1SHYB

The crystal structure of hgf beta-chain in complex with the sema domain of the met receptor.
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
525
structure length
499
Chain Sequence
KYQLPNFTAETPIQNVILHEHHIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMALVVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCIFSPQIEEPSQCPDCVVSALGAKVLSSVKDRFINFFVGNTINSSYFPDHPLHSISVRRLKETKDGFMFLTDQSYIDVLPEFRDSYPIKYVHAFESNNFIYFLTVQRETLDAQTFHTRIIRFCSINSGLHSYMEMPLECILTKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQSKPDSAEPMDRSAMCAFPIKYVNDFFNKINVRCLQHFYGPNHEHCFNRDEYRTEFTTALQRVDLFMGQFSEVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFLLDSHPVSPEVIVEHTLNQNGYTLVITGKKITKIPLNGLGCRHFQSCSQCLSAPPFVQCGWCHDKCVRSEECLSGTWTQQICLPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Growth factor/growth factor receptor
molecule keywords Hepatocyte growth factor
publication title Crystal structure of the HGF beta-chain in complex with the Sema domain of the Met receptor.
pubmed doi rcsb
source organism Homo sapiens
total genus 101
structure length 499
sequence length 525
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2004-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01403 Sema Sema domain
B PF01437 PSI Plexin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1shyB01
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 1shyB02
4Z7QB 4O9DA 3F3FA 4J79A 4QQEA 2P9LC 3GREA 4JSNC 2PM9B 5HYNB 2I0TA 2VDNB 2IUVA 2VDLB 3VI4B 4CZVA 3SMRA 4UI9R 4FB1D 1R5MA 5E6UB 1NR0A 1QNIA 5IGOA 4NSXA 4PSWB 5EARA 1N6EA 4Y7RA 4ZN4A 5K1CC 4J73A 3ZWLB 2AQ5A 2I3TA 4WK2B 5HE1B 4L3GD 4CY1A 4ERYA 4J8BA 2YB8B 5FA5B 4GM8A 2OJYA 3JZGA 4FAND 3BG0A 2J57G 2HJBA 4J8GA 3CFSB 4I79A 4CZXA 3MXXA 3PXSD 3JB9L 3UVOA 4A7JA 4J0WA 1PGUA 5EM2A 3DSMA 2GNQA 5EM2B 3SXTD 4R7AB 5HDBB 4GM9A 4CI1A 2IAAA 3IIYA 2H13A 4OZUA 3L4OD 2P9UC 5TF2A 2EBSA 3RFGA 4FA5D 4PNKB 2P9KC 1SQ9A 4GM3A 4Y5RD 1L0QA 2H3XA 2I0SA 2HXCA 3EI4A 3MMYA 3T3MB 1TBGA 3RMZD 2XL2A 2H47A 3EI4B 3UVMA 3ZDYB 4GMBA 3SJLD 4X63B 2BCJB 2P26A 4L3HD 3EMHA 4GGDA 4PSXB 4WK4B 1B9YA 4JT6C 5TDHB 5EMMB 4E54A 3SN6B 2XL3A 3DWLC 4GZ8A 5GXIA 4E54B 1GOTB 2O9KA 5CYKA 3NVQA 3V9FA 2B4EA 5CYKB 4JXMA 2UZXB 5H17A 3I7PA 3OL2A 3SWSD 4A2LA 2H9PA 5EAMA 5JWZA 3OL2B 3ZDXB 4E5ZA 1S4UX 3V5WB 4UM9B 3FGBA 2HJ4A 2H9LA 4E5ZB 4FAVD 5I5IA 3BG1A 3UR4A 4N14A 2H68A 3JAMg 3PSLA 3JRPA 4L9OA 1MG2A 5GXHA 4JSVC 1U4CA 2HESX 4BUJC 3UVLA 3RSEC 3A0FA 4J86A 5K19A 5I5JA 3NIFB 1JJUB 4X60B 3HFQA 4X3EA 3VA6A 4J87A 3OTTA 2PM9A 2OVRB 3UKUC 3J80g 3SCYA 3SFZA 1TYEB 2IURA 2YNNA 3ULEC 3NIDB 4A2MA 4CC9A 3ZE2B 2P9PC 3UVNA 4IA9A 3AL8A 4PC0A 2OK6A 4QT8A 2I0RA 4ERZA 2CN2A 3AL8B 2PBIB 4LG8A 1U2VC 3OW8A 4A0BA 4CZYA 3EWEA 4GQ1A 3W15A 4A0BB 4D0KA 4YVDA 3U4YA 5IJ7E 2J56H 4CY5A 4O45A 3VI3B 3E0CA 3OKWA 2OK4A 2QC5A 3K27A 3V7DB 2MTAH 1XKSA 1A0RB 2Z2OA 5AFU3 2G99A 1OMWB 1SSLA 1P22A 5FKQA 4A0AA 4A0AB 4J78A 3NIGB 5AJAA 4XYHA 5FQDA 2CN3A 3I2NA 1MDAH 4J77A 2OVPB 3I8CA 4A09A 3RRMC 4A09B 3OKYA 5IGQA 5I5MA 4LGNA 3SHFA 3OKYB 5EAPA 2G9AA 2CO0C 3I7HA 3KRXB 3NVNA 2IWFA 3EI2A 3EI2B 3PSCB 4O3TB 1JOFA 4QRJA 4PBZA 2VDQB 5FKTA 4CY3A 2QXVA 4GGAA 4PBYA 3JZNA 3RFHA 3I7LA 2CNXA 3C75H 2IWKA 1N6DA 2B5NA 4ES0A 2J55H 5FXYA 3SVWD 1PBYB 2YMUA 4J82A 4GQ2P 3I7OA 2TRCB 4CI8A 2VDPB 3C5MA 2PM6B 5EMLB 2YNOA 2AGWA 1SQJA 1K8KC 1JMZB 4EWRA 2P9NC 1OLZA 3IJ1A 3UVKA 4J0XA 2H6NA 5A2Qg 1NEXB 4J84A 4L1QD 5EALA 5GSAA 4XYIA 4G56B 3I89A 2H14A 5HQGA 3ORVD 3MKSB 4JSPC 4O1QD 4ZOYA 2VDKB 3EI1A 4IMMA 3EG6A 5FKSA 3EI1B 5HE0B 5FKRA 5E6RB 5IT9g 2OVQB 4GQBB 2IUPA 3PVUB 2CE9A 2VDRB 3GFCA 2AGYA 3VGZA 2CE8A 4JD2C 2AGXA 3SLED 3CFVA 4OWRA 1GG2B 4FHLA 2P9IC 4BL0A 3FCUB 5B4WA 4UM8B 4WJKB 2UZYB 4PXWA 3T3PB 2IUQA 2AH1A 4D6VA 4Z7OB 4ZOZA 2H9NA 