4UI9R

Atomic structure of the human anaphase-promoting complex
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
452
structure length
387
Chain Sequence
SKHGDRFIPSRAGANWSVNFHRINENGLAYSALLKNELLGAGIEKVQKGLFTYSLSPYSLSPVSNKSQKLLRSSKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWNAEQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSLSPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSVSVLNLFTRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANAPHASE-PROMOTING COMPLEX SUBUNIT 1
publication title Atomic Structure of the Apc and its Mechanism of Protein Ubiquitination
pubmed doi rcsb
molecule tags Cell cycle
total genus 77
structure length 387
sequence length 452
ec nomenclature
pdb deposition date 2015-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00400 WD40 WD domain, G-beta repeat
R PF12894 ANAPC4_WD40 Anaphase-promoting complex subunit 4 WD40 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4ui9R01
4A0AB 2YNOA 3L4OD 3DM0A 2HESX 5GMKn 1U2VC 2XU7A 3I7NA 3JZNA 1JOFA 2AQ5A 2I0SA 3PSCB 3JRPA 4HDJA 4ZOVA 5GXIA 4Y5RD 5FKTA 3IJ1A 4X3EA 3N0DA 4KFMB 5EM2A 1XKSA 4PSXB 4BH6A 2QXVA 4A7JA 2PM9B 3PXTD 4CC9A 2H9LA 3EI2B 2OVPB 1JMXB 5AMSA 3BWSA 1YFQA 3RSEC 3C5MA 4GM3A 4ERQA 5IT9g 5CXCA 3MXXA 2HJ4A 4J8GA 2YBAA 4L1QD 3DXMC 1XIPA 4ZOYA 2CNXA 4XYHA 3I7LA 5HYNB 4GGAA 5TF2A 3SVWD 2H6QA 3A0FA 4A2MA 3SJLD 2Q7QA 2CE9A 2YB8B 1MG2A 4FAVD 1GG2B 2J57G 3EG6A 2G99A 4J79A 3KRXB 3P4FA 2H68A 5TEFA 4IA9A 3JPXA 2HYEA 4K3ID 3CFVA 3RLMD 1N6EA 2P9KC 4A2LA 3E0CA 3SCYA 3VH0A 1GXRA 3DXKC 5EARA 2GNQA 2IWKA 3BG1A 2PM6B 3UVOA 3ODTA 4GM9A 2AGXA 3AFCA 3EI3B 2MTAH 1JMZB 1SHYB 3GREA 4J73A 3V9FA 5H14A 4FA5D 4ZOZA 3UVLA 3OL2A 3OKYA 3MZLA 4X63B 4JSPC 2Z2PA 4JSVC 4I79A 2AGLA 3U4YA 4CI1A 2YMUA 3SBRA 5THAA 3C75H 3MKQA 5FKRA 5EALA 3RFHA 3RMZD 3BG0A 3EMHA 3I8EA 4J8BA 3IIYA 1PEVA 5HE3B 3ULEC 4A0BB 5H1MA 3C9CA 2H14A 5HE1B 4CY5A 4CY2A 4CZYA 1SQ9A 4U7AA 2H47A 3IJCA 5EAPA 1TYQC 5IGOA 4PXWA 4JSNC 1TBGA 4XEIC 3SMRA 5FA5B 1S4UX 4NSXA 2AGYA 3CFSB 4CY3A 5HE0B 3UVNA 3EI1B 3DWLC 4GMBA 4N14A 4FA4D 1RI6A 3FRXA 2CO0C 3I7KA 2PBIB 3PE7A 2P9NC 2YNPA 1OLZA 4TZ4A 3JZHA 2IAAA 4J84A 3JB9L 4BUJC 3W15A 3EI4A 3UVKA 4QRJA 3JZGA 3SN6B 5FQDA 5B4WA 4CZVA 4CI3A 4EWRA 1P22A 2HJBA 2EBSA 2OVQB 3AL8A 5TDHB 4A09B 3EU7A 4QL1A 4CI8A 2UZXB 2AH1A 4X61B 2IUPA 5AJAA 4J78A 2TRCB 4UI9R 4A0BA 1VYHC 1OMWB 1N6FA 4A08B 5A2Qg 3AH8B 4R7AB 5I5IA 3B7FA 5EMJB 4A0AA 4JT6C 3KRWB 2OJYA 3UVMA 1PI6A 4L9OA 3FGBA 5CYKB 5K1CC 4J81A 3OW8A 2P9SC 5FKQA 3SXTD 4O1QD 3OTTA 3PVWB 4GM8A 4CI2A 5CXBB 2O9KA 1GOTB 1GP2B 2PM9A 4A11B 4ERYA 4FWWA 4E5ZB 2CO0A 3EI2A 4JSXC 4O3TB 1NR0A 4E54B 4LGNA 4D6VA 4J86A 4X60B 4ESGA 4O3UB 5FKSA 2IUQA 3I7PA 2OK6A 4ZN4A 5GXHA 2HKRA 3IIWA 2XL2A 1L0QA 4K3JB 4A09A 2P9LC 2I0RA 5FXYA 3PXSD 2XYIA 4GZ8A 5H17A 5EM2B 3I8CA 3ZWLB 5C2WB 3NVXA 2I3TA 4MK0B 3UR4A 4AOWA 5EMLB 1MDAH 1Q47A 3C99A 4A08A 3SFZA 3I7OA 1K8KC 3F3PA 4QQEA 4GQ2P 4L3GD 3RN1D 4PC0A 2W18A 5CXCB 4AEZA 5HQGA 4FA9D 4Y7RA 2J55H 2P9UC 2AGZA 4LG8A 5EMKB 3OKTA 2H6KA 5IJ8E 3F3GA 2QC5A 3MKSB 1JJUB 3I7HA 4LG9A 3UKUC 2IUVA 4FB1D 2P9IC 4FA1D 1A0RB 2OIZA 3OKWA 3HFQA 4L3HD 1B9XA 4PBYA 2I3SA 3J80g 2H9PA 4BL0A 3VGZA 3EI3A 1R5MA 1QNIA 2XL3A 3SBPA 4D0KA 3SLED 4J82A 1B9YA 3I2NA 2Z2OA 4U1EI 5TEEA 5C2VB 1PGUA 4Z8LA 1ERJA 3CIKB 3JAMg 3IJ0A 2OVRB 4PNKB 1NEXB 2H6NA 1K32A 2IURA 5SXMA 4FAND 4FHLA 4GGCA 2AH0A 3V7DB 4PBZA 3IKOA 3SBQA 4PSWB 5EAMA 3F3FA 4CZXA 2G9AA 