWA 1SQ9A 4BCBA 4QL1A 2JKXA 5AJAA 1PI6A 5HE0B 3UVNA 1SHYB 1XKSA 3EI4A 5FKQA 3K72A 2J57G 4G1MA 3U4YA 4O45A 5E6UA 5IC7A 3P4FA 4ESGA 3K6SA 2H9LA 2UZXB 4UM8A 3SN6B 2IURA 3T3MA 5AFU3 1JJUB 5EMJB 2H6QA 3NVXA 2H9MA 3QI0A 1VZ3A 4ES0A 3L4MD 4CI8A 3DM0A 3RFHA 5EMLB 3MMYA 4A0BB 5HE2B 3IUNA 4GQ1A 3V5WB 1I2MB 2XE4A 1VE6A 4AN0A 3GC3B 5CXBB 5CXCB 5GXHA 2AGXA 3PVWB 5FFOA 3C99A 1U8CA 4J0XA 2YNOA 3JB9L 5IGOA 3AL8A 3MVDK 3FGBA 3K71A 5C92A 4A08B 2EIDA 2I0TA 2J55H 3EQ8A 3DSMA 3OL2B 1E8NA 2P9PC 4Y5RD 3W15A 5EMKB 3SBRA 4AMYA 3FCUA 5M61A 1M1XA 3IUMA 4L9OA 4ZN4A 1MG3A 2P9KC 4NENA 3EQ7A 5I5JA 1H2WA 3I2NA 5HDBA 5CYKA 5M5UA 5IJ7E 5EM2B 3ZWLB 4BP8A 3SMRA 2XYIA 3MZLA 3EI1A 2CO0C 2P9LC 3L4OD 4CC9A 4X3EA 4Z8LA 1UOQA 4JSPC 2QZPA 2AQ5A 1H2ZA 2I3SA 4LG8A 3F3FA 4WK2A 5FQDA 4Z7QA 2VDOA 2GNQA 1QFMA 4JHNA 4YVDA 2QXVA 5FKRA 4JXMA 3I7PA 3KRXB 2HKRA 3F3PA 2OK4A 5FFGA 4J8GA 5H17A 4AOWA 5A2Qg 2HJBA 3NVNA 3O4JA 3ZDXA 1N6FA 4QRJA 2O9KA 3V7DB 5FKTA 3UKUC 3IJ0A 3IVMA 3EI2A 1NEXB 1GOGA 1PBYB 2Z2PA 4RE5A 2HESX 4UM9A 4XYIA 2XDWA 3JPXA 3SLED 3ODTA 4A09B 4X61B 1E5TA 3VI3A 4GQBB 3I7LA 3A0FA 4U7AA 3RRMC 2PM6B 5EALA 2PM9B 4K3ID 2YBAA 5HE3B 3JRPA 2XL3A 4BL0A 2CE8A 1YR2A 3UR4A 3VH0A 3ZDYA 2AGWA 3PSCB 2H13A 1S4UX 2YMUA 3NIFA 4J86A 2IAAA 3IIYA 1JMZB 4NBMA 3I7KA 4JSNC 2AGLA 3I89A 4JT6C 1TYEA 5JWZA 3EQ9A 4E54A 4PXWA 5FKSA 3UVMA 2XL2A 3UVOA 5H14A 3RFGA 3I8EA 4FA1D 2BBKH 2H14A 4JT5C 2W18A 2XZGA 4FA9D 1ERJA 4GGAA 2VDPA 4ERYA 5CXCA 4CI2A 2BKLA 2YB8B 3SCYA 3EI4B 5B4WA 5EARA 3OF7A 1H2YA 4NC4A 3ZDZA 5M5SA 1GP2B 5TDHB 1K32A 3SWSD 2VDKA 4A08A 3JROA 3PE7A 5E6RA 5C86A 4J0WA 3OL2A 2I0RA 3C5MA 4G56B 2PM7B 4Z7OA 1OLZA 2H68A 4DNWA 4G1EA 4R7AB 4AMZA 3DDUA 3IULA 4GM8A 5C2WB 1A12A 4QT8A 3MKQA 4DNUA 4MMXA 4A11B 2PBIB 3IJCA 4ZOYA 5HYNB 3E0CA 4LGNA 2HYEA 4WJKA 5C9ZB 1YFQA 4CZXA 4O2WA 3IUJA 4L1MA 5GMKn 1B9XA 1L0QA 4J84A 4J81A 5HE1B 3I7NA 4GQ2P 4O9DA 3V4PA 3O4HA 1XIPA 1JTDB 3I7OA 1TBGA 1UTCA 3GREA 3CFSB 2H47A 5EAPA 1QNIA 3SBQA 1VZ2A 2AGYA 2Z2NA 3I7HA 3OKYB 3SVWD 4CY2A 3MUNA 5FLXg 3K26A 3JZGA 4E5ZA 5K19A 1JMXB 5HQGA 5THAA 4A0AA 2VDQA 2G9AA 3FRXA 2VDNA 5CYKB 4JSVC 5I5MA 4JD2C 1O6FA 4BCCA 3GD1I 4TZ4A 3PXWD 4ZOXA 5FXYA 1C9IA 1JV2A 3FM0A 3NVQA 3C9CA 3EI3A 3RN0D 3ZE2A 3AFCA 2IWFA 5SXMA 2XU7A 4AEZA 4X63B 4FAND 3SHFA 3CIKB 4A2MA 2OJYA 3DXKC 2H3XA 3MUOA 2QR5A 4A09A 4IRZA 3IKOA 4H5JA 2IUVA 3OTTA 2EIEA 3V4VA 5GSAA 3N0DA 3J81g 4J77A 3CFVA 4CI3A 1N6DA 5EMMB 3EG6A 2CN3A 2IUPA 4LG9A 5K1CC 4U1EI 4HDJA 3F3GA 3SBPA 2VDMA 1GOFA 2HU5A 4X60B 2AH1A 2H9NA 4N14A 4OWRA 2IUQA 3DWLC 4O1QD 2H6KA 2OK6A 4L1QD 4Y7RA 4NAAA 5AMSA 2HJ4A 2AGZA 3I8CA 3MKSB 4WK4A 2UZYB 3MXXA 4JSXC 4BH6A 4FAVD 5KDOB 3SXTD 3T3PA 2CE9A 4FA4D 4GM9A 3JZNA 5I5IA 1RI6A 2VC2A 4A0BA 2B5MA 3GFCA 1UOPA 4J79A 4GZ8A 4L3GD 2TRCB 4GM3A 3RMZD 1O6GA 2P9NC 5CXBA 1P22A 5TEFA 3N0EA 2HXCA 4L3HD 4BUJC 3BG0A 3SFZA 2VDRA 2EBSA 1MG2A 3HFQA 3K27A 3OKTA 3IUQA 1PGUA 