4HDJA 3IJCA 2Z2NA 1Q47A 3C9CA 3SBRA 1PEVA 2HYEA 3F3PA 1XIPA 5HE3B 3JROA 3JZHA 5TEFA 1JMXB 4BH6A 4K3ID 3PXWD 4A11A 4K3JB 4ZOVA 2H9MA 4A11B 5GMKn 5H14A 3PXTD 2BBKH 4Z7NB 1N6FA 5E6SB 3FM0A 3IIWA 2P9SC 3EU7A 3SBPA 3AFCA 5CXBA 4FA9D 4ZOXA 4ERQA 5CXBB 4MK0B 3EI3A 4ESGA 5TEEA 4CI2A 5C9ZB 3EI3B 4U7AA 4UM9D 2CO0A 1YFQA 3UKRC 3AL9A 2YNPA 2XU7A 3ZDZB 1ERJA 3ZE0B 2HKRA 3L4MD 5KDOB 1MG3A 2OIZA 5C2VB 1XHMA 3N0EA 3I8EA 4FA1D 1GXRA 2AGLA 2HKMA 4CI3A 4H5JA 2VDOB 5HE2B 2GC4A 3KRWB 3SBQA 4GGCA 3J81g 4CY2A 1YUKA 1FWXA 1B9XA 3MKQA 2I3SA 3MZLA 5IC7A 3CIKB 3PE7A 2B5LA 2YBAA 3ZE1B 3BWSA 5THAA 5SXMA 3DXMC 3VH0A 4TZ4A 4AEZA 3JPXA 5EMJB 2PM7B 3DXKC 4JT5C 3RLMD 3IJ0A 3P4FA 5AMSA 3OKTA 5EMKB 4J81A 4WK0B 4QL1A 1PI6A 3MZKA 3ODTA 5IJ8E 2B5MA 4FA4D 3B7FA 2XYIA 3K26A 1RI6A 3IKOA 2H6QA 2Z2PA 2AH0A 3DM0A 5CXCA 3I7KA 1U8CB 1K32A 5FLXg 5CXCB 1SHYB 3AH8B 2P28A 3I7NA 4Z8LA 4O3UB 3C99A 3F3GA 1GP2B 4LG9A 4U1EI 4FWWA 3FRXA 2VC2B 4XEIC 4KFMB 4A08A 4AOWA 2H6KA 4A08B 3N0DA 5H1MA 1TYQC 2GC7A 2Q7QA 4X61B 3NVXA 4H5IA 1VYHC 2VDMB 3RN0D 3PVWB 4JSXC 3RN1D 5C2WB 2W18A 2AGZA
chains in the Genus database with same CATH superfamily
4Z7QB 4O9DA 2VDNA 3F3FA 4J79A 2P9LC 4QQEA 3GREA 4JSNC 2PM9B 2VDLA 5HYNB 2I0TA 3VI4A 2VDNB 3QI0A 3KCIA 2IUVA 2VDLB 3VI4B 4CZVA 3SMRA 4UI9R 5E6UA 4IRZA 4RE5A 4FB1D 1YR2A 1R5MA 1H2ZA 5E6UB 1NR0A 1QNIA 3O4GA 5IGOA 1VZ2A 4NSXA 4PSWB 5EARA 4AMYA 1N6EA 4Y7RA 1E8MA 4WK2A 4ZN4A 5K1CC 4J73A 1E5TA 3ZWLB 2AQ5A 2I3TA 4WK2B 5HE1B 4L3GD 4CY1A 4ERYA 4J8BA 2YB8B 5FA5B 4GM8A 2OJYA 3JZGA 4FAND 3BG0A 2J57G 2HJBA 4J8GA 3CFSB 4I79A 4CZXA 3MXXA 3PXSD 3JB9L 3UVOA 4A7JA 4J0WA 1PGUA 5EM2A 3DSMA 2GNQA 5HDBA 5EM2B 4G1EA 4MMYA 3SXTD 4R7AB 5HDBB 4GM9A 4L1MA 4CI1A 2IAAA 3IIYA 2VZ3A 2H13A 4OZUA 3L4OD 2P9UC 5TF2A 2EBSA 3RFGA 4FA5D 4PNKB 2P9KC 3QHYB 1SQ9A 2VDOA 3T3MA 4GM3A 4Y5RD 1L0QA 2H3XA 2I0SA 2HXCA 2BKLA 3EI4A 3MMYA 1TBGA 3T3MB 3ZDYA 3RMZD 2XL2A 2H47A 2XZGA 3K72A 3EI4B 3UVMA 3ZDYB 4GMBA 3SJLD 4X63B 4WK4A 2BCJB 4MMXA 4L3HD 2P26A 3EMHA 4GGDA 4PSXB 4WK4B 1B9YA 4JT6C 5TDHB 1QFMA 5EMMB 4E54A 2WQ8A 3SN6B 2XL3A 3DWLC 4GZ8A 5GXIA 4E54B 1GOTB 2O9KA 2EICA 5CYKA 4DNVA 4DNWA 3NVQA 3V9FA 2B4EA 5CYKB 4JXMA 4NC4A 2UZXB 3MUOA 5H17A 3I7PA 3OL2A 3SWSD 3ZDXA 4A2LA 2H9PA 4UM9A 5EAMA 5JWZA 3OL2B 3ZDXB 4E5ZA 1S4UX 3V5WB 4UM9B 3FGBA 2HJ4A 2H9LA 4E5ZB 4AMZA 4FAVD 1VE7A 5I5IA 3BG1A 3UR4A 2H68A 4N14A 3JAMg 3PSLA 3JRPA 1BPOA 4L9OA 1MG2A 5GXHA 4JSVC 1U4CA 2HESX 4BUJC 3UVLA 5M5VA 3RSEC 3A0FA 3NIFA 4J86A 5K19A 1VZ3A 3IVMA 5M5UA 5I5JA 3NIFB 1JJUB 4X60B 3HFQA 4X3EA 3VA6A 4DNUA 4Z7QA 4J87A 3OTTA 2PM9A 3FCSA 2OVRB 3UKUC 3J80g 2JWHA 3SCYA 3NIDA 3SFZA 1TYEB 2IURA 2YNNA 3ULEC 3ZE2A 3NIDB 4A2MA 4CC9A 4G55A 1M1XA 3ZE2B 2P9PC 3EQ7A 3UVNA 4IA9A 3AL8A 4PC0A 2OK6A 4QT8A 2I0RA 4ERZA 2CN2A 3AL8B 2PBIB 4LG8A 1U2VC 3OW8A 4A0BA 4CZYA 3VI3A 3EWEA 4GQ1A 3W15A 4A0BB 4D0KA 4YVDA 3U4YA 5IJ7E 2J56H 4CY5A 4O45A 5M5SA 3VI3B 3E0CA 3OKWA 2OK4A 2QC5A 3IUMA 3K27A 3V7DB 2MTAH 1XKSA 1A0RB 2Z2OA 5AFU3 2G99A 1O6FA 1OMWB 1SSLA 4NENA 1P22A 3DDUA 5FKQA 4A0AA 5C92A 4A0AB 2HU7A 3NIGA 4BCCA 4JHPC 4J78A 3NIGB 5AJAA 1C9IA 1I2MB 4XYHA 5FQDA 2QR5A 2CN3A 3I2NA 1MDAH 4J77A 1UOPA 2EIDA 2OVPB 3I8CA 4A09A 4AN0A 3OF7A 3RRMC 4A09B 3OKYA 2EIBA 5I5MA 5IGQA 4LGNA 4AX4A 3SHFA 3OKYB 5EAPA 3IUJA 2G9AA 2CO0C 3I7HA 3EQ9A 3KRXB 2IWFA 3NVNA 3EI2A 3EI2B 3PSCB 2VDQA 4O3TB 1JOFA 4QRJA 4PBZA 2VDQB 5FKTA 4CY3A 4NAAA 2QXVA 4GGAA 4PBYA 3JZNA 3RFHA 3I7LA 2CNXA 3C75H 2IWKA 1JV2A 1N6DA 2B5NA 4ES0A 2J55H 5FXYA 3SVWD 1PBYB 2YMUA 4J82A 2VDPA 4GQ2P 3I7OA 3V4PA 2TRCB 4CI8A 2VDPB 3C5MA 2PM6B 4BCDA 5EMLB 2YNOA 2AGWA 1SQJA 5FFGA 1K8KC 1JMZB 4EWRA 2P9NC 1OLZA 3IJ1A 3UVKA 4J0XA 2H6NA 4O02A 5A2Qg 1NEXB 1QFSA 4J84A 4L1QD 5EALA 5GSAA 1JTDB 4XYIA 4G56B 3I89A 2H14A 3O4IA 5HQGA 3ORVD 2VDKA 