4UI9R

Atomic structure of the human anaphase-promoting complex
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
452
structure length
387
Chain Sequence
SKHGDRFIPSRAGANWSVNFHRINENGLAYSALLKNELLGAGIEKVQKGLFTYSLSPYSLSPVSNKSQKLLRSSKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWNAEQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSLSPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSVSVLNLFTRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic Structure of the Apc and its Mechanism of Protein Ubiquitination
pubmed doi rcsb
molecule tags Cell cycle
molecule keywords ANAPHASE-PROMOTING COMPLEX SUBUNIT 1
total genus 77
structure length 387
sequence length 452
ec nomenclature
pdb deposition date 2015-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00400 WD40 WD domain, G-beta repeat
R PF12894 ANAPC4_WD40 Anaphase-promoting complex subunit 4 WD40 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4ui9R01
3UVOA 3PXTD 5IJ8E 2AGYA 2GC4A 3OKYA 4CI1A 4CZXA 4X60B 2H9PA 4GGDA 4LG9A 3I7NA 4J86A 4KFMB 1JMXB 4E5ZB 4ZOXA 3FRXA 4J0XA 2O9KA 5KDOB 1XHMA 3SBRA 4QQEA 3A0FA 3EG6A 2BBKH 4J73A 3EI3A 2P9SC 3I7LA 4CC9A 3SMRA 4FWWA 1MDAH 4A2MA 3JZHA 2H9NA 2I0SA 4AOWA 5TF2A 3F3FA 4HDJA 3SLED 2AQ5A 4Z8LA 2HKRA 2G9AA 2HXCA 3I8CA 4ERZA 2P9NC 5EMLB 3EI2A 3F3PA 2W18A 2HJ4A 2IWKA 3EI4B 5SXMA 4PXWA 3L4MD 4A11A 3JZNA 2H3XA 1B9XA 2OVPB 4X3EA 4J81A 2AGXA 3C5MA 4LG8A 1TBGA 4UI9R 2B5MA 2Z2OA 3ODTA 3P4FA 5EM2B 3N0DA 3SFZA 2HJBA 3K26A 4J82A 4CI8A 4ZN4A 3PSCB 4A7JA 3BWSA 4XYHA 2HKMA 2CE8A 2CN3A 3CFSB 4J8BA 3I7OA 2CO0A 4O3TB 1N6DA 4J87A 2XL2A 3UVLA 2B5NA 5HE0B 1JMZB 3ORVD 1R5MA 4XEIC 1RI6A 5C2WB 3MMYA 4GMBA 3MKSB 2HESX 1OLZA 3PXSD 4JSNC 4GGCA 3PXWD 3EWEA 2AH0A 4GM3A 4JT6C 3NVXA 2EBSA 2B4EA 1XIPA 3FGBA 5B4WA 5THAA 3OL2A 5I5IA 3RMZD 3PE7A 4ZOZA 1MG3A 4PBZA 4ZOVA 5I5MA 4H5IA 3SJLD 2GNQA 5FKQA 1SQ9A 4CI2A 3EU7A 2H47A 2QXVA 4X63B 3MZKA 4GM9A 5EM2A 2H6NA 2AGLA 5JWZA 5FKRA 3DM0A 4J8GA 3UKRC 3JAMg 5TEEA 2PBIB 2I3TA 3PVUB 4NSXA 4PC0A 2QC5A 1QNIA 3OKTA 2P9LC 3GREA 3PSLA 3I89A 3UVKA 2YNOA 2YNNA 4K3ID 3J80g 3EMHA 5IJ7E 2I3SA 3HFQA 3EI2B 4FHLA 4A0AB 4J84A 4D6VA 3GFCA 4I79A 4TZ4A 2PM6B 1GP2B 3AFCA 5HE1B 3I7HA 4BH6A 2PM7B 3V9FA 4FA1D 4O9DA 4QL1A 2Z2NA 4J77A 5HQGA 4FA4D 3OL2B 3RN1D 3VGZA 1U2VC 3JZGA 4E54A 3I2NA 4G56B 1P22A 1TYQC 4K3JB 2IURA 4L3HD 4D0KA 2BCJB 5EAMA 3SN6B 3CFVA 1N6FA 5EAPA 2UZYB 3SXTD 2H6QA 4A08B 1ERJA 1B9YA 4X61B 2AGWA 3JRPA 3I8EA 3K27A 3SVWD 4L9OA 3C99A 3ULEC 5GSAA 3PVWB 4JSPC 4L1QD 3MZLA 2H13A 4CI3A 3J81g 3RFHA 3U4YA 3E0CA 3V7DB 4ZOYA 3OKWA 3DWLC 5IGQA 3SCYA 4Y5RD 3B7FA 4A2LA 2IUQA 2CE9A 2H9LA 2GC7A 3OW8A 3IJ1A 2OVQB 5EMKB 4O1QD 5TEFA 2HYEA 4L3GD 2H14A 4H5JA 5FA5B 3N0EA 4A0BB 3JPXA 3JB9L 2OVRB 3SWSD 2IWFA 4GGAA 5FQDA 2IUVA 4QT8A 3MXXA 4R7AB 5FKTA 4CY5A 3MKQA 3IJ0A 3W15A 1PI6A 4CY1A 3DXMC 5A2Qg 2IAAA 3BG1A 5K1CC 4FB1D 2PM9B 4E54B 4MK0B 2MTAH 4IA9A 4U1EI 1S4UX 1GXRA 2P9IC 5CYKA 2Q7QA 1NEXB 4N14A 2OK6A 4A08A 4A0AA 3I7PA 3EI1B 3NVNA 3VH0A 3I7KA 4GQ1A 2XYIA 3AL8A 3V5WB 2XL3A 4FA5D 4U7AA 3UR4A 2I0RA 1JJUB 2YNPA 5H1MA 4A09A 4JSVC 4GZ8A 5HYNB 2XU7A 4A0BA 2G99A 4ERYA 4O45A 3RSEC 1PGUA 1K8KC 5CXBA 4GQ2P 5AJAA 5AFU3 5TDHB 4ERQA 5FKSA 2H6KA 5GXIA 2PM9A 4JT5C 4GM8A 3L4OD 2H68A 2YB8B 1GOTB 3KRWB 2IUPA 3SBQA 1A0RB 4FA9D 4FAND 5CYKB 2P9KC 5FXYA 2CN2A 3SHFA 3DSMA 5AMSA 1U4CA 3EI1A 2CO0C 2OIZA 5CXCB 3KRXB 3C9CA 1GG2B 1YFQA 2OJYA 2CNXA 2Z2PA 1K32A 3F3GA 