3RFGA

Crystal structure of the yeast rack1 dimer in space group p63
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
312
structure length
288
Chain Sequence
b'VLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRVVNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVFSLAFSPNRYWLAAATATGIKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVIRVWQVMT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanine nucleotide-binding protein subunit beta-like protein
publication title Structure of the RACK1 dimer from Saccharomyces cerevisiae
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 48
structure length 288
sequence length 312
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3rfgA00
3PSCB 2G99A 2B5MA 4O3TB 3C5MA 5H14A 5K19A 3SWSD 4L3HD 4QRJA 4A2LA 4A11B 3RSEC 2GC7A 2B5NA 3NVQA 4Y7RA 1YFQA 5HYNB 4A0AB 5EAMA 2P9LC 3DXKC 4X61B 2I0SA 2AGXA 3C9CA 2HJBA 2P9UC 4FAVD 5IJ8E 2HESX 2BCJB 5EMKB 5K1CC 4U7AA 3AL9A 4GM3A 5FKTA 5EMJB 3N0EA 2CO0C 5CYKA 3EI3B 1K32A 1L0QA 3JROA 4XEIC 3V7DB 1VYHC 3RMZD 2I3TA 2EBSA 5CXCB 4GGCA 4QQEA 4LG8A 4FA5D 4J77A 3RFGA 2OVRB 3JRPA 5EALA 5FXYA 5FQDA 2YNNA 2AGYA 3F3PA 3AL8A 4XYHA 4N14A 2H14A 5EARA 5B4WA 3J81g 5EMLB 4L3GD 2Z2NA 3BG0A 3EI4A 5C2WB 4GGAA 3K27A 3RFHA 5CXBA 3SBRA 2H47A 3I8EA 4I79A 4X3EA 4J84A 4U1EI 4GZ8A 4L1QD 3V9FA 3OKWA 4A09B 1XHMA 2P9PC 4PXWA 4A0BB 1U2VC 2YB8B 3FRXA 1S4UX 2AQ5A 5A2Qg 4J86A 1SQJA 3SMRA 4FHLA 2J56H 4E54A 2GC4A 3ULEC 1PGUA 4CI3A 4J73A 4J79A 4ZOYA 5HE2B 2CE9A 5FKSA 4E5ZA 4JSPC 2H9NA 2HJ4A 2YNPA 3FGBA 4EWRA 4A08A 5I5JA 4TZ4A 3OW8A 5HE0B 3OKTA 2YNOA 3DSMA 1GG2B 3I8CA 3IIWA 3JZGA 2XU7A 4GGDA 3UVNA 3UR4A 3EI1A 1MG2A 4FB1D 2H13A 4J87A 3DM0A 1Q47A 4A7JA 1ERJA 4NSXA 4FA9D 3RN0D 2HKMA 2PM9A 4JD2C 2HYEA 3MMYA 3C99A 2H9LA 3OL2B 4O3UB 3VH0A 3SN6B 4GM8A 1JJUB 3RN1D 3MKSB 4HDJA 2QC5A 4CZVA 3PXTD 4O9DA 3EI2B 2OIZA 4GMBA 2P9IC 4J0XA 4R7AB 3UVKA 1U4CA 4PSWB 2PM6B 3BWSA 2IWKA 4KFMB 4IA9A 4A2MA 2UZYB 2W18A 4GQ1A 3FM0A 4IMMA 3JAMg 2CN3A 2AGWA 5EM2A 3IJ0A 2CNXA 3IKOA 3L4OD 4A08B 5GMKn 2B4EA 4ERZA 3ORVD 5H17A 3IJ1A 3IJCA 5I5IA 4XYIA 2J57G 4ZOVA 3SBPA 4X63B 5HQGA 1PI6A 3EG6A 3CFVA 3RRMC 3UKRC 5JWZA 5IC7A 2QXVA 1XKSA 3N0DA 5I5MA 5THAA 5AFU3 1MG3A 1GP2B 5IGQA 1SQ9A 3JZNA 4FA4D 3DXMC 3KRWB 4A0BA 5KDOB 2H6KA 5FLXg 2H3XA 4ERQA 5CYKB 3SHFA 4ZOZA 2O9KA 1GOTB 3UVOA 5GXIA 4GQ2P 2PM7B 2AGLA 3PXSD 3IIYA 4Z8LA 3K26A 3GFCA 4BL0A 3SVWD 2I0RA 3AL8B 4ZN4A 3BG1A 3EMHA 1N6DA 2OK6A 3SJLD 1XIPA 3I7OA 5EMMB 4O45A 3UKUC 2XYIA 1MDAH 1PBYB 3PXWD 5HE3B 1K8KC 3NVXA 3MKQA 2OVPB 4JSNC 5AMSA 2B5LA 1QNIA 3EI4B 2Q7QA 3I7NA 4OWRA 5CXBB 4QL1A 1PEVA 4MK0B 3AFCA 4ERYA 4A11A 4JXMA 3JPXA 4JT5C 4PNKB 3DWLC 4ESGA 4CC9A 2H68A 4CI1A 2OJYA 4A0AA 4ES0A 3C75H 2IUQA 1P22A 1NEXB 1JOFA 3MZKA 4JT6C 4E54B 3SXTD 5IJ7E 5FA5B 4QT8A 1OMWB 3OKYB 3MXXA 4E5ZB 1JMXB 3PVWB 3B7FA 3PE7A 3EI3A 1N6FA 2HKRA 5H1MA 4ZOXA 2H9MA 4CI8A 5CXCA 3U4YA 2IWFA 3SCYA 4CI2A 4FA1D 4J81A 4J82A 5C9ZB 1A0RB 3OTTA 3L4MD 3CIKB 4H5JA 