3NIGA 3JAMg 1VE7A 2B4EA 1U4CA 1H2XA 3OKWA 4H5IA 4O02A 4E54B 5H1MA 3UKRC 3VA6A 3PVUB 4AX4A 3ORVD 3AH8B 3QHYB 3ZE1A 4J87A 4ERZA 2AH0A 2I0SA 4A11A 2CNXA 4QAMA 4D9SA 2QC5A 3VGZA 1TYQC 1C9LA 4BP9A 2GC4A 4CY1A 5TEEA 3EMHA 4GMBA 3MZKA 4IMMA 2MTAH 3KRWB 5EAMA 3IJ1A 5EM2A 4RE6A 4K3JB 4PBZA 4XEIC 3O4IA 1U2VC 3AL9A 3PXSD 3EWEA 2VDLA 4MMYA 4CY3A 3KCIA 4ZOVA 4ERQA 2VZ1A 4AN1A 2EICA 4FB1D 4PC0A 3VI4A 1N6EA 4UI9R 1SQJA 3AL8B 1OMWB 3SJLD 3EU7A 1JOFA 4MMZA 3RSEC 3NIDA 3OKYA 1Q47A 1XHMA 1GOHA 3DXMC 2OVQB 5IJ8E 1MDAH 1L5GA 2HU7A 1UOOA 2P9SC 4Z7NA 4KFMB 3PXTD 5FA5B 3IJEA 3JZHA 2I3TA 3OW8A 1GOTB 4G55A 4D0KA 2H6NA 5E6SA 2WQ8A 4QQEA 5IGQA 4XYHA 5M5VA 4I79A 3EI1B 2YNNA 4GGCA 3RN1D 2HKMA 4FHLA 4O3TB 2J56H 2OIZA 3BG1A 4O3UB 2Q7QA 5M5TA 2CN2A 1A0RB 1T2XA 2IWKA 2YNPA 2P9UC 3IURA 4OZUA 1VYHC 4PBYA 3ULEC 2CO0A 5C2VB 3J80g 3ZE0A 4PSXB 5IT9g 1B9YA 4E5ZB 1FWXA 3RLMD 2Z2OA 2HU8A 4FA5D 4A0AB 4GGDA 4IA9A 3FCSA 4J78A 3V9FA 1PEVA 2P9IC 2PM9A 2VZ3A 4MK0B 4J8BA 4CY5A 2H9PA 3BWSA 4J82A 4CZYA 4DNVA 4NSXA 4J73A 5M5RA 1NR0A 3PSLA
chains in the Genus database with same CATH topology
5TF2A 2BCJB 3EI3B 4D6VA 2B5LA 2OVPB 3C75H 3UVKA 4A7JA 3B7FA 1R5MA 4A2LA 4EWRA 2B5NA 4CZVA 3EI2B 2GC7A 4PSWB 3UVLA 2OVRB 3IIWA 4CI1A 1GXRA 1K8KC 1GG2B 5GXIA 4PNKB 2G99A 4ZOZA 4FWWA 1SQ9A 4QL1A 5AJAA 1PI6A 5HE0B 3UVNA 1SHYB 1XKSA 3EI4A 5FKQA 2J57G 3U4YA 4O45A 5IC7A 3P4FA 4ESGA 2H9LA 2UZXB 3SN6B 2IURA 5AFU3 1JJUB 5EMJB 2H6QA 3NVXA 2H9MA 4ES0A 3L4MD 4CI8A 3DM0A 3RFHA 5EMLB 3MMYA 4A0BB 5HE2B 4GQ1A 3V5WB 5CXBB 5CXCB 5GXHA 2AGXA 3PVWB 3C99A 4J0XA 2YNOA 3JB9L 5IGOA 3AL8A 3FGBA 4A08B 2I0TA 2J55H 3DSMA 3OL2B 2P9PC 4Y5RD 3W15A 5EMKB 3SBRA 4L9OA 4ZN4A 1MG3A 2P9KC 5I5JA 3I2NA 5CYKA 5IJ7E 5EM2B 3ZWLB 3SMRA 2XYIA 3MZLA 3EI1A 2CO0C 2P9LC 3L4OD 4CC9A 4X3EA 4Z8LA 4JSPC 2AQ5A 2I3SA 4LG8A 3F3FA 5FQDA 2GNQA 4YVDA 2QXVA 5FKRA 4JXMA 3I7PA 3KRXB 2HKRA 3F3PA 2OK4A 4J8GA 5H17A 4AOWA 5A2Qg 2HJBA 3NVNA 1N6FA 4QRJA 2O9KA 3V7DB 5FKTA 3UKUC 3IJ0A 3EI2A 1NEXB 1PBYB 2Z2PA 2HESX 4XYIA 3JPXA 3SLED 3ODTA 4A09B 4X61B 4GQBB 3I7LA 3A0FA 4U7AA 3RRMC 2PM6B 5EALA 2PM9B 4K3ID 2YBAA 5HE3B 3JRPA 2XL3A 4BL0A 2CE8A 3UR4A 3VH0A 2AGWA 3PSCB 2H13A 1S4UX 2YMUA 4J86A 2IAAA 3IIYA 1JMZB 3I7KA 4JSNC 2AGLA 3I89A 4JT6C 5JWZA 4E54A 4PXWA 5FKSA 3UVMA 2XL2A 3UVOA 5H14A 3RFGA 3I8EA 4FA1D 2BBKH 2H14A 4JT5C 2W18A 4FA9D 1ERJA 4GGAA 4ERYA 5CXCA 4CI2A 2YB8B 3SCYA 3EI4B 5B4WA 5EARA 1GP2B 5TDHB 1K32A 3SWSD 4A08A 3JROA 3PE7A 4J0WA 3OL2A 2I0RA 3C5MA 4G56B 2PM7B 1OLZA 2H68A 4R7AB 4GM8A 5C2WB 4QT8A 3MKQA 4A11B 2PBIB 3IJCA 4ZOYA 5HYNB 3E0CA 4LGNA 2HYEA 5C9ZB 1YFQA 4CZXA 5GMKn 1B9XA 1L0QA 4J84A 4J81A 5HE1B 3I7NA 4GQ2P 4O9DA 1XIPA 3I7OA 1TBGA 3GREA 3CFSB 2H47A 5EAPA 1QNIA 3SBQA 3OKYB 2AGYA 2Z2NA 3I7HA 3SVWD 4CY2A 5FLXg 3K26A 3JZGA 4E5ZA 5K19A 1JMXB 5HQGA 5THAA 4A0AA 2G9AA 3FRXA 5CYKB 4JSVC 5I5MA 4JD2C 4TZ4A 5FXYA 3PXWD 4ZOXA 3FM0A 3NVQA 3C9CA 