5GMKn 3DXKC 3AL8B 4IMMA 1N6EA 3BG0A 4JD2C 5I5JA 3UVMA 3OKYB 2OK4A 1NR0A 1XKSA 2YMUA 3NVQA 2B5LA 3OTTA 4A09B 2P9UC 3AH8B 4JSXC 5IGOA 3RLMD 4E5ZA 4AEZA 1OMWB 4LGNA 4CY3A 3IKOA 5HE2B 3EI3B 4J79A 1L0QA 3RRMC 2J56H 3RFGA 5EARA 4QRJA 5GXHA 3CIKB 5K19A 5IC7A 4J0WA 4FAVD 2H9MA 4CY2A 3ZWLB 1VYHC 4O3UB 3EI4A 5C2VB 1SQJA 4PNKB 2I0TA 4CZVA 5EALA 4ESGA 2TRCB 4YVDA 4OZUA 4XYIA 3UVNA 4CZYA 5CXBB 4GQBB 1FWXA 1PEVA 1Q47A 5EMJB 4Y7RA 3JROA 3UKUC 5C9ZB 3VA6A 3IIYA 2J57G 5FLXg 3FM0A 4EWRA 3RN0D 4PSXB 5H14A 3IIWA 2P9PC 3C75H 1SHYB 5HE3B 3AL9A 4OWRA 4PSWB 5IT9g 2AGZA 5H17A 5EMMB 2AH1A 4PBYA 4ES0A 4A11B 4J78A 1PBYB 2UZXB 5CXCA 3SBPA 1MG2A 2J55H 3IJCA 1JOFA 2YBAA 4BUJC 4BL0A 4JXMA
chains in the Genus database with same CATH superfamily
3UVOA 3PXTD 5IJ8E 4NENA 2AGYA 2GC4A 3OKYA 4CI1A 4CZXA 4X60B 2H9PA 4GGDA 3V4PA 4LG9A 3I7NA 3NIDA 4J86A 4NAAA 3V4VA 4KFMB 1JMXB 4E5ZB 5M5UA 4ZOXA 3FRXA 4J0XA 2O9KA 5KDOB 1XHMA 3O4IA 3SBRA 4QQEA 1H2ZA 3A0FA 3EG6A 3ZDYA 2BBKH 4J73A 3EI3A 2VC2A 2P9SC 3I7LA 3IVMA 4CC9A 3SMRA 4FWWA 1L5GA 4DNWA 1MDAH 4A2MA 3JZHA 5M5TA 2H9NA 2I0SA 4AOWA 5TF2A 4DNUA 3F3FA 4HDJA 3SLED 2AQ5A 4Z8LA 2EIDA 2HKRA 2G9AA 2HXCA 3I8CA 4ERZA 2P9NC 5EMLB 2XDWA 3EI2A 3VI3A 1M1XA 3F3PA 2W18A 5FFOA 3KCIA 2HJ4A 1K3IA 2IWKA 3EI4B 4BCBA 5M5VA 5SXMA 3QHYB 4PXWA 3L4MD 4A11A 1E8MA 3JZNA 1H2WA 2H3XA 1B9XA 2OVPB 4X3EA 4AMZA 4J81A 2AGXA 3C5MA 4LG8A 1TBGA 4UI9R 2B5MA 2Z2OA 3ODTA 3P4FA 5EM2B 3N0DA 3SFZA 2HJBA 3K26A 4J82A 4CI8A 4ZN4A 3PSCB 4A7JA 3BWSA 4XYHA 3QI0A 5M5RA 3ZDXA 2HKMA 2CE8A 2CN3A 5C86A 3CFSB 4J8BA 3I7OA 2CO0A 4O3TB 4D9SA 4Z7QA 1N6DA 4J87A 2XL2A 3UVLA 2B5NA 5HE0B 3MUOA 3ZE2A 1JMZB 3ORVD 4G1MA 1R5MA 4XEIC 4BP8A 1RI6A 5C2WB 3MMYA 4GMBA 4JHPC 3IUMA 3MKSB 1C9LA 1OLZA 2HESX 3PXSD 4GGCA 4JSNC 5M5SA 3PXWD 3ZE0A 3EWEA 1A12A 5E6RA 2AH0A 4GM3A 3GC3B 3ZE1A 4JT6C 3NVXA 2EBSA 2B4EA 1XIPA 3FGBA 5B4WA 5THAA 3OL2A 5I5IA 3RMZD 3PE7A 4ZOZA 1MG3A 1O6GA 4PBZA 2EIEA 4ZOVA 5I5MA 4H5IA 3SJLD 2JKXA 1U8CA 2GNQA 5FKQA 2HU7A 1SQ9A 4CI2A 1GOGA 3EU7A 2H47A 2QXVA 4X63B 3MZKA 4GM9A 5EM2A 2H6NA 2AGLA 5JWZA 5FKRA 4AN1A 3DM0A 4J8GA 1I2MB 4MMZA 3UKRC 3JAMg 5TEEA 2PBIB 2I3TA 3PVUB 4NSXA 4PC0A 2QC5A 1QNIA 3OKTA 1UTCA 2P9LC 3GREA 3PSLA 3MUNA 3I89A 4DNVA 3UVKA 2YNOA 2YNNA 4K3ID 1H2YA 3J80g 3EMHA 5IJ7E 2I3SA 3HFQA 3EI2B 1UOOA 4FHLA 4J84A 4D6VA 4A0AB 3GFCA 4I79A 4TZ4A 2PM6B 1GP2B 3T3MA 3AFCA 3FCUA 2VZ1A 5FFGA 5HE1B 3I7HA 4BH6A 2PM7B 2VDLA 3T3PA 3V9FA 4FA1D 4O9DA 2BKLA 4QL1A 2Z2NA 2QR5A 1JTDB 4J77A 5HQGA 4FA4D 4MMYA 2WQ8A 3OL2B 3RN1D 3VGZA 1U2VC 3JZGA 4E54A 3I2NA 4G56B 1P22A 1TYQC 4K3JB 2IURA 4L3HD 4O2WA 4D0KA 2BCJB 5EAMA 3SN6B 3CFVA 1N6FA 5EAPA 2UZYB 3SXTD 2H6QA 4A08B 1ERJA 1B9YA 4RE5A 4X61B 2AGWA 3JRPA 5C92A 3I8EA 3K27A 3SVWD 1QFSA 4L9OA 3C99A 3GD1I 3ULEC 3PVWB 4JSPC 4L1QD 3MZLA 2H13A 4CI3A 5GSAA 3IURA 3J81g 3RFHA 3U4YA 3E0CA 3V7DB 4ZOYA 3OKWA 3DWLC 5IGQA 2XZGA 3SCYA 4Y5RD 3B7FA 4A2LA 2IUQA 2CE9A 2H9LA 3K72A 2GC7A 3OW8A 3IJ1A 2OVQB 5EMKB 4O1QD 5HDBA 5TEFA 2HYEA 4L3GD 2H14A 4H5JA 5FA5B 3N0EA 1JV2A 4A0BB 2VDMA 3JPXA 3JB9L 2OVRB 1UOPA 2IWFA 4GGAA 5FQDA 3SWSD 2IUVA 4QT8A 3MXXA 4R7AB 5FKTA 4CY5A 3MKQA 2VDRA 3IJ0A 3W15A 1PI6A 4CY1A 3DXMC 5A2Qg 4L1MA 2IAAA 1E8NA 3ZDZA 4AN0A 4G55A 3BG1A 5K1CC 4QAMA 4FB1D 2PM9B 4E54B 4WJKA 4MK0B 2MTAH 4IA9A 4U1EI 2HU8A 4BCDA 1S4UX 1GXRA 3IUJA 3IULA 2P9IC 5CYKA 2EICA 2Q7QA 1NEXB 1VE6A 4N14A 2OK6A 4A08A 4A0AA 1BPOA 3I7PA 3EI1B 3NVNA 3VH0A 3I7KA 4GQ1A 2XYIA 1GOFA 3AL8A 2VDOA 