4UI9R

Atomic structure of the human anaphase-promoting complex
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
452
structure length
387
Chain Sequence
SKHGDRFIPSRAGANWSVNFHRINENGLAYSALLKNELLGAGIEKVQKGLFTYSLSPYSLSPVSNKSQKLLRSSKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWNAEQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSLSPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSVSVLNLFTRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANAPHASE-PROMOTING COMPLEX SUBUNIT 1
publication title Atomic Structure of the Apc and its Mechanism of Protein Ubiquitination
pubmed doi rcsb
molecule tags Cell cycle
total genus 77
structure length 387
sequence length 452
ec nomenclature
pdb deposition date 2015-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00400 WD40 WD domain, G-beta repeat
R PF12894 ANAPC4_WD40 Anaphase-promoting complex subunit 4 WD40 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4ui9R01
1N6FA 4CZVA 2AGWA 5H1MA 2OVRB 4CY1A 2YNPA 3GFCA 3V7DB 4CI2A 2B5MA 4U1EI 2HKRA 3EI3B 5HE0B 4CZYA 5CXCA 4X3EA 1YFQA 3OKYA 4L3GD 3UVKA 3I7NA 2IUPA 3SBRA 3DWLC 3RN1D 4JSVC 4J78A 4IMMA 3BG0A 1R5MA 2IAAA 3UVLA 5C2WB 4K3JB 5EALA 2OJYA 4ESGA 5HYNB 3JZGA 2P9UC 5FXYA 3OKWA 1A0RB 2CN3A 2AGYA 2OK6A 2Z2PA 3JROA 3SCYA 3PVUB 3DSMA 1NR0A 2I0RA 4ZOXA 4FWWA 1QNIA 1VYHC 4A0BB 2G9AA 5EAPA 3RSEC 3F3GA 3N0DA 5TF2A 3SBPA 2G99A 1OLZA 2HYEA 3PVWB 2IURA 2J57G 3PXTD 1TBGA 1JMZB 5CXBB 2HJBA 2J56H 4XEIC 1JMXB 3KRXB 3P4FA 3VGZA 1GG2B 3L4MD 4R7AB 4XYIA 3OKTA 4JXMA 4TZ4A 5CYKB 1GP2B 3OL2A 4JSNC 4LG8A 3I7LA 3V5WB 2CE8A 5TEFA 5GMKn 2PM7B 3I8CA 4A09B 4BH6A 4PSXB 4CY5A 5IGQA 1L0QA 5FA5B 3F3PA 2H6QA 4YVDA 4OZUA 4CI3A 3RFHA 3SXTD 2UZXB 4JSPC 3SJLD 1K8KC 3ODTA 5HE2B 2HJ4A 4CI1A 4PNKB 2I3TA 1P22A 3MZKA 4MK0B 4E54A 5AMSA 4AOWA 4A0AB 3CFVA 3EG6A 3I89A 2PBIB 5EMJB 5KDOB 2IWKA 2H9PA 4ZOVA 3NVNA 5HQGA 4A11A 2IUVA 1GXRA 3RLMD 4O3TB 2H47A 3CFSB 2H6KA 2YNOA 2XYIA 2OK4A 5I5MA 3UKUC 2J55H 5EMLB 3IIWA 3EI2A 4PBZA 2PM6B 4UI9R 4A11B 2IUQA 4QRJA 2GC7A 2HXCA 1SQJA 3PXWD 4ES0A 4FHLA 3ZWLB 4GMBA 5GXIA 1Q47A 2H3XA 5EM2B 4NSXA 3SWSD 2B4EA 2CNXA 2I3SA 3NVQA 3EI2B 4A0BA 2H14A 2H6NA 3E0CA 3FM0A 3UKRC 2P9SC 2H9NA 3N0EA 4H5IA 3I2NA 3SLED 4PBYA 4AEZA 4GGAA 5AJAA 4X63B 5H17A 3I7OA 1RI6A 5CXBA 3IJ0A 4J77A 3AFCA 4J73A 3PSCB 4HDJA 3DM0A 3JRPA 4K3ID 2HKMA 5C9ZB 5CYKA 1PI6A 2UZYB 3IJCA 3JPXA 3EMHA 3FRXA 5THAA 1MG3A 4PC0A 4I79A 3K27A 2H13A 3C75H 2AH0A 2QXVA 1MDAH 3C9CA 4CC9A 5FLXg 4A09A 4FA9D 2H9MA 3SHFA 5IC7A 2CE9A 3AL8B 1SQ9A 3C5MA 3F3FA 1B9YA 4JT6C 4OWRA 4FAVD 4J79A 2O9KA 2H68A 3BG1A 5EMMB 3RMZD 4LG9A 3SMRA 5C2VB 3IJ1A 3PE7A 5A2Qg 4X60B 2OVQB 3MKQA 4A0AA 5K19A 4GM8A 5HE3B 4A08B 4FA5D 3SFZA 1FWXA 2B5NA 2P9NC 4IA9A 3BWSA 2W18A 1U2VC 3IKOA 3FGBA 2PM9B 5GSAA 5IJ7E 1ERJA 3OTTA 4BL0A 4BUJC 2AGXA 4J84A 3IIYA 2YMUA 3MKSB 5FKTA 1XHMA 4L3HD 1PGUA 4PXWA 3UVMA 3V9FA 4D0KA 4EWRA 1PBYB 1N6EA 3SBQA 3KRWB 2AQ5A 3AL9A 3EU7A 2B5LA 5EARA 5EM2A 1JOFA 2OVPB 2XL3A 3HFQA 3GREA 4PSWB 5FQDA 1TYQC 2YNNA 3VA6A 3VH0A 4FAND 4E5ZB 4X61B 3I7PA 5I5JA 3UVOA 4A2LA 2AGLA 5GXHA 1U4CA 2OIZA 3NVXA 4J81A 3CIKB 1K32A 1OMWB 2Z2NA 4XYHA 4CY3A 2Z2OA 4KFMB 5FKQA 3PXSD 4FB1D 3EI4A 1XIPA 2GC4A 3ORVD 2CO0A 4QL1A 1GOTB 4GM9A 4J87A 4L9OA 5B4WA 3RFGA 1XKSA 5EAMA 4O9DA 4O3UB 3EI1B 2BBKH 2YBAA 3JZNA 2CN2A 3I8EA 5I5IA 3J80g 3EI4B 4JSXC 4QQEA 4J8GA 4GM3A 4Y5RD 4J0XA 4U7AA 3AL8A 5CXCB 4ZOZA 3OKYB 3AH8B 4GQ1A 4ERQA 1JJUB 