3EI3A 3RN0D 3AFCA 2IWFA 5SXMA 2XU7A 4AEZA 4X63B 4FAND 3SHFA 3CIKB 4A2MA 2OJYA 3DXKC 2H3XA 4A09A 3IKOA 4H5JA 2IUVA 3OTTA 5GSAA 3N0DA 3J81g 4J77A 3CFVA 4CI3A 1N6DA 5EMMB 3EG6A 2CN3A 2IUPA 4LG9A 5K1CC 4U1EI 4HDJA 3F3GA 3SBPA 4X60B 2AH1A 2H9NA 4N14A 4OWRA 2IUQA 3DWLC 4O1QD 2H6KA 2OK6A 4L1QD 4Y7RA 5AMSA 2HJ4A 2AGZA 3I8CA 3MKSB 2UZYB 3MXXA 4JSXC 4BH6A 4FAVD 5KDOB 3SXTD 2CE9A 4FA4D 4GM9A 3JZNA 5I5IA 1RI6A 4A0BA 2B5MA 3GFCA 4J79A 4GZ8A 4L3GD 2TRCB 4GM3A 3RMZD 2P9NC 5CXBA 1P22A 5TEFA 3N0EA 2HXCA 4L3HD 4BUJC 3BG0A 3SFZA 2EBSA 1MG2A 3HFQA 3K27A 3OKTA 1PGUA 3JAMg 2B4EA 1U4CA 3OKWA 4H5IA 4E54B 5H1MA 3UKRC 3VA6A 3PVUB 3ORVD 3AH8B 4ERZA 4J87A 2AH0A 2I0SA 4A11A 2CNXA 2QC5A 3VGZA 1TYQC 2GC4A 4CY1A 5TEEA 3EMHA 4GMBA 3MZKA 4IMMA 2MTAH 3KRWB 5EAMA 3IJ1A 5EM2A 4K3JB 4PBZA 4XEIC 1U2VC 3AL9A 3PXSD 3EWEA 4CY3A 4ZOVA 4ERQA 4FB1D 4PC0A 1N6EA 4UI9R 1SQJA 3AL8B 1OMWB 3SJLD 3EU7A 1JOFA 3RSEC 3OKYA 1Q47A 1XHMA 3DXMC 2OVQB 5IJ8E 1MDAH 2P9SC 4KFMB 3PXTD 5FA5B 3JZHA 2I3TA 3OW8A 1GOTB 4D0KA 2H6NA 4QQEA 5IGQA 4XYHA 4I79A 3EI1B 2YNNA 4GGCA 3RN1D 2HKMA 4FHLA 4O3TB 2J56H 2OIZA 3BG1A 4O3UB 2Q7QA 2CN2A 1A0RB 2IWKA 2YNPA 2P9UC 4OZUA 1VYHC 4PBYA 3ULEC 2CO0A 5C2VB 3J80g 5IT9g 4PSXB 1B9YA 4E5ZB 1FWXA 3RLMD 2Z2OA 4FA5D 4A0AB 4GGDA 4IA9A 3V9FA 4J78A 1PEVA 2P9IC 2PM9A 4MK0B 4J8BA 4CY5A 2H9PA 3BWSA 4J82A 4CZYA 4NSXA 4J73A 1NR0A 3PSLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TF2 A;  2BCJ B;  3EI3 B;  4D6V A;  2B5L A;  2OVP B;  3C75 H;  3UVK A;  4A7J A;  3B7F A;  1R5M A;  4A2L A;  4EWR A;  2B5N A;  4CZV A;  3EI2 B;  2GC7 A;  4PSW B;  3UVL A;  2OVR B;  3IIW A;  4CI1 A;  1GXR A;  1K8K C;  1GG2 B;  5GXI A;  4PNK B;  2G99 A;  4ZOZ A;  4FWW A;  1SQ9 A;  4QL1 A;  5AJA A;  1PI6 A;  5HE0 B;  3UVN A;  1SHY B;  1XKS A;  3EI4 A;  5FKQ A;  2J57 G;  3U4Y A;  4O45 A;  5IC7 A;  3P4F A;  4ESG A;  2H9L A;  2UZX B;  3SN6 B;  2IUR A;  5AFU 3;  1JJU B;  5EMJ B;  2H6Q A;  3NVX A;  2H9M A;  4ES0 A;  3L4M D;  4CI8 A;  3DM0 A;  3RFH A;  5EML B;  3MMY A;  4A0B B;  5HE2 B;  4GQ1 A;  3V5W B;  5CXB B;  5CXC B;  5GXH A;  2AGX A;  3PVW B;  3C99 A;  4J0X A;  2YNO A;  3JB9 L;  5IGO A;  3AL8 A;  3FGB A;  4A08 B;  2I0T A;  2J55 H;  3DSM A;  3OL2 B;  2P9P C;  4Y5R D;  3W15 A;  5EMK B;  3SBR A;  4L9O A;  4ZN4 A;  1MG3 A;  2P9K C;  5I5J A;  3I2N A;  5CYK A;  5IJ7 E;  5EM2 B;  3ZWL B;  3SMR A;  2XYI A;  3MZL A;  3EI1 A;  2CO0 C;  2P9L C;  3L4O D;  4CC9 A;  4X3E A;  4Z8L A;  4JSP C;  2AQ5 A;  2I3S A;  4LG8 A;  3F3F A;  5FQD A;  2GNQ A;  4YVD A;  2QXV A;  5FKR A;  4JXM A;  3I7P A;  3KRX B;  2HKR A;  3F3P A;  2OK4 A;  4J8G A;  5H17 A;  4AOW A;  5A2Q g;  2HJB A;  3NVN A;  1N6F A;  4QRJ A;  2O9K A;  3V7D B;  5FKT A;  3UKU C;  3IJ0 A;  3EI2 A;  1NEX B;  1PBY B;  2Z2P A;  2HES X;  4XYI A;  3JPX A;  3SLE D;  3ODT A;  4A09 B;  4X61 B;  4GQB B;  3I7L A;  3A0F A;  4U7A A;  3RRM C;  2PM6 B;  