3MKSB 4JSPC 4O1QD 4D9SA 4ZOYA 2VDKB 3EI1A 1GOFA 4IMMA 5E6RA 2QZPA 1GOHA 3EG6A 5FKSA 3EI1B 5HE0B 5FKRA 5E6RB 5IT9g 3IUNA 3IUQA 2OVQB 2XE4A 2VDRA 3V4VA 1C9LA 2IUPA 4GQBB 3PVUB 2CE9A 2VDRB 1UOOA 3GFCA 2AGYA 3VGZA 2CE8A 4JD2C 2AGXA 3SLED 3CFVA 1TYEA 1A12A 1H2XA 4OWRA 1GG2B 4FHLA 1E8NA 5M61A 2P9IC 3FCUA 4BL0A 3IJEA 4WJKA 3FCUB 5B4WA 4UM8B 4WJKB 3T3PA 2UZYB 4PXWA 3T3PB 4Z7OA 2IUQA 2AH1A 4D6VA 4Z7OB 4ZOZA 2H9NA 4HDJA 3O4HA 3IJCA 2Z2NA 1Q47A 4QAMA 2VZ1A 3C9CA 5C86A 2EIEA 3SBRA 1PEVA 2HU8A 2HYEA 3F3PA 1XIPA 5HE3B 3JROA 1UOQA 3JZHA 5TEFA 1JMXB 4BH6A 4K3ID 3PXWD 4A11A 4K3JB 4ZOVA 3GD1I 2H9MA 1K3IA 4A11B 1UTCA 5GMKn 5H14A 3PXTD 4Z7NA 5E6SA 2BBKH 4BP8A 2JWGA 4Z7NB 1N6FA 5E6SB 3FM0A 1O6GA 3IIWA 2P9SC 3EU7A 3SBPA 4NBMA 3AFCA 5CXBA 4FA9D 5M5TA 3O4JA 4ZOXA 4ERQA 5CXBB 1H2WA 4MK0B 3EI3A 4ESGA 5TEEA 4CI2A 5C9ZB 3EI3B 3ZDZA 3ZE0A 4U7AA 4UM9D 2CO0A 1YFQA 3UKRC 3AL9A 2YNPA 2XU7A 3ZDZB 1ERJA 1L5GA 3ZE0B 2HKRA 3L4MD 5KDOB 1MG3A 2OIZA 5C2VB 1XHMA 3N0EA 3I8EA 3MVDK 4FA1D 1GXRA 2AGLA 2HKMA 4CI3A 3GC3B 4H5JA 2VDOB 5HE2B 2GC4A 3KRWB 3SBQA 4GGCA 3J81g 4CY2A 1YUKA 1FWXA 1B9XA 3MKQA 2I3SA 3MZLA 5IC7A 3ZE1A 3CIKB 3PE7A 2B5LA 2YBAA 3ZE1B 3BWSA 5THAA 5SXMA 3DXMC 3VH0A 4TZ4A 4AEZA 3JPXA 5EMJB 2PM7B 3DXKC 4JT5C 3RLMD 3IJ0A 3P4FA 5AMSA 3OKTA 4WK0A 1GOGA 5EMKB 4J81A 4WK0B 4QL1A 3MZKA 1PI6A 3ODTA 4JHNA 5IJ8E 2B5MA 1T2XA 4FA4D 3B7FA 4BP9A 2XYIA 3K26A 5FFOA 1RI6A 3IKOA 2H6QA 2Z2PA 1U8CA 1H2YA 5M5RA 2AH0A 3DM0A 3IURA 5CXCA 3I7KA 1U8CB 4RE6A 1K32A 5FLXg 5CXCB 1SHYB 3AH8B 2P28A 3I7NA 4Z8LA 4O3UB 3C99A 3F3GA 2HU5A 2VC2A 4AN1A 2JKXA 3IULA 4G1MA 4MMZA 1GP2B 4LG9A 2XDWA 4FWWA 3FRXA 4U1EI 2VC2B 4XEIC 3K6SA 4KFMB 4A08A 4UM8A 4AOWA 4BCBA 2H6KA 3EQ8A 4A08B 3K71A 1VE6A 2VDMA 3N0DA 5H1MA 1TYQC 2GC7A 3MUNA 2Q7QA 4X61B 3NVXA 4H5IA 1VYHC 2VDMB 3RN0D 3PVWB 4JSXC 3RN1D 5C2WB 2W18A 2AGZA 4O2WA
chains in the Genus database with same CATH topology
4Z7QB 4O9DA 3F3FA 4J79A 4QQEA 2P9LC 3GREA 4JSNC 2PM9B 5HYNB 2I0TA 2VDNB 2IUVA 2VDLB 3VI4B 4CZVA 3SMRA 4UI9R 4FB1D 1R5MA 5E6UB 1NR0A 1QNIA 5IGOA 4NSXA 4PSWB 5EARA 1N6EA 4Y7RA 4ZN4A 5K1CC 4J73A 3ZWLB 2AQ5A 2I3TA 4WK2B 5HE1B 4L3GD 4CY1A 4ERYA 4J8BA 2YB8B 5FA5B 4GM8A 2OJYA 3JZGA 4FAND 3BG0A 2J57G 2HJBA 4J8GA 3CFSB 4I79A 4CZXA 3MXXA 3PXSD 3JB9L 3UVOA 4A7JA 4J0WA 1PGUA 5EM2A 3DSMA 2GNQA 5EM2B 3SXTD 4R7AB 5HDBB 4GM9A 4CI1A 2IAAA 3IIYA 2H13A 4OZUA 3L4OD 2P9UC 5TF2A 2EBSA 3RFGA 4FA5D 4PNKB 2P9KC 1SQ9A 4GM3A 4Y5RD 1L0QA 2H3XA 2I0SA 2HXCA 3EI4A 3MMYA 3T3MB 1TBGA 3RMZD 2XL2A 2H47A 3EI4B 3UVMA 3ZDYB 4GMBA 3SJLD 4X63B 2BCJB 2P26A 4L3HD 3EMHA 4GGDA 4PSXB 4WK4B 1B9YA 4JT6C 5TDHB 5EMMB 4E54A 3SN6B 2XL3A 3DWLC 4GZ8A 5GXIA 4E54B 1GOTB 2O9KA 5CYKA 3NVQA 3V9FA 2B4EA 5CYKB 4JXMA 2UZXB 5H17A 3I7PA 3OL2A 3SWSD 4A2LA 2H9PA 5EAMA 5JWZA 3OL2B 3ZDXB 4E5ZA 1S4UX 3V5WB 4UM9B 3FGBA 2HJ4A 2H9LA 4E5ZB 4FAVD 5I5IA 3BG1A 3UR4A 4N14A 2H68A 3JAMg 3PSLA 3JRPA 4L9OA 1MG2A 5GXHA 4JSVC 1U4CA 2HESX 4BUJC 3UVLA 3RSEC 3A0FA 4J86A 5K19A 5I5JA 3NIFB 1JJUB 4X60B 3HFQA 4X3EA 3VA6A 4J87A 3OTTA 2PM9A 2OVRB 3UKUC 3J80g 2JWHA 3SCYA 3SFZA 1TYEB 2IURA 2YNNA 3ULEC 3NIDB 4A2MA 4CC9A 3ZE2B 2P9PC 3UVNA 4IA9A 3AL8A 4PC0A 2OK6A 4QT8A 2I0RA 4ERZA 2CN2A 3AL8B 2PBIB 4LG8A 1U2VC 3OW8A 4A0BA 4CZYA 3EWEA 4GQ1A 3W15A 4A0BB 4D0KA 4YVDA 3U4YA 5IJ7E 2J56H 4CY5A 4O45A 3VI3B 3E0CA 3OKWA 2OK4A 2QC5A 3K27A 3V7DB 2MTAH 1XKSA 1A0RB 2Z2OA 5AFU3 2G99A 1OMWB 1SSLA 1P22A 5FKQA 4A0AA 4A0AB 4J78A 3NIGB 5AJAA 4XYHA 5FQDA 2CN3A 3I2NA 1MDAH 4J77A 2OVPB 3I8CA 4A09A 3RRMC 4A09B 3OKYA 5IGQA 5I5MA 4LGNA 3SHFA 3OKYB 5EAPA 2G9AA 2CO0C 3I7HA 3KRXB 3NVNA 2IWFA 3EI2A 3EI2B 3PSCB 4O3TB 1JOFA 4QRJA 4PBZA 2VDQB 5FKTA 4CY3A 2QXVA 4GGAA 4PBYA 3JZNA 3RFHA 3I7LA 2CNXA 3C75H 2IWKA 1N6DA 2B5NA 4ES0A 2J55H 5FXYA 3SVWD 1PBYB 2YMUA 4J82A 