1MG2A 4J82A 4A2MA 2P9LC 2H9LA 3SN6B 2YB8B 2BCJB 3JAMg 2HESX 3OW8A 3J81g 5JWZA 3A0FA 5IGOA 5FKRA 4O1QD 2IWFA 2XU7A 5TDHB 1NEXB 4H5JA 4A08A 4N14A 3JB9L 4CI8A 2I0SA 4JD2C 3MMYA 2Q7QA 4J0WA 3UVNA 1N6DA 2PM9A 4Y7RA 5EMKB 4ERZA 4QT8A 2AH1A 4GZ8A 2XL2A 4A7JA 1B9XA 5IJ8E 4Z8LA 3K26A 4FA4D 4G56B 3U4YA 1SHYB 3DXMC 3DXKC 4ZN4A 3MZLA 3UR4A 2P9KC 5SXMA 4ZOYA 3PSLA 4GGDA 4GQBB 4GGCA 2I0TA 4O45A 5IT9g 5K1CC 5H14A 3I7KA 4GQ2P 2TRCB 3W15A 4CZXA 3RN0D 3L4OD 4FA1D 4LGNA 3MXXA 3OL2B 3B7FA 4E5ZA 3ULEC 4CY2A 2GNQA 4L1QD 5FKSA 3EWEA 4D6VA 2CO0C 5AFU3 5HE1B 3JZHA 4JT5C 4J8BA 2QC5A 2P9PC 4J86A 2EBSA 1S4UX 3EI3A 3SVWD 3RRMC 3C99A 3I7HA 2MTAH 2P9IC 1PEVA 4ERYA 5TEEA 4E54B 2AGZA 3EI1A
chains in the Genus database with same CATH superfamily
1N6FA 4O2WA 4CZVA 2AGWA 5H1MA 2OVRB 4CY1A 2YNPA 3GFCA 3V7DB 3ZDYA 2B5MA 4CI2A 4U1EI 2HKRA 3EI3B 5HE0B 4CZYA 5CXCA 4X3EA 1YFQA 3OKYA 4L3GD 2XE4A 2JKXA 3UVKA 3I7NA 2IUPA 1H2ZA 3DWLC 3RN1D 4JSVC 3SBRA 4J78A 4NC4A 3O4HA 3IULA 4IMMA 3BG0A 3K71A 1R5MA 2IAAA 3UVLA 3O4JA 5C2WB 4K3JB 3ZDXA 5EALA 2OJYA 4ESGA 5HYNB 4AMYA 3JZGA 2P9UC 5FXYA 3O4GA 3OKWA 1A0RB 2CN3A 2AGYA 1M1XA 2OK6A 2Z2PA 3JROA 3SCYA 2VDQA 3DDUA 3DSMA 1NR0A 2I0RA 3PVUB 4ZOXA 4FWWA 3OF7A 1QNIA 1VYHC 4A0BB 2G9AA 5EAPA 3RSEC 3F3GA 3N0DA 5TF2A 3SBPA 2G99A 1OLZA 2HYEA 3PVWB 2IURA 2J57G 3PXTD 4AN1A 1TBGA 1JMZB 4Z7OA 5CXBB 2HJBA 3IJEA 2J56H 4XEIC 1JMXB 3KRXB 3P4FA 3VGZA 1GG2B 5C92A 3L4MD 4R7AB 4XYIA 3OKTA 4DNUA 4JXMA 4TZ4A 5CYKB 2EIDA 5M5TA 3GC3B 1GP2B 3FCSA 3OL2A 4JSNC 4LG8A 3I7LA 3V5WB 1JTDB 2CE8A 5TEFA 5GMKn 1E8NA 2PM7B 3I8CA 4A09B 4G1MA 4BH6A 4PSXB 5M5SA 4CY5A 4RE5A 5IGQA 4BP8A 1L0QA 5FA5B 3F3PA 2H6QA 3NIFA 5C86A 4YVDA 4OZUA 4CI3A 3RFHA 4MMXA 3SXTD 1O6FA 2UZXB 4JSPC 3SJLD 1K8KC 3ODTA 4JHNA 5HE2B 2HJ4A 4CI1A 4PNKB 2I3TA 3T3MA 1P22A 3MZKA 4BCCA 4MK0B 4E54A 5AMSA 4AOWA 3FCUA 4A0AB 5M5UA 3CFVA 3EG6A 3I89A 2PBIB 5EMJB 5KDOB 2IWKA 2H9PA 2QR5A 4ZOVA 3NVNA 5HQGA 4A11A 2IUVA 3ZDZA 1GXRA 3RLMD 3K72A 4O3TB 2H47A 1VE7A 5M5VA 3CFSB 5E6RA 4O02A 1BPOA 2H6KA 2EICA 2YNOA 2XYIA 3IUJA 2OK4A 5I5MA 3UKUC 2J55H 5EMLB 3IIWA 3EI2A 4PBZA 2PM6B 4UI9R 4A11B 2IUQA 4QRJA 2VDPA 2GC7A 2HXCA 1SQJA 3PXWD 4ES0A 4FHLA 3ZWLB 3GD1I 4GMBA 5GXIA 3MUOA 1Q47A 2H3XA 5EM2B 3K6SA 4NSXA 3SWSD 2B4EA 2CNXA 2I3SA 3NVQA 3VI4A 3EI2B 4BCDA 4A0BA 2H14A 2H6NA 3NIGA 3E0CA 3FM0A 2VDKA 3UKRC 2P9SC 1YR2A 4NAAA 2H9NA 3N0EA 4BP9A 4H5IA 2BKLA 3I2NA 4Z7QA 3SLED 3MUNA 4PBYA 4AEZA 4GGAA 3V4VA 4NBMA 5AJAA 4X63B 5H17A 3I7OA 1RI6A 5CXBA 3IJ0A 4J77A 2VC2A 1A12A 3AFCA 3ZE0A 4J73A 4G55A 3PSCB 4HDJA 3DM0A 3JRPA 4K3ID 2HKMA 5C9ZB 5CYKA 1PI6A 3NIDA 2UZYB 1UTCA 3IUNA 3IJCA 1QFMA 2HU7A 3JPXA 1TYEA 3EMHA 2EIBA 3FRXA 1MG3A 5THAA 4PC0A 4I79A 4BCBA 3K27A 2H13A 4AMZA 3C75H 2AH0A 2QXVA 1MDAH 3C9CA 5E6SA 4CC9A 5FLXg 4AN0A 4A09A 4FA9D 2H9MA 3SHFA 5IC7A 2CE9A 2VDMA 3AL8B 4DNVA 1VZ2A 1SQ9A 3C5MA 3F3FA 1B9YA 4JT6C 4OWRA 4FAVD 4J79A 2O9KA 2H68A 3BG1A 4WJKA 5EMMB 3RMZD 1QFSA 4LG9A 3SMRA 5C2VB 3IJ1A 3PE7A 5A2Qg 3MVDK 4X60B 2OVQB 4WK2A 3MKQA 4A0AA 4L1MA 4GM8A 5HE3B 5K19A 4A08B 4FA5D 3SFZA 1FWXA 1UOPA 2B5NA 2P9NC 4IA9A 3KCIA 5FFOA 3BWSA 4Z7NA 2W18A 1U2VC 3IKOA 3FGBA 2PM9B 4RE6A 5GSAA 5IJ7E 1ERJA 3OTTA 4BL0A 4BUJC 2AGXA 4J84A 3IIYA 2YMUA 3MKSB 4UM9A 5FKTA 3IUQA 1XHMA 4L3HD 1PGUA 1JV2A 4PXWA 3UVMA 3V9FA 4D0KA 4EWRA 1PBYB 3V4PA 1N6EA 3IURA 3SBQA 1VE6A 3KRWB 2AQ5A 2VDRA 3AL9A 1H2XA 3EU7A 2B5LA 5M5RA 5EARA 3IUMA 5M61A 5EM2A 1H2WA 1JOFA 2OVPB 2VDLA 2XL3A 