4FWWA 3V5WB 2CO0A 2I3SA 4PSXB 3ZWLB 3EI1B 1B9XA 2YBAA 3JZHA 3I7LA 4LGNA 2J55H 1SHYB 3EWEA 4AEZA 2IUVA 4BH6A 2IURA 2CN2A 4CY2A 5TF2A 2PM9B 3I2NA 4GQBB 4H5IA 3F3FA 2XL2A 2I0TA 2CE8A 2H6QA 3VGZA 5C2VB 5FKRA 5AJAA 5FKQA 4Y5RD 4J8GA 1N6EA 3PSLA 5HE1B 3A0FA 2GNQA 3I89A 4A09A 4GM9A 1NR0A 2AGZA 3I7KA 4AOWA 4PC0A 4K3ID 4CY1A 2YMUA 1TBGA 4OZUA 5EM2B 2AH0A 2XL3A 5IT9g 5IGOA 3VA6A 4J0WA 2P9NC 4G56B 5GSAA 3UVMA 2G9AA 3SBQA 2Z2PA 2Z2OA 1OLZA 2OVQB 4JSVC 3PVUB 2BBKH 3SFZA 1JMZB 5TEEA 3NVNA 4JSXC 3SLED 3E0CA 2H9PA 3I7HA 4L9OA 4D0KA 5SXMA 4CY5A 4K3JB 4J8BA 4J78A 2MTAH 1R5MA 2PBIB 4O1QD 2TRCB 3KRXB 4CZYA 1GXRA 1B9YA 3RLMD 3EU7A 5EAPA 2H6NA 2HXCA 2IAAA 3JB9L 3I7PA 4YVDA 4CZXA 2IUPA 2P9SC 3OKYA 3OL2A 4FAND 5TDHB 5TEFA 3GREA 3EI2A 1FWXA 4PBZA 2UZXB 3F3GA 3HFQA 1TYQC 3CFSB 4PBYA 2OK4A 4X60B 4BUJC 3ODTA 4CY3A 3AH8B 3J80g 3UVLA 4LG9A 4D6VA 4UI9R 2P9KC 5GXHA 1RI6A 3W15A 2AH1A 3MZLA 3P4FA
chains in the Genus database with same CATH superfamily
5M5VA 3PSCB 1A12A 2G99A 2B5MA 4O3TB 4DNWA 1YR2A 3C5MA 5H14A 5K19A 3SWSD 4L3HD 4QRJA 4A2LA 4DNUA 2EIBA 4A11B 3RSEC 2GC7A 2JKXA 2B5NA 4WK0A 3NVQA 4Z7NA 4Y7RA 1YFQA 5HYNB 4A0AB 5EAMA 2P9LC 2QR5A 3DXKC 4X61B 2I0SA 2AGXA 3C9CA 1UOQA 2HJBA 2P9UC 1TYEA 4FAVD 5IJ8E 2HESX 5E6RA 5FFGA 2BCJB 5EMKB 3ZDYA 3T3PA 5K1CC 4U7AA 3AL9A 4GM3A 5FKTA 5EMJB 3N0EA 2CO0C 5CYKA 3EI3B 1K32A 1L0QA 3JROA 4XEIC 3V7DB 1VYHC 3RMZD 2I3TA 2EBSA 5CXCB 4GGCA 4QQEA 4LG8A 4FA5D 4J77A 3RFGA 2OVRB 3JRPA 5EALA 5FXYA 5FQDA 1QFSA 2YNNA 2AGYA 3F3PA 3AL8A 4XYHA 1JV2A 4N14A 2H14A 1O6FA 5M5UA 2HU7A 5EARA 5B4WA 3J81g 5C92A 1E8MA 2XE4A 3O4GA 5EMLB 4JHNA 4L3GD 2Z2NA 3BG0A 3EI4A 5C2WB 1GOFA 4GGAA 3K27A 3RFHA 4O2WA 5CXBA 4AMYA 3SBRA 1H2XA 2H47A 3I8EA 4I79A 4X3EA 4J84A 4G1EA 4U1EI 5FFOA 4GZ8A 4L1QD 3V9FA 1UOOA 3OKWA 4A09B 1XHMA 2P9PC 4PXWA 4A0BB 1U2VC 2YB8B 3FRXA 1S4UX 2AQ5A 5A2Qg 4J86A 1SQJA 1O6GA 3IUJA 3SMRA 4FHLA 2J56H 4E54A 4RE6A 3T3MA 2GC4A 3ZE0A 3ULEC 4AN0A 3NIFA 1PGUA 4CI3A 4J73A 4J79A 4L1MA 4ZOYA 5HE2B 2CE9A 4QAMA 5FKSA 4E5ZA 4JSPC 2H9NA 2HJ4A 2EIDA 2YNPA 1VE7A 3FGBA 4EWRA 3FCUA 4AX4A 4A08A 5I5JA 3GC3B 4TZ4A 4NC4A 3OW8A 5HE0B 3OKTA 2YNOA 3DSMA 1GG2B 3I8CA 3ZE2A 4UM9A 2XZGA 3VI3A 3IIWA 3JZGA 2XU7A 4GGDA 3UVNA 3UR4A 3EI1A 1MG2A 4FB1D 2VDMA 2H13A 4J87A 3DM0A 1Q47A 4A7JA 1ERJA 1VE6A 4NSXA 4FA9D 5HDBA 2HKMA 3RN0D 2PM9A 4JD2C 5E6SA 2HYEA 3MMYA 3C99A 2H9LA 3OL2B 4O3UB 3VH0A 3SN6B 4GM8A 1JJUB 3RN1D 3MKSB 4HDJA 2QC5A 4CZVA 3PXTD 4O9DA 3EI2B 2VDNA 2OIZA 4GMBA 2P9IC 4J0XA 4R7AB 4D9SA 3UVKA 1U4CA 4PSWB 2PM6B 5M5TA 3BWSA 3GD1I 2IWKA 1GOHA 2VC2A 4KFMB 2VDKA 4IA9A 4A2MA 2UZYB 2W18A 4GQ1A 1VZ3A 3FM0A 4IMMA 3JAMg 2CN3A 4JHPC 2AGWA 5EM2A 1M1XA 3IJ0A 2CNXA 3IKOA 3L4OD 4A08B 5C86A 5GMKn 4MMXA 2B4EA 5M5SA 3MUNA 4ERZA 4IRZA 3ORVD 5H17A 3IJ1A 3QI0A 3IJCA 5I5IA 4XYIA 2J57G 1QFMA 2BKLA 3IJEA 4WJKA 4ZOVA 4X63B 5HQGA 1PI6A 3SBPA 3EG6A 3CFVA 4MMYA 3RRMC 3UKRC 5JWZA 5IC7A 2QXVA 1XKSA 3N0DA 5I5MA 5THAA 5AFU3 1MG3A 1GP2B 5IGQA 1SQ9A 3JZNA 4FA4D 3DXMC 3KRWB 