1MG3A 2H3XA 3GFCA 2BCJB 5KDOB 4GQBB 4G56B 2P9PC 2Z2NA 4J0WA 5IC7A 3MZKA 4O45A 2UZYB 3RFGA 3PXWD 3OL2B 3OKYB 4J87A 3K27A 4ERZA 4JD2C 4OWRA 5EMMB 3MMYA 1PBYB 2PM7B 2HXCA 3V5WB 5GSAA 2BBKH 4OZUA 3EI1A 4IMMA 5IGQA 2I0TA 3SHFA 2B5LA 3RRMC 5IJ7E 2AGWA 2B4EA 2HKMA 3K26A 1SQJA 5C9ZB 3UKRC 2CE8A 4O9DA 2H9MA 3N0EA 5JWZA 3J81g 3ORVD 3L4MD 5I5JA 4J77A 2B5MA 5I5MA 1N6DA 4H5IA 4XYIA 3FM0A 2CN2A 2GC4A 5AFU3 2J56H 3NVNA 1FWXA 2IWFA 2YNNA 3RN0D 3I89A 4QT8A 3EI4B 5CYKA 2B5NA 3VA6A 4YVDA 3JROA 4JT5C 2GC7A 5HE2B 3SWSD 5K19A 4GQ1A 5FLXg 4ES0A 2H13A 4ZOXA 3AL8B 4H5JA 3PVUB 2H9NA 4JXMA 5CXBA 3NVQA 4CY1A 4A11A 4GGDA 4E5ZA 3PSLA 1XHMA 3AL9A 3DSMA 1U4CA 2OK4A 4E54A 4J0XA 3EWEA 2CN3A
chains in the Genus database with same CATH superfamily
4A0AB 2YNOA 3L4OD 3DM0A 2HESX 2EIEA 5GMKn 1U2VC 2VC2A 2XU7A 3I7NA 3JZNA 1JOFA 4NAAA 2AQ5A 2I0SA 3PSCB 3JRPA 4HDJA 4ZOVA 5GXIA 4Y5RD 5FKTA 3IJ1A 4X3EA 3T3PA 3N0DA 4KFMB 5EM2A 1XKSA 4PSXB 4BH6A 4JHPC 2QXVA 2VDRA 4A7JA 2PM9B 3PXTD 3ZDZA 5M5RA 4CC9A 2H9LA 1JV2A 3O4IA 3ZDXA 4BP8A 2OVPB 3EI2B 1JMXB 5FFOA 5AMSA 3BWSA 1YFQA 3RSEC 3C5MA 4GM3A 4ERQA 5IT9g 5CXCA 3MXXA 2HJ4A 4IRZA 4J8GA 2YBAA 4L1QD 3GC3B 4MMZA 3O4JA 1T2XA 3DXMC 3T3MA 1XIPA 4ZOYA 2CNXA 4XYHA 3I7LA 5HYNB 4GGAA 4Z7OA 5TF2A 3SVWD 3KCIA 2H6QA 3A0FA 4A2MA 3IUJA 3SJLD 2Q7QA 3K71A 2HU8A 2CE9A 2YB8B 1MG2A 4FAVD 4G1EA 1GG2B 2J57G 3EG6A 2G99A 4J79A 1O6GA 3KRXB 3P4FA 1H2YA 4WK4A 2H68A 5TEFA 4IA9A 3JPXA 2HYEA 5E6SA 4K3ID 4BCBA 2XZGA 3CFVA 3RLMD 4AX4A 1N6EA 3DDUA 2P9KC 4A2LA 3E0CA 3SCYA 3VH0A 2WQ8A 1UOPA 1GXRA 4AN0A 3DXKC 3ZE0A 5EARA 2GNQA 2IWKA 4AN1A 3BG1A 2PM6B 3UVOA 3ODTA 4GM9A 2AGXA 2QR5A 3AFCA 3EI3B 2MTAH 1JMZB 1SHYB 3GREA 4J73A 3V9FA 5H14A 4FA5D 3ZE2A 4ZOZA 1YR2A 3UVLA 3OL2A 3OKYA 3NIDA 3MZLA 1C9IA 4X63B 4JSPC 2Z2PA 4JSVC 4I79A 4UM9A 2AGLA 2XDWA 3U4YA 1H2ZA 1E8MA 3EQ8A 3V4VA 2VDQA 4CI1A 2YMUA 3SBRA 5THAA 3C75H 3MKQA 5FKRA 5EALA 3RFHA 3RMZD 3BG0A 3EMHA 3I8EA 3IUNA 4J8BA 4O02A 3IIYA 3VI4A 4BCDA 1PEVA 2VDKA 5HE3B 3VI3A 3ULEC 4A0BB 5H1MA 3C9CA 2H14A 5HE1B 1U8CA 4CY5A 1UOOA 4CY2A 4CZYA 1SQ9A 4U7AA 2H47A 3IJCA 5EAPA 1TYQC 5IGOA 4D9SA 4PXWA 4JSNC 1TBGA 4XEIC 3SMRA 5FA5B 1S4UX 4NSXA 2AGYA 3CFSB 4CY3A 5HE0B 3UVNA 2JKXA 3EI1B 3DWLC 4GMBA 4N14A 4FA4D 1RI6A 3FRXA 1VE6A 2CO0C 1QFMA 3I7KA 2PBIB 3PE7A 3MUNA 2P9NC 2YNPA 1OLZA 4TZ4A 3JZHA 2IAAA 4J84A 4WJKA 3JB9L 4BUJC 3W15A 3EI4A 3UVKA 4QRJA 3JZGA 3IUQA 1VZ2A 3SN6B 5FQDA 5B4WA 4CZVA 4CI3A 1BPOA 4EWRA 1P22A 2HJBA 3FCUA 4G1MA 2EBSA 2OVQB 3AL8A 5TDHB 4A09B 3EU7A 4QL1A 1GOFA 4CI8A 3MVDK 2UZXB 3NIGA 2AH1A 4X61B 2IUPA 5AJAA 3O4HA 4J78A 2TRCB 4UI9R 4A0BA 1VYHC 1OMWB 1N6FA 4A08B 5A2Qg 3AH8B 4R7AB 5I5IA 2VDNA 2VDOA 3B7FA 5EMJB 4A0AA 4JT6C 5E6UA 3KRWB 2OJYA 3UVMA 1PI6A 4L9OA 3FGBA 5CYKB 5K1CC 4MMYA 4J81A 4AMYA 2QZPA 3OW8A 2P9SC 4UM8A 5FKQA 3SXTD 3K6SA 4O1QD 3OTTA 4RE5A 3PVWB 4GM8A 4CI2A 3EQ7A 5CXBB 4DNWA 2O9KA 1GOTB 3K72A 1GP2B 2PM9A 4A11B 4ERYA 4FWWA 4E5ZB 2CO0A 3EI2A 4JSXC 4O3TB 1NR0A 3IULA 4E54B 4LGNA 4D6VA 4J86A 4X60B 4ESGA 4O3UB 5FKSA 2IUQA 3I7PA 2OK6A 4ZN4A 5GXHA 2HKRA 3IIWA 1H2WA 2XL2A 4DNUA 1L0QA 4K3JB 4A09A 2P9LC 2I0RA 5FXYA 5HDBA 3PXSD 2XYIA 2VDPA 4GZ8A 5H17A 5EM2B 1K3IA 3I8CA 3ZWLB 5C2WB 3NVXA 2I3TA 4MK0B 3UR4A 4AOWA 5EMLB 1MDAH 1Q47A 4WK0A 3C99A 4JHNA 4A08A 1VE7A 3SFZA 3I7OA 1K8KC 3F3PA 4QQEA 4GQ2P 4L3GD 5M5VA 3RN1D 4PC0A 2W18A 5CXCB 4AEZA 5HQGA 4AMZA 4FA9D 2XE4A 2VZ1A 4Y7RA 2J55H 2P9UC 2AGZA 4LG8A 3EQ9A 5EMKB 1I2MB 3OKTA 2H6KA 