5EAL A;  2PM9 B;  4K3I D;  2YBA A;  5HE3 B;  3JRP A;  2XL3 A;  4BL0 A;  2CE8 A;  3UR4 A;  3VH0 A;  2AGW A;  3PSC B;  2H13 A;  1S4U X;  2YMU A;  4J86 A;  2IAA A;  3IIY A;  1JMZ B;  3I7K A;  4JSN C;  2AGL A;  3I89 A;  4JT6 C;  5JWZ A;  4E54 A;  4PXW A;  5FKS A;  3UVM A;  2XL2 A;  3UVO A;  5H14 A;  3RFG A;  3I8E A;  4FA1 D;  2BBK H;  2H14 A;  4JT5 C;  2W18 A;  4FA9 D;  1ERJ A;  4GGA A;  4ERY A;  5CXC A;  4CI2 A;  2YB8 B;  3SCY A;  3EI4 B;  5B4W A;  5EAR A;  1GP2 B;  5TDH B;  1K32 A;  3SWS D;  4A08 A;  3JRO A;  3PE7 A;  4J0W A;  3OL2 A;  2I0R A;  3C5M A;  4G56 B;  2PM7 B;  1OLZ A;  2H68 A;  4R7A B;  4GM8 A;  5C2W B;  4QT8 A;  3MKQ A;  4A11 B;  2PBI B;  3IJC A;  4ZOY A;  5HYN B;  3E0C A;  4LGN A;  2HYE A;  5C9Z B;  1YFQ A;  4CZX A;  5GMK n;  1B9X A;  1L0Q A;  4J84 A;  4J81 A;  5HE1 B;  3I7N A;  4GQ2 P;  4O9D A;  1XIP A;  3I7O A;  1TBG A;  3GRE A;  3CFS B;  2H47 A;  5EAP A;  1QNI A;  3SBQ A;  3OKY B;  2AGY A;  2Z2N A;  3I7H A;  3SVW D;  4CY2 A;  5FLX g;  3K26 A;  3JZG A;  4E5Z A;  5K19 A;  1JMX B;  5HQG A;  5THA A;  4A0A A;  2G9A A;  3FRX A;  5CYK B;  4JSV C;  5I5M A;  4JD2 C;  4TZ4 A;  5FXY A;  3PXW D;  4ZOX A;  3FM0 A;  3NVQ A;  3C9C A;  3EI3 A;  3RN0 D;  3AFC A;  2IWF A;  5SXM A;  2XU7 A;  4AEZ A;  4X63 B;  4FAN D;  3SHF A;  3CIK B;  4A2M A;  2OJY A;  3DXK C;  2H3X A;  4A09 A;  3IKO A;  4H5J A;  2IUV A;  3OTT A;  5GSA A;  3N0D A;  3J81 g;  4J77 A;  3CFV A;  4CI3 A;  1N6D A;  5EMM B;  3EG6 A;  2CN3 A;  2IUP A;  4LG9 A;  5K1C C;  4U1E I;  4HDJ A;  3F3G A;  3SBP A;  4X60 B;  2AH1 A;  2H9N A;  4N14 A;  4OWR A;  2IUQ A;  3DWL C;  4O1Q D;  2H6K A;  2OK6 A;  4L1Q D;  4Y7R A;  5AMS A;  2HJ4 A;  2AGZ A;  3I8C A;  3MKS B;  2UZY B;  3MXX A;  4JSX C;  4BH6 A;  4FAV D;  5KDO B;  3SXT D;  2CE9 A;  4FA4 D;  4GM9 A;  3JZN A;  5I5I A;  1RI6 A;  4A0B A;  2B5M A;  3GFC A;  4J79 A;  4GZ8 A;  4L3G D;  2TRC B;  4GM3 A;  3RMZ D;  2P9N C;  5CXB A;  1P22 A;  5TEF A;  3N0E A;  2HXC A;  4L3H D;  4BUJ C;  3BG0 A;  3SFZ A;  2EBS A;  1MG2 A;  3HFQ A;  3K27 A;  3OKT A;  1PGU A;  3JAM g;  2B4E A;  1U4C A;  3OKW A;  4H5I A;  4E54 B;  5H1M A;  3UKR C;  3VA6 A;  3PVU B;  3ORV D;  3AH8 B;  4ERZ A;  4J87 A;  2AH0 A;  2I0S A;  4A11 A;  2CNX A;  2QC5 A;  3VGZ A;  1TYQ C;  2GC4 A;  4CY1 A;  5TEE A;  3EMH A;  4GMB A;  3MZK A;  4IMM A;  2MTA H;  3KRW B;  5EAM A;  3IJ1 A;  5EM2 A;  4K3J B;  4PBZ A;  4XEI C;  1U2V C;  3AL9 A;  3PXS D;  3EWE A;  4CY3 A;  4ZOV A;  4ERQ A;  4FB1 D;  4PC0 A;  1N6E A;  4UI9 R;  1SQJ A;  3AL8 B;  1OMW B;  3SJL D;  3EU7 A;  1JOF A;  3RSE C;  3OKY A;  1Q47 A;  1XHM A;  3DXM C;  2OVQ B;  5IJ8 E;  1MDA H;  2P9S C;  4KFM B;  3PXT D;  5FA5 B;  3JZH A;  2I3T A;  3OW8 A;  1GOT B;  4D0K A;  2H6N A;  4QQE A;  5IGQ A;  4XYH A;  4I79 A;  3EI1 B;  2YNN A;  4GGC A;  3RN1 D;  2HKM A;  4FHL A;  4O3T B;  2J56 H;  2OIZ A;  3BG1 A;  4O3U B;  2Q7Q A;  2CN2 A;  1A0R B;  2IWK A;  2YNP A;  2P9U C;  4OZU A;  1VYH C;  4PBY A;  3ULE C;  2CO0 A;  5C2V B;  3J80 g;  5IT9 g;  4PSX B;  1B9Y A;  4E5Z B;  1FWX A;  3RLM D;  2Z2O A;  4FA5 D;  4A0A B;  4GGD A;  4IA9 A;  3V9F A;  4J78 A;  1PEV A;  2P9I C;  2PM9 A;  4MK0 B;  4J8B A;  4CY5 A;  2H9P A;  3BWS A;  4J82 A;  4CZY A;  4NSX A;  4J73 A;  1NR0 A;  3PSL A; 