4A0BA 5M61A 3EQ8A 5KDOB 2H6KA 5FLXg 2H3XA 4ERQA 3O4HA 4NENA 5CYKB 3SHFA 4ZOZA 2O9KA 1E5TA 1GOTB 3UVOA 5GXIA 4GQ2P 3V4VA 2PM7B 2AGLA 3PXSD 3IIYA 4Z8LA 3V4PA 3FCSA 3K26A 3GFCA 4BL0A 3SVWD 2I0RA 3AL8B 4MMZA 4ZN4A 3BG1A 3EMHA 1N6DA 2OK6A 3SJLD 1H2ZA 1XIPA 2QZPA 3EQ9A 3I7OA 5EMMB 4O45A 3UKUC 2XYIA 1MDAH 1PBYB 3PXWD 5HE3B 2VZ1A 1K8KC 3NVXA 3MKQA 2OVPB 4JSNC 5AMSA 2B5LA 3IVMA 4AMZA 2VDLA 3QHYB 5M5RA 1QNIA 3EI4B 3O4JA 5E6UA 2Q7QA 4BCCA 4BCDA 3I7NA 4OWRA 5CXBB 1JTDB 4QL1A 1PEVA 4MK0B 3AFCA 4ERYA 4A11A 4Z7OA 4JXMA 3JPXA 4JT5C 4PNKB 3DWLC 4ESGA 4CC9A 2H68A 4CI1A 2OJYA 4A0AA 3O4IA 4ES0A 3C75H 2IUQA 1U8CA 1P22A 1NEXB 1JOFA 3MZKA 4JT6C 4E54B 3SXTD 4NBMA 5IJ7E 5FA5B 1I2MB 4QT8A 1OMWB 3OKYB 4G1MA 3MXXA 3K72A 3MVDK 4E5ZB 4BP9A 1JMXB 3PVWB 3B7FA 3NIGA 3EI3A 3PE7A 3IUNA 1N6FA 2HKRA 5H1MA 4ZOXA 2H9MA 4CI8A 5CXCA 3OF7A 3U4YA 2IWFA 3SCYA 4CI2A 4FA1D 4J81A 4J82A 5C9ZB 2VDOA 1A0RB 3OTTA 3L4MD 3CIKB 4H5JA 4FWWA 3V5WB 2CO0A 2I3SA 4PSXB 3ZWLB 3EI1B 1B9XA 2YBAA 3JZHA 3I7LA 4LGNA 4DNVA 2J55H 1SHYB 3EWEA 3NIDA 2IUVA 4AEZA 2HU8A 4NAAA 4BH6A 2IURA 1K3IA 2CN2A 3IUMA 4CY2A 5TF2A 2PM9B 3I2NA 1UOPA 4GQBB 3K71A 4H5IA 3F3FA 2XL2A 2I0TA 2CE8A 2H6QA 1BPOA 3VGZA 5C2VB 5FKRA 5AJAA 5FKQA 4Y5RD 4J8GA 4WK2A 4RE5A 3K6SA 1N6EA 3PSLA 5HE1B 3A0FA 2GNQA 1VZ2A 3I89A 4A09A 4GM9A 1NR0A 2AGZA 2VDPA 3I7KA 4AOWA 4PC0A 4K3ID 4CY1A 2YMUA 1TBGA 4OZUA 4BCBA 5EM2B 2EICA 3ZDZA 1H2WA 2AH0A 2XL3A 3ZDXA 5IT9g 5IGOA 3VA6A 4J0WA 2P9NC 4G56B 5GSAA 3UVMA 2G9AA 1T2XA 3SBQA 2Z2PA 3ZE1A 1L5GA 2Z2OA 2WQ8A 1OLZA 2OVQB 1H2YA 4O02A 4JSVC 3IUQA 3PVUB 2BBKH 3SFZA 1JMZB 2VZ3A 5TEEA 3NVNA 2VDRA 4JSXC 3SLED 3E0CA 2H9PA 4BP8A 4G55A 3I7HA 4L9OA 4D0KA 5SXMA 4CY5A 4K3JB 2XDWA 4J8BA 4J78A 2MTAH 1R5MA 2PBIB 4O1QD 2TRCB 3KRXB 4CZYA 1GXRA 1B9YA 3RLMD 3EU7A 2EIEA 5EAPA 2H6NA 3IURA 2HXCA 2IAAA 3EQ7A 3JB9L 1GOGA 3I7PA 4WK4A 3IULA 4YVDA 4CZXA 2IUPA 2P9SC 3OKYA 1C9LA 3OL2A 4FAND 5TDHB 5TEFA 1C9IA 2HU5A 3GREA 3EI2A 1E8NA 1FWXA 4Z7QA 4PBZA 4AN1A 2UZXB 3F3GA 3HFQA 4UM8A 1TYQC 3CFSB 4PBYA 2OK4A 3MUOA 4X60B 3ODTA 4BUJC 4CY3A 3AH8B 3J80g 3UVLA 4LG9A 2VDQA 4D6VA 4UI9R 2P9KC 1UTCA 3KCIA 3VI4A 5GXHA 1RI6A 3DDUA 3W15A 2AH1A 3MZLA 3P4FA
chains in the Genus database with same CATH topology
3PSCB 2G99A 2B5MA 4O3TB 3C5MA 5H14A 5K19A 3SWSD 4L3HD 4QRJA 4A2LA 4A11B 3RSEC 2GC7A 2B5NA 3NVQA 4Y7RA 1YFQA 5HYNB 4A0AB 5EAMA 2P9LC 3DXKC 4X61B 2I0SA 2AGXA 3C9CA 2HJBA 2P9UC 4FAVD 5IJ8E 2HESX 2BCJB 5EMKB 5K1CC 4U7AA 3AL9A 4GM3A 5FKTA 5EMJB 3N0EA 2CO0C 5CYKA 3EI3B 1K32A 1L0QA 3JROA 4XEIC 3V7DB 1VYHC 3RMZD 2I3TA 2EBSA 5CXCB 4GGCA 4QQEA 4LG8A 4FA5D 4J77A 3RFGA 2OVRB 3JRPA 5EALA 5FXYA 5FQDA 2YNNA 2AGYA 3F3PA 3AL8A 4XYHA 4N14A 2H14A 5EARA 5B4WA 3J81g 5EMLB 4L3GD 2Z2NA 3BG0A 3EI4A 5C2WB 4GGAA 3K27A 3RFHA 5CXBA 3SBRA 2H47A 3I8EA 4I79A 4X3EA 4J84A 4U1EI 4GZ8A 4L1QD 3V9FA 3OKWA 4A09B 1XHMA 2P9PC 4PXWA 4A0BB 1U2VC 2YB8B 3FRXA 1S4UX 2AQ5A 5A2Qg 4J86A 1SQJA 3SMRA 4FHLA 2J56H 4E54A 2GC4A 3ULEC 1PGUA 4CI3A 4J73A 4J79A 