5IJ8E 1JTDB 2QC5A 3F3GA 3MKSB 1JJUB 3I7HA 4LG9A 3UKUC 2IUVA 5M61A 4FB1D 2P9IC 4FA1D 1A0RB 1M1XA 2OIZA 3OKWA 3HFQA 4L3HD 1B9XA 4PBYA 2I3SA 3J80g 2H9PA 3GD1I 4BL0A 3VGZA 3EI3A 1R5MA 1QNIA 2XL3A 3SBPA 4D0KA 3SLED 2VZ3A 1B9YA 4J82A 3I2NA 1UTCA 3FCSA 2Z2OA 4U1EI 5TEEA 5C2VB 1H2XA 3ZE1A 1PGUA 1QFSA 4Z8LA 1ERJA 3CIKB 3JAMg 3IJ0A 2OVRB 3IUMA 4PNKB 1NEXB 2H6NA 1K32A 2IURA 5SXMA 4FAND 4FHLA 4GGCA 2AH0A 3V7DB 3QHYB 4PBZA 3IKOA 3SBQA 4PSWB 5EAMA 3F3FA 4CZXA 2G9AA 1MG3A 4NENA 2H3XA 5FFGA 5E6RA 3GFCA 1GOGA 2BCJB 5KDOB 4GQBB 4G56B 5M5SA 2P9PC 2Z2NA 3MUOA 4J0WA 3MZKA 5IC7A 3V4PA 4O45A 2UZYB 3RFGA 3PXWD 3OL2B 3OKYB 4J87A 3IJEA 3K27A 4ERZA 4G55A 1C9LA 4JD2C 4OWRA 5EMMB 2EIBA 3MMYA 5C92A 1PBYB 2PM7B 2HXCA 3V5WB 5GSAA 2BBKH 1VZ3A 4OZUA 3EI1A 4IMMA 5IGQA 2I0TA 3IVMA 3SHFA 4NC4A 3ZDYA 4Z7QA 2B5LA 3RRMC 1O6FA 5IJ7E 2AGWA 2B4EA 2HKMA 3K26A 5C86A 1SQJA 5M5TA 1TYEA 2EICA 5C9ZB 3UKRC 2CE8A 4O9DA 2H9MA 3N0EA 4BCCA 4DNVA 1A12A 5JWZA 3J81g 3ORVD 3L4MD 5I5JA 4J77A 2VDLA 2B5MA 5I5MA 1N6DA 4H5IA 4WK2A 4XYIA 4BP9A 3FM0A 2CN2A 4Z7NA 2GC4A 5AFU3 2J56H 2EIDA 3NVNA 1FWXA 2VDMA 2IWFA 4L1MA 2YNNA 3IURA 2HU7A 3RN0D 3I89A 4QT8A 3EI4B 4O2WA 5CYKA 2B5NA 2BKLA 3VA6A 4YVDA 3JROA 4JT5C 2GC7A 5HE2B 3SWSD 5K19A 4GQ1A 5FLXg 3QI0A 4QAMA 4MMXA 4ES0A 1GOHA 2H13A 4ZOXA 4RE6A 3AL8B 5M5UA 4H5JA 4NBMA 3PVUB 2H9NA 1E5TA 4JXMA 5CXBA 2HU5A 3NVQA 4CY1A 4A11A 3NIFA 1UOQA 4GGDA 4E5ZA 3PSLA 1XHMA 3AL9A 3DSMA 3OF7A 3O4GA 1U4CA 1L5GA 2OK4A 4E54A 4J0XA 1E8NA 3EWEA 2CN3A
chains in the Genus database with same CATH topology
4A0AB 2YNOA 3L4OD 3DM0A 2HESX 5GMKn 1U2VC 2XU7A 3I7NA 3JZNA 1JOFA 2AQ5A 2I0SA 3PSCB 3JRPA 4HDJA 4ZOVA 5GXIA 4Y5RD 5FKTA 3IJ1A 4X3EA 3N0DA 4KFMB 5EM2A 1XKSA 4PSXB 4BH6A 2QXVA 4A7JA 2PM9B 3PXTD 4CC9A 2H9LA 3EI2B 2OVPB 1JMXB 5AMSA 3BWSA 1YFQA 3RSEC 3C5MA 4GM3A 4ERQA 5IT9g 5CXCA 3MXXA 2HJ4A 4J8GA 2YBAA 4L1QD 3DXMC 1XIPA 4ZOYA 2CNXA 4XYHA 3I7LA 5HYNB 4GGAA 5TF2A 3SVWD 2H6QA 3A0FA 4A2MA 3SJLD 2Q7QA 2CE9A 2YB8B 1MG2A 4FAVD 1GG2B 2J57G 3EG6A 2G99A 4J79A 3KRXB 3P4FA 2H68A 5TEFA 4IA9A 3JPXA 2HYEA 4K3ID 3CFVA 3RLMD 1N6EA 2P9KC 4A2LA 3E0CA 3SCYA 3VH0A 1GXRA 3DXKC 5EARA 2GNQA 2IWKA 3BG1A 2PM6B 3UVOA 3ODTA 4GM9A 2AGXA 3AFCA 3EI3B 2MTAH 1JMZB 1SHYB 3GREA 4J73A 3V9FA 5H14A 4FA5D 4ZOZA 3UVLA 3OL2A 3OKYA 3MZLA 4X63B 4JSPC 2Z2PA 4JSVC 4I79A 2AGLA 3U4YA 4CI1A 2YMUA 3SBRA 5THAA 3C75H 3MKQA 5FKRA 5EALA 3RFHA 3RMZD 3BG0A 3EMHA 3I8EA 4J8BA 3IIYA 1PEVA 5HE3B 3ULEC 4A0BB 5H1MA 3C9CA 2H14A 5HE1B 4CY5A 4CY2A 4CZYA 1SQ9A 4U7AA 2H47A 3IJCA 5EAPA 1TYQC 5IGOA 4PXWA 4JSNC 1TBGA 4XEIC 3SMRA 5FA5B 1S4UX 4NSXA 2AGYA 3CFSB 4CY3A 5HE0B 3UVNA 3EI1B 3DWLC 4GMBA 4N14A 4FA4D 1RI6A 3FRXA 2CO0C 3I7KA 2PBIB 3PE7A 2P9NC 2YNPA 1OLZA 4TZ4A 3JZHA 2IAAA 4J84A 3JB9L 4BUJC 3W15A 3EI4A 3UVKA 4QRJA 3JZGA 3SN6B 5FQDA 5B4WA 4CZVA 4CI3A 4EWRA 1P22A 2HJBA 2EBSA 2OVQB 3AL8A 5TDHB 4A09B 3EU7A 4QL1A 4CI8A 2UZXB 2AH1A 4X61B 2IUPA 5AJAA 4J78A 2TRCB 4UI9R 4A0BA 1VYHC 1OMWB 1N6FA 4A08B 5A2Qg 3AH8B 4R7AB 5I5IA 3B7FA 5EMJB 4A0AA 4JT6C 3KRWB 2OJYA 3UVMA 1PI6A 4L9OA 3FGBA 5CYKB 5K1CC 4J81A 3OW8A 2P9SC 5FKQA 3SXTD 4O1QD 3OTTA 3PVWB 4GM8A 4CI2A 5CXBB 2O9KA 1GOTB 1GP2B 2PM9A 4A11B 4ERYA 4FWWA 4E5ZB 2CO0A 3EI2A 4JSXC 4O3TB 1NR0A 4E54B 4LGNA 4D6VA 4J86A 4X60B 4ESGA 4O3UB 5FKSA 2IUQA 3I7PA 2OK6A 4ZN4A 5GXHA 2HKRA 3IIWA 2XL2A 1L0QA 4K3JB 4A09A 2P9LC 2I0RA 5FXYA 3PXSD 2XYIA 4GZ8A 5H17A 5EM2B 3I8CA 3ZWLB 5C2WB 3NVXA 2I3TA 4MK0B 3UR4A 4AOWA 5EMLB 