#chains in the Genus database with same CATH topology
 5TF2 A;  4JHP C;  2BCJ B;  3EI3 B;  4D6V A;  2B5L A;  2EIB A;  2OVP B;  3C75 H;  3UVK A;  4A7J A;  3B7F A;  4BCD A;  1R5M A;  4A2L A;  4EWR A;  2B5N A;  4CZV A;  3EI2 B;  2GC7 A;  1QFS A;  4PSW B;  4WK0 A;  3O4G A;  3UVL A;  1K3I A;  1E8M A;  2OVR B;  3IIW A;  4CI1 A;  1GXR A;  1K8K C;  1BPO A;  1GG2 B;  5GXI A;  4PNK B;  2G99 A;  4ZOZ A;  4FWW A;  1SQ9 A;  4BCB A;  4QL1 A;  2JKX A;  5AJA A;  1PI6 A;  5HE0 B;  3UVN A;  1SHY B;  1XKS A;  3EI4 A;  5FKQ A;  3K72 A;  2J57 G;  4G1M A;  3U4Y A;  4O45 A;  5E6U A;  5IC7 A;  3P4F A;  4ESG A;  3K6S A;  2H9L A;  2UZX B;  4UM8 A;  3SN6 B;  2IUR A;  3T3M A;  5AFU 3;  1JJU B;  5EMJ B;  2H6Q A;  3NVX A;  2H9M A;  3QI0 A;  1VZ3 A;  4ES0 A;  3L4M D;  4CI8 A;  3DM0 A;  3RFH A;  5EML B;  3MMY A;  4A0B B;  5HE2 B;  3IUN A;  4GQ1 A;  3V5W B;  1I2M B;  2XE4 A;  1VE6 A;  4AN0 A;  3GC3 B;  5CXB B;  5CXC B;  5GXH A;  2AGX A;  3PVW B;  5FFO A;  3C99 A;  1U8C A;  4J0X A;  2YNO A;  3JB9 L;  5IGO A;  3AL8 A;  3MVD K;  3FGB A;  3K71 A;  5C92 A;  4A08 B;  2EID A;  2I0T A;  2J55 H;  3EQ8 A;  3DSM A;  3OL2 B;  1E8N A;  2P9P C;  4Y5R D;  3W15 A;  5EMK B;  3SBR A;  4AMY A;  3FCU A;  5M61 A;  1M1X A;  3IUM A;  4L9O A;  4ZN4 A;  1MG3 A;  2P9K C;  4NEN A;  3EQ7 A;  5I5J A;  1H2W A;  3I2N A;  5HDB A;  5CYK A;  5M5U A;  5IJ7 E;  5EM2 B;  3ZWL B;  4BP8 A;  3SMR A;  2XYI A;  3MZL A;  3EI1 A;  2CO0 C;  2P9L C;  3L4O D;  4CC9 A;  4X3E A;  4Z8L A;  1UOQ A;  4JSP C;  2QZP A;  2AQ5 A;  1H2Z A;  2I3S A;  4LG8 A;  3F3F A;  4WK2 A;  5FQD A;  4Z7Q A;  2VDO A;  2GNQ A;  1QFM A;  4JHN A;  4YVD A;  2QXV A;  5FKR A;  4JXM A;  3I7P A;  3KRX B;  2HKR A;  3F3P A;  2OK4 A;  5FFG A;  4J8G A;  5H17 A;  4AOW A;  5A2Q g;  2HJB A;  3NVN A;  3O4J A;  3ZDX A;  1N6F A;  4QRJ A;  2O9K A;  3V7D B;  5FKT A;  3UKU C;  3IJ0 A;  3IVM A;  3EI2 A;  1NEX B;  1GOG A;  1PBY B;  2Z2P A;  4RE5 A;  2HES X;  4UM9 A;  4XYI A;  2XDW A;  3JPX A;  3SLE D;  3ODT A;  4A09 B;  4X61 B;  1E5T A;  3VI3 A;  4GQB B;  3I7L A;  3A0F A;  4U7A A;  3RRM C;  2PM6 B;  5EAL A;  2PM9 B;  4K3I D;  2YBA A;  5HE3 B;  3JRP A;  2XL3 A;  4BL0 A;  2CE8 A;  1YR2 A;  3UR4 A;  3VH0 A;  3ZDY A;  2AGW A;  3PSC B;  2H13 A;  1S4U X;  2YMU A;  3NIF A;  4J86 A;  2IAA A;  3IIY A;  1JMZ B;  4NBM A;  3I7K A;  4JSN C;  2AGL A;  3I89 A;  4JT6 C;  1TYE A;  5JWZ A;  3EQ9 A;  4E54 A;  4PXW A;  5FKS A;  3UVM A;  2XL2 A;  3UVO A;  5H14 A;  3RFG A;  3I8E A;  4FA1 D;  2BBK