3V5WB 2XL3A 3DDUA 4FA5D 4U7AA 3UR4A 2I0RA 4BP9A 1JJUB 2VDQA 4UM8A 4AX4A 2YNPA 3O4GA 4BL0A 5H1MA 4A09A 4JSVC 4GZ8A 5HYNB 1T2XA 4Z7OA 2XU7A 4RE6A 4A0BA 2G99A 4ERYA 4O45A 3RSEC 1PGUA 1K8KC 4WK2A 5E6SA 5CXBA 3K6SA 4GQ2P 5AJAA 5AFU3 4WK4A 5TDHB 4ERQA 5FKSA 2H6KA 3OF7A 1C9IA 5GXIA 1VE7A 2PM9A 3VI4A 4JT5C 2VDNA 4GM8A 3L4OD 2H68A 2YB8B 2VDKA 1GOTB 3KRWB 2IUPA 3SBQA 1A0RB 4FA9D 4FAND 5CYKB 2P9KC 5FXYA 2CN2A 3SHFA 3DSMA 5AMSA 1U4CA 3EI1A 2CO0C 2OIZA 5CXCB 3KRXB 3C9CA 1GG2B 1YFQA 2OJYA 2CNXA 2Z2PA 4IRZA 1K32A 3F3GA 5GMKn 3DXKC 3AL8B 3K71A 1TYEA 4IMMA 1VZ3A 1N6EA 3BG0A 4JD2C 5I5JA 3UVMA 3OKYB 3O4JA 4O02A 2OK4A 2EIBA 1NR0A 1XKSA 2YMUA 3NVQA 2B5LA 3OTTA 4A09B 2XE4A 1QFMA 2P9UC 3AH8B 4JSXC 3IUQA 5M61A 5IGOA 3RLMD 4G1EA 4E5ZA 4AEZA 1OMWB 4LGNA 4CY3A 3IKOA 5HE2B 3EI3B 4UM9A 4J79A 3IJEA 1L0QA 3RRMC 2J56H 3EQ9A 3RFGA 3EQ7A 4Z7NA 3MVDK 5EARA 4QRJA 5GXHA 3CIKB 3O4HA 1O6FA 5K19A 5IC7A 4J0WA 4FAVD 2H9MA 3IUNA 4CY2A 3ZWLB 2VZ3A 1VYHC 4O3UB 3EI4A 5C2VB 1SQJA 4PNKB 2I0TA 4CZVA 1E5TA 5EALA 4ESGA 2TRCB 1YR2A 4YVDA 4OZUA 4XYIA 4MMXA 3UVNA 4CZYA 1UOQA 5CXBB 1VZ2A 4GQBB 1FWXA 1PEVA 1Q47A 5EMJB 4AMYA 4Y7RA 1GOHA 3JROA 3UKUC 5C9ZB 3VA6A 3IIYA 3EQ8A 2J57G 5FLXg 3FM0A 4EWRA 3RN0D 4PSXB 5H14A 3IIWA 2P9PC 3C75H 1SHYB 5HE3B 3AL9A 4OWRA 4PSWB 1H2XA 5IT9g 2AGZA 4JHNA 2VDPA 5H17A 5EMMB 2QZPA 3NIGA 2AH1A 4NC4A 4NBMA 4PBYA 3FCSA 4WK0A 4A11B 4ES0A 4J78A 1PBYB 2UZXB 5CXCA 4BCCA 3SBPA 1MG2A 2HU5A 2J55H 5E6UA 3IJCA 1JOFA 2YBAA 4BUJC 3NIFA 4JXMA
chains in the Genus database with same CATH topology
3UVOA 3PXTD 5IJ8E 2AGYA 2GC4A 3OKYA 4CI1A 4CZXA 4X60B 2H9PA 4GGDA 4LG9A 3I7NA 4J86A 4KFMB 1JMXB 4E5ZB 4ZOXA 3FRXA 4J0XA 2O9KA 5KDOB 1XHMA 3SBRA 4QQEA 3A0FA 3EG6A 2BBKH 4J73A 3EI3A 2P9SC 3I7LA 4CC9A 3SMRA 4FWWA 1MDAH 4A2MA 3JZHA 2H9NA 2I0SA 4AOWA 5TF2A 3F3FA 4HDJA 3SLED 2AQ5A 4Z8LA 2HKRA 2G9AA 2HXCA 3I8CA 4ERZA 2P9NC 5EMLB 3EI2A 3F3PA 2W18A 2HJ4A 2IWKA 3EI4B 5SXMA 4PXWA 3L4MD 4A11A 3JZNA 2H3XA 1B9XA 2OVPB 4X3EA 4J81A 2AGXA 3C5MA 4LG8A 1TBGA 4UI9R 2B5MA 2Z2OA 3ODTA 3P4FA 5EM2B 3N0DA 3SFZA 2HJBA 3K26A 4J82A 4CI8A 4ZN4A 3PSCB 4A7JA 3BWSA 4XYHA 2HKMA 2CE8A 2CN3A 3CFSB 4J8BA 3I7OA 2CO0A 4O3TB 1N6DA 4J87A 2XL2A 3UVLA 2B5NA 5HE0B 1JMZB 3ORVD 1R5MA 4XEIC 1RI6A 5C2WB 3MMYA 4GMBA 3MKSB 2HESX 1OLZA 3PXSD 4JSNC 4GGCA 3PXWD 3EWEA 2AH0A 4GM3A 4JT6C 3NVXA 2EBSA 2B4EA 1XIPA 3FGBA 5B4WA 5THAA 3OL2A 5I5IA 3RMZD 3PE7A 4ZOZA 1MG3A 4PBZA 4ZOVA 5I5MA 4H5IA 3SJLD 2GNQA 5FKQA 1SQ9A 4CI2A 3EU7A 2H47A 2QXVA 4X63B 3MZKA 4GM9A 5EM2A 2H6NA 2AGLA 5JWZA 5FKRA 3DM0A 4J8GA 3UKRC 3JAMg 5TEEA 2PBIB 2I3TA 3PVUB 4NSXA 4PC0A 2QC5A 1QNIA 3OKTA 2P9LC 3GREA 3PSLA 3I89A 3UVKA 2YNOA 2YNNA 4K3ID 3J80g 3EMHA 5IJ7E 2I3SA 3HFQA 3EI2B 4FHLA 4A0AB 4J84A 4D6VA 3GFCA 4I79A 4TZ4A 2PM6B 1GP2B 3AFCA 5HE1B 3I7HA 4BH6A 2PM7B 3V9FA 4FA1D 4O9DA 4QL1A 2Z2NA 4J77A 5HQGA 4FA4D 3OL2B 3RN1D 3VGZA 1U2VC 3JZGA 4E54A 3I2NA 4G56B 1P22A 1TYQC 4K3JB 2IURA 4L3HD 4D0KA 2BCJB 5EAMA 3SN6B 3CFVA 1N6FA 5EAPA 2UZYB 3SXTD 2H6QA 4A08B 1ERJA 1B9YA 4X61B 2AGWA 3JRPA 3I8EA 3K27A 3SVWD 4L9OA 3C99A 3ULEC 5GSAA 3PVWB 4JSPC 4L1QD 3MZLA 2H13A 4CI3A 3J81g 3RFHA 3U4YA 3E0CA 3V7DB 4ZOYA 3OKWA 3DWLC 5IGQA 3SCYA 4Y5RD 3B7FA 4A2LA 2IUQA 2CE9A 2H9LA 2GC7A 3OW8A 3IJ1A 2OVQB 5EMKB 4O1QD 5TEFA 2HYEA 4L3GD 2H14A 4H5JA 5FA5B 3N0EA 4A0BB 3JPXA 3JB9L 2OVRB 3SWSD 2IWFA 4GGAA 5FQDA 2IUVA 4QT8A 3MXXA 4R7AB 5FKTA 4CY5A 3MKQA 3IJ0A 3W15A 1PI6A 4CY1A 3DXMC 5A2Qg 2IAAA 3BG1A 5K1CC 