1MDAH 1Q47A 3C99A 4A08A 3SFZA 3I7OA 1K8KC 3F3PA 4QQEA 4GQ2P 4L3GD 3RN1D 4PC0A 2W18A 5CXCB 4AEZA 5HQGA 4FA9D 4Y7RA 2J55H 2P9UC 2AGZA 4LG8A 5EMKB 3OKTA 2H6KA 5IJ8E 3F3GA 2QC5A 3MKSB 1JJUB 3I7HA 4LG9A 3UKUC 2IUVA 4FB1D 2P9IC 4FA1D 1A0RB 2OIZA 3OKWA 3HFQA 4L3HD 1B9XA 4PBYA 2I3SA 3J80g 2H9PA 4BL0A 3VGZA 3EI3A 1R5MA 1QNIA 2XL3A 3SBPA 4D0KA 3SLED 4J82A 1B9YA 3I2NA 2Z2OA 4U1EI 5TEEA 5C2VB 1PGUA 4Z8LA 1ERJA 3CIKB 3JAMg 3IJ0A 2OVRB 4PNKB 1NEXB 2H6NA 1K32A 2IURA 5SXMA 4FAND 4FHLA 4GGCA 2AH0A 3V7DB 4PBZA 3IKOA 3SBQA 4PSWB 5EAMA 3F3FA 4CZXA 2G9AA 1MG3A 2H3XA 3GFCA 2BCJB 5KDOB 4GQBB 4G56B 2P9PC 2Z2NA 4J0WA 5IC7A 3MZKA 4O45A 2UZYB 3RFGA 3PXWD 3OL2B 3OKYB 4J87A 3K27A 4ERZA 4JD2C 4OWRA 5EMMB 3MMYA 1PBYB 2PM7B 2HXCA 3V5WB 5GSAA 2BBKH 4OZUA 3EI1A 4IMMA 5IGQA 2I0TA 3SHFA 2B5LA 3RRMC 5IJ7E 2AGWA 2B4EA 2HKMA 3K26A 1SQJA 5C9ZB 3UKRC 2CE8A 4O9DA 2H9MA 3N0EA 5JWZA 3J81g 3ORVD 3L4MD 5I5JA 4J77A 2B5MA 5I5MA 1N6DA 4H5IA 4XYIA 3FM0A 2CN2A 2GC4A 5AFU3 2J56H 3NVNA 1FWXA 2IWFA 2YNNA 3RN0D 3I89A 4QT8A 3EI4B 5CYKA 2B5NA 3VA6A 4YVDA 3JROA 4JT5C 2GC7A 5HE2B 3SWSD 5K19A 4GQ1A 5FLXg 4ES0A 2H13A 4ZOXA 3AL8B 4H5JA 3PVUB 2H9NA 4JXMA 5CXBA 3NVQA 4CY1A 4A11A 4GGDA 4E5ZA 3PSLA 1XHMA 3AL9A 3DSMA 1U4CA 2OK4A 4E54A 4J0XA 3EWEA 2CN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A0A B;  2YNO A;  3L4O D;  3DM0 A;  2HES X;  5GMK n;  1U2V C;  2XU7 A;  3I7N A;  3JZN A;  1JOF A;  2AQ5 A;  2I0S A;  3PSC B;  3JRP A;  4HDJ A;  4ZOV A;  5GXI A;  4Y5R D;  5FKT A;  3IJ1 A;  4X3E A;  3N0D A;  4KFM B;  5EM2 A;  1XKS A;  4PSX B;  4BH6 A;  2QXV A;  4A7J A;  2PM9 B;  3PXT D;  4CC9 A;  2H9L A;  3EI2 B;  2OVP B;  1JMX B;  5AMS A;  3BWS A;  1YFQ A;  3RSE C;  3C5M A;  4GM3 A;  4ERQ A;  5IT9 g;  5CXC A;  3MXX A;  2HJ4 A;  4J8G A;  2YBA A;  4L1Q D;  3DXM C;  1XIP A;  4ZOY A;  2CNX A;  4XYH A;  3I7L A;  5HYN B;  4GGA A;  5TF2 A;  3SVW D;  2H6Q A;  3A0F A;  4A2M A;  3SJL D;  2Q7Q A;  2CE9 A;  2YB8 B;  1MG2 A;  4FAV D;  1GG2 B;  2J57 G;  3EG6 A;  2G99 A;  4J79 A;  3KRX B;  3P4F A;  2H68 A;  5TEF A;  4IA9 A;  3JPX A;  2HYE A;  4K3I D;  3CFV A;  3RLM D;  1N6E A;  2P9K C;  4A2L A;  3E0C A;  3SCY A;  3VH0 A;  1GXR A;  3DXK C;  5EAR A;  2GNQ A;  2IWK A;  3BG1 A;  2PM6 B;  3UVO A;  3ODT A;  4GM9 A;  2AGX A;  3AFC A;  3EI3 B;  2MTA H;  1JMZ B;  1SHY B;  3GRE A;  4J73 A;  3V9F A;  5H14 A;  4FA5 D;  4ZOZ A;  3UVL A;  3OL2 A;  3OKY A;  3MZL A;  4X63 B;  4JSP C;  2Z2P A;  4JSV C;  4I79 A;  2AGL A;  3U4Y A;  4CI1 A;  2YMU A;  3SBR A;  5THA A;  3C75 H;  3MKQ A;  5FKR A;  5EAL A;  3RFH A;  3RMZ D;  3BG0 A;  3EMH A;  3I8E A;  4J8B A;  3IIY A;  1PEV A;  5HE3 B;  3ULE C;  4A0B B;  5H1M A;  3C9C A;  2H14 A;  5HE1 B;  4CY5 A;  4CY2 A;  4CZY A;  1SQ9 A;  4U7A A;  2H47 A;  3IJC A;  5EAP A;  1TYQ C;  5IGO A;  4PXW A;  4JSN C;  1TBG A;  4XEI C;  3SMR A;  5FA5 B;  1S4U X;  4NSX A;  2AGY A;  3CFS B;  4CY3 A;  5HE0 B;  3UVN A;  3EI1 B;  3DWL C;  4GMB A;  4N14 A;  4FA4 D;  1RI6 A;  3FRX A;  2CO0 C;  3I7K A;  2PBI B;  3PE7 A;  2P9N C;  2YNP A;  1OLZ A;  4TZ4 A;  3JZH A;  2IAA A;  4J84 A;  3JB9 L;  4BUJ C;  3W15 A;  3EI4 A;  3UVK A;  4QRJ A;  3JZG A;  3SN6 B;  5FQD A;  5B4W A;  4CZV A;  4CI3 A;  4EWR A;  1P22 A;  2HJB A;  2EBS A;  2OVQ B;  3AL8 A;  5TDH B;  4A09 B;  3EU7 A;  4QL1 A;  4CI8 A;  2UZX B;  2AH1 A;  4X61 B;  2IUP A;  5AJA A;  4J78 A;  2TRC B;  4UI9 R;  4A0B A;  1VYH C;  1OMW B;  1N6F A;  4A08 B;  5A2Q g;  3AH8 