3HFQA 3GREA 1L5GA 4PSWB 5FQDA 1TYQC 4D9SA 2YNNA 3VA6A 3VH0A 4FAND 4E5ZB 4X61B 3I7PA 1T2XA 3EQ7A 5I5JA 3UVOA 4A2LA 2AGLA 5GXHA 1U4CA 2OIZA 3NVXA 4J81A 3CIKB 1K32A 1OMWB 3T3PA 3QHYB 2Z2NA 4XYHA 4CY3A 2Z2OA 4KFMB 5FKQA 2EIEA 3PXSD 4FB1D 3EI4A 1XIPA 3QI0A 2GC4A 3O4IA 1O6GA 3ORVD 2CO0A 4QL1A 1GOTB 4GM9A 4J87A 4L9OA 5B4WA 4NENA 3RFGA 1XKSA 5EAMA 4O9DA 4O3UB 3EI1B 2BBKH 2YBAA 3JZNA 2CN2A 3I8EA 5I5IA 3J80g 3EI4B 4IRZA 4JSXC 4QQEA 4J8GA 4GM3A 4Y5RD 2VZ1A 4J0XA 4U7AA 4JHPC 3AL8A 5CXCB 4ZOZA 3OKYB 3AH8B 4GQ1A 4ERQA 1JJUB 1MG2A 4J82A 4A2MA 2P9LC 2H9LA 3SN6B 2YB8B 2BCJB 3JAMg 2HESX 1C9IA 3OW8A 3J81g 5JWZA 2HU5A 3A0FA 5IGOA 5FKRA 1E5TA 1GOFA 4O1QD 1K3IA 2IWFA 3IVMA 2XU7A 5TDHB 2XDWA 1NEXB 4H5JA 4A08A 4N14A 3JB9L 4CI8A 2I0SA 4JD2C 4WK4A 3MMYA 1GOHA 2Q7QA 2VDOA 4J0WA 2HU8A 3UVNA 4AX4A 1N6DA 2PM9A 5FFGA 4Y7RA 5EMKB 4ERZA 1C9LA 4QT8A 1H2YA 3ZE1A 2AH1A 4GZ8A 5HDBA 2XL2A 4A7JA 1B9XA 2QZPA 5IJ8E 4Z8LA 3K26A 4FA4D 3EQ9A 1UOQA 4G56B 1SHYB 3U4YA 3DXMC 3DXKC 4ZN4A 1I2MB 3MZLA 3ZE2A 3UR4A 2P9KC 5SXMA 4ZOYA 3PSLA 4GGDA 4GQBB 4GGCA 2I0TA 4O45A 5IT9g 5K1CC 5H14A 5E6UA 3I7KA 4GQ2P 2XZGA 2TRCB 4QAMA 3W15A 4CZXA 4WK0A 3RN0D 3L4OD 4FA1D 4LGNA 4MMYA 3MXXA 2VDNA 3OL2B 3B7FA 4E5ZA 4UM8A 3ULEC 4CY2A 1E8MA 1GOGA 2GNQA 4L1QD 1U8CA 1VZ3A 5FKSA 3EWEA 4D6VA 2CO0C 5AFU3 1UOOA 5HE1B 4G1EA 3JZHA 4JT5C 4J8BA 2QC5A 2P9PC 4J86A 2EBSA 1S4UX 2WQ8A 3EI3A 4DNWA 2VZ3A 3SVWD 3RRMC 3C99A 4MMZA 3I7HA 3EQ8A 2MTAH 2P9IC 1PEVA 4ERYA 5TEEA 4E54B 2AGZA 3EI1A 3VI3A
chains in the Genus database with same CATH topology
1N6FA 4CZVA 2AGWA 5H1MA 2OVRB 4CY1A 2YNPA 3GFCA 3V7DB 4CI2A 2B5MA 4U1EI 2HKRA 3EI3B 5HE0B 4CZYA 5CXCA 4X3EA 1YFQA 3OKYA 4L3GD 3UVKA 3I7NA 2IUPA 3SBRA 3DWLC 3RN1D 4JSVC 4J78A 4IMMA 3BG0A 1R5MA 2IAAA 3UVLA 5C2WB 4K3JB 5EALA 2OJYA 4ESGA 5HYNB 3JZGA 2P9UC 5FXYA 3OKWA 1A0RB 2CN3A 2AGYA 2OK6A 2Z2PA 3JROA 3SCYA 3PVUB 3DSMA 1NR0A 2I0RA 4ZOXA 4FWWA 1QNIA 1VYHC 4A0BB 2G9AA 5EAPA 3RSEC 3F3GA 3N0DA 5TF2A 3SBPA 2G99A 1OLZA 2HYEA 3PVWB 2IURA 2J57G 3PXTD 1TBGA 1JMZB 5CXBB 2HJBA 2J56H 4XEIC 1JMXB 3KRXB 3P4FA 3VGZA 1GG2B 3L4MD 4R7AB 4XYIA 3OKTA 4JXMA 4TZ4A 5CYKB 1GP2B 3OL2A 4JSNC 4LG8A 3I7LA 3V5WB 2CE8A 5TEFA 5GMKn 2PM7B 3I8CA 4A09B 4BH6A 4PSXB 4CY5A 5IGQA 1L0QA 5FA5B 3F3PA 2H6QA 4YVDA 4OZUA 4CI3A 3RFHA 3SXTD 2UZXB 4JSPC 3SJLD 1K8KC 3ODTA 5HE2B 2HJ4A 4CI1A 4PNKB 2I3TA 1P22A 3MZKA 4MK0B 4E54A 5AMSA 4AOWA 4A0AB 3CFVA 3EG6A 3I89A 2PBIB 5EMJB 5KDOB 2IWKA 2H9PA 4ZOVA 3NVNA 5HQGA 4A11A 2IUVA 1GXRA 3RLMD 4O3TB 2H47A 3CFSB 2H6KA 2YNOA 2XYIA 2OK4A 5I5MA 3UKUC 2J55H 5EMLB 3IIWA 3EI2A 4PBZA 2PM6B 4UI9R 4A11B 2IUQA 4QRJA 2GC7A 2HXCA 1SQJA 3PXWD 4ES0A 4FHLA 3ZWLB 4GMBA 5GXIA 1Q47A 2H3XA 5EM2B 4NSXA 3SWSD 2B4EA 2CNXA 2I3SA 3NVQA 3EI2B 4A0BA 2H14A 2H6NA 3E0CA 3FM0A 3UKRC 2P9SC 2H9NA 3N0EA 4H5IA 3I2NA 3SLED 4PBYA 4AEZA 4GGAA 5AJAA 4X63B 5H17A 3I7OA 1RI6A 5CXBA 3IJ0A 4J77A 3AFCA 4J73A 3PSCB 4HDJA 3DM0A 3JRPA 4K3ID 2HKMA 5C9ZB 5CYKA 1PI6A 2UZYB 3IJCA 3JPXA 3EMHA 3FRXA 5THAA 1MG3A 4PC0A 4I79A 3K27A 2H13A 3C75H 2AH0A 2QXVA 1MDAH 3C9CA 4CC9A 5FLXg 4A09A 4FA9D 2H9MA 3SHFA 5IC7A 2CE9A 3AL8B 1SQ9A 3C5MA 3F3FA 1B9YA 4JT6C 4OWRA 4FAVD 4J79A 2O9KA 2H68A 3BG1A 5EMMB 3RMZD 4LG9A 3SMRA 5C2VB 3IJ1A 3PE7A 5A2Qg 4X60B 2OVQB 3MKQA 4A0AA 5K19A 4GM8A 5HE3B 4A08B 4FA5D 3SFZA 1FWXA 2B5NA 2P9NC 4IA9A 3BWSA 2W18A 1U2VC 3IKOA 3FGBA 2PM9B 5GSAA 5IJ7E 1ERJA 3OTTA 4BL0A 4BUJC 2AGXA 4J84A 3IIYA 2YMUA 3MKSB 5FKTA 1XHMA 4L3HD 1PGUA 