4FB1D 2PM9B 4E54B 4MK0B 2MTAH 4IA9A 4U1EI 1S4UX 1GXRA 2P9IC 5CYKA 2Q7QA 1NEXB 4N14A 2OK6A 4A08A 4A0AA 3I7PA 3EI1B 3NVNA 3VH0A 3I7KA 4GQ1A 2XYIA 3AL8A 3V5WB 2XL3A 4FA5D 4U7AA 3UR4A 2I0RA 1JJUB 2YNPA 5H1MA 4A09A 4JSVC 4GZ8A 5HYNB 2XU7A 4A0BA 2G99A 4ERYA 4O45A 3RSEC 1PGUA 1K8KC 5CXBA 4GQ2P 5AJAA 5AFU3 5TDHB 4ERQA 5FKSA 2H6KA 5GXIA 2PM9A 4JT5C 4GM8A 3L4OD 2H68A 2YB8B 1GOTB 3KRWB 2IUPA 3SBQA 1A0RB 4FA9D 4FAND 5CYKB 2P9KC 5FXYA 2CN2A 3SHFA 3DSMA 5AMSA 1U4CA 3EI1A 2CO0C 2OIZA 5CXCB 3KRXB 3C9CA 1GG2B 1YFQA 2OJYA 2CNXA 2Z2PA 1K32A 3F3GA 5GMKn 3DXKC 3AL8B 4IMMA 1N6EA 3BG0A 4JD2C 5I5JA 3UVMA 3OKYB 2OK4A 1NR0A 1XKSA 2YMUA 3NVQA 2B5LA 3OTTA 4A09B 2P9UC 3AH8B 4JSXC 5IGOA 3RLMD 4E5ZA 4AEZA 1OMWB 4LGNA 4CY3A 3IKOA 5HE2B 3EI3B 4J79A 1L0QA 3RRMC 2J56H 3RFGA 5EARA 4QRJA 5GXHA 3CIKB 5K19A 5IC7A 4J0WA 4FAVD 2H9MA 4CY2A 3ZWLB 1VYHC 4O3UB 3EI4A 5C2VB 1SQJA 4PNKB 2I0TA 4CZVA 5EALA 4ESGA 2TRCB 4YVDA 4OZUA 4XYIA 3UVNA 4CZYA 5CXBB 4GQBB 1FWXA 1PEVA 1Q47A 5EMJB 4Y7RA 3JROA 3UKUC 5C9ZB 3VA6A 3IIYA 2J57G 5FLXg 3FM0A 4EWRA 3RN0D 4PSXB 5H14A 3IIWA 2P9PC 3C75H 1SHYB 5HE3B 3AL9A 4OWRA 4PSWB 5IT9g 2AGZA 5H17A 5EMMB 2AH1A 4PBYA 4ES0A 4A11B 4J78A 1PBYB 2UZXB 5CXCA 3SBPA 1MG2A 2J55H 3IJCA 1JOFA 2YBAA 4BUJC 4BL0A 4JXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UVO A;  3PXT D;  5IJ8 E;  2AGY A;  2GC4 A;  3OKY A;  4CI1 A;  4CZX A;  4X60 B;  2H9P A;  4GGD A;  4LG9 A;  3I7N A;  4J86 A;  4KFM B;  1JMX B;  4E5Z B;  4ZOX A;  3FRX A;  4J0X A;  2O9K A;  5KDO B;  1XHM A;  3SBR A;  4QQE A;  3A0F A;  3EG6 A;  2BBK H;  4J73 A;  3EI3 A;  2P9S C;  3I7L A;  4CC9 A;  3SMR A;  4FWW A;  1MDA H;  4A2M A;  3JZH A;  2H9N A;  2I0S A;  4AOW A;  5TF2 A;  3F3F A;  4HDJ A;  3SLE D;  2AQ5 A;  4Z8L A;  2HKR A;  2G9A A;  2HXC A;  3I8C A;  4ERZ A;  2P9N C;  5EML B;  3EI2 A;  3F3P A;  2W18 A;  2HJ4 A;  2IWK A;  3EI4 B;  5SXM A;  4PXW A;  3L4M D;  4A11 A;  3JZN A;  2H3X A;  1B9X A;  2OVP B;  4X3E A;  4J81 A;  2AGX A;  3C5M A;  4LG8 A;  1TBG A;  4UI9 R;  2B5M A;  2Z2O A;  3ODT A;  3P4F A;  5EM2 B;  3N0D A;  3SFZ A;  2HJB A;  3K26 A;  4J82 A;  4CI8 A;  4ZN4 A;  3PSC B;  4A7J A;  3BWS A;  4XYH A;  2HKM A;  2CE8 A;  2CN3 A;  3CFS B;  4J8B A;  3I7O A;  2CO0 A;  4O3T B;  1N6D A;  4J87 A;  2XL2 A;  3UVL A;  2B5N A;  5HE0 B;  1JMZ B;  3ORV D;  1R5M A;  4XEI C;  1RI6 A;  5C2W B;  3MMY A;  4GMB A;  3MKS B;  2HES X;  1OLZ A;  3PXS D;  4JSN C;  4GGC A;  3PXW D;  3EWE A;  2AH0 A;  4GM3 A;  4JT6 C;  3NVX A;  2EBS A;  2B4E A;  1XIP A;  3FGB A;  5B4W A;  5THA A;  3OL2 A;  5I5I A;  3RMZ D;  3PE7 A;  4ZOZ A;  1MG3 A;  4PBZ A;  4ZOV A;  5I5M A;  4H5I A;  3SJL D;  2GNQ A;  5FKQ A;  1SQ9 A;  4CI2 A;  3EU7 A;  2H47 A;  2QXV A;  4X63 B;  3MZK A;  4GM9 A;  5EM2 A;  2H6N A;  2AGL A;  5JWZ A;  5FKR A;  3DM0 A;  4J8G A;  3UKR C;  3JAM g;  5TEE A;  2PBI B;  2I3T A;  3PVU B;  4NSX A;  4PC0 A;  2QC5 A;  1QNI A;  3OKT A;  2P9L C;  3GRE A;  3PSL A;  3I89 A;  3UVK A;  2YNO A;  2YNN A;  4K3I D;  3J80 g;  3EMH A;  5IJ7 E;  2I3S A;  3HFQ A;  3EI2 B;  4FHL A;  4A0A B;  4J84 A;  4D6V A;  3GFC A;  4I79 A;  4TZ4 A;  2PM6 B;  1GP2 B;  3AFC A;  5HE1 B;  3I7H A;  4BH6 A;  2PM7 B;  3V9F A;  4FA1 D;  4O9D A;  4QL1 A;  2Z2N A;  4J77 A;  5HQG A;  4FA4 D;  3OL2 B;  3RN1 D;  3VGZ A;  1U2V C;  3JZG A;  4E54 A;  3I2N A;  4G56 B;  1P22 A;  1TYQ C;  4K3J B;  2IUR A;  4L3H D;  4D0K A;  2BCJ B;  5EAM A;  3SN6 B;  3CFV A;  1N6F A;  5EAP