4ZOYA 5HE2B 2CE9A 5FKSA 4E5ZA 4JSPC 2H9NA 2HJ4A 2YNPA 3FGBA 4EWRA 4A08A 5I5JA 4TZ4A 3OW8A 5HE0B 3OKTA 2YNOA 3DSMA 1GG2B 3I8CA 3IIWA 3JZGA 2XU7A 4GGDA 3UVNA 3UR4A 3EI1A 1MG2A 4FB1D 2H13A 4J87A 3DM0A 1Q47A 4A7JA 1ERJA 4NSXA 4FA9D 3RN0D 2HKMA 2PM9A 4JD2C 2HYEA 3MMYA 3C99A 2H9LA 3OL2B 4O3UB 3VH0A 3SN6B 4GM8A 1JJUB 3RN1D 3MKSB 4HDJA 2QC5A 4CZVA 3PXTD 4O9DA 3EI2B 2OIZA 4GMBA 2P9IC 4J0XA 4R7AB 3UVKA 1U4CA 4PSWB 2PM6B 3BWSA 2IWKA 4KFMB 4IA9A 4A2MA 2UZYB 2W18A 4GQ1A 3FM0A 4IMMA 3JAMg 2CN3A 2AGWA 5EM2A 3IJ0A 2CNXA 3IKOA 3L4OD 4A08B 5GMKn 2B4EA 4ERZA 3ORVD 5H17A 3IJ1A 3IJCA 5I5IA 4XYIA 2J57G 4ZOVA 3SBPA 4X63B 5HQGA 1PI6A 3EG6A 3CFVA 3RRMC 3UKRC 5JWZA 5IC7A 2QXVA 1XKSA 3N0DA 5I5MA 5THAA 5AFU3 1MG3A 1GP2B 5IGQA 1SQ9A 3JZNA 4FA4D 3DXMC 3KRWB 4A0BA 5KDOB 2H6KA 5FLXg 2H3XA 4ERQA 5CYKB 3SHFA 4ZOZA 2O9KA 1GOTB 3UVOA 5GXIA 4GQ2P 2PM7B 2AGLA 3PXSD 3IIYA 4Z8LA 3K26A 3GFCA 4BL0A 3SVWD 2I0RA 3AL8B 4ZN4A 3BG1A 3EMHA 1N6DA 2OK6A 3SJLD 1XIPA 3I7OA 5EMMB 4O45A 3UKUC 2XYIA 1MDAH 1PBYB 3PXWD 5HE3B 1K8KC 3NVXA 3MKQA 2OVPB 4JSNC 5AMSA 2B5LA 1QNIA 3EI4B 2Q7QA 3I7NA 4OWRA 5CXBB 4QL1A 1PEVA 4MK0B 3AFCA 4ERYA 4A11A 4JXMA 3JPXA 4JT5C 4PNKB 3DWLC 4ESGA 4CC9A 2H68A 4CI1A 2OJYA 4A0AA 4ES0A 3C75H 2IUQA 1P22A 1NEXB 1JOFA 3MZKA 4JT6C 4E54B 3SXTD 5IJ7E 5FA5B 4QT8A 1OMWB 3OKYB 3MXXA 4E5ZB 1JMXB 3PVWB 3B7FA 3PE7A 3EI3A 1N6FA 2HKRA 5H1MA 4ZOXA 2H9MA 4CI8A 5CXCA 3U4YA 2IWFA 3SCYA 4CI2A 4FA1D 4J81A 4J82A 5C9ZB 1A0RB 3OTTA 3L4MD 3CIKB 4H5JA 4FWWA 3V5WB 2CO0A 2I3SA 4PSXB 3ZWLB 3EI1B 1B9XA 2YBAA 3JZHA 3I7LA 4LGNA 2J55H 1SHYB 3EWEA 4AEZA 2IUVA 4BH6A 2IURA 2CN2A 4CY2A 5TF2A 2PM9B 3I2NA 4GQBB 4H5IA 3F3FA 2XL2A 2I0TA 2CE8A 2H6QA 3VGZA 5C2VB 5FKRA 5AJAA 5FKQA 4Y5RD 4J8GA 1N6EA 3PSLA 5HE1B 3A0FA 2GNQA 3I89A 4A09A 4GM9A 1NR0A 2AGZA 3I7KA 4AOWA 4PC0A 4K3ID 4CY1A 2YMUA 1TBGA 4OZUA 5EM2B 2AH0A 2XL3A 5IT9g 5IGOA 3VA6A 4J0WA 2P9NC 4G56B 5GSAA 3UVMA 2G9AA 3SBQA 2Z2PA 2Z2OA 1OLZA 2OVQB 4JSVC 3PVUB 2BBKH 3SFZA 1JMZB 5TEEA 3NVNA 4JSXC 3SLED 3E0CA 2H9PA 3I7HA 4L9OA 4D0KA 5SXMA 4CY5A 4K3JB 4J8BA 4J78A 2MTAH 1R5MA 2PBIB 4O1QD 2TRCB 3KRXB 4CZYA 1GXRA 1B9YA 3RLMD 3EU7A 5EAPA 2H6NA 2HXCA 2IAAA 3JB9L 3I7PA 4YVDA 4CZXA 2IUPA 2P9SC 3OKYA 3OL2A 4FAND 5TDHB 5TEFA 3GREA 3EI2A 1FWXA 4PBZA 2UZXB 3F3GA 3HFQA 1TYQC 3CFSB 4PBYA 2OK4A 4X60B 4BUJC 3ODTA 4CY3A 3AH8B 3J80g 3UVLA 4LG9A 4D6VA 4UI9R 2P9KC 5GXHA 1RI6A 3W15A 2AH1A 3MZLA 3P4FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PSC B;  2G99 A;  2B5M A;  4O3T B;  3C5M A;  5H14 A;  5K19 A;  3SWS D;  4L3H D;  4QRJ A;  4A2L A;  4A11 B;  3RSE C;  2GC7 A;  2B5N A;  3NVQ A;  4Y7R A;  1YFQ A;  5HYN B;  4A0A B;  5EAM A;  2P9L C;  3DXK C;  4X61 B;  2I0S A;  2AGX A;  3C9C A;  2HJB A;  2P9U C;  4FAV D;  5IJ8 E;  2HES X;  2BCJ B;  5EMK B;  5K1C C;  4U7A A;  3AL9 A;  4GM3 A;  5FKT A;  5EMJ B;  3N0E A;  2CO0 C;  5CYK A;  3EI3 B;  1K32 A;  1L0Q A;  3JRO A;  4XEI C;  3V7D B;  1VYH C;  3RMZ D;  2I3T A;  2EBS A;  5CXC B;  4GGC A;  4QQE