B;  4R7A B;  5I5I A;  3B7F A;  5EMJ B;  4A0A A;  4JT6 C;  3KRW B;  2OJY A;  3UVM A;  1PI6 A;  4L9O A;  3FGB A;  5CYK B;  5K1C C;  4J81 A;  3OW8 A;  2P9S C;  5FKQ A;  3SXT D;  4O1Q D;  3OTT A;  3PVW B;  4GM8 A;  4CI2 A;  5CXB B;  2O9K A;  1GOT B;  1GP2 B;  2PM9 A;  4A11 B;  4ERY A;  4FWW A;  4E5Z B;  2CO0 A;  3EI2 A;  4JSX C;  4O3T B;  1NR0 A;  4E54 B;  4LGN A;  4D6V A;  4J86 A;  4X60 B;  4ESG A;  4O3U B;  5FKS A;  2IUQ A;  3I7P A;  2OK6 A;  4ZN4 A;  5GXH A;  2HKR A;  3IIW A;  2XL2 A;  1L0Q A;  4K3J B;  4A09 A;  2P9L C;  2I0R A;  5FXY A;  3PXS D;  2XYI A;  4GZ8 A;  5H17 A;  5EM2 B;  3I8C A;  3ZWL B;  5C2W B;  3NVX A;  2I3T A;  4MK0 B;  3UR4 A;  4AOW A;  5EML B;  1MDA H;  1Q47 A;  3C99 A;  4A08 A;  3SFZ A;  3I7O A;  1K8K C;  3F3P A;  4QQE A;  4GQ2 P;  4L3G D;  3RN1 D;  4PC0 A;  2W18 A;  5CXC B;  4AEZ A;  5HQG A;  4FA9 D;  4Y7R A;  2J55 H;  2P9U C;  2AGZ A;  4LG8 A;  5EMK B;  3OKT A;  2H6K A;  5IJ8 E;  3F3G A;  2QC5 A;  3MKS B;  1JJU B;  3I7H A;  4LG9 A;  3UKU C;  2IUV A;  4FB1 D;  2P9I C;  4FA1 D;  1A0R B;  2OIZ A;  3OKW A;  3HFQ A;  4L3H D;  1B9X A;  4PBY A;  2I3S A;  3J80 g;  2H9P A;  4BL0 A;  3VGZ A;  3EI3 A;  1R5M A;  1QNI A;  2XL3 A;  3SBP A;  4D0K A;  3SLE D;  4J82 A;  1B9Y A;  3I2N A;  2Z2O A;  4U1E I;  5TEE A;  5C2V B;  1PGU A;  4Z8L A;  1ERJ A;  3CIK B;  3JAM g;  3IJ0 A;  2OVR B;  4PNK B;  1NEX B;  2H6N A;  1K32 A;  2IUR A;  5SXM A;  4FAN D;  4FHL A;  4GGC A;  2AH0 A;  3V7D B;  4PBZ A;  3IKO A;  3SBQ A;  4PSW B;  5EAM A;  3F3F A;  4CZX A;  2G9A A;  1MG3 A;  2H3X A;  3GFC A;  2BCJ B;  5KDO B;  4GQB B;  4G56 B;  2P9P C;  2Z2N A;  4J0W A;  5IC7 A;  3MZK A;  4O45 A;  2UZY B;  3RFG A;  3PXW D;  3OL2 B;  3OKY B;  4J87 A;  3K27 A;  4ERZ A;  4JD2 C;  4OWR A;  5EMM B;  3MMY A;  1PBY B;  2PM7 B;  2HXC A;  3V5W B;  5GSA A;  2BBK H;  4OZU A;  3EI1 A;  4IMM A;  5IGQ A;  2I0T A;  3SHF A;  2B5L A;  3RRM C;  5IJ7 E;  2AGW A;  2B4E A;  2HKM A;  3K26 A;  1SQJ A;  5C9Z B;  3UKR C;  2CE8 A;  4O9D A;  2H9M A;  3N0E A;  5JWZ A;  3J81 g;  3ORV D;  3L4M D;  5I5J A;  4J77 A;  2B5M A;  5I5M A;  1N6D A;  4H5I A;  4XYI A;  3FM0 A;  2CN2 A;  2GC4 A;  5AFU 3;  2J56 H;  3NVN A;  1FWX A;  2IWF A;  2YNN A;  3RN0 D;  3I89 A;  4QT8 A;  3EI4 B;  5CYK A;  2B5N A;  3VA6 A;  4YVD A;  3JRO A;  4JT5 C;  2GC7 A;  5HE2 B;  3SWS D;  5K19 A;  4GQ1 A;  5FLX g;  4ES0 A;  2H13 A;  4ZOX A;  3AL8 B;  4H5J A;  3PVU B;  2H9N A;  4JXM A;  5CXB A;  3NVQ A;  4CY1 A;  4A11 A;  4GGD A;  4E5Z A;  3PSL A;  1XHM A;  3AL9 A;  3DSM A;  1U4C A;  2OK4 A;  4E54 A;  4J0X A;  3EWE A;  2CN3 A; 
#chains in the Genus database with same CATH topology
 4A0A B;  2YNO A;  3L4O D;  3DM0 A;  2HES X;  2EIE A;  5GMK n;  1U2V C;  2VC2 A;  2XU7 A;  3I7N A;  3JZN A;  1JOF A;  4NAA A;  2AQ5 A;  2I0S A;  3PSC B;  3JRP A;  4HDJ A;  4ZOV A;  5GXI A;  4Y5R D;  5FKT A;  3IJ1 A;  4X3E A;  3T3P A;  3N0D A;  4KFM B;  5EM2 A;  1XKS A;  4PSX B;  4BH6 A;  4JHP C;  2QXV A;  2VDR A;  4A7J A;  2PM9 B;  3PXT D;  3ZDZ A;  5M5R A;  4CC9 A;  2H9L A;  1JV2 A;  3O4I A;  3ZDX A;  4BP8 A;  2OVP B;  3EI2 B;  1JMX B;  5FFO A;  5AMS A;  3BWS A;  1YFQ A;  3RSE C;  3C5M A;  4GM3 A;  4ERQ A;  5IT9 g;  5CXC A;  3MXX A;  2HJ4 A;  4IRZ A;  4J8G A;  2YBA A;  4L1Q D;  3GC3 B;  4MMZ A;  3O4J A;  1T2X A;  3DXM C;  3T3M A;  1XIP A;  4ZOY A;  2CNX A;  4XYH A;  3I7L A;  5HYN B;  4GGA A;  4Z7O A;  5TF2 A;  3SVW D;  3KCI A;  2H6Q A;  