A;  2UZY B;  3SXT D;  2H6Q A;  4A08 B;  1ERJ A;  1B9Y A;  4X61 B;  2AGW A;  3JRP A;  3I8E A;  3K27 A;  3SVW D;  4L9O A;  3C99 A;  3ULE C;  5GSA A;  3PVW B;  4JSP C;  4L1Q D;  3MZL A;  2H13 A;  4CI3 A;  3J81 g;  3RFH A;  3U4Y A;  3E0C A;  3V7D B;  4ZOY A;  3OKW A;  3DWL C;  5IGQ A;  3SCY A;  4Y5R D;  3B7F A;  4A2L A;  2IUQ A;  2CE9 A;  2H9L A;  2GC7 A;  3OW8 A;  3IJ1 A;  2OVQ B;  5EMK B;  4O1Q D;  5TEF A;  2HYE A;  4L3G D;  2H14 A;  4H5J A;  5FA5 B;  3N0E A;  4A0B B;  3JPX A;  3JB9 L;  2OVR B;  3SWS D;  2IWF A;  4GGA A;  5FQD A;  2IUV A;  4QT8 A;  3MXX A;  4R7A B;  5FKT A;  4CY5 A;  3MKQ A;  3IJ0 A;  3W15 A;  1PI6 A;  4CY1 A;  3DXM C;  5A2Q g;  2IAA A;  3BG1 A;  5K1C C;  4FB1 D;  2PM9 B;  4E54 B;  4MK0 B;  2MTA H;  4IA9 A;  4U1E I;  1S4U X;  1GXR A;  2P9I C;  5CYK A;  2Q7Q A;  1NEX B;  4N14 A;  2OK6 A;  4A08 A;  4A0A A;  3I7P A;  3EI1 B;  3NVN A;  3VH0 A;  3I7K A;  4GQ1 A;  2XYI A;  3AL8 A;  3V5W B;  2XL3 A;  4FA5 D;  4U7A A;  3UR4 A;  2I0R A;  1JJU B;  2YNP A;  5H1M A;  4A09 A;  4JSV C;  4GZ8 A;  5HYN B;  2XU7 A;  4A0B A;  2G99 A;  4ERY A;  4O45 A;  3RSE C;  1PGU A;  1K8K C;  5CXB A;  4GQ2 P;  5AJA A;  5AFU 3;  5TDH B;  4ERQ A;  5FKS A;  2H6K A;  5GXI A;  2PM9 A;  4JT5 C;  4GM8 A;  3L4O D;  2H68 A;  2YB8 B;  1GOT B;  3KRW B;  2IUP A;  3SBQ A;  1A0R B;  4FA9 D;  4FAN D;  5CYK B;  2P9K C;  5FXY A;  2CN2 A;  3SHF A;  3DSM A;  5AMS A;  1U4C A;  3EI1 A;  2CO0 C;  2OIZ A;  5CXC B;  3KRX B;  3C9C A;  1GG2 B;  1YFQ A;  2OJY A;  2CNX A;  2Z2P A;  1K32 A;  3F3G A;  5GMK n;  3DXK C;  3AL8 B;  4IMM A;  1N6E A;  3BG0 A;  4JD2 C;  5I5J A;  3UVM A;  3OKY B;  2OK4 A;  1NR0 A;  1XKS A;  2YMU A;  3NVQ A;  2B5L A;  3OTT A;  4A09 B;  2P9U C;  3AH8 B;  4JSX C;  5IGO A;  3RLM D;  4E5Z A;  4AEZ A;  1OMW B;  4LGN A;  4CY3 A;  3IKO A;  5HE2 B;  3EI3 B;  4J79 A;  1L0Q A;  3RRM C;  2J56 H;  3RFG A;  5EAR A;  4QRJ A;  5GXH A;  3CIK B;  5K19 A;  5IC7 A;  4J0W A;  4FAV D;  2H9M A;  4CY2 A;  3ZWL B;  1VYH C;  4O3U B;  3EI4 A;  5C2V B;  1SQJ A;  4PNK B;  2I0T A;  4CZV A;  5EAL A;  4ESG A;  2TRC B;  4YVD A;  4OZU A;  4XYI A;  3UVN A;  4CZY A;  5CXB B;  4GQB B;  1FWX A;  1PEV A;  1Q47 A;  5EMJ B;  4Y7R A;  3JRO A;  3UKU C;  5C9Z B;  3VA6 A;  3IIY A;  2J57 G;  5FLX g;  3FM0 A;  4EWR A;  3RN0 D;  4PSX B;  5H14 A;  3IIW A;  2P9P C;  3C75 H;  1SHY B;  5HE3 B;  3AL9 A;  4OWR A;  4PSW B;  5IT9 g;  2AGZ A;  5H17 A;  5EMM B;  2AH1 A;  4PBY A;  4ES0 A;  4A11 B;  4J78 A;  1PBY B;  2UZX B;  5CXC A;  3SBP A;  1MG2 A;  2J55 H;  3IJC A;  1JOF A;  2YBA A;  4BUJ C;  4BL0 A;  4JXM A; 
#chains in the Genus database with same CATH topology
 3UVO A;  3PXT D;  5IJ8 E;  4NEN A;  2AGY A;  2GC4 A;  3OKY A;  4CI1 A;  4CZX A;  4X60 B;  2H9P A;  4GGD A;  3V4P A;  4LG9 A;  3I7N A;  3NID A;  4J86 A;  4NAA A;  3V4V A;  4KFM B;  1JMX B;  4E5Z B;  5M5U A;  4ZOX A;  3FRX A;  4J0X A;  2O9K A;  5KDO B;  1XHM A;  3O4I A;  3SBR A;  4QQE A;  1H2Z A;  3A0F A;  3EG6 A;  3ZDY A;  2BBK H;  4J73 A;  3EI3 A;  2VC2 A;  2P9S C;  3I7L A;  3IVM A;  4CC9 A;  3SMR A;  4FWW A;  1L5G A;  4DNW A;  1MDA H;  4A2M A;  3JZH A;  5M5T A;  2H9N A;  2I0S A;  4AOW A;  5TF2 A;  4DNU A;  3F3F A;  4HDJ A;  3SLE D;  2AQ5 A;  4Z8L A;  2EID A;  2HKR A;  2G9A A;  2HXC A;  3I8C A;  4ERZ A;  2P9N C;  5EML B;  2XDW A;  3EI2 A;  3VI3 A;  1M1X A;  3F3P A;  2W18 A;  5FFO A;  3KCI A;  2HJ4 A;  1K3I A;  2IWK A;  3EI4 B;  4BCB A;  