A;  4LG8 A;  4FA5 D;  4J77 A;  3RFG A;  2OVR B;  3JRP A;  5EAL A;  5FXY A;  5FQD A;  2YNN A;  2AGY A;  3F3P A;  3AL8 A;  4XYH A;  4N14 A;  2H14 A;  5EAR A;  5B4W A;  3J81 g;  5EML B;  4L3G D;  2Z2N A;  3BG0 A;  3EI4 A;  5C2W B;  4GGA A;  3K27 A;  3RFH A;  5CXB A;  3SBR A;  2H47 A;  3I8E A;  4I79 A;  4X3E A;  4J84 A;  4U1E I;  4GZ8 A;  4L1Q D;  3V9F A;  3OKW A;  4A09 B;  1XHM A;  2P9P C;  4PXW A;  4A0B B;  1U2V C;  2YB8 B;  3FRX A;  1S4U X;  2AQ5 A;  5A2Q g;  4J86 A;  1SQJ A;  3SMR A;  4FHL A;  2J56 H;  4E54 A;  2GC4 A;  3ULE C;  1PGU A;  4CI3 A;  4J73 A;  4J79 A;  4ZOY A;  5HE2 B;  2CE9 A;  5FKS A;  4E5Z A;  4JSP C;  2H9N A;  2HJ4 A;  2YNP A;  3FGB A;  4EWR A;  4A08 A;  5I5J A;  4TZ4 A;  3OW8 A;  5HE0 B;  3OKT A;  2YNO A;  3DSM A;  1GG2 B;  3I8C A;  3IIW A;  3JZG A;  2XU7 A;  4GGD A;  3UVN A;  3UR4 A;  3EI1 A;  1MG2 A;  4FB1 D;  2H13 A;  4J87 A;  3DM0 A;  1Q47 A;  4A7J A;  1ERJ A;  4NSX A;  4FA9 D;  3RN0 D;  2HKM A;  2PM9 A;  4JD2 C;  2HYE A;  3MMY A;  3C99 A;  2H9L A;  3OL2 B;  4O3U B;  3VH0 A;  3SN6 B;  4GM8 A;  1JJU B;  3RN1 D;  3MKS B;  4HDJ A;  2QC5 A;  4CZV A;  3PXT D;  4O9D A;  3EI2 B;  2OIZ A;  4GMB A;  2P9I C;  4J0X A;  4R7A B;  3UVK A;  1U4C A;  4PSW B;  2PM6 B;  3BWS A;  2IWK A;  4KFM B;  4IA9 A;  4A2M A;  2UZY B;  2W18 A;  4GQ1 A;  3FM0 A;  4IMM A;  3JAM g;  2CN3 A;  2AGW A;  5EM2 A;  3IJ0 A;  2CNX A;  3IKO A;  3L4O D;  4A08 B;  5GMK n;  2B4E A;  4ERZ A;  3ORV D;  5H17 A;  3IJ1 A;  3IJC A;  5I5I A;  4XYI A;  2J57 G;  4ZOV A;  3SBP A;  4X63 B;  5HQG A;  1PI6 A;  3EG6 A;  3CFV A;  3RRM C;  3UKR C;  5JWZ A;  5IC7 A;  2QXV A;  1XKS A;  3N0D A;  5I5M A;  5THA A;  5AFU 3;  1MG3 A;  1GP2 B;  5IGQ A;  1SQ9 A;  3JZN A;  4FA4 D;  3DXM C;  3KRW B;  4A0B A;  5KDO B;  2H6K A;  5FLX g;  2H3X A;  4ERQ A;  5CYK B;  3SHF A;  4ZOZ A;  2O9K A;  1GOT B;  3UVO A;  5GXI A;  4GQ2 P;  2PM7 B;  2AGL A;  3PXS D;  3IIY A;  4Z8L A;  3K26 A;  3GFC A;  4BL0 A;  3SVW D;  2I0R A;  3AL8 B;  4ZN4 A;  3BG1 A;  3EMH A;  1N6D A;  2OK6 A;  3SJL D;  1XIP A;  3I7O A;  5EMM B;  4O45 A;  3UKU C;  2XYI A;  1MDA H;  1PBY B;  3PXW D;  5HE3 B;  1K8K C;  3NVX A;  3MKQ A;  2OVP B;  4JSN C;  5AMS A;  2B5L A;  1QNI A;  3EI4 B;  2Q7Q A;  3I7N A;  4OWR A;  5CXB B;  4QL1 A;  1PEV A;  4MK0 B;  3AFC A;  4ERY A;  4A11 A;  4JXM A;  3JPX A;  4JT5 C;  4PNK B;  3DWL C;  4ESG A;  4CC9 A;  2H68 A;  4CI1 A;  2OJY A;  4A0A A;  4ES0 A;  3C75 H;  2IUQ A;  1P22 A;  1NEX B;  1JOF A;  3MZK A;  4JT6 C;  4E54 B;  3SXT D;  5IJ7 E;  5FA5 B;  4QT8 A;  1OMW B;  3OKY B;  3MXX A;  4E5Z B;  1JMX B;  3PVW B;  3B7F A;  3PE7 A;  3EI3 A;  1N6F A;  2HKR A;  5H1M A;  4ZOX A;  2H9M A;  4CI8 A;  5CXC A;  3U4Y A;  2IWF A;  3SCY A;  4CI2 A;  4FA1 D;  4J81 A;  4J82 A;  5C9Z B;  1A0R B;  3OTT A;  3L4M D;  3CIK B;  4H5J A;  4FWW A;  3V5W B;  2CO0 A;  2I3S A;  4PSX B;  3ZWL B;  3EI1 B;  1B9X A;  2YBA A;  3JZH A;  3I7L A;  4LGN A;  2J55 H;  1SHY B;  3EWE A;  4AEZ A;  2IUV