3A0F A;  4A2M A;  3IUJ A;  3SJL D;  2Q7Q A;  3K71 A;  2HU8 A;  2CE9 A;  2YB8 B;  1MG2 A;  4FAV D;  4G1E A;  1GG2 B;  2J57 G;  3EG6 A;  2G99 A;  4J79 A;  1O6G A;  3KRX B;  3P4F A;  1H2Y A;  4WK4 A;  2H68 A;  5TEF A;  4IA9 A;  3JPX A;  2HYE A;  5E6S A;  4K3I D;  4BCB A;  2XZG A;  3CFV A;  3RLM D;  4AX4 A;  1N6E A;  3DDU A;  2P9K C;  4A2L A;  3E0C A;  3SCY A;  3VH0 A;  2WQ8 A;  1UOP A;  1GXR A;  4AN0 A;  3DXK C;  3ZE0 A;  5EAR A;  2GNQ A;  2IWK A;  4AN1 A;  3BG1 A;  2PM6 B;  3UVO A;  3ODT A;  4GM9 A;  2AGX A;  2QR5 A;  3AFC A;  3EI3 B;  2MTA H;  1JMZ B;  1SHY B;  3GRE A;  4J73 A;  3V9F A;  5H14 A;  4FA5 D;  3ZE2 A;  4ZOZ A;  1YR2 A;  3UVL A;  3OL2 A;  3OKY A;  3NID A;  3MZL A;  1C9I A;  4X63 B;  4JSP C;  2Z2P A;  4JSV C;  4I79 A;  4UM9 A;  2AGL A;  2XDW A;  3U4Y A;  1H2Z A;  1E8M A;  3EQ8 A;  3V4V A;  2VDQ A;  4CI1 A;  2YMU A;  3SBR A;  5THA A;  3C75 H;  3MKQ A;  5FKR A;  5EAL A;  3RFH A;  3RMZ D;  3BG0 A;  3EMH A;  3I8E A;  3IUN A;  4J8B A;  4O02 A;  3IIY A;  3VI4 A;  4BCD A;  1PEV A;  2VDK A;  5HE3 B;  3VI3 A;  3ULE C;  4A0B B;  5H1M A;  3C9C A;  2H14 A;  5HE1 B;  1U8C A;  4CY5 A;  1UOO A;  4CY2 A;  4CZY A;  1SQ9 A;  4U7A A;  2H47 A;  3IJC A;  5EAP A;  1TYQ C;  5IGO A;  4D9S A;  4PXW A;  4JSN C;  1TBG A;  4XEI C;  3SMR A;  5FA5 B;  1S4U X;  4NSX A;  2AGY A;  3CFS B;  4CY3 A;  5HE0 B;  3UVN A;  2JKX A;  3EI1 B;  3DWL C;  4GMB A;  4N14 A;  4FA4 D;  1RI6 A;  3FRX A;  1VE6 A;  2CO0 C;  1QFM A;  3I7K A;  2PBI B;  3PE7 A;  3MUN A;  2P9N C;  2YNP A;  1OLZ A;  4TZ4 A;  3JZH A;  2IAA A;  4J84 A;  4WJK A;  3JB9 L;  4BUJ C;  3W15 A;  3EI4 A;  3UVK A;  4QRJ A;  3JZG A;  3IUQ A;  1VZ2 A;  3SN6 B;  5FQD A;  5B4W A;  4CZV A;  4CI3 A;  1BPO A;  4EWR A;  1P22 A;  2HJB A;  3FCU A;  4G1M A;  2EBS A;  2OVQ B;  3AL8 A;  5TDH B;  4A09 B;  3EU7 A;  4QL1 A;  1GOF A;  4CI8 A;  3MVD K;  2UZX B;  3NIG A;  2AH1 A;  4X61 B;  2IUP A;  5AJA A;  3O4H A;  4J78 A;  2TRC B;  4UI9 R;  4A0B A;  1VYH C;  1OMW B;  1N6F A;  4A08 B;  5A2Q g;  3AH8 B;  4R7A B;  5I5I A;  2VDN A;  2VDO A;  3B7F A;  5EMJ B;  4A0A A;  4JT6 C;  5E6U A;  3KRW B;  2OJY A;  3UVM A;  1PI6 A;  4L9O A;  3FGB A;  5CYK B;  5K1C C;  4MMY A;  4J81 A;  4AMY A;  2QZP A;  3OW8 A;  2P9S C;  4UM8 A;  5FKQ A;  3SXT D;  3K6S A;  4O1Q D;  3OTT A;  4RE5 A;  3PVW B;  4GM8 A;  4CI2 A;  3EQ7 A;  5CXB B;  4DNW A;  2O9K A;  1GOT B;  3K72 A;  1GP2 B;  2PM9 A;  4A11 B;  4ERY A;  4FWW A;  4E5Z B;  2CO0 A;  3EI2 A;  4JSX C;  4O3T B;  1NR0 A;  3IUL A;  4E54 B;  4LGN A;  4D6V A;  4J86 A;  4X60 B;  4ESG A;  4O3U B;  5FKS A;  2IUQ A;  3I7P A;  2OK6 A;  4ZN4 A;  5GXH A;  2HKR A;  3IIW A;  1H2W A;  2XL2 A;  4DNU A;  1L0Q A;  4K3J B;  4A09 A;  2P9L C;  2I0R A;  5FXY A;  5HDB A;  3PXS D;  2XYI A;  2VDP A;  4GZ8 A;  5H17 A;  5EM2 B;  1K3I A;  3I8C A;  3ZWL B;  5C2W B;  3NVX A;  2I3T A;  4MK0 B;  3UR4 A;  4AOW A;  5EML B;  1MDA H;  1Q47 A;  4WK0 A;  3C99 A;  4JHN A;  4A08 A;  1VE7 A;  3SFZ A;  3I7O A;  1K8K C;  3F3P A;  4QQE A;  4GQ2 P;  4L3G D;  5M5V A;  3RN1 D;  4PC0 A;  2W18 A;  5CXC B;  4AEZ A;  5HQG A;  4AMZ A;  4FA9 D;  2XE4 A;  2VZ1 A;  4Y7R A;  2J55 H;  2P9U C;  2AGZ A;  4LG8 A;  3EQ9 A;  5EMK B;  1I2M B;  3OKT A;  2H6K A;  5IJ8 E;  1JTD B;  2QC5 A;  3F3G A;  3MKS B;  1JJU B;  3I7H A;  4LG9 A;  3UKU C;  2IUV A;  5M61 A;  4FB1 D;  2P9I C;  4FA1 D;  1A0R B;  1M1X A;  2OIZ A;  3OKW A;  3HFQ A;  4L3H D;  1B9X A;  4PBY