H;  2H14 A;  4JT5 C;  2W18 A;  2XZG A;  4FA9 D;  1ERJ A;  4GGA A;  2VDP A;  4ERY A;  5CXC A;  4CI2 A;  2BKL A;  2YB8 B;  3SCY A;  3EI4 B;  5B4W A;  5EAR A;  3OF7 A;  1H2Y A;  4NC4 A;  3ZDZ A;  5M5S A;  1GP2 B;  5TDH B;  1K32 A;  3SWS D;  2VDK A;  4A08 A;  3JRO A;  3PE7 A;  5E6R A;  5C86 A;  4J0W A;  3OL2 A;  2I0R A;  3C5M A;  4G56 B;  2PM7 B;  4Z7O A;  1OLZ A;  2H68 A;  4DNW A;  4G1E A;  4R7A B;  4AMZ A;  3DDU A;  3IUL A;  4GM8 A;  5C2W B;  1A12 A;  4QT8 A;  3MKQ A;  4DNU A;  4MMX A;  4A11 B;  2PBI B;  3IJC A;  4ZOY A;  5HYN B;  3E0C A;  4LGN A;  2HYE A;  4WJK A;  5C9Z B;  1YFQ A;  4CZX A;  4O2W A;  3IUJ A;  4L1M A;  5GMK n;  1B9X A;  1L0Q A;  4J84 A;  4J81 A;  5HE1 B;  3I7N A;  4GQ2 P;  4O9D A;  3V4P A;  3O4H A;  1XIP A;  1JTD B;  3I7O A;  1TBG A;  1UTC A;  3GRE A;  3CFS B;  2H47 A;  5EAP A;  1QNI A;  3SBQ A;  1VZ2 A;  2AGY A;  2Z2N A;  3I7H A;  3OKY B;  3SVW D;  4CY2 A;  3MUN A;  5FLX g;  3K26 A;  3JZG A;  4E5Z A;  5K19 A;  1JMX B;  5HQG A;  5THA A;  4A0A A;  2VDQ A;  2G9A A;  3FRX A;  2VDN A;  5CYK B;  4JSV C;  5I5M A;  4JD2 C;  1O6F A;  4BCC A;  3GD1 I;  4TZ4 A;  3PXW D;  4ZOX A;  5FXY A;  1C9I A;  1JV2 A;  3FM0 A;  3NVQ A;  3C9C A;  3EI3 A;  3RN0 D;  3ZE2 A;  3AFC A;  2IWF A;  5SXM A;  2XU7 A;  4AEZ A;  4X63 B;  4FAN D;  3SHF A;  3CIK B;  4A2M A;  2OJY A;  3DXK C;  2H3X A;  3MUO A;  2QR5 A;  4A09 A;  4IRZ A;  3IKO A;  4H5J A;  2IUV A;  3OTT A;  2EIE A;  3V4V A;  5GSA A;  3N0D A;  3J81 g;  4J77 A;  3CFV A;  4CI3 A;  1N6D A;  5EMM B;  3EG6 A;  2CN3 A;  2IUP A;  4LG9 A;  5K1C C;  4U1E I;  4HDJ A;  3F3G A;  3SBP A;  2VDM A;  1GOF A;  2HU5 A;  4X60 B;  2AH1 A;  2H9N A;  4N14 A;  4OWR A;  2IUQ A;  3DWL C;  4O1Q D;  2H6K A;  2OK6 A;  4L1Q D;  4Y7R A;  4NAA A;  5AMS A;  2HJ4 A;  2AGZ A;  3I8C A;  3MKS B;  4WK4 A;  2UZY B;  3MXX A;  4JSX C;  4BH6 A;  4FAV D;  5KDO B;  3SXT D;  3T3P A;  2CE9 A;  4FA4 D;  4GM9 A;  3JZN A;  5I5I A;  1RI6 A;  2VC2 A;  4A0B A;  2B5M A;  3GFC A;  1UOP A;  4J79 A;  4GZ8 A;  4L3G D;  2TRC B;  4GM3 A;  3RMZ D;  1O6G A;  2P9N C;  5CXB A;  1P22 A;  5TEF A;  3N0E A;  2HXC A;  4L3H D;  4BUJ C;  3BG0 A;  3SFZ A;  2VDR A;  2EBS A;  1MG2 A;  3HFQ A;  3K27 A;  3OKT A;  3IUQ A;  1PGU A;  3NIG A;  3JAM g;  1VE7 A;  2B4E A;  1U4C A;  1H2X A;  3OKW A;  4H5I A;  4O02 A;  4E54 B;  5H1M A;  3UKR C;  3VA6 A;  3PVU B;  4AX4 A;  3ORV D;  3AH8 B;  3QHY B;  3ZE1 A;  4J87 A;  4ERZ A;  2AH0 A;  2I0S A;  4A11 A;  2CNX A;  4QAM A;  4D9S A;  2QC5 A;  3VGZ A;  1TYQ C;  1C9L A;  4BP9 A;  2GC4 A;  4CY1 A;  5TEE A;  3EMH A;  4GMB A;  3MZK A;  4IMM A;  2MTA H;  3KRW B;  5EAM A;  3IJ1 A;  5EM2 A;  4RE6 A;  4K3J B;  4PBZ A;  4XEI C;  3O4I A;  1U2V C;  3AL9 A;  3PXS D;  3EWE A;  2VDL A;  4MMY A;  4CY3 A;  3KCI A;  4ZOV A;  4ERQ A;  2VZ1 A;  4AN1 A;  2EIC A;  4FB1 D;  4PC0 A;  3VI4 A;  1N6E A;  4UI9 R;  1SQJ A;  