A;  4BH6 A;  2IUR A;  2CN2 A;  4CY2 A;  5TF2 A;  2PM9 B;  3I2N A;  4GQB B;  4H5I A;  3F3F A;  2XL2 A;  2I0T A;  2CE8 A;  2H6Q A;  3VGZ A;  5C2V B;  5FKR A;  5AJA A;  5FKQ A;  4Y5R D;  4J8G A;  1N6E A;  3PSL A;  5HE1 B;  3A0F A;  2GNQ A;  3I89 A;  4A09 A;  4GM9 A;  1NR0 A;  2AGZ A;  3I7K A;  4AOW A;  4PC0 A;  4K3I D;  4CY1 A;  2YMU A;  1TBG A;  4OZU A;  5EM2 B;  2AH0 A;  2XL3 A;  5IT9 g;  5IGO A;  3VA6 A;  4J0W A;  2P9N C;  4G56 B;  5GSA A;  3UVM A;  2G9A A;  3SBQ A;  2Z2P A;  2Z2O A;  1OLZ A;  2OVQ B;  4JSV C;  3PVU B;  2BBK H;  3SFZ A;  1JMZ B;  5TEE A;  3NVN A;  4JSX C;  3SLE D;  3E0C A;  2H9P A;  3I7H A;  4L9O A;  4D0K A;  5SXM A;  4CY5 A;  4K3J B;  4J8B A;  4J78 A;  2MTA H;  1R5M A;  2PBI B;  4O1Q D;  2TRC B;  3KRX B;  4CZY A;  1GXR A;  1B9Y A;  3RLM D;  3EU7 A;  5EAP A;  2H6N A;  2HXC A;  2IAA A;  3JB9 L;  3I7P A;  4YVD A;  4CZX A;  2IUP A;  2P9S C;  3OKY A;  3OL2 A;  4FAN D;  5TDH B;  5TEF A;  3GRE A;  3EI2 A;  1FWX A;  4PBZ A;  2UZX B;  3F3G A;  3HFQ A;  1TYQ C;  3CFS B;  4PBY A;  2OK4 A;  4X60 B;  4BUJ C;  3ODT A;  4CY3 A;  3AH8 B;  3J80 g;  3UVL A;  4LG9 A;  4D6V A;  4UI9 R;  2P9K C;  5GXH A;  1RI6 A;  3W15 A;  2AH1 A;  3MZL A;  3P4F A; 
#chains in the Genus database with same CATH topology
 5M5V A;  3PSC B;  1A12 A;  2G99 A;  2B5M A;  4O3T B;  4DNW A;  1YR2 A;  3C5M A;  5H14 A;  5K19 A;  3SWS D;  4L3H D;  4QRJ A;  4A2L A;  4DNU A;  2EIB A;  4A11 B;  3RSE C;  2GC7 A;  2JKX A;  2B5N A;  4WK0 A;  3NVQ A;  4Z7N A;  4Y7R A;  1YFQ A;  5HYN B;  4A0A B;  5EAM A;  2P9L C;  2QR5 A;  3DXK C;  4X61 B;  2I0S A;  2AGX A;  3C9C A;  1UOQ A;  2HJB A;  2P9U C;  1TYE A;  4FAV D;  5IJ8 E;  2HES X;  5E6R A;  5FFG A;  2BCJ B;  5EMK B;  3ZDY A;  3T3P A;  5K1C C;  4U7A A;  3AL9 A;  4GM3 A;  5FKT A;  5EMJ B;  3N0E A;  2CO0 C;  5CYK A;  3EI3 B;  1K32 A;  1L0Q A;  3JRO A;  4XEI C;  3V7D B;  1VYH C;  3RMZ D;  2I3T A;  2EBS A;  5CXC B;  4GGC A;  4QQE A;  4LG8 A;  4FA5 D;  4J77 A;  3RFG A;  2OVR B;  3JRP A;  5EAL A;  5FXY A;  5FQD A;  1QFS A;  2YNN A;  2AGY A;  3F3P A;  3AL8 A;  4XYH A;  1JV2 A;  4N14 A;  2H14 A;  1O6F A;  5M5U A;  2HU7 A;  5EAR A;  5B4W A;  3J81 g;  5C92 A;  1E8M A;  2XE4 A;  3O4G A;  5EML B;  4JHN A;  4L3G D;  2Z2N A;  3BG0 A;  3EI4 A;  5C2W B;  1GOF A;  4GGA A;  3K27 A;  3RFH A;  4O2W A;  5CXB A;  4AMY A;  3SBR A;  1H2X A;  2H47 A;  3I8E A;  4I79 A;  4X3E A;  4J84 A;  4G1E A;  4U1E I;  5FFO A;  4GZ8 A;  4L1Q D;  3V9F A;  1UOO A;  3OKW A;  4A09 B;  1XHM A;  2P9P C;  4PXW A;  4A0B B;  1U2V C;  2YB8 B;  3FRX A;  1S4U X;  2AQ5 A;  5A2Q g;  4J86 A;  1SQJ A;  1O6G A;  3IUJ A;  3SMR A;  4FHL A;  2J56 H;  4E54 A;  4RE6 A;  3T3M A;  2GC4 A;  3ZE0 A;  3ULE C;  4AN0 A;  3NIF A;  1PGU A;  4CI3 A;  4J73 A;  4J79 A;  4L1M A;  4ZOY A;  5HE2 B;  2CE9 A;  4QAM A;  5FKS A;  4E5Z A;  4JSP C;  2H9N A;  2HJ4 A;  2EID A;  2YNP A;  1VE7 A;  3FGB A;  4EWR A;  3FCU A;  4AX4 A;  4A08 A;  5I5J A;  3GC3 B;  4TZ4 A;  