4PXWA 3UVMA 3V9FA 4D0KA 4EWRA 1PBYB 1N6EA 3SBQA 3KRWB 2AQ5A 3AL9A 3EU7A 2B5LA 5EARA 5EM2A 1JOFA 2OVPB 2XL3A 3HFQA 3GREA 4PSWB 5FQDA 1TYQC 2YNNA 3VA6A 3VH0A 4FAND 4E5ZB 4X61B 3I7PA 5I5JA 3UVOA 4A2LA 2AGLA 5GXHA 1U4CA 2OIZA 3NVXA 4J81A 3CIKB 1K32A 1OMWB 2Z2NA 4XYHA 4CY3A 2Z2OA 4KFMB 5FKQA 3PXSD 4FB1D 3EI4A 1XIPA 2GC4A 3ORVD 2CO0A 4QL1A 1GOTB 4GM9A 4J87A 4L9OA 5B4WA 3RFGA 1XKSA 5EAMA 4O9DA 4O3UB 3EI1B 2BBKH 2YBAA 3JZNA 2CN2A 3I8EA 5I5IA 3J80g 3EI4B 4JSXC 4QQEA 4J8GA 4GM3A 4Y5RD 4J0XA 4U7AA 3AL8A 5CXCB 4ZOZA 3OKYB 3AH8B 4GQ1A 4ERQA 1JJUB 1MG2A 4J82A 4A2MA 2P9LC 2H9LA 3SN6B 2YB8B 2BCJB 3JAMg 2HESX 3OW8A 3J81g 5JWZA 3A0FA 5IGOA 5FKRA 4O1QD 2IWFA 2XU7A 5TDHB 1NEXB 4H5JA 4A08A 4N14A 3JB9L 4CI8A 2I0SA 4JD2C 3MMYA 2Q7QA 4J0WA 3UVNA 1N6DA 2PM9A 4Y7RA 5EMKB 4ERZA 4QT8A 2AH1A 4GZ8A 2XL2A 4A7JA 1B9XA 5IJ8E 4Z8LA 3K26A 4FA4D 4G56B 3U4YA 1SHYB 3DXMC 3DXKC 4ZN4A 3MZLA 3UR4A 2P9KC 5SXMA 4ZOYA 3PSLA 4GGDA 4GQBB 4GGCA 2I0TA 4O45A 5IT9g 5K1CC 5H14A 3I7KA 4GQ2P 2TRCB 3W15A 4CZXA 3RN0D 3L4OD 4FA1D 4LGNA 3MXXA 3OL2B 3B7FA 4E5ZA 3ULEC 4CY2A 2GNQA 4L1QD 5FKSA 3EWEA 4D6VA 2CO0C 5AFU3 5HE1B 3JZHA 4JT5C 4J8BA 2QC5A 2P9PC 4J86A 2EBSA 1S4UX 3EI3A 3SVWD 3RRMC 3C99A 3I7HA 2MTAH 2P9IC 1PEVA 4ERYA 5TEEA 4E54B 2AGZA 3EI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N6F A;  4CZV A;  2AGW A;  5H1M A;  2OVR B;  4CY1 A;  2YNP A;  3GFC A;  3V7D B;  4CI2 A;  2B5M A;  4U1E I;  2HKR A;  3EI3 B;  5HE0 B;  4CZY A;  5CXC A;  4X3E A;  1YFQ A;  3OKY A;  4L3G D;  3UVK A;  3I7N A;  2IUP A;  3SBR A;  3DWL C;  3RN1 D;  4JSV C;  4J78 A;  4IMM A;  3BG0 A;  1R5M A;  2IAA A;  3UVL A;  5C2W B;  4K3J B;  5EAL A;  2OJY A;  4ESG A;  5HYN B;  3JZG A;  2P9U C;  5FXY A;  3OKW A;  1A0R B;  2CN3 A;  2AGY A;  2OK6 A;  2Z2P A;  3JRO A;  3SCY A;  3PVU B;  3DSM A;  1NR0 A;  2I0R A;  4ZOX A;  4FWW A;  1QNI A;  1VYH C;  4A0B B;  2G9A A;  5EAP A;  3RSE C;  3F3G A;  3N0D A;  5TF2 A;  3SBP A;  2G99 A;  1OLZ A;  2HYE A;  3PVW B;  2IUR A;  2J57 G;  3PXT D;  1TBG A;  1JMZ B;  5CXB B;  2HJB A;  2J56 H;  4XEI C;  1JMX B;  3KRX B;  3P4F A;  3VGZ A;  1GG2 B;  3L4M D;  4R7A B;  4XYI A;  3OKT A;  4JXM A;  4TZ4 A;  5CYK B;  1GP2 B;  3OL2 A;  4JSN C;  4LG8 A;  3I7L A;  3V5W B;  2CE8 A;  5TEF A;  5GMK n;  2PM7 B;  3I8C A;  4A09 B;  4BH6 A;  4PSX B;  4CY5 A;  5IGQ A;  1L0Q A;  5FA5 B;  3F3P A;  2H6Q A;  4YVD A;  4OZU A;  4CI3 A;  3RFH A;  3SXT D;  2UZX B;  4JSP C;  3SJL D;  1K8K C;  3ODT A;  5HE2 B;  2HJ4 A;  4CI1 A;  4PNK B;  2I3T A;  1P22 A;  3MZK A;  4MK0 B;  4E54 A;  5AMS A;  4AOW A;  4A0A B;  3CFV A;  3EG6 A;  3I89 A;  2PBI B;  5EMJ B;  5KDO B;  2IWK A;  2H9P A;  4ZOV A;  3NVN A;  5HQG A;  4A11 A;  2IUV A;  1GXR A;  3RLM D;  4O3T B;  2H47 A;  3CFS B;  2H6K A;  2YNO A;  2XYI A;  2OK4 A;  5I5M A;  3UKU C;  2J55 H;  5EML B;  3IIW A;  3EI2 A;  4PBZ A;  2PM6 B;  4UI9 R;  4A11 B;  2IUQ A;  4QRJ A;  2GC7 A;  2HXC A;  1SQJ A;  3PXW D;  4ES0 A;  4FHL A;  3ZWL B;  4GMB A;  5GXI A;  1Q47 A;  2H3X A;  5EM2 B;  4NSX A;  3SWS D;  2B4E A;  2CNX A;  2I3S A;  3NVQ A;  3EI2 B;  4A0B A;  2H14 A;  2H6N A;  3E0C A;  3FM0 A;  3UKR C;  2P9S C;  2H9N A;  3N0E A;  4H5I A;  3I2N A;  3SLE D;  4PBY A;  4AEZ A;  4GGA A;  5AJA A;  4X63 B;  5H17 A;  3I7O A;  1RI6 A;  5CXB A;  3IJ0 A;  4J77 A;  3AFC A;  4J73 A;  3PSC B;  4HDJ A;  3DM0 A;  3JRP A;  4K3I D;  2HKM A;  5C9Z B;  5CYK A;  1PI6 A;  2UZY B;  3IJC A;  3JPX A;  3EMH A;  3FRX