A;  2I3S A;  3J80 g;  2H9P A;  3GD1 I;  4BL0 A;  3VGZ A;  3EI3 A;  1R5M A;  1QNI A;  2XL3 A;  3SBP A;  4D0K A;  3SLE D;  2VZ3 A;  1B9Y A;  4J82 A;  3I2N A;  1UTC A;  3FCS A;  2Z2O A;  4U1E I;  5TEE A;  5C2V B;  1H2X A;  3ZE1 A;  1PGU A;  1QFS A;  4Z8L A;  1ERJ A;  3CIK B;  3JAM g;  3IJ0 A;  2OVR B;  3IUM A;  4PNK B;  1NEX B;  2H6N A;  1K32 A;  2IUR A;  5SXM A;  4FAN D;  4FHL A;  4GGC A;  2AH0 A;  3V7D B;  3QHY B;  4PBZ A;  3IKO A;  3SBQ A;  4PSW B;  5EAM A;  3F3F A;  4CZX A;  2G9A A;  1MG3 A;  4NEN A;  2H3X A;  5FFG A;  5E6R A;  3GFC A;  1GOG A;  2BCJ B;  5KDO B;  4GQB B;  4G56 B;  5M5S A;  2P9P C;  2Z2N A;  3MUO A;  4J0W A;  3MZK A;  5IC7 A;  3V4P A;  4O45 A;  2UZY B;  3RFG A;  3PXW D;  3OL2 B;  3OKY B;  4J87 A;  3IJE A;  3K27 A;  4ERZ A;  4G55 A;  1C9L A;  4JD2 C;  4OWR A;  5EMM B;  2EIB A;  3MMY A;  5C92 A;  1PBY B;  2PM7 B;  2HXC A;  3V5W B;  5GSA A;  2BBK H;  1VZ3 A;  4OZU A;  3EI1 A;  4IMM A;  5IGQ A;  2I0T A;  3IVM A;  3SHF A;  4NC4 A;  3ZDY A;  4Z7Q A;  2B5L A;  3RRM C;  1O6F A;  5IJ7 E;  2AGW A;  2B4E A;  2HKM A;  3K26 A;  5C86 A;  1SQJ A;  5M5T A;  1TYE A;  2EIC A;  5C9Z B;  3UKR C;  2CE8 A;  4O9D A;  2H9M A;  3N0E A;  4BCC A;  4DNV A;  1A12 A;  5JWZ A;  3J81 g;  3ORV D;  3L4M D;  5I5J A;  4J77 A;  2VDL A;  2B5M A;  5I5M A;  1N6D A;  4H5I A;  4WK2 A;  4XYI A;  4BP9 A;  3FM0 A;  2CN2 A;  4Z7N A;  2GC4 A;  5AFU 3;  2J56 H;  2EID A;  3NVN A;  1FWX A;  2VDM A;  2IWF A;  4L1M A;  2YNN A;  3IUR A;  2HU7 A;  3RN0 D;  3I89 A;  4QT8 A;  3EI4 B;  4O2W A;  5CYK A;  2B5N A;  2BKL A;  3VA6 A;  4YVD A;  3JRO A;  4JT5 C;  2GC7 A;  5HE2 B;  3SWS D;  5K19 A;  4GQ1 A;  5FLX g;  3QI0 A;  4QAM A;  4MMX A;  4ES0 A;  1GOH A;  2H13 A;  4ZOX A;  4RE6 A;  3AL8 B;  5M5U A;  4H5J A;  4NBM A;  3PVU B;  2H9N A;  1E5T A;  4JXM A;  5CXB A;  2HU5 A;  3NVQ A;  4CY1 A;  4A11 A;  3NIF A;  1UOQ A;  4GGD A;  4E5Z A;  3PSL A;  1XHM A;  3AL9 A;  3DSM A;  3OF7 A;  3O4G A;  1U4C A;  1L5G A;  2OK4 A;  4E54 A;  4J0X A;  1E8N A;  3EWE A;  2CN3 A; 
#chains in the Genus database with same CATH homology
 4A0A B;  2YNO A;  3L4O D;  3DM0 A;  2HES X;  5GMK n;  1U2V C;  2XU7 A;  3I7N A;  3JZN A;  1JOF A;  2AQ5 A;  2I0S A;  3PSC B;  3JRP A;  4HDJ A;  4ZOV A;  5GXI A;  4Y5R D;  5FKT A;  3IJ1 A;  4X3E A;  3N0D A;  4KFM B;  5EM2 A;  1XKS A;  4PSX B;  4BH6 A;  2QXV A;  4A7J A;  2PM9 B;  3PXT D;  4CC9 A;  2H9L A;  3EI2 B;  2OVP B;  1JMX B;  5AMS A;  3BWS A;  1YFQ A;  3RSE C;  3C5M A;  4GM3 A;  4ERQ A;  5IT9 g;  5CXC A;  3MXX A;  2HJ4 A;  4J8G A;  2YBA A;  4L1Q D;  3DXM C;  1XIP A;  4ZOY A;  2CNX A;  4XYH A;  3I7L A;  5HYN B;  4GGA A;  5TF2 A;  3SVW D;  2H6Q A;  3A0F A;  4A2M A;  3SJL D;  2Q7Q A;  2CE9 A;  2YB8 B;  1MG2 A;  4FAV D;  1GG2 B;  2J57 G;  3EG6 A;  2G99 A;  4J79 A;  3KRX B;  3P4F A;  2H68 A;  5TEF A;  4IA9 A;  3JPX A;  2HYE A;  4K3I D;  3CFV A;  3RLM D;  1N6E A;  2P9K C;  4A2L A;  3E0C A;  3SCY A;  3VH0 A;  1GXR A;  3DXK C;  5EAR A;  2GNQ A;  2IWK A;  3BG1 A;  2PM6 B;  3UVO A;  3ODT A;  4GM9 A;  2AGX A;  3AFC A;  3EI3 B;  2MTA H;  1JMZ B;  1SHY B;  3GRE A;  4J73 A;  3V9F A;  5H14 A;  4FA5 D;  4ZOZ A;  3UVL A;  3OL2 A;  3OKY A;  3MZL A;  4X63 B;  4JSP C;  2Z2P A;  4JSV C;  4I79 A;  2AGL A;  3U4Y A;  4CI1 A;  2YMU A;  3SBR A;  5THA A;  3C75 H;  3MKQ A;  5FKR A;  5EAL A;  3RFH A;  3RMZ D;  3BG0 A;  3EMH A;  3I8E A;  4J8B A;  3IIY A;  1PEV A;  5HE3 B;  3ULE C;  