3AL8 B;  1OMW B;  3SJL D;  3EU7 A;  1JOF A;  4MMZ A;  3RSE C;  3NID A;  3OKY A;  1Q47 A;  1XHM A;  1GOH A;  3DXM C;  2OVQ B;  5IJ8 E;  1MDA H;  1L5G A;  2HU7 A;  1UOO A;  2P9S C;  4Z7N A;  4KFM B;  3PXT D;  5FA5 B;  3IJE A;  3JZH A;  2I3T A;  3OW8 A;  1GOT B;  4G55 A;  4D0K A;  2H6N A;  5E6S A;  2WQ8 A;  4QQE A;  5IGQ A;  4XYH A;  5M5V A;  4I79 A;  3EI1 B;  2YNN A;  4GGC A;  3RN1 D;  2HKM A;  4FHL A;  4O3T B;  2J56 H;  2OIZ A;  3BG1 A;  4O3U B;  2Q7Q A;  5M5T A;  2CN2 A;  1A0R B;  1T2X A;  2IWK A;  2YNP A;  2P9U C;  3IUR A;  4OZU A;  1VYH C;  4PBY A;  3ULE C;  2CO0 A;  5C2V B;  3J80 g;  3ZE0 A;  4PSX B;  5IT9 g;  1B9Y A;  4E5Z B;  1FWX A;  3RLM D;  2Z2O A;  2HU8 A;  4FA5 D;  4A0A B;  4GGD A;  4IA9 A;  3FCS A;  4J78 A;  3V9F A;  1PEV A;  2P9I C;  2PM9 A;  2VZ3 A;  4MK0 B;  4J8B A;  4CY5 A;  2H9P A;  3BWS A;  4J82 A;  4CZY A;  4DNV A;  4NSX A;  4J73 A;  5M5R A;  1NR0 A;  3PSL A; 
#chains in the Genus database with same CATH homology
 5TF2 A;  2BCJ B;  3EI3 B;  4D6V A;  2B5L A;  2OVP B;  3C75 H;  3UVK A;  4A7J A;  3B7F A;  1R5M A;  4A2L A;  4EWR A;  2B5N A;  4CZV A;  3EI2 B;  2GC7 A;  4PSW B;  3UVL A;  2OVR B;  3IIW A;  4CI1 A;  1GXR A;  1K8K C;  1GG2 B;  5GXI A;  4PNK B;  2G99 A;  4ZOZ A;  4FWW A;  1SQ9 A;  4QL1 A;  5AJA A;  1PI6 A;  5HE0 B;  3UVN A;  1SHY B;  1XKS A;  3EI4 A;  5FKQ A;  2J57 G;  3U4Y A;  4O45 A;  5IC7 A;  3P4F A;  4ESG A;  2H9L A;  2UZX B;  3SN6 B;  2IUR A;  5AFU 3;  1JJU B;  5EMJ B;  2H6Q A;  3NVX A;  2H9M A;  4ES0 A;  3L4M D;  4CI8 A;  3DM0 A;  3RFH A;  5EML B;  3MMY A;  4A0B B;  5HE2 B;  4GQ1 A;  3V5W B;  5CXB B;  5CXC B;  5GXH A;  2AGX A;  3PVW B;  3C99 A;  4J0X A;  2YNO A;  3JB9 L;  5IGO A;  3AL8 A;  3FGB A;  4A08 B;  2I0T A;  2J55 H;  3DSM A;  3OL2 B;  2P9P C;  4Y5R D;  3W15 A;  5EMK B;  3SBR A;  4L9O A;  4ZN4 A;  1MG3 A;  2P9K C;  5I5J A;  3I2N A;  5CYK A;  5IJ7 E;  5EM2 B;  3ZWL B;  3SMR A;  2XYI A;  3MZL A;  3EI1 A;  2CO0 C;  2P9L C;  3L4O D;  4CC9 A;  4X3E A;  4Z8L A;  4JSP C;  2AQ5 A;  2I3S A;  4LG8 A;  3F3F A;  5FQD A;  2GNQ A;  4YVD A;  2QXV A;  5FKR A;  4JXM A;  3I7P A;  3KRX B;  2HKR A;  3F3P A;  2OK4 A;  4J8G A;  5H17 A;  4AOW A;  5A2Q g;  2HJB A;  3NVN A;  1N6F A;  4QRJ A;  2O9K A;  3V7D B;  5FKT A;  3UKU C;  3IJ0 A;  3EI2 A;  1NEX B;  1PBY B;  2Z2P A;  2HES X;  4XYI A;  3JPX A;  3SLE D;  3ODT A;  4A09 B;  4X61 B;  4GQB B;  3I7L A;  3A0F A;  4U7A A;  3RRM C;  2PM6 B;  5EAL A;  2PM9 B;  4K3I D;  2YBA A;  5HE3 B;  3JRP A;  2XL3 A;  4BL0 A;  2CE8 A;  3UR4 A;  3VH0 A;  2AGW A;  3PSC B;  2H13 A;  1S4U X;  2YMU A;  4J86 A;  2IAA A;  3IIY A;  1JMZ B;  3I7K A;  4JSN C;  2AGL A;  3I89 A;  4JT6 C;  5JWZ A;  4E54 A;  4PXW A;  5FKS A;  3UVM A;  2XL2 A;  3UVO A;  5H14 A;  3RFG A;  3I8E A;  4FA1 D;  2BBK H;  2H14 A;  4JT5 C;  2W18 A;  4FA9 D;  1ERJ A;  4GGA A;  4ERY A;  5CXC A;  4CI2 A;  