4GQ2P 3I7OA 2TRCB 4CI8A 2VDPB 3C5MA 2PM6B 5EMLB 2YNOA 2AGWA 1SQJA 1K8KC 1JMZB 4EWRA 2P9NC 1OLZA 3IJ1A 3UVKA 4J0XA 2H6NA 5A2Qg 1NEXB 4J84A 4L1QD 5EALA 5GSAA 4XYIA 4G56B 3I89A 2H14A 5HQGA 3ORVD 3MKSB 4JSPC 4O1QD 4ZOYA 2VDKB 3EI1A 4IMMA 3EG6A 5FKSA 3EI1B 5HE0B 5FKRA 5E6RB 5IT9g 2OVQB 4GQBB 2IUPA 3PVUB 2CE9A 2VDRB 3GFCA 2AGYA 3VGZA 2CE8A 4JD2C 2AGXA 3SLED 3CFVA 4OWRA 1GG2B 4FHLA 2P9IC 4BL0A 3FCUB 5B4WA 4UM8B 4WJKB 2UZYB 4PXWA 3T3PB 2IUQA 2AH1A 4D6VA 4Z7OB 4ZOZA 2H9NA 4HDJA 3IJCA 2Z2NA 1Q47A 3C9CA 3SBRA 1PEVA 2HYEA 3F3PA 1XIPA 5HE3B 3JROA 3JZHA 5TEFA 1JMXB 4BH6A 4K3ID 3PXWD 4A11A 4K3JB 4ZOVA 2H9MA 4A11B 5GMKn 5H14A 3PXTD 2BBKH 4Z7NB 2JWGA 1N6FA 5E6SB 3FM0A 3IIWA 2P9SC 3EU7A 3SBPA 3AFCA 5CXBA 4FA9D 4ZOXA 4ERQA 5CXBB 4MK0B 3EI3A 4ESGA 5TEEA 4CI2A 5C9ZB 3EI3B 4U7AA 4UM9D 2CO0A 1YFQA 3UKRC 3AL9A 2YNPA 2XU7A 3ZDZB 1ERJA 3ZE0B 2HKRA 3L4MD 5KDOB 1MG3A 2OIZA 5C2VB 1XHMA 3N0EA 3I8EA 4FA1D 1GXRA 2AGLA 2HKMA 4CI3A 4H5JA 2VDOB 5HE2B 2GC4A 3KRWB 3SBQA 4GGCA 3J81g 4CY2A 1YUKA 1FWXA 1B9XA 3MKQA 2I3SA 3MZLA 5IC7A 3CIKB 3PE7A 2B5LA 2YBAA 3ZE1B 3BWSA 5THAA 5SXMA 3DXMC 3VH0A 4TZ4A 4AEZA 3JPXA 5EMJB 2PM7B 3DXKC 4JT5C 3RLMD 3IJ0A 3P4FA 5AMSA 3OKTA 5EMKB 4J81A 4WK0B 4QL1A 1PI6A 3MZKA 3ODTA 5IJ8E 2B5MA 4FA4D 3B7FA 2XYIA 3K26A 1RI6A 3IKOA 2H6QA 2Z2PA 2AH0A 3DM0A 5CXCA 3I7KA 1U8CB 1K32A 5FLXg 5CXCB 1SHYB 3AH8B 2P28A 3I7NA 4Z8LA 4O3UB 3C99A 3F3GA 1GP2B 4LG9A 4U1EI 4FWWA 3FRXA 2VC2B 4XEIC 4KFMB 4A08A 4AOWA 2H6KA 4A08B 3N0DA 5H1MA 1TYQC 2GC7A 2Q7QA 4X61B 3NVXA 4H5IA 1VYHC 2VDMB 3RN0D 3PVWB 4JSXC 3RN1D 5C2WB 2W18A 2AGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z7Q B;  4O9D A;  3F3F A;  4J79 A;  4QQE A;  2P9L C;  3GRE A;  4JSN C;  2PM9 B;  5HYN B;  2I0T A;  2VDN B;  2IUV A;  2VDL B;  3VI4 B;  4CZV A;  3SMR A;  4UI9 R;  4FB1 D;  1R5M A;  5E6U B;  1NR0 A;  1QNI A;  5IGO A;  4NSX A;  4PSW B;  5EAR A;  1N6E A;  4Y7R A;  4ZN4 A;  5K1C C;  4J73 A;  3ZWL B;  2AQ5 A;  2I3T A;  4WK2 B;  5HE1 B;  4L3G D;  4CY1 A;  4ERY A;  4J8B A;  2YB8 B;  5FA5 B;  4GM8 A;  2OJY A;  3JZG A;  4FAN D;  3BG0 A;  2J57 G;  2HJB A;  4J8G A;  3CFS B;  4I79 A;  4CZX A;  3MXX A;  3PXS D;  3JB9 L;  3UVO A;  4A7J A;  4J0W A;  1PGU A;  5EM2 A;  3DSM A;  2GNQ A;  5EM2 B;  3SXT D;  4R7A B;  5HDB B;  4GM9 A;  4CI1 A;  2IAA A;  3IIY A;  2H13 A;  4OZU A;  3L4O D;  2P9U C;  5TF2 A;  2EBS A;  3RFG A;  4FA5 D;  4PNK B;  2P9K C;  1SQ9 A;  4GM3 A;  4Y5R D;  1L0Q A;  2H3X A;  2I0S A;  2HXC A;  3EI4 A;  3MMY A;  3T3M B;  1TBG A;  3RMZ D;  2XL2 A;  2H47 A;  3EI4 B;  3UVM A;  3ZDY B;  4GMB A;  3SJL D;  4X63 B;  2BCJ B;  2P26 A;  4L3H D;  3EMH A;  4GGD A;  4PSX B;  4WK4 B;  1B9Y A;  4JT6 C;  5TDH B;  5EMM B;  4E54 A;  3SN6 B;  2XL3 A;  3DWL C;  4GZ8 A;  5GXI A;  4E54 B;  1GOT B;  2O9K A;  5CYK A;  3NVQ A;  3V9F A;  2B4E A;  5CYK B;  4JXM A;  2UZX B;  5H17 A;  3I7P A;  3OL2 A;  3SWS D;  4A2L A;  2H9P A;  5EAM A;  5JWZ A;  3OL2 B;  3ZDX B;  4E5Z A;  1S4U X;  3V5W B;  4UM9 B;  3FGB A;  2HJ4 A;  2H9L A;  4E5Z B;  4FAV D;  5I5I A;  3BG1 A;  3UR4 A;  4N14 A;  2H68 A;  3JAM g;  3PSL A;  3JRP A;  4L9O A;  1MG2 A;  5GXH A;  4JSV C;  1U4C A;  2HES X;  4BUJ C;  3UVL A;  3RSE C;  3A0F A;  4J86 A;  5K19 A;  5I5J A;  3NIF B;  1JJU B;  4X60 B;  3HFQ A;  4X3E A;  3VA6 A;  4J87 A;  3OTT A;  2PM9 A;  2OVR B;  3UKU C;  3J80 g;  3SCY A;  3SFZ A;  1TYE B;  2IUR A;  2YNN A;  3ULE C;  3NID B;  4A2M A;  4CC9 A;  3ZE2 B;  2P9P C;  3UVN A;  4IA9 A;  3AL8 A;  4PC0 A;  2OK6 A;  4QT8 A;  2I0R A;  4ERZ A;  2CN2 A;  3AL8 B;  2PBI B;  4LG8 A;  1U2V C;  3OW8 A;  4A0B A;  4CZY A;  3EWE A;  4GQ1 A;  3W15 A;  4A0B B;  4D0K A;  4YVD A;  3U4Y A;  5IJ7 E;  2J56 H;  4CY5 A;  4O45 A;  3VI3 B;  3E0C A;  3OKW A;  2OK4 A;  2QC5 A;  3K27 