4A0B B;  5H1M A;  3C9C A;  2H14 A;  5HE1 B;  4CY5 A;  4CY2 A;  4CZY A;  1SQ9 A;  4U7A A;  2H47 A;  3IJC A;  5EAP A;  1TYQ C;  5IGO A;  4PXW A;  4JSN C;  1TBG A;  4XEI C;  3SMR A;  5FA5 B;  1S4U X;  4NSX A;  2AGY A;  3CFS B;  4CY3 A;  5HE0 B;  3UVN A;  3EI1 B;  3DWL C;  4GMB A;  4N14 A;  4FA4 D;  1RI6 A;  3FRX A;  2CO0 C;  3I7K A;  2PBI B;  3PE7 A;  2P9N C;  2YNP A;  1OLZ A;  4TZ4 A;  3JZH A;  2IAA A;  4J84 A;  3JB9 L;  4BUJ C;  3W15 A;  3EI4 A;  3UVK A;  4QRJ A;  3JZG A;  3SN6 B;  5FQD A;  5B4W A;  4CZV A;  4CI3 A;  4EWR A;  1P22 A;  2HJB A;  2EBS A;  2OVQ B;  3AL8 A;  5TDH B;  4A09 B;  3EU7 A;  4QL1 A;  4CI8 A;  2UZX B;  2AH1 A;  4X61 B;  2IUP A;  5AJA A;  4J78 A;  2TRC B;  4UI9 R;  4A0B A;  1VYH C;  1OMW B;  1N6F A;  4A08 B;  5A2Q g;  3AH8 B;  4R7A B;  5I5I A;  3B7F A;  5EMJ B;  4A0A A;  4JT6 C;  3KRW B;  2OJY A;  3UVM A;  1PI6 A;  4L9O A;  3FGB A;  5CYK B;  5K1C C;  4J81 A;  3OW8 A;  2P9S C;  5FKQ A;  3SXT D;  4O1Q D;  3OTT A;  3PVW B;  4GM8 A;  4CI2 A;  5CXB B;  2O9K A;  1GOT B;  1GP2 B;  2PM9 A;  4A11 B;  4ERY A;  4FWW A;  4E5Z B;  2CO0 A;  3EI2 A;  4JSX C;  4O3T B;  1NR0 A;  4E54 B;  4LGN A;  4D6V A;  4J86 A;  4X60 B;  4ESG A;  4O3U B;  5FKS A;  2IUQ A;  3I7P A;  2OK6 A;  4ZN4 A;  5GXH A;  2HKR A;  3IIW A;  2XL2 A;  1L0Q A;  4K3J B;  4A09 A;  2P9L C;  2I0R A;  5FXY A;  3PXS D;  2XYI A;  4GZ8 A;  5H17 A;  5EM2 B;  3I8C A;  3ZWL B;  5C2W B;  3NVX A;  2I3T A;  4MK0 B;  3UR4 A;  4AOW A;  5EML B;  1MDA H;  1Q47 A;  3C99 A;  4A08 A;  3SFZ A;  3I7O A;  1K8K C;  3F3P A;  4QQE A;  4GQ2 P;  4L3G D;  3RN1 D;  4PC0 A;  2W18 A;  5CXC B;  4AEZ A;  5HQG A;  4FA9 D;  4Y7R A;  2J55 H;  2P9U C;  2AGZ A;  4LG8 A;  5EMK B;  3OKT A;  2H6K A;  5IJ8 E;  3F3G A;  2QC5 A;  3MKS B;  1JJU B;  3I7H A;  4LG9 A;  3UKU C;  2IUV A;  4FB1 D;  2P9I C;  4FA1 D;  1A0R B;  2OIZ A;  3OKW A;  3HFQ A;  4L3H D;  1B9X A;  4PBY A;  2I3S A;  3J80 g;  2H9P A;  4BL0 A;  3VGZ A;  3EI3 A;  1R5M A;  1QNI A;  2XL3 A;  3SBP A;  4D0K A;  3SLE D;  4J82 A;  1B9Y A;  3I2N A;  2Z2O A;  4U1E I;  5TEE A;  5C2V B;  1PGU A;  4Z8L A;  1ERJ A;  3CIK B;  3JAM g;  3IJ0 A;  2OVR B;  4PNK B;  1NEX B;  2H6N A;  1K32 A;  2IUR A;  5SXM A;  4FAN D;  4FHL A;  4GGC A;  2AH0 A;  3V7D B;  4PBZ A;  3IKO A;  3SBQ A;  4PSW B;  5EAM A;  3F3F A;  4CZX A;  2G9A A;  1MG3 A;  2H3X A;  3GFC A;  2BCJ B;  5KDO B;  4GQB B;  4G56 B;  2P9P C;  2Z2N A;  4J0W A;  5IC7 A;  3MZK A;  4O45 A;  2UZY B;  3RFG A;  3PXW D;  3OL2 B;  3OKY B;  4J87 A;  3K27 A;  4ERZ A;  4JD2 C;  4OWR A;  5EMM B;  3MMY A;  1PBY B;  2PM7 B;  2HXC A;  3V5W B;  5GSA A;  2BBK H;  4OZU A;  3EI1 A;  4IMM A;  5IGQ A;  2I0T A;  3SHF A;  2B5L A;  3RRM C;  5IJ7 E;  2AGW A;  2B4E A;  2HKM A;  3K26 A;  1SQJ A;  5C9Z B;  3UKR C;  2CE8 A;  4O9D A;  2H9M A;  3N0E A;  5JWZ A;  3J81 g;  3ORV D;  3L4M D;  5I5J A;  4J77 A;  2B5M A;  5I5M A;  1N6D A;  4H5I A;  4XYI A;  3FM0 A;  2CN2 A;  2GC4 A;  5AFU 3;  2J56 H;  3NVN A;  1FWX A;  2IWF A;  2YNN A;  3RN0 D;  3I89 A;  4QT8 A;  3EI4 B;  5CYK A;  2B5N A;  3VA6 A;  4YVD A;  3JRO A;  4JT5 C;  2GC7 A;  5HE2 B;  3SWS D;  5K19 A;  4GQ1 A;  5FLX g;  4ES0 A;  2H13 A;  4ZOX A;  3AL8 B;  4H5J A;  3PVU B;  2H9N A;  4JXM A;  5CXB A;  3NVQ A;  4CY1 A;  4A11 A;  4GGD A;  4E5Z A;  3PSL A;  1XHM A;  3AL9 A;  3DSM A;  1U4C A;  2OK4 A;  4E54 A;  4J0X A;  3EWE A;  2CN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...