5M5V A;  5SXM A;  3QHY B;  4PXW A;  3L4M D;  4A11 A;  1E8M A;  3JZN A;  1H2W A;  2H3X A;  1B9X A;  2OVP B;  4X3E A;  4AMZ A;  4J81 A;  2AGX A;  3C5M A;  4LG8 A;  1TBG A;  4UI9 R;  2B5M A;  2Z2O A;  3ODT A;  3P4F A;  5EM2 B;  3N0D A;  3SFZ A;  2HJB A;  3K26 A;  4J82 A;  4CI8 A;  4ZN4 A;  3PSC B;  4A7J A;  3BWS A;  4XYH A;  3QI0 A;  5M5R A;  3ZDX A;  2HKM A;  2CE8 A;  2CN3 A;  5C86 A;  3CFS B;  4J8B A;  3I7O A;  2CO0 A;  4O3T B;  4D9S A;  4Z7Q A;  1N6D A;  4J87 A;  2XL2 A;  3UVL A;  2B5N A;  5HE0 B;  3MUO A;  3ZE2 A;  1JMZ B;  3ORV D;  4G1M A;  1R5M A;  4XEI C;  4BP8 A;  1RI6 A;  5C2W B;  3MMY A;  4GMB A;  4JHP C;  3IUM A;  3MKS B;  1C9L A;  1OLZ A;  2HES X;  3PXS D;  4GGC A;  4JSN C;  5M5S A;  3PXW D;  3ZE0 A;  3EWE A;  1A12 A;  5E6R A;  2AH0 A;  4GM3 A;  3GC3 B;  3ZE1 A;  4JT6 C;  3NVX A;  2EBS A;  2B4E A;  1XIP A;  3FGB A;  5B4W A;  5THA A;  3OL2 A;  5I5I A;  3RMZ D;  3PE7 A;  4ZOZ A;  1MG3 A;  1O6G A;  4PBZ A;  2EIE A;  4ZOV A;  5I5M A;  4H5I A;  3SJL D;  2JKX A;  1U8C A;  2GNQ A;  5FKQ A;  2HU7 A;  1SQ9 A;  4CI2 A;  1GOG A;  3EU7 A;  2H47 A;  2QXV A;  4X63 B;  3MZK A;  4GM9 A;  5EM2 A;  2H6N A;  2AGL A;  5JWZ A;  5FKR A;  4AN1 A;  3DM0 A;  4J8G A;  1I2M B;  4MMZ A;  3UKR C;  3JAM g;  5TEE A;  2PBI B;  2I3T A;  3PVU B;  4NSX A;  4PC0 A;  2QC5 A;  1QNI A;  3OKT A;  1UTC A;  2P9L C;  3GRE A;  3PSL A;  3MUN A;  3I89 A;  4DNV A;  3UVK A;  2YNO A;  2YNN A;  4K3I D;  1H2Y A;  3J80 g;  3EMH A;  5IJ7 E;  2I3S A;  3HFQ A;  3EI2 B;  1UOO A;  4FHL A;  4J84 A;  4D6V A;  4A0A B;  3GFC A;  4I79 A;  4TZ4 A;  2PM6 B;  1GP2 B;  3T3M A;  3AFC A;  3FCU A;  2VZ1 A;  5FFG A;  5HE1 B;  3I7H A;  4BH6 A;  2PM7 B;  2VDL A;  3T3P A;  3V9F A;  4FA1 D;  4O9D A;  2BKL A;  4QL1 A;  2Z2N A;  2QR5 A;  1JTD B;  4J77 A;  5HQG A;  4FA4 D;  4MMY A;  2WQ8 A;  3OL2 B;  3RN1 D;  3VGZ A;  1U2V C;  3JZG A;  4E54 A;  3I2N A;  4G56 B;  1P22 A;  1TYQ C;  4K3J B;  2IUR A;  4L3H D;  4O2W A;  4D0K A;  2BCJ B;  5EAM A;  3SN6 B;  3CFV A;  1N6F A;  5EAP A;  2UZY B;  3SXT D;  2H6Q A;  4A08 B;  1ERJ A;  1B9Y A;  4RE5 A;  4X61 B;  2AGW A;  3JRP A;  5C92 A;  3I8E A;  3K27 A;  3SVW D;  1QFS A;  4L9O A;  3C99 A;  3GD1 I;  3ULE C;  3PVW B;  4JSP C;  4L1Q D;  3MZL A;  2H13 A;  4CI3 A;  5GSA A;  3IUR A;  3J81 g;  3RFH A;  3U4Y A;  3E0C A;  3V7D B;  4ZOY A;  3OKW A;  3DWL C;  5IGQ A;  2XZG A;  3SCY A;  4Y5R D;  3B7F A;  4A2L A;  2IUQ A;  2CE9 A;  2H9L A;  3K72 A;  2GC7 A;  3OW8 A;  3IJ1 A;  2OVQ B;  5EMK B;  4O1Q D;  5HDB A;  5TEF A;  2HYE A;  4L3G D;  2H14 A;  4H5J A;  5FA5 B;  3N0E A;  1JV2 A;  4A0B B;  2VDM A;  3JPX A;  3JB9 L;  2OVR B;  1UOP A;  2IWF A;  4GGA A;  5FQD A;  3SWS D;  2IUV A;  4QT8 A;  3MXX A;  4R7A B;  5FKT A;  4CY5 A;  3MKQ A;  2VDR A;  3IJ0 A;  3W15 A;  1PI6 A;  4CY1 A;  3DXM C;  5A2Q g;  4L1M A;  2IAA A;  1E8N A;  3ZDZ A;  4AN0 A;  4G55 A;  3BG1 A;  5K1C C;  4QAM A;  4FB1 D;  2PM9 B;  4E54 B;  4WJK A;  4MK0 B;  2MTA H;  4IA9 A;  4U1E I;  2HU8 A;  4BCD A;  1S4U X;  1GXR A;  3IUJ A;  3IUL A;  2P9I C;  5CYK A;  2EIC A;  2Q7Q A;  1NEX B;  1VE6 A;  4N14 A;  2OK6 A;  4A08 A;  4A0A A;  1BPO A;  3I7P A;  3EI1 B;  3NVN A;  3VH0 A;  3I7K A;  4GQ1 A;  2XYI A;  1GOF A;  3AL8 A;  2VDO A;  3V5W B;  2XL3 A;  3DDU A;  4FA5 D;  4U7A A;  3UR4 A;  2I0R A;  4BP9 A;  1JJU B;  2VDQ A;  4UM8 A;  4AX4 A;  2YNP A;  3O4G A;  4BL0 A;  5H1M A;  4A09 A;  4JSV C;  4GZ8 A;  5HYN B;  1T2X