A;  3V7D B;  2MTA H;  1XKS A;  1A0R B;  2Z2O A;  5AFU 3;  2G99 A;  1OMW B;  1SSL A;  1P22 A;  5FKQ A;  4A0A A;  4A0A B;  4J78 A;  3NIG B;  5AJA A;  4XYH A;  5FQD A;  2CN3 A;  3I2N A;  1MDA H;  4J77 A;  2OVP B;  3I8C A;  4A09 A;  3RRM C;  4A09 B;  3OKY A;  5IGQ A;  5I5M A;  4LGN A;  3SHF A;  3OKY B;  5EAP A;  2G9A A;  2CO0 C;  3I7H A;  3KRX B;  3NVN A;  2IWF A;  3EI2 A;  3EI2 B;  3PSC B;  4O3T B;  1JOF A;  4QRJ A;  4PBZ A;  2VDQ B;  5FKT A;  4CY3 A;  2QXV A;  4GGA A;  4PBY A;  3JZN A;  3RFH A;  3I7L A;  2CNX A;  3C75 H;  2IWK A;  1N6D A;  2B5N A;  4ES0 A;  2J55 H;  5FXY A;  3SVW D;  1PBY B;  2YMU A;  4J82 A;  4GQ2 P;  3I7O A;  2TRC B;  4CI8 A;  2VDP B;  3C5M A;  2PM6 B;  5EML B;  2YNO A;  2AGW A;  1SQJ A;  1K8K C;  1JMZ B;  4EWR A;  2P9N C;  1OLZ A;  3IJ1 A;  3UVK A;  4J0X A;  2H6N A;  5A2Q g;  1NEX B;  4J84 A;  4L1Q D;  5EAL A;  5GSA A;  4XYI A;  4G56 B;  3I89 A;  2H14 A;  5HQG A;  3ORV D;  3MKS B;  4JSP C;  4O1Q D;  4ZOY A;  2VDK B;  3EI1 A;  4IMM A;  3EG6 A;  5FKS A;  3EI1 B;  5HE0 B;  5FKR A;  5E6R B;  5IT9 g;  2OVQ B;  4GQB B;  2IUP A;  3PVU B;  2CE9 A;  2VDR B;  3GFC A;  2AGY A;  3VGZ A;  2CE8 A;  4JD2 C;  2AGX A;  3SLE D;  3CFV A;  4OWR A;  1GG2 B;  4FHL A;  2P9I C;  4BL0 A;  3FCU B;  5B4W A;  4UM8 B;  4WJK B;  2UZY B;  4PXW A;  3T3P B;  2IUQ A;  2AH1 A;  4D6V A;  4Z7O B;  4ZOZ A;  2H9N A;  4HDJ A;  3IJC A;  2Z2N A;  1Q47 A;  3C9C A;  3SBR A;  1PEV A;  2HYE A;  3F3P A;  1XIP A;  5HE3 B;  3JRO A;  3JZH A;  5TEF A;  1JMX B;  4BH6 A;  4K3I D;  3PXW D;  4A11 A;  4K3J B;  4ZOV A;  2H9M A;  4A11 B;  5GMK n;  5H14 A;  3PXT D;  2BBK H;  4Z7N B;  1N6F A;  5E6S B;  3FM0 A;  3IIW A;  2P9S C;  3EU7 A;  3SBP A;  3AFC A;  5CXB A;  4FA9 D;  4ZOX A;  4ERQ A;  5CXB B;  4MK0 B;  3EI3 A;  4ESG A;  5TEE A;  4CI2 A;  5C9Z B;  3EI3 B;  4U7A A;  4UM9 D;  2CO0 A;  1YFQ A;  3UKR C;  3AL9 A;  2YNP A;  2XU7 A;  3ZDZ B;  1ERJ A;  3ZE0 B;  2HKR A;  3L4M D;  5KDO B;  1MG3 A;  2OIZ A;  5C2V B;  1XHM A;  3N0E A;  3I8E A;  4FA1 D;  1GXR A;  2AGL A;  2HKM A;  4CI3 A;  4H5J A;  2VDO B;  5HE2 B;  2GC4 A;  3KRW B;  3SBQ A;  4GGC A;  3J81 g;  4CY2 A;  1YUK A;  1FWX A;  1B9X A;  3MKQ A;  2I3S A;  3MZL A;  5IC7 A;  3CIK B;  3PE7 A;  2B5L A;  2YBA A;  3ZE1 B;  3BWS A;  5THA A;  5SXM A;  3DXM C;  3VH0 A;  4TZ4 A;  4AEZ A;  3JPX A;  5EMJ B;  2PM7 B;  3DXK C;  4JT5 C;  3RLM D;  3IJ0 A;  3P4F A;  5AMS A;  3OKT A;  5EMK B;  4J81 A;  4WK0 B;  4QL1 A;  1PI6 A;  3MZK A;  3ODT A;  5IJ8 E;  2B5M A;  4FA4 D;  3B7F A;  2XYI A;  3K26 A;  1RI6 A;  3IKO A;  2H6Q A;  2Z2P A;  2AH0 A;  3DM0 A;  5CXC A;  3I7K A;  1U8C B;  1K32 A;  5FLX g;  5CXC B;  1SHY B;  3AH8 B;  2P28 A;  3I7N A;  4Z8L A;  4O3U B;  3C99 A;  3F3G A;  1GP2 B;  4LG9 A;  4U1E I;  4FWW A;  3FRX A;  2VC2 B;  4XEI C;  4KFM B;  4A08 A;  4AOW A;  2H6K A;  4A08 B;  3N0D A;  5H1M A;  1TYQ C;  2GC7 A;  2Q7Q A;  4X61 B;  3NVX A;  4H5I A;  1VYH C;  2VDM B;  3RN0 D;  3PVW B;  4JSX C;  3RN1 D;  5C2W B;  2W18 A;  2AGZ A; 
#chains in the Genus database with same CATH topology
 4Z7Q B;  4O9D A;  2VDN A;  3F3F A;  4J79 A;  2P9L C;  4QQE A;  3GRE A;  4JSN C;  2PM9 B;  2VDL A;  5HYN B;  2I0T A;  3VI4 A;  2VDN B;  3QI0 A;  3KCI A;  2IUV A;  2VDL B;  3VI4 B;  4CZV A;  3SMR A;  4UI9 R;  5E6U A;  4IRZ A;  4RE5 A;  4FB1 D;  1YR2 A;  1R5M A;  1H2Z A;  5E6U B;  1NR0 A;  1QNI A;  3O4G A;  5IGO A;  1VZ2 A;  4NSX A;  4PSW B;  5EAR A;  4AMY A;  1N6E A;  4Y7R A;  1E8M A;  4WK2 A;  4ZN4 A;  5K1C C;  4J73 A;  1E5T A;  3ZWL B;  2AQ5 A;  2I3T A;  4WK2 B;  5HE1 B;  4L3G D;  4CY1 A;  4ERY A;  4J8B A;  2YB8 B;  5FA5 B;  4GM8 A;  2OJY A;  3JZG A;  4FAN D;  3BG0 A;  2J57 G;  2HJB A;  4J8G A;  3CFS B;  4I79 A;  4CZX A;  3MXX A;  3PXS D;  3JB9 