A;  5THA A;  1MG3 A;  4PC0 A;  4I79 A;  3K27 A;  2H13 A;  3C75 H;  2AH0 A;  2QXV A;  1MDA H;  3C9C A;  4CC9 A;  5FLX g;  4A09 A;  4FA9 D;  2H9M A;  3SHF A;  5IC7 A;  2CE9 A;  3AL8 B;  1SQ9 A;  3C5M A;  3F3F A;  1B9Y A;  4JT6 C;  4OWR A;  4FAV D;  4J79 A;  2O9K A;  2H68 A;  3BG1 A;  5EMM B;  3RMZ D;  4LG9 A;  3SMR A;  5C2V B;  3IJ1 A;  3PE7 A;  5A2Q g;  4X60 B;  2OVQ B;  3MKQ A;  4A0A A;  5K19 A;  4GM8 A;  5HE3 B;  4A08 B;  4FA5 D;  3SFZ A;  1FWX A;  2B5N A;  2P9N C;  4IA9 A;  3BWS A;  2W18 A;  1U2V C;  3IKO A;  3FGB A;  2PM9 B;  5GSA A;  5IJ7 E;  1ERJ A;  3OTT A;  4BL0 A;  4BUJ C;  2AGX A;  4J84 A;  3IIY A;  2YMU A;  3MKS B;  5FKT A;  1XHM A;  4L3H D;  1PGU A;  4PXW A;  3UVM A;  3V9F A;  4D0K A;  4EWR A;  1PBY B;  1N6E A;  3SBQ A;  3KRW B;  2AQ5 A;  3AL9 A;  3EU7 A;  2B5L A;  5EAR A;  5EM2 A;  1JOF A;  2OVP B;  2XL3 A;  3HFQ A;  3GRE A;  4PSW B;  5FQD A;  1TYQ C;  2YNN A;  3VA6 A;  3VH0 A;  4FAN D;  4E5Z B;  4X61 B;  3I7P A;  5I5J A;  3UVO A;  4A2L A;  2AGL A;  5GXH A;  1U4C A;  2OIZ A;  3NVX A;  4J81 A;  3CIK B;  1K32 A;  1OMW B;  2Z2N A;  4XYH A;  4CY3 A;  2Z2O A;  4KFM B;  5FKQ A;  3PXS D;  4FB1 D;  3EI4 A;  1XIP A;  2GC4 A;  3ORV D;  2CO0 A;  4QL1 A;  1GOT B;  4GM9 A;  4J87 A;  4L9O A;  5B4W A;  3RFG A;  1XKS A;  5EAM A;  4O9D A;  4O3U B;  3EI1 B;  2BBK H;  2YBA A;  3JZN A;  2CN2 A;  3I8E A;  5I5I A;  3J80 g;  3EI4 B;  4JSX C;  4QQE A;  4J8G A;  4GM3 A;  4Y5R D;  4J0X A;  4U7A A;  3AL8 A;  5CXC B;  4ZOZ A;  3OKY B;  3AH8 B;  4GQ1 A;  4ERQ A;  1JJU B;  1MG2 A;  4J82 A;  4A2M A;  2P9L C;  2H9L A;  3SN6 B;  2YB8 B;  2BCJ B;  3JAM g;  2HES X;  3OW8 A;  3J81 g;  5JWZ A;  3A0F A;  5IGO A;  5FKR A;  4O1Q D;  2IWF A;  2XU7 A;  5TDH B;  1NEX B;  4H5J A;  4A08 A;  4N14 A;  3JB9 L;  4CI8 A;  2I0S A;  4JD2 C;  3MMY A;  2Q7Q A;  4J0W A;  3UVN A;  1N6D A;  2PM9 A;  4Y7R A;  5EMK B;  4ERZ A;  4QT8 A;  2AH1 A;  4GZ8 A;  2XL2 A;  4A7J A;  1B9X A;  5IJ8 E;  4Z8L A;  3K26 A;  4FA4 D;  4G56 B;  3U4Y A;  1SHY B;  3DXM C;  3DXK C;  4ZN4 A;  3MZL A;  3UR4 A;  2P9K C;  5SXM A;  4ZOY A;  3PSL A;  4GGD A;  4GQB B;  4GGC A;  2I0T A;  4O45 A;  5IT9 g;  5K1C C;  5H14 A;  3I7K A;  4GQ2 P;  2TRC B;  3W15 A;  4CZX A;  3RN0 D;  3L4O D;  4FA1 D;  4LGN A;  3MXX A;  3OL2 B;  3B7F A;  4E5Z A;  3ULE C;  4CY2 A;  2GNQ A;  4L1Q D;  5FKS A;  3EWE A;  4D6V A;  2CO0 C;  5AFU 3;  5HE1 B;  3JZH A;  4JT5 C;  4J8B A;  2QC5 A;  2P9P C;  4J86 A;  2EBS A;  1S4U X;  3EI3 A;  3SVW D;  3RRM C;  3C99 A;  3I7H A;  2MTA H;  2P9I C;  1PEV A;  4ERY A;  5TEE A;  4E54 B;  2AGZ A;  3EI1 A; 
#chains in the Genus database with same CATH topology
 1N6F A;  4O2W A;  4CZV A;  2AGW A;  5H1M A;  2OVR B;  4CY1 A;  2YNP A;  3GFC A;  3V7D B;  3ZDY A;  2B5M A;  4CI2 A;  4U1E I;  2HKR A;  3EI3 B;  5HE0 B;  4CZY A;  5CXC A;  4X3E A;  1YFQ A;  3OKY A;  4L3G D;  2XE4 A;  2JKX A;  3UVK A;  3I7N A;  2IUP A;  1H2Z A;  3DWL C;  3RN1 D;  4JSV C;  3SBR A;  4J78 A;  4NC4 A;  3O4H A;  3IUL A;  4IMM A;  3BG0 A;  3K71 A;  1R5M A;  2IAA A;  3UVL A;  3O4J A;  5C2W B;  4K3J B;  3ZDX A;  5EAL A;  2OJY A;  4ESG A;  5HYN B;  4AMY A;  3JZG A;  2P9U C;  5FXY A;  3O4G A;  3OKW A;  1A0R B;  2CN3 A;  2AGY A;  1M1X A;  2OK6 A;  2Z2P A;  3JRO A;  3SCY A;  2VDQ A;  3DDU A;  3DSM A;  1NR0 A;  2I0R A;  3PVU B;  4ZOX A;  4FWW A;  3OF7 A;  1QNI A;  1VYH C;  4A0B B;  2G9A A;  5EAP A;  3RSE C;  3F3G A;  3N0D A;  5TF2 A;  