A;  4Z7O A;  2XU7 A;  4RE6 A;  4A0B A;  2G99 A;  4ERY A;  4O45 A;  3RSE C;  1PGU A;  1K8K C;  4WK2 A;  5E6S A;  5CXB A;  3K6S A;  4GQ2 P;  5AJA A;  5AFU 3;  4WK4 A;  5TDH B;  4ERQ A;  5FKS A;  2H6K A;  3OF7 A;  1C9I A;  5GXI A;  1VE7 A;  2PM9 A;  3VI4 A;  4JT5 C;  2VDN A;  4GM8 A;  3L4O D;  2H68 A;  2YB8 B;  2VDK A;  1GOT B;  3KRW B;  2IUP A;  3SBQ A;  1A0R B;  4FA9 D;  4FAN D;  5CYK B;  2P9K C;  5FXY A;  2CN2 A;  3SHF A;  3DSM A;  5AMS A;  1U4C A;  3EI1 A;  2CO0 C;  2OIZ A;  5CXC B;  3KRX B;  3C9C A;  1GG2 B;  1YFQ A;  2OJY A;  2CNX A;  2Z2P A;  4IRZ A;  1K32 A;  3F3G A;  5GMK n;  3DXK C;  3AL8 B;  3K71 A;  1TYE A;  4IMM A;  1VZ3 A;  1N6E A;  3BG0 A;  4JD2 C;  5I5J A;  3UVM A;  3OKY B;  3O4J A;  4O02 A;  2OK4 A;  2EIB A;  1NR0 A;  1XKS A;  2YMU A;  3NVQ A;  2B5L A;  3OTT A;  4A09 B;  2XE4 A;  1QFM A;  2P9U C;  3AH8 B;  4JSX C;  3IUQ A;  5M61 A;  5IGO A;  3RLM D;  4G1E A;  4E5Z A;  4AEZ A;  1OMW B;  4LGN A;  4CY3 A;  3IKO A;  5HE2 B;  3EI3 B;  4UM9 A;  4J79 A;  3IJE A;  1L0Q A;  3RRM C;  2J56 H;  3EQ9 A;  3RFG A;  3EQ7 A;  4Z7N A;  3MVD K;  5EAR A;  4QRJ A;  5GXH A;  3CIK B;  3O4H A;  1O6F A;  5K19 A;  5IC7 A;  4J0W A;  4FAV D;  2H9M A;  3IUN A;  4CY2 A;  3ZWL B;  2VZ3 A;  1VYH C;  4O3U B;  3EI4 A;  5C2V B;  1SQJ A;  4PNK B;  2I0T A;  4CZV A;  1E5T A;  5EAL A;  4ESG A;  2TRC B;  1YR2 A;  4YVD A;  4OZU A;  4XYI A;  4MMX A;  3UVN A;  4CZY A;  1UOQ A;  5CXB B;  1VZ2 A;  4GQB B;  1FWX A;  1PEV A;  1Q47 A;  5EMJ B;  4AMY A;  4Y7R A;  1GOH A;  3JRO A;  3UKU C;  5C9Z B;  3VA6 A;  3IIY A;  3EQ8 A;  2J57 G;  5FLX g;  3FM0 A;  4EWR A;  3RN0 D;  4PSX B;  5H14 A;  3IIW A;  2P9P C;  3C75 H;  1SHY B;  5HE3 B;  3AL9 A;  4OWR A;  4PSW B;  1H2X A;  5IT9 g;  2AGZ A;  4JHN A;  2VDP A;  5H17 A;  5EMM B;  2QZP A;  3NIG A;  2AH1 A;  4NC4 A;  4NBM A;  4PBY A;  3FCS A;  4WK0 A;  4A11 B;  4ES0 A;  4J78 A;  1PBY B;  2UZX B;  5CXC A;  4BCC A;  3SBP A;  1MG2 A;  2HU5 A;  2J55 H;  5E6U A;  3IJC A;  1JOF A;  2YBA A;  4BUJ C;  3NIF A;  4JXM A; 
#chains in the Genus database with same CATH homology
 3UVO A;  3PXT D;  5IJ8 E;  2AGY A;  2GC4 A;  3OKY A;  4CI1 A;  4CZX A;  4X60 B;  2H9P A;  4GGD A;  4LG9 A;  3I7N A;  4J86 A;  4KFM B;  1JMX B;  4E5Z B;  4ZOX A;  3FRX A;  4J0X A;  2O9K A;  5KDO B;  1XHM A;  3SBR A;  4QQE A;  3A0F A;  3EG6 A;  2BBK H;  4J73 A;  3EI3 A;  2P9S C;  3I7L A;  4CC9 A;  3SMR A;  4FWW A;  1MDA H;  4A2M A;  3JZH A;  2H9N A;  2I0S A;  4AOW A;  5TF2 A;  3F3F A;  4HDJ A;  3SLE D;  2AQ5 A;  4Z8L A;  2HKR A;  2G9A A;  2HXC A;  3I8C A;  4ERZ A;  2P9N C;  5EML B;  3EI2 A;  3F3P A;  2W18 A;  2HJ4 A;  2IWK A;  3EI4 B;  5SXM A;  4PXW A;  3L4M D;  4A11 A;  3JZN A;  2H3X A;  1B9X A;  2OVP B;  4X3E A;  4J81 A;  2AGX A;  3C5M A;  4LG8 A;  1TBG A;  4UI9 R;  2B5M A;  2Z2O A;  3ODT A;  3P4F A;  5EM2 B;  3N0D A;  3SFZ A;  2HJB A;  3K26 A;  4J82 A;  4CI8 A;  4ZN4 A;  3PSC B;  4A7J A;  3BWS A;  4XYH A;  2HKM A;  2CE8 A;  2CN3 A;  3CFS B;  4J8B A;  3I7O A;  2CO0 A;  4O3T B;  1N6D A;  4J87 A;  2XL2 A;  3UVL A;  2B5N A;  5HE0 B;  1JMZ B;  3ORV D;  1R5M A;  4XEI C;  1RI6 A;  5C2W B;  3MMY A;  4GMB A;  3MKS B;  2HES X;  1OLZ A;  3PXS D;  4JSN C;  4GGC A;  3PXW D;  3EWE A;  2AH0 A;  4GM3 A;  4JT6 C;  3NVX A;  2EBS A;  2B4E A;  1XIP A;  3FGB A;  5B4W A;  5THA A;  3OL2 A;  5I5I A;  3RMZ D;  3PE7 A;  4ZOZ A;  1MG3 A;  4PBZ A;  4ZOV A;  5I5M A;  4H5I A;  3SJL D;  