L;  3UVO A;  4A7J A;  4J0W A;  1PGU A;  5EM2 A;  3DSM A;  2GNQ A;  5HDB A;  5EM2 B;  4G1E A;  4MMY A;  3SXT D;  4R7A B;  5HDB B;  4GM9 A;  4L1M A;  4CI1 A;  2IAA A;  3IIY A;  2VZ3 A;  2H13 A;  4OZU A;  3L4O D;  2P9U C;  5TF2 A;  2EBS A;  3RFG A;  4FA5 D;  4PNK B;  2P9K C;  3QHY B;  1SQ9 A;  2VDO A;  3T3M A;  4GM3 A;  4Y5R D;  1L0Q A;  2H3X A;  2I0S A;  2HXC A;  2BKL A;  3EI4 A;  3MMY A;  1TBG A;  3T3M B;  3ZDY A;  3RMZ D;  2XL2 A;  2H47 A;  2XZG A;  3K72 A;  3EI4 B;  3UVM A;  3ZDY B;  4GMB A;  3SJL D;  4X63 B;  4WK4 A;  2BCJ B;  4MMX A;  4L3H D;  2P26 A;  3EMH A;  4GGD A;  4PSX B;  4WK4 B;  1B9Y A;  4JT6 C;  5TDH B;  1QFM A;  5EMM B;  4E54 A;  2WQ8 A;  3SN6 B;  2XL3 A;  3DWL C;  4GZ8 A;  5GXI A;  4E54 B;  1GOT B;  2O9K A;  2EIC A;  5CYK A;  4DNV A;  4DNW A;  3NVQ A;  3V9F A;  2B4E A;  5CYK B;  4JXM A;  4NC4 A;  2UZX B;  3MUO A;  5H17 A;  3I7P A;  3OL2 A;  3SWS D;  3ZDX A;  4A2L A;  2H9P A;  4UM9 A;  5EAM A;  5JWZ A;  3OL2 B;  3ZDX B;  4E5Z A;  1S4U X;  3V5W B;  4UM9 B;  3FGB A;  2HJ4 A;  2H9L A;  4E5Z B;  4AMZ A;  4FAV D;  1VE7 A;  5I5I A;  3BG1 A;  3UR4 A;  2H68 A;  4N14 A;  3JAM g;  3PSL A;  3JRP A;  1BPO A;  4L9O A;  1MG2 A;  5GXH A;  4JSV C;  1U4C A;  2HES X;  4BUJ C;  3UVL A;  5M5V A;  3RSE C;  3A0F A;  3NIF A;  4J86 A;  5K19 A;  1VZ3 A;  3IVM A;  5M5U A;  5I5J A;  3NIF B;  1JJU B;  4X60 B;  3HFQ A;  4X3E A;  3VA6 A;  4DNU A;  4Z7Q A;  4J87 A;  3OTT A;  2PM9 A;  3FCS A;  2OVR B;  3UKU C;  3J80 g;  2JWH A;  3SCY A;  3NID A;  3SFZ A;  1TYE B;  2IUR A;  2YNN A;  3ULE C;  3ZE2 A;  3NID B;  4A2M A;  4CC9 A;  4G55 A;  1M1X A;  3ZE2 B;  2P9P C;  3EQ7 A;  3UVN A;  4IA9 A;  3AL8 A;  4PC0 A;  2OK6 A;  4QT8 A;  2I0R A;  4ERZ A;  2CN2 A;  3AL8 B;  2PBI B;  4LG8 A;  1U2V C;  3OW8 A;  4A0B A;  4CZY A;  3VI3 A;  3EWE A;  4GQ1 A;  3W15 A;  4A0B B;  4D0K A;  4YVD A;  3U4Y A;  5IJ7 E;  2J56 H;  4CY5 A;  4O45 A;  5M5S A;  3VI3 B;  3E0C A;  3OKW A;  2OK4 A;  2QC5 A;  3IUM A;  3K27 A;  3V7D B;  2MTA H;  1XKS A;  1A0R B;  2Z2O A;  5AFU 3;  2G99 A;  1O6F A;  1OMW B;  1SSL A;  4NEN A;  1P22 A;  3DDU A;  5FKQ A;  4A0A A;  5C92 A;  4A0A B;  2HU7 A;  3NIG A;  4BCC A;  4JHP C;  4J78 A;  3NIG B;  5AJA A;  1C9I A;  1I2M B;  4XYH A;  5FQD A;  2QR5 A;  2CN3 A;  3I2N A;  1MDA H;  4J77 A;  1UOP A;  2EID A;  2OVP B;  3I8C A;  4A09 A;  4AN0 A;  3OF7 A;  3RRM C;  4A09 B;  3OKY A;  2EIB A;  5I5M A;  5IGQ A;  4LGN A;  4AX4 A;  3SHF A;  3OKY B;  5EAP A;  3IUJ A;  2G9A A;  2CO0 C;  3I7H A;  3EQ9 A;  3KRX B;  2IWF A;  3NVN A;  3EI2 A;  3EI2 B;  3PSC B;  2VDQ A;  4O3T B;  1JOF A;  4QRJ A;  4PBZ A;  2VDQ B;  5FKT A;  4CY3 A;  4NAA A;  2QXV A;  4GGA A;  4PBY A;  3JZN A;  3RFH A;  3I7L A;  2CNX A;  3C75 H;  2IWK A;  1JV2 A;  1N6D A;  2B5N A;  4ES0 A;  2J55 H;  5FXY A;  3SVW D;  1PBY B;  2YMU A;  4J82 A;  2VDP A;  4GQ2 P;  3I7O A;  3V4P A;  2TRC B;  4CI8 A;  2VDP B;  3C5M A;  2PM6 B;  4BCD A;  5EML B;  2YNO A;  2AGW A;  1SQJ A;  5FFG A;  1K8K C;  1JMZ B;  4EWR A;  2P9N C;  1OLZ A;  3IJ1 A;  3UVK A;  4J0X A;  2H6N A;  4O02 A;  5A2Q g;  1NEX B;  1QFS A;  4J84 A;  4L1Q D;  5EAL A;  5GSA A;  1JTD B;  4XYI A;  4G56 B;  3I89 A;  2H14 A;  3O4I A;  5HQG A;  3ORV D;  2VDK A;  3MKS B;  4JSP C;  4O1Q D;  4D9S A;  4ZOY A;  2VDK B;  3EI1 A;  1GOF A;  4IMM A;  5E6R A;  2QZP A;  1GOH A;  3EG6 A;  5FKS A;  3EI1 B;  5HE0 B;  5FKR A;  5E6R B;  5IT9 g;  3IUN A;  3IUQ A;  2OVQ B;  2XE4 A;  2VDR A;  3V4V A;  1C9L A;  2IUP A;  4GQB B;  3PVU B;  2CE9 A;  2VDR B;  1UOO A;  3GFC A;  2AGY A;  3VGZ A;  2CE8 A;  4JD2 C;  2AGX A;  3SLE D;  3CFV A;  1TYE A;  1A12 A;  1H2X A;  4OWR A;  1GG2 B;  4FHL A;  1E8N A;  5M61 A;  2P9I C;  3FCU A;  4BL0 A;  3IJE A;  4WJK A;  3FCU B;  5B4W A;  4UM8 