2YB8 B;  3SCY A;  3EI4 B;  5B4W A;  5EAR A;  1GP2 B;  5TDH B;  1K32 A;  3SWS D;  4A08 A;  3JRO A;  3PE7 A;  4J0W A;  3OL2 A;  2I0R A;  3C5M A;  4G56 B;  2PM7 B;  1OLZ A;  2H68 A;  4R7A B;  4GM8 A;  5C2W B;  4QT8 A;  3MKQ A;  4A11 B;  2PBI B;  3IJC A;  4ZOY A;  5HYN B;  3E0C A;  4LGN A;  2HYE A;  5C9Z B;  1YFQ A;  4CZX A;  5GMK n;  1B9X A;  1L0Q A;  4J84 A;  4J81 A;  5HE1 B;  3I7N A;  4GQ2 P;  4O9D A;  1XIP A;  3I7O A;  1TBG A;  3GRE A;  3CFS B;  2H47 A;  5EAP A;  1QNI A;  3SBQ A;  3OKY B;  2AGY A;  2Z2N A;  3I7H A;  3SVW D;  4CY2 A;  5FLX g;  3K26 A;  3JZG A;  4E5Z A;  5K19 A;  1JMX B;  5HQG A;  5THA A;  4A0A A;  2G9A A;  3FRX A;  5CYK B;  4JSV C;  5I5M A;  4JD2 C;  4TZ4 A;  5FXY A;  3PXW D;  4ZOX A;  3FM0 A;  3NVQ A;  3C9C A;  3EI3 A;  3RN0 D;  3AFC A;  2IWF A;  5SXM A;  2XU7 A;  4AEZ A;  4X63 B;  4FAN D;  3SHF A;  3CIK B;  4A2M A;  2OJY A;  3DXK C;  2H3X A;  4A09 A;  3IKO A;  4H5J A;  2IUV A;  3OTT A;  5GSA A;  3N0D A;  3J81 g;  4J77 A;  3CFV A;  4CI3 A;  1N6D A;  5EMM B;  3EG6 A;  2CN3 A;  2IUP A;  4LG9 A;  5K1C C;  4U1E I;  4HDJ A;  3F3G A;  3SBP A;  4X60 B;  2AH1 A;  2H9N A;  4N14 A;  4OWR A;  2IUQ A;  3DWL C;  4O1Q D;  2H6K A;  2OK6 A;  4L1Q D;  4Y7R A;  5AMS A;  2HJ4 A;  2AGZ A;  3I8C A;  3MKS B;  2UZY B;  3MXX A;  4JSX C;  4BH6 A;  4FAV D;  5KDO B;  3SXT D;  2CE9 A;  4FA4 D;  4GM9 A;  3JZN A;  5I5I A;  1RI6 A;  4A0B A;  2B5M A;  3GFC A;  4J79 A;  4GZ8 A;  4L3G D;  2TRC B;  4GM3 A;  3RMZ D;  2P9N C;  5CXB A;  1P22 A;  5TEF A;  3N0E A;  2HXC A;  4L3H D;  4BUJ C;  3BG0 A;  3SFZ A;  2EBS A;  1MG2 A;  3HFQ A;  3K27 A;  3OKT A;  1PGU A;  3JAM g;  2B4E A;  1U4C A;  3OKW A;  4H5I A;  4E54 B;  5H1M A;  3UKR C;  3VA6 A;  3PVU B;  3ORV D;  3AH8 B;  4ERZ A;  4J87 A;  2AH0 A;  2I0S A;  4A11 A;  2CNX A;  2QC5 A;  3VGZ A;  1TYQ C;  2GC4 A;  4CY1 A;  5TEE A;  3EMH A;  4GMB A;  3MZK A;  4IMM A;  2MTA H;  3KRW B;  5EAM A;  3IJ1 A;  5EM2 A;  4K3J B;  4PBZ A;  4XEI C;  1U2V C;  3AL9 A;  3PXS D;  3EWE A;  4CY3 A;  4ZOV A;  4ERQ A;  4FB1 D;  4PC0 A;  1N6E A;  4UI9 R;  1SQJ A;  3AL8 B;  1OMW B;  3SJL D;  3EU7 A;  1JOF A;  3RSE C;  3OKY A;  1Q47 A;  1XHM A;  3DXM C;  2OVQ B;  5IJ8 E;  1MDA H;  2P9S C;  4KFM B;  3PXT D;  5FA5 B;  3JZH A;  2I3T A;  3OW8 A;  1GOT B;  4D0K A;  2H6N A;  4QQE A;  5IGQ A;  4XYH A;  4I79 A;  3EI1 B;  2YNN A;  4GGC A;  3RN1 D;  2HKM A;  4FHL A;  4O3T B;  2J56 H;  2OIZ A;  3BG1 A;  4O3U B;  2Q7Q A;  2CN2 A;  1A0R B;  2IWK A;  2YNP A;  2P9U C;  4OZU A;  1VYH C;  4PBY A;  3ULE C;  2CO0 A;  5C2V B;  3J80 g;  5IT9 g;  4PSX B;  1B9Y A;  4E5Z B;  1FWX A;  3RLM D;  2Z2O A;  4FA5 D;  4A0A B;  4GGD A;  4IA9 A;  3V9F A;  4J78 A;  1PEV A;  2P9I C;  2PM9 A;  4MK0 B;  4J8B A;  4CY5 A;  2H9P A;  3BWS A;  4J82 A;  4CZY A;  4NSX A;  4J73 A;  1NR0 A;  3PSL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...