2GNQ A;  5FKQ A;  1SQ9 A;  4CI2 A;  3EU7 A;  2H47 A;  2QXV A;  4X63 B;  3MZK A;  4GM9 A;  5EM2 A;  2H6N A;  2AGL A;  5JWZ A;  5FKR A;  3DM0 A;  4J8G A;  3UKR C;  3JAM g;  5TEE A;  2PBI B;  2I3T A;  3PVU B;  4NSX A;  4PC0 A;  2QC5 A;  1QNI A;  3OKT A;  2P9L C;  3GRE A;  3PSL A;  3I89 A;  3UVK A;  2YNO A;  2YNN A;  4K3I D;  3J80 g;  3EMH A;  5IJ7 E;  2I3S A;  3HFQ A;  3EI2 B;  4FHL A;  4A0A B;  4J84 A;  4D6V A;  3GFC A;  4I79 A;  4TZ4 A;  2PM6 B;  1GP2 B;  3AFC A;  5HE1 B;  3I7H A;  4BH6 A;  2PM7 B;  3V9F A;  4FA1 D;  4O9D A;  4QL1 A;  2Z2N A;  4J77 A;  5HQG A;  4FA4 D;  3OL2 B;  3RN1 D;  3VGZ A;  1U2V C;  3JZG A;  4E54 A;  3I2N A;  4G56 B;  1P22 A;  1TYQ C;  4K3J B;  2IUR A;  4L3H D;  4D0K A;  2BCJ B;  5EAM A;  3SN6 B;  3CFV A;  1N6F A;  5EAP A;  2UZY B;  3SXT D;  2H6Q A;  4A08 B;  1ERJ A;  1B9Y A;  4X61 B;  2AGW A;  3JRP A;  3I8E A;  3K27 A;  3SVW D;  4L9O A;  3C99 A;  3ULE C;  5GSA A;  3PVW B;  4JSP C;  4L1Q D;  3MZL A;  2H13 A;  4CI3 A;  3J81 g;  3RFH A;  3U4Y A;  3E0C A;  3V7D B;  4ZOY A;  3OKW A;  3DWL C;  5IGQ A;  3SCY A;  4Y5R D;  3B7F A;  4A2L A;  2IUQ A;  2CE9 A;  2H9L A;  2GC7 A;  3OW8 A;  3IJ1 A;  2OVQ B;  5EMK B;  4O1Q D;  5TEF A;  2HYE A;  4L3G D;  2H14 A;  4H5J A;  5FA5 B;  3N0E A;  4A0B B;  3JPX A;  3JB9 L;  2OVR B;  3SWS D;  2IWF A;  4GGA A;  5FQD A;  2IUV A;  4QT8 A;  3MXX A;  4R7A B;  5FKT A;  4CY5 A;  3MKQ A;  3IJ0 A;  3W15 A;  1PI6 A;  4CY1 A;  3DXM C;  5A2Q g;  2IAA A;  3BG1 A;  5K1C C;  4FB1 D;  2PM9 B;  4E54 B;  4MK0 B;  2MTA H;  4IA9 A;  4U1E I;  1S4U X;  1GXR A;  2P9I C;  5CYK A;  2Q7Q A;  1NEX B;  4N14 A;  2OK6 A;  4A08 A;  4A0A A;  3I7P A;  3EI1 B;  3NVN A;  3VH0 A;  3I7K A;  4GQ1 A;  2XYI A;  3AL8 A;  3V5W B;  2XL3 A;  4FA5 D;  4U7A A;  3UR4 A;  2I0R A;  1JJU B;  2YNP A;  5H1M A;  4A09 A;  4JSV C;  4GZ8 A;  5HYN B;  2XU7 A;  4A0B A;  2G99 A;  4ERY A;  4O45 A;  3RSE C;  1PGU A;  1K8K C;  5CXB A;  4GQ2 P;  5AJA A;  5AFU 3;  5TDH B;  4ERQ A;  5FKS A;  2H6K A;  5GXI A;  2PM9 A;  4JT5 C;  4GM8 A;  3L4O D;  2H68 A;  2YB8 B;  1GOT B;  3KRW B;  2IUP A;  3SBQ A;  1A0R B;  4FA9 D;  4FAN D;  5CYK B;  2P9K C;  5FXY A;  2CN2 A;  3SHF A;  3DSM A;  5AMS A;  1U4C A;  3EI1 A;  2CO0 C;  2OIZ A;  5CXC B;  3KRX B;  3C9C A;  1GG2 B;  1YFQ A;  2OJY A;  2CNX A;  2Z2P A;  1K32 A;  3F3G A;  5GMK n;  3DXK C;  3AL8 B;  4IMM A;  1N6E A;  3BG0 A;  4JD2 C;  5I5J A;  3UVM A;  3OKY B;  2OK4 A;  1NR0 A;  1XKS A;  2YMU A;  3NVQ A;  2B5L A;  3OTT A;  4A09 B;  2P9U C;  3AH8 B;  4JSX C;  5IGO A;  3RLM D;  4E5Z A;  4AEZ A;  1OMW B;  4LGN A;  4CY3 A;  3IKO A;  5HE2 B;  3EI3 B;  4J79 A;  1L0Q A;  3RRM C;  2J56 H;  3RFG A;  5EAR A;  4QRJ A;  5GXH A;  3CIK B;  5K19 A;  5IC7 A;  4J0W A;  4FAV D;  2H9M A;  4CY2 A;  3ZWL B;  1VYH C;  4O3U B;  3EI4 A;  5C2V B;  1SQJ A;  4PNK B;  2I0T A;  4CZV A;  5EAL A;  4ESG A;  2TRC B;  4YVD A;  4OZU A;  4XYI A;  3UVN A;  4CZY A;  5CXB B;  4GQB B;  1FWX A;  1PEV A;  1Q47 A;  5EMJ B;  4Y7R A;  3JRO A;  3UKU C;  5C9Z B;  3VA6 A;  3IIY A;  2J57 G;  5FLX g;  3FM0 A;  4EWR A;  3RN0 D;  4PSX B;  5H14 A;  3IIW A;  2P9P C;  3C75 H;  1SHY B;  5HE3 B;  3AL9 A;  4OWR A;  4PSW B;  5IT9 g;  2AGZ A;  5H17 A;  5EMM B;  2AH1 A;  4PBY A;  4ES0 A;  4A11 B;  4J78 A;  1PBY B;  2UZX B;  5CXC A;  3SBP A;  1MG2 A;  2J55 H;  3IJC A;  1JOF A;  2YBA A;  4BUJ C;  4BL0 A;  4JXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...