3SBP A;  2G99 A;  1OLZ A;  2HYE A;  3PVW B;  2IUR A;  2J57 G;  3PXT D;  4AN1 A;  1TBG A;  1JMZ B;  4Z7O A;  5CXB B;  2HJB A;  3IJE A;  2J56 H;  4XEI C;  1JMX B;  3KRX B;  3P4F A;  3VGZ A;  1GG2 B;  5C92 A;  3L4M D;  4R7A B;  4XYI A;  3OKT A;  4DNU A;  4JXM A;  4TZ4 A;  5CYK B;  2EID A;  5M5T A;  3GC3 B;  1GP2 B;  3FCS A;  3OL2 A;  4JSN C;  4LG8 A;  3I7L A;  3V5W B;  1JTD B;  2CE8 A;  5TEF A;  5GMK n;  1E8N A;  2PM7 B;  3I8C A;  4A09 B;  4G1M A;  4BH6 A;  4PSX B;  5M5S A;  4CY5 A;  4RE5 A;  5IGQ A;  4BP8 A;  1L0Q A;  5FA5 B;  3F3P A;  2H6Q A;  3NIF A;  5C86 A;  4YVD A;  4OZU A;  4CI3 A;  3RFH A;  4MMX A;  3SXT D;  1O6F A;  2UZX B;  4JSP C;  3SJL D;  1K8K C;  3ODT A;  4JHN A;  5HE2 B;  2HJ4 A;  4CI1 A;  4PNK B;  2I3T A;  3T3M A;  1P22 A;  3MZK A;  4BCC A;  4MK0 B;  4E54 A;  5AMS A;  4AOW A;  3FCU A;  4A0A B;  5M5U A;  3CFV A;  3EG6 A;  3I89 A;  2PBI B;  5EMJ B;  5KDO B;  2IWK A;  2H9P A;  2QR5 A;  4ZOV A;  3NVN A;  5HQG A;  4A11 A;  2IUV A;  3ZDZ A;  1GXR A;  3RLM D;  3K72 A;  4O3T B;  2H47 A;  1VE7 A;  5M5V A;  3CFS B;  5E6R A;  4O02 A;  1BPO A;  2H6K A;  2EIC A;  2YNO A;  2XYI A;  3IUJ A;  2OK4 A;  5I5M A;  3UKU C;  2J55 H;  5EML B;  3IIW A;  3EI2 A;  4PBZ A;  2PM6 B;  4UI9 R;  4A11 B;  2IUQ A;  4QRJ A;  2VDP A;  2GC7 A;  2HXC A;  1SQJ A;  3PXW D;  4ES0 A;  4FHL A;  3ZWL B;  3GD1 I;  4GMB A;  5GXI A;  3MUO A;  1Q47 A;  2H3X A;  5EM2 B;  3K6S A;  4NSX A;  3SWS D;  2B4E A;  2CNX A;  2I3S A;  3NVQ A;  3VI4 A;  3EI2 B;  4BCD A;  4A0B A;  2H14 A;  2H6N A;  3NIG A;  3E0C A;  3FM0 A;  2VDK A;  3UKR C;  2P9S C;  1YR2 A;  4NAA A;  2H9N A;  3N0E A;  4BP9 A;  4H5I A;  2BKL A;  3I2N A;  4Z7Q A;  3SLE D;  3MUN A;  4PBY A;  4AEZ A;  4GGA A;  3V4V A;  4NBM A;  5AJA A;  4X63 B;  5H17 A;  3I7O A;  1RI6 A;  5CXB A;  3IJ0 A;  4J77 A;  2VC2 A;  1A12 A;  3AFC A;  3ZE0 A;  4J73 A;  4G55 A;  3PSC B;  4HDJ A;  3DM0 A;  3JRP A;  4K3I D;  2HKM A;  5C9Z B;  5CYK A;  1PI6 A;  3NID A;  2UZY B;  1UTC A;  3IUN A;  3IJC A;  1QFM A;  2HU7 A;  3JPX A;  1TYE A;  3EMH A;  2EIB A;  3FRX A;  1MG3 A;  5THA A;  4PC0 A;  4I79 A;  4BCB A;  3K27 A;  2H13 A;  4AMZ A;  3C75 H;  2AH0 A;  2QXV A;  1MDA H;  3C9C A;  5E6S A;  4CC9 A;  5FLX g;  4AN0 A;  4A09 A;  4FA9 D;  2H9M A;  3SHF A;  5IC7 A;  2CE9 A;  2VDM A;  3AL8 B;  4DNV A;  1VZ2 A;  1SQ9 A;  3C5M A;  3F3F A;  1B9Y A;  4JT6 C;  4OWR A;  4FAV D;  4J79 A;  2O9K A;  2H68 A;  3BG1 A;  4WJK A;  5EMM B;  3RMZ D;  1QFS A;  4LG9 A;  3SMR A;  5C2V B;  3IJ1 A;  3PE7 A;  5A2Q g;  3MVD K;  4X60 B;  2OVQ B;  4WK2 A;  3MKQ A;  4A0A A;  4L1M A;  4GM8 A;  5HE3 B;  5K19 A;  4A08 B;  4FA5 D;  3SFZ A;  1FWX A;  1UOP A;  2B5N A;  2P9N C;  4IA9 A;  3KCI A;  5FFO A;  3BWS A;  4Z7N A;  2W18 A;  1U2V C;  3IKO A;  3FGB A;  2PM9 B;  4RE6 A;  5GSA A;  5IJ7 E;  1ERJ A;  3OTT A;  4BL0 A;  4BUJ C;  2AGX A;  4J84 A;  3IIY A;  2YMU A;  3MKS B;  4UM9 A;  5FKT A;  3IUQ A;  1XHM A;  4L3H D;  1PGU A;  1JV2 A;  4PXW A;  3UVM A;  3V9F A;  4D0K A;  4EWR A;  1PBY B;  3V4P A;  1N6E A;  3IUR A;  3SBQ A;  1VE6 A;  3KRW B;  2AQ5 A;  2VDR A;  3AL9 A;  1H2X A;  3EU7 A;  2B5L A;  5M5R A;  5EAR A;  3IUM A;  5M61 A;  5EM2 A;  1H2W A;  1JOF A;  2OVP B;  2VDL A;  2XL3 A;  3HFQ A;  3GRE A;  1L5G A;  4PSW B;  5FQD A;  1TYQ C;  4D9S A;  2YNN A;  3VA6 A;  3VH0 A;  4FAN D;  4E5Z B;  4X61 B;  3I7P A;  1T2X A;  3EQ7 A;  5I5J A;  3UVO A;  4A2L A;  2AGL A;  5GXH A;  1U4C