B;  4WJK B;  3T3P A;  2UZY B;  4PXW A;  3T3P B;  4Z7O A;  2IUQ A;  2AH1 A;  4D6V A;  4Z7O B;  4ZOZ A;  2H9N A;  4HDJ A;  3O4H A;  3IJC A;  2Z2N A;  1Q47 A;  4QAM A;  2VZ1 A;  3C9C A;  5C86 A;  2EIE A;  3SBR A;  1PEV A;  2HU8 A;  2HYE A;  3F3P A;  1XIP A;  5HE3 B;  3JRO A;  1UOQ A;  3JZH A;  5TEF A;  1JMX B;  4BH6 A;  4K3I D;  3PXW D;  4A11 A;  4K3J B;  4ZOV A;  3GD1 I;  2H9M A;  1K3I A;  4A11 B;  1UTC A;  5GMK n;  5H14 A;  3PXT D;  4Z7N A;  5E6S A;  2BBK H;  4BP8 A;  2JWG A;  4Z7N B;  1N6F A;  5E6S B;  3FM0 A;  1O6G A;  3IIW A;  2P9S C;  3EU7 A;  3SBP A;  4NBM A;  3AFC A;  5CXB A;  4FA9 D;  5M5T A;  3O4J A;  4ZOX A;  4ERQ A;  5CXB B;  1H2W A;  4MK0 B;  3EI3 A;  4ESG A;  5TEE A;  4CI2 A;  5C9Z B;  3EI3 B;  3ZDZ A;  3ZE0 A;  4U7A A;  4UM9 D;  2CO0 A;  1YFQ A;  3UKR C;  3AL9 A;  2YNP A;  2XU7 A;  3ZDZ B;  1ERJ A;  1L5G A;  3ZE0 B;  2HKR A;  3L4M D;  5KDO B;  1MG3 A;  2OIZ A;  5C2V B;  1XHM A;  3N0E A;  3I8E A;  3MVD K;  4FA1 D;  1GXR A;  2AGL A;  2HKM A;  4CI3 A;  3GC3 B;  4H5J A;  2VDO B;  5HE2 B;  2GC4 A;  3KRW B;  3SBQ A;  4GGC A;  3J81 g;  4CY2 A;  1YUK A;  1FWX A;  1B9X A;  3MKQ A;  2I3S A;  3MZL A;  5IC7 A;  3ZE1 A;  3CIK B;  3PE7 A;  2B5L A;  2YBA A;  3ZE1 B;  3BWS A;  5THA A;  5SXM A;  3DXM C;  3VH0 A;  4TZ4 A;  4AEZ A;  3JPX A;  5EMJ B;  2PM7 B;  3DXK C;  4JT5 C;  3RLM D;  3IJ0 A;  3P4F A;  5AMS A;  3OKT A;  4WK0 A;  1GOG A;  5EMK B;  4J81 A;  4WK0 B;  4QL1 A;  3MZK A;  1PI6 A;  3ODT A;  4JHN A;  5IJ8 E;  2B5M A;  1T2X A;  4FA4 D;  3B7F A;  4BP9 A;  2XYI A;  3K26 A;  5FFO A;  1RI6 A;  3IKO A;  2H6Q A;  2Z2P A;  1U8C A;  1H2Y A;  5M5R A;  2AH0 A;  3DM0 A;  3IUR A;  5CXC A;  3I7K A;  1U8C B;  4RE6 A;  1K32 A;  5FLX g;  5CXC B;  1SHY B;  3AH8 B;  2P28 A;  3I7N A;  4Z8L A;  4O3U B;  3C99 A;  3F3G A;  2HU5 A;  2VC2 A;  4AN1 A;  2JKX A;  3IUL A;  4G1M A;  4MMZ A;  1GP2 B;  4LG9 A;  2XDW A;  4FWW A;  3FRX A;  4U1E I;  2VC2 B;  4XEI C;  3K6S A;  4KFM B;  4A08 A;  4UM8 A;  4AOW A;  4BCB A;  2H6K A;  3EQ8 A;  4A08 B;  3K71 A;  1VE6 A;  2VDM A;  3N0D A;  5H1M A;  1TYQ C;  2GC7 A;  3MUN A;  2Q7Q A;  4X61 B;  3NVX A;  4H5I A;  1VYH C;  2VDM B;  3RN0 D;  3PVW B;  4JSX C;  3RN1 D;  5C2W B;  2W18 A;  2AGZ A;  4O2W A; 
#chains in the Genus database with same CATH homology
 4Z7Q B;  4O9D A;  3F3F A;  4J79 A;  4QQE A;  2P9L C;  3GRE A;  4JSN C;  2PM9 B;  5HYN B;  2I0T A;  2VDN B;  2IUV A;  2VDL B;  3VI4 B;  4CZV A;  3SMR A;  4UI9 R;  4FB1 D;  1R5M A;  5E6U B;  1NR0 A;  1QNI A;  5IGO A;  4NSX A;  4PSW B;  5EAR A;  1N6E A;  4Y7R A;  4ZN4 A;  5K1C C;  4J73 A;  3ZWL B;  2AQ5 A;  2I3T A;  4WK2 B;  5HE1 B;  4L3G D;  4CY1 A;  4ERY A;  4J8B A;  2YB8 B;  5FA5 B;  4GM8 A;  2OJY A;  3JZG A;  4FAN D;  3BG0 A;  2J57 G;  2HJB A;  4J8G A;  3CFS B;  4I79 A;  4CZX A;  3MXX A;  3PXS D;  3JB9 L;  3UVO A;  4A7J A;  4J0W A;  1PGU A;  5EM2 A;  3DSM A;  2GNQ A;  5EM2 B;  3SXT D;  4R7A B;  5HDB B;  4GM9 A;  4CI1 A;  2IAA A;  3IIY A;  2H13 A;  4OZU A;  3L4O D;  2P9U C;  5TF2 A;  2EBS A;  3RFG A;  4FA5 D;  4PNK B;  2P9K C;  1SQ9 A;  4GM3 A;  4Y5R D;  1L0Q A;  2H3X A;  2I0S A;  2HXC A;  3EI4 A;  3MMY A;  3T3M B;  1TBG A;  3RMZ D;  2XL2 A;  2H47 A;  3EI4 B;  3UVM A;  3ZDY B;  4GMB A;  3SJL D;  4X63 B;  2BCJ B;  2P26 A;  4L3H D;  3EMH A;  4GGD A;  4PSX B;  4WK4 B;  1B9Y A;  4JT6 C;  5TDH B;  5EMM B;  4E54 A;  3SN6 B;  2XL3 A;  3DWL C;  4GZ8 A;  5GXI A;  4E54 B;  1GOT B;  2O9K A;  5CYK A;  3NVQ A;  3V9F A;  2B4E A;  5CYK B;  4JXM A;  2UZX B;  5H17 A;  3I7P A;  3OL2 A;  3SWS D;  4A2L A;  2H9P A;  5EAM A;  5JWZ A;  3OL2 B;  3ZDX B;  4E5Z A;  1S4U X;  3V5W B;  4UM9 B;  3FGB A;  2HJ4 A;  2H9L A;  4E5Z B;  4FAV D;  5I5I A;  3BG1 A;  3UR4 A;  4N14 A;  2H68 A;  3JAM