4NC4 A;  3OW8 A;  5HE0 B;  3OKT A;  2YNO A;  3DSM A;  1GG2 B;  3I8C A;  3ZE2 A;  4UM9 A;  2XZG A;  3VI3 A;  3IIW A;  3JZG A;  2XU7 A;  4GGD A;  3UVN A;  3UR4 A;  3EI1 A;  1MG2 A;  4FB1 D;  2VDM A;  2H13 A;  4J87 A;  3DM0 A;  1Q47 A;  4A7J A;  1ERJ A;  1VE6 A;  4NSX A;  4FA9 D;  5HDB A;  2HKM A;  3RN0 D;  2PM9 A;  4JD2 C;  5E6S A;  2HYE A;  3MMY A;  3C99 A;  2H9L A;  3OL2 B;  4O3U B;  3VH0 A;  3SN6 B;  4GM8 A;  1JJU B;  3RN1 D;  3MKS B;  4HDJ A;  2QC5 A;  4CZV A;  3PXT D;  4O9D A;  3EI2 B;  2VDN A;  2OIZ A;  4GMB A;  2P9I C;  4J0X A;  4R7A B;  4D9S A;  3UVK A;  1U4C A;  4PSW B;  2PM6 B;  5M5T A;  3BWS A;  3GD1 I;  2IWK A;  1GOH A;  2VC2 A;  4KFM B;  2VDK A;  4IA9 A;  4A2M A;  2UZY B;  2W18 A;  4GQ1 A;  1VZ3 A;  3FM0 A;  4IMM A;  3JAM g;  2CN3 A;  4JHP C;  2AGW A;  5EM2 A;  1M1X A;  3IJ0 A;  2CNX A;  3IKO A;  3L4O D;  4A08 B;  5C86 A;  5GMK n;  4MMX A;  2B4E A;  5M5S A;  3MUN A;  4ERZ A;  4IRZ A;  3ORV D;  5H17 A;  3IJ1 A;  3QI0 A;  3IJC A;  5I5I A;  4XYI A;  2J57 G;  1QFM A;  2BKL A;  3IJE A;  4WJK A;  4ZOV A;  4X63 B;  5HQG A;  1PI6 A;  3SBP A;  3EG6 A;  3CFV A;  4MMY A;  3RRM C;  3UKR C;  5JWZ A;  5IC7 A;  2QXV A;  1XKS A;  3N0D A;  5I5M A;  5THA A;  5AFU 3;  1MG3 A;  1GP2 B;  5IGQ A;  1SQ9 A;  3JZN A;  4FA4 D;  3DXM C;  3KRW B;  4A0B A;  5M61 A;  3EQ8 A;  5KDO B;  2H6K A;  5FLX g;  2H3X A;  4ERQ A;  3O4H A;  4NEN A;  5CYK B;  3SHF A;  4ZOZ A;  2O9K A;  1E5T A;  1GOT B;  3UVO A;  5GXI A;  4GQ2 P;  3V4V A;  2PM7 B;  2AGL A;  3PXS D;  3IIY A;  4Z8L A;  3V4P A;  3FCS A;  3K26 A;  3GFC A;  4BL0 A;  3SVW D;  2I0R A;  3AL8 B;  4MMZ A;  4ZN4 A;  3BG1 A;  3EMH A;  1N6D A;  2OK6 A;  3SJL D;  1H2Z A;  1XIP A;  2QZP A;  3EQ9 A;  3I7O A;  5EMM B;  4O45 A;  3UKU C;  2XYI A;  1MDA H;  1PBY B;  3PXW D;  5HE3 B;  2VZ1 A;  1K8K C;  3NVX A;  3MKQ A;  2OVP B;  4JSN C;  5AMS A;  2B5L A;  3IVM A;  4AMZ A;  2VDL A;  3QHY B;  5M5R A;  1QNI A;  3EI4 B;  3O4J A;  5E6U A;  2Q7Q A;  4BCC A;  4BCD A;  3I7N A;  4OWR A;  5CXB B;  1JTD B;  4QL1 A;  1PEV A;  4MK0 B;  3AFC A;  4ERY A;  4A11 A;  4Z7O A;  4JXM A;  3JPX A;  4JT5 C;  4PNK B;  3DWL C;  4ESG A;  4CC9 A;  2H68 A;  4CI1 A;  2OJY A;  4A0A A;  3O4I A;  4ES0 A;  3C75 H;  2IUQ A;  1U8C A;  1P22 A;  1NEX B;  1JOF A;  3MZK A;  4JT6 C;  4E54 B;  3SXT D;  4NBM A;  5IJ7 E;  5FA5 B;  1I2M B;  4QT8 A;  1OMW B;  3OKY B;  4G1M A;  3MXX A;  3K72 A;  3MVD K;  4E5Z B;  4BP9 A;  1JMX B;  3PVW B;  3B7F A;  3NIG A;  3EI3 A;  3PE7 A;  3IUN A;  1N6F A;  2HKR A;  5H1M A;  4ZOX A;  2H9M A;  4CI8 A;  5CXC A;  3OF7 A;  3U4Y A;  2IWF A;  3SCY A;  4CI2 A;  4FA1 D;  4J81 A;  4J82 A;  5C9Z B;  2VDO A;  1A0R B;  3OTT A;  3L4M D;  3CIK B;  4H5J A;  4FWW A;  3V5W B;  2CO0 A;  2I3S A;  4PSX B;  3ZWL B;  3EI1 B;  1B9X A;  2YBA A;  3JZH A;  3I7L A;  4LGN A;  4DNV A;  2J55 H;  1SHY B;  3EWE A;  3NID A;  2IUV A;  4AEZ A;  2HU8 A;  4NAA A;  4BH6 A;  2IUR A;  1K3I A;  2CN2 A;  3IUM A;  4CY2 A;  5TF2 A;  