A;  2OIZ A;  3NVX A;  4J81 A;  3CIK B;  1K32 A;  1OMW B;  3T3P A;  3QHY B;  2Z2N A;  4XYH A;  4CY3 A;  2Z2O A;  4KFM B;  5FKQ A;  2EIE A;  3PXS D;  4FB1 D;  3EI4 A;  1XIP A;  3QI0 A;  2GC4 A;  3O4I A;  1O6G A;  3ORV D;  2CO0 A;  4QL1 A;  1GOT B;  4GM9 A;  4J87 A;  4L9O A;  5B4W A;  4NEN A;  3RFG A;  1XKS A;  5EAM A;  4O9D A;  4O3U B;  3EI1 B;  2BBK H;  2YBA A;  3JZN A;  2CN2 A;  3I8E A;  5I5I A;  3J80 g;  3EI4 B;  4IRZ A;  4JSX C;  4QQE A;  4J8G A;  4GM3 A;  4Y5R D;  2VZ1 A;  4J0X A;  4U7A A;  4JHP C;  3AL8 A;  5CXC B;  4ZOZ A;  3OKY B;  3AH8 B;  4GQ1 A;  4ERQ A;  1JJU B;  1MG2 A;  4J82 A;  4A2M A;  2P9L C;  2H9L A;  3SN6 B;  2YB8 B;  2BCJ B;  3JAM g;  2HES X;  1C9I A;  3OW8 A;  3J81 g;  5JWZ A;  2HU5 A;  3A0F A;  5IGO A;  5FKR A;  1E5T A;  1GOF A;  4O1Q D;  1K3I A;  2IWF A;  3IVM A;  2XU7 A;  5TDH B;  2XDW A;  1NEX B;  4H5J A;  4A08 A;  4N14 A;  3JB9 L;  4CI8 A;  2I0S A;  4JD2 C;  4WK4 A;  3MMY A;  1GOH A;  2Q7Q A;  2VDO A;  4J0W A;  2HU8 A;  3UVN A;  4AX4 A;  1N6D A;  2PM9 A;  5FFG A;  4Y7R A;  5EMK B;  4ERZ A;  1C9L A;  4QT8 A;  1H2Y A;  3ZE1 A;  2AH1 A;  4GZ8 A;  5HDB A;  2XL2 A;  4A7J A;  1B9X A;  2QZP A;  5IJ8 E;  4Z8L A;  3K26 A;  4FA4 D;  3EQ9 A;  1UOQ A;  4G56 B;  1SHY B;  3U4Y A;  3DXM C;  3DXK C;  4ZN4 A;  1I2M B;  3MZL A;  3ZE2 A;  3UR4 A;  2P9K C;  5SXM A;  4ZOY A;  3PSL A;  4GGD A;  4GQB B;  4GGC A;  2I0T A;  4O45 A;  5IT9 g;  5K1C C;  5H14 A;  5E6U A;  3I7K A;  4GQ2 P;  2XZG A;  2TRC B;  4QAM A;  3W15 A;  4CZX A;  4WK0 A;  3RN0 D;  3L4O D;  4FA1 D;  4LGN A;  4MMY A;  3MXX A;  2VDN A;  3OL2 B;  3B7F A;  4E5Z A;  4UM8 A;  3ULE C;  4CY2 A;  1E8M A;  1GOG A;  2GNQ A;  4L1Q D;  1U8C A;  1VZ3 A;  5FKS A;  3EWE A;  4D6V A;  2CO0 C;  5AFU 3;  1UOO A;  5HE1 B;  4G1E A;  3JZH A;  4JT5 C;  4J8B A;  2QC5 A;  2P9P C;  4J86 A;  2EBS A;  1S4U X;  2WQ8 A;  3EI3 A;  4DNW A;  2VZ3 A;  3SVW D;  3RRM C;  3C99 A;  4MMZ A;  3I7H A;  3EQ8 A;  2MTA H;  2P9I C;  1PEV A;  4ERY A;  5TEE A;  4E54 B;  2AGZ A;  3EI1 A;  3VI3 A; 
#chains in the Genus database with same CATH homology
 1N6F A;  4CZV A;  2AGW A;  5H1M A;  2OVR B;  4CY1 A;  2YNP A;  3GFC A;  3V7D B;  4CI2 A;  2B5M A;  4U1E I;  2HKR A;  3EI3 B;  5HE0 B;  4CZY A;  5CXC A;  4X3E A;  1YFQ A;  3OKY A;  4L3G D;  3UVK A;  3I7N A;  2IUP A;  3SBR A;  3DWL C;  3RN1 D;  4JSV C;  4J78 A;  4IMM A;  3BG0 A;  1R5M A;  2IAA A;  3UVL A;  5C2W B;  4K3J B;  5EAL A;  2OJY A;  4ESG A;  5HYN B;  3JZG A;  2P9U C;  5FXY A;  3OKW A;  1A0R B;  2CN3 A;  2AGY A;  2OK6 A;  2Z2P A;  3JRO A;  3SCY A;  3PVU B;  3DSM A;  1NR0 A;  2I0R A;  4ZOX A;  4FWW A;  1QNI A;  1VYH C;  4A0B B;  2G9A A;  5EAP A;  3RSE C;  3F3G A;  3N0D A;  5TF2 A;  3SBP A;  2G99 A;  1OLZ A;  2HYE A;  3PVW B;  2IUR A;  2J57 G;  3PXT D;  1TBG A;  1JMZ B;  5CXB B;  2HJB A;  2J56 H;  4XEI C;  1JMX B;  3KRX B;  3P4F A;  3VGZ A;  1GG2 B;  3L4M D;  4R7A B;  4XYI A;  3OKT A;  4JXM A;  4TZ4 A;  5CYK B;  1GP2 B;  3OL2 A;  4JSN C;  4LG8 A;  3I7L A;  3V5W B;  2CE8 A;  5TEF A;  5GMK n;  2PM7 B;  3I8C A;  4A09 B;  4BH6 A;  4PSX B;  4CY5 A;  5IGQ A;  1L0Q A;  5FA5 B;  3F3P A;  2H6Q A;  4YVD A;  4OZU A;  4CI3 A;  3RFH A;  3SXT D;  2UZX B;  4JSP C;  3SJL D;  1K8K C;  3ODT A;  5HE2 B;  2HJ4 A;  4CI1 A;  4PNK B;  2I3T A;  1P22 A;  3MZK A;  4MK0 B;  4E54 A;  5AMS A;  4AOW A;  4A0A B;  3CFV A;  3EG6 A;  3I89 A;  2PBI B;  5EMJ B;  5KDO B;  2IWK A;  2H9P A;  