g;  3PSL A;  3JRP A;  4L9O A;  1MG2 A;  5GXH A;  4JSV C;  1U4C A;  2HES X;  4BUJ C;  3UVL A;  3RSE C;  3A0F A;  4J86 A;  5K19 A;  5I5J A;  3NIF B;  1JJU B;  4X60 B;  3HFQ A;  4X3E A;  3VA6 A;  4J87 A;  3OTT A;  2PM9 A;  2OVR B;  3UKU C;  3J80 g;  2JWH A;  3SCY A;  3SFZ A;  1TYE B;  2IUR A;  2YNN A;  3ULE C;  3NID B;  4A2M A;  4CC9 A;  3ZE2 B;  2P9P C;  3UVN A;  4IA9 A;  3AL8 A;  4PC0 A;  2OK6 A;  4QT8 A;  2I0R A;  4ERZ A;  2CN2 A;  3AL8 B;  2PBI B;  4LG8 A;  1U2V C;  3OW8 A;  4A0B A;  4CZY A;  3EWE A;  4GQ1 A;  3W15 A;  4A0B B;  4D0K A;  4YVD A;  3U4Y A;  5IJ7 E;  2J56 H;  4CY5 A;  4O45 A;  3VI3 B;  3E0C A;  3OKW A;  2OK4 A;  2QC5 A;  3K27 A;  3V7D B;  2MTA H;  1XKS A;  1A0R B;  2Z2O A;  5AFU 3;  2G99 A;  1OMW B;  1SSL A;  1P22 A;  5FKQ A;  4A0A A;  4A0A B;  4J78 A;  3NIG B;  5AJA A;  4XYH A;  5FQD A;  2CN3 A;  3I2N A;  1MDA H;  4J77 A;  2OVP B;  3I8C A;  4A09 A;  3RRM C;  4A09 B;  3OKY A;  5IGQ A;  5I5M A;  4LGN A;  3SHF A;  3OKY B;  5EAP A;  2G9A A;  2CO0 C;  3I7H A;  3KRX B;  3NVN A;  2IWF A;  3EI2 A;  3EI2 B;  3PSC B;  4O3T B;  1JOF A;  4QRJ A;  4PBZ A;  2VDQ B;  5FKT A;  4CY3 A;  2QXV A;  4GGA A;  4PBY A;  3JZN A;  3RFH A;  3I7L A;  2CNX A;  3C75 H;  2IWK A;  1N6D A;  2B5N A;  4ES0 A;  2J55 H;  5FXY A;  3SVW D;  1PBY B;  2YMU A;  4J82 A;  4GQ2 P;  3I7O A;  2TRC B;  4CI8 A;  2VDP B;  3C5M A;  2PM6 B;  5EML B;  2YNO A;  2AGW A;  1SQJ A;  1K8K C;  1JMZ B;  4EWR A;  2P9N C;  1OLZ A;  3IJ1 A;  3UVK A;  4J0X A;  2H6N A;  5A2Q g;  1NEX B;  4J84 A;  4L1Q D;  5EAL A;  5GSA A;  4XYI A;  4G56 B;  3I89 A;  2H14 A;  5HQG A;  3ORV D;  3MKS B;  4JSP C;  4O1Q D;  4ZOY A;  2VDK B;  3EI1 A;  4IMM A;  3EG6 A;  5FKS A;  3EI1 B;  5HE0 B;  5FKR A;  5E6R B;  5IT9 g;  2OVQ B;  4GQB B;  2IUP A;  3PVU B;  2CE9 A;  2VDR B;  3GFC A;  2AGY A;  3VGZ A;  2CE8 A;  4JD2 C;  2AGX A;  3SLE D;  3CFV A;  4OWR A;  1GG2 B;  4FHL A;  2P9I C;  4BL0 A;  3FCU B;  5B4W A;  4UM8 B;  4WJK B;  2UZY B;  4PXW A;  3T3P B;  2IUQ A;  2AH1 A;  4D6V A;  4Z7O B;  4ZOZ A;  2H9N A;  4HDJ A;  3IJC A;  2Z2N A;  1Q47 A;  3C9C A;  3SBR A;  1PEV A;  2HYE A;  3F3P A;  1XIP A;  5HE3 B;  3JRO A;  3JZH A;  5TEF A;  1JMX B;  4BH6 A;  4K3I D;  3PXW D;  4A11 A;  4K3J B;  4ZOV A;  2H9M A;  4A11 B;  5GMK n;  5H14 A;  3PXT D;  2BBK H;  4Z7N B;  2JWG A;  1N6F A;  5E6S B;  3FM0 A;  3IIW A;  2P9S C;  3EU7 A;  3SBP A;  3AFC A;  5CXB A;  4FA9 D;  4ZOX A;  4ERQ A;  5CXB B;  4MK0 B;  3EI3 A;  4ESG A;  5TEE A;  4CI2 A;  5C9Z B;  3EI3 B;  4U7A A;  4UM9 D;  2CO0 A;  1YFQ A;  3UKR C;  3AL9 A;  2YNP A;  2XU7 A;  3ZDZ B;  1ERJ A;  3ZE0 B;  2HKR A;  3L4M D;  5KDO B;  1MG3 A;  2OIZ A;  5C2V B;  1XHM A;  3N0E A;  3I8E A;  4FA1 D;  1GXR A;  2AGL A;  2HKM A;  4CI3 A;  4H5J A;  2VDO B;  5HE2 B;  2GC4 A;  3KRW B;  3SBQ A;  4GGC A;  3J81 g;  4CY2 A;  1YUK A;  1FWX A;  1B9X A;  3MKQ A;  2I3S A;  3MZL A;  5IC7 A;  3CIK B;  3PE7 A;  2B5L A;  2YBA A;  3ZE1 B;  3BWS A;  5THA A;  5SXM A;  3DXM C;  3VH0 A;  4TZ4 A;  4AEZ A;  3JPX A;  5EMJ B;  2PM7 B;  3DXK C;  4JT5 C;  3RLM D;  3IJ0 A;  3P4F A;  5AMS A;  3OKT A;  5EMK B;  4J81 A;  4WK0 B;  4QL1 A;  1PI6 A;  3MZK A;  3ODT A;  5IJ8 E;  2B5M A;  4FA4 D;  3B7F A;  2XYI A;  3K26 A;  1RI6 A;  3IKO A;  2H6Q A;  2Z2P A;  2AH0 A;  3DM0 A;  5CXC A;  3I7K A;  1U8C B;  1K32 A;  5FLX g;  5CXC B;  1SHY B;  3AH8 B;  2P28 A;  3I7N A;  4Z8L A;  4O3U B;  3C99 A;  3F3G A;  1GP2 B;  4LG9 A;  4U1E I;  4FWW A;  3FRX A;  2VC2 B;  4XEI C;  4KFM B;  4A08 A;  4AOW A;  2H6K A;  4A08 B;  3N0D A;  5H1M A;  1TYQ C;  2GC7 A;  2Q7Q A;  4X61 B;  3NVX A;  4H5I A;  1VYH C;  2VDM B;  3RN0 D;  3PVW B;  4JSX C;  3RN1 D;  5C2W B;  2W18 A;  2AGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...