4ZOV A;  3NVN A;  5HQG A;  4A11 A;  2IUV A;  1GXR A;  3RLM D;  4O3T B;  2H47 A;  3CFS B;  2H6K A;  2YNO A;  2XYI A;  2OK4 A;  5I5M A;  3UKU C;  2J55 H;  5EML B;  3IIW A;  3EI2 A;  4PBZ A;  2PM6 B;  4UI9 R;  4A11 B;  2IUQ A;  4QRJ A;  2GC7 A;  2HXC A;  1SQJ A;  3PXW D;  4ES0 A;  4FHL A;  3ZWL B;  4GMB A;  5GXI A;  1Q47 A;  2H3X A;  5EM2 B;  4NSX A;  3SWS D;  2B4E A;  2CNX A;  2I3S A;  3NVQ A;  3EI2 B;  4A0B A;  2H14 A;  2H6N A;  3E0C A;  3FM0 A;  3UKR C;  2P9S C;  2H9N A;  3N0E A;  4H5I A;  3I2N A;  3SLE D;  4PBY A;  4AEZ A;  4GGA A;  5AJA A;  4X63 B;  5H17 A;  3I7O A;  1RI6 A;  5CXB A;  3IJ0 A;  4J77 A;  3AFC A;  4J73 A;  3PSC B;  4HDJ A;  3DM0 A;  3JRP A;  4K3I D;  2HKM A;  5C9Z B;  5CYK A;  1PI6 A;  2UZY B;  3IJC A;  3JPX A;  3EMH A;  3FRX A;  5THA A;  1MG3 A;  4PC0 A;  4I79 A;  3K27 A;  2H13 A;  3C75 H;  2AH0 A;  2QXV A;  1MDA H;  3C9C A;  4CC9 A;  5FLX g;  4A09 A;  4FA9 D;  2H9M A;  3SHF A;  5IC7 A;  2CE9 A;  3AL8 B;  1SQ9 A;  3C5M A;  3F3F A;  1B9Y A;  4JT6 C;  4OWR A;  4FAV D;  4J79 A;  2O9K A;  2H68 A;  3BG1 A;  5EMM B;  3RMZ D;  4LG9 A;  3SMR A;  5C2V B;  3IJ1 A;  3PE7 A;  5A2Q g;  4X60 B;  2OVQ B;  3MKQ A;  4A0A A;  5K19 A;  4GM8 A;  5HE3 B;  4A08 B;  4FA5 D;  3SFZ A;  1FWX A;  2B5N A;  2P9N C;  4IA9 A;  3BWS A;  2W18 A;  1U2V C;  3IKO A;  3FGB A;  2PM9 B;  5GSA A;  5IJ7 E;  1ERJ A;  3OTT A;  4BL0 A;  4BUJ C;  2AGX A;  4J84 A;  3IIY A;  2YMU A;  3MKS B;  5FKT A;  1XHM A;  4L3H D;  1PGU A;  4PXW A;  3UVM A;  3V9F A;  4D0K A;  4EWR A;  1PBY B;  1N6E A;  3SBQ A;  3KRW B;  2AQ5 A;  3AL9 A;  3EU7 A;  2B5L A;  5EAR A;  5EM2 A;  1JOF A;  2OVP B;  2XL3 A;  3HFQ A;  3GRE A;  4PSW B;  5FQD A;  1TYQ C;  2YNN A;  3VA6 A;  3VH0 A;  4FAN D;  4E5Z B;  4X61 B;  3I7P A;  5I5J A;  3UVO A;  4A2L A;  2AGL A;  5GXH A;  1U4C A;  2OIZ A;  3NVX A;  4J81 A;  3CIK B;  1K32 A;  1OMW B;  2Z2N A;  4XYH A;  4CY3 A;  2Z2O A;  4KFM B;  5FKQ A;  3PXS D;  4FB1 D;  3EI4 A;  1XIP A;  2GC4 A;  3ORV D;  2CO0 A;  4QL1 A;  1GOT B;  4GM9 A;  4J87 A;  4L9O A;  5B4W A;  3RFG A;  1XKS A;  5EAM A;  4O9D A;  4O3U B;  3EI1 B;  2BBK H;  2YBA A;  3JZN A;  2CN2 A;  3I8E A;  5I5I A;  3J80 g;  3EI4 B;  4JSX C;  4QQE A;  4J8G A;  4GM3 A;  4Y5R D;  4J0X A;  4U7A A;  3AL8 A;  5CXC B;  4ZOZ A;  3OKY B;  3AH8 B;  4GQ1 A;  4ERQ A;  1JJU B;  1MG2 A;  4J82 A;  4A2M A;  2P9L C;  2H9L A;  3SN6 B;  2YB8 B;  2BCJ B;  3JAM g;  2HES X;  3OW8 A;  3J81 g;  5JWZ A;  3A0F A;  5IGO A;  5FKR A;  4O1Q D;  2IWF A;  2XU7 A;  5TDH B;  1NEX B;  4H5J A;  4A08 A;  4N14 A;  3JB9 L;  4CI8 A;  2I0S A;  4JD2 C;  3MMY A;  2Q7Q A;  4J0W A;  3UVN A;  1N6D A;  2PM9 A;  4Y7R A;  5EMK B;  4ERZ A;  4QT8 A;  2AH1 A;  4GZ8 A;  2XL2 A;  4A7J A;  1B9X A;  5IJ8 E;  4Z8L A;  3K26 A;  4FA4 D;  4G56 B;  3U4Y A;  1SHY B;  3DXM C;  3DXK C;  4ZN4 A;  3MZL A;  3UR4 A;  2P9K C;  5SXM A;  4ZOY A;  3PSL A;  4GGD A;  4GQB B;  4GGC A;  2I0T A;  4O45 A;  5IT9 g;  5K1C C;  5H14 A;  3I7K A;  4GQ2 P;  2TRC B;  3W15 A;  4CZX A;  3RN0 D;  3L4O D;  4FA1 D;  4LGN A;  3MXX A;  3OL2 B;  3B7F A;  4E5Z A;  3ULE C;  4CY2 A;  2GNQ A;  4L1Q D;  5FKS A;  3EWE A;  4D6V A;  2CO0 C;  5AFU 3;  5HE1 B;  3JZH A;  4JT5 C;  4J8B A;  2QC5 A;  2P9P C;  4J86 A;  2EBS A;  1S4U X;  3EI3 A;  3SVW D;  3RRM C;  3C99 A;  3I7H A;  2MTA H;  2P9I C;  1PEV A;  4ERY A;  5TEE A;  4E54 B;  2AGZ A;  3EI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...