2PM9 B;  3I2N A;  1UOP A;  4GQB B;  3K71 A;  4H5I A;  3F3F A;  2XL2 A;  2I0T A;  2CE8 A;  2H6Q A;  1BPO A;  3VGZ A;  5C2V B;  5FKR A;  5AJA A;  5FKQ A;  4Y5R D;  4J8G A;  4WK2 A;  4RE5 A;  3K6S A;  1N6E A;  3PSL A;  5HE1 B;  3A0F A;  2GNQ A;  1VZ2 A;  3I89 A;  4A09 A;  4GM9 A;  1NR0 A;  2AGZ A;  2VDP A;  3I7K A;  4AOW A;  4PC0 A;  4K3I D;  4CY1 A;  2YMU A;  1TBG A;  4OZU A;  4BCB A;  5EM2 B;  2EIC A;  3ZDZ A;  1H2W A;  2AH0 A;  2XL3 A;  3ZDX A;  5IT9 g;  5IGO A;  3VA6 A;  4J0W A;  2P9N C;  4G56 B;  5GSA A;  3UVM A;  2G9A A;  1T2X A;  3SBQ A;  2Z2P A;  3ZE1 A;  1L5G A;  2Z2O A;  2WQ8 A;  1OLZ A;  2OVQ B;  1H2Y A;  4O02 A;  4JSV C;  3IUQ A;  3PVU B;  2BBK H;  3SFZ A;  1JMZ B;  2VZ3 A;  5TEE A;  3NVN A;  2VDR A;  4JSX C;  3SLE D;  3E0C A;  2H9P A;  4BP8 A;  4G55 A;  3I7H A;  4L9O A;  4D0K A;  5SXM A;  4CY5 A;  4K3J B;  2XDW A;  4J8B A;  4J78 A;  2MTA H;  1R5M A;  2PBI B;  4O1Q D;  2TRC B;  3KRX B;  4CZY A;  1GXR A;  1B9Y A;  3RLM D;  3EU7 A;  2EIE A;  5EAP A;  2H6N A;  3IUR A;  2HXC A;  2IAA A;  3EQ7 A;  3JB9 L;  1GOG A;  3I7P A;  4WK4 A;  3IUL A;  4YVD A;  4CZX A;  2IUP A;  2P9S C;  3OKY A;  1C9L A;  3OL2 A;  4FAN D;  5TDH B;  5TEF A;  1C9I A;  2HU5 A;  3GRE A;  3EI2 A;  1E8N A;  1FWX A;  4Z7Q A;  4PBZ A;  4AN1 A;  2UZX B;  3F3G A;  3HFQ A;  4UM8 A;  1TYQ C;  3CFS B;  4PBY A;  2OK4 A;  3MUO A;  4X60 B;  3ODT A;  4BUJ C;  4CY3 A;  3AH8 B;  3J80 g;  3UVL A;  4LG9 A;  2VDQ A;  4D6V A;  4UI9 R;  2P9K C;  1UTC A;  3KCI A;  3VI4 A;  5GXH A;  1RI6 A;  3DDU A;  3W15 A;  2AH1 A;  3MZL A;  3P4F A; 
#chains in the Genus database with same CATH homology
 3PSC B;  2G99 A;  2B5M A;  4O3T B;  3C5M A;  5H14 A;  5K19 A;  3SWS D;  4L3H D;  4QRJ A;  4A2L A;  4A11 B;  3RSE C;  2GC7 A;  2B5N A;  3NVQ A;  4Y7R A;  1YFQ A;  5HYN B;  4A0A B;  5EAM A;  2P9L C;  3DXK C;  4X61 B;  2I0S A;  2AGX A;  3C9C A;  2HJB A;  2P9U C;  4FAV D;  5IJ8 E;  2HES X;  2BCJ B;  5EMK B;  5K1C C;  4U7A A;  3AL9 A;  4GM3 A;  5FKT A;  5EMJ B;  3N0E A;  2CO0 C;  5CYK A;  3EI3 B;  1K32 A;  1L0Q A;  3JRO A;  4XEI C;  3V7D B;  1VYH C;  3RMZ D;  2I3T A;  2EBS A;  5CXC B;  4GGC A;  4QQE A;  4LG8 A;  4FA5 D;  4J77 A;  3RFG A;  2OVR B;  3JRP A;  5EAL A;  5FXY A;  5FQD A;  2YNN A;  2AGY A;  3F3P A;  3AL8 A;  4XYH A;  4N14 A;  2H14 A;  5EAR A;  5B4W A;  3J81 g;  5EML B;  4L3G D;  2Z2N A;  3BG0 A;  3EI4 A;  5C2W B;  4GGA A;  3K27 A;  3RFH A;  5CXB A;  3SBR A;  2H47 A;  3I8E A;  4I79 A;  4X3E A;  4J84 A;  4U1E I;  4GZ8 A;  4L1Q D;  3V9F A;  3OKW A;  4A09 B;  1XHM A;  2P9P C;  4PXW A;  4A0B B;  1U2V C;  2YB8 B;  3FRX A;  1S4U X;  2AQ5 A;  5A2Q g;  4J86 A;  1SQJ A;  3SMR A;  4FHL A;  2J56 H;  4E54 A;  2GC4 A;  3ULE C;  1PGU A;  4CI3 A;  4J73 A;  4J79 A;  4ZOY A;  5HE2 B;  2CE9 A;  5FKS A;  4E5Z A;  4JSP C;  2H9N A;  2HJ4 A;  2YNP A;  3FGB A;  4EWR A;  4A08 A;  5I5J A;  4TZ4 A;  3OW8 A;  5HE0 B;  3OKT A;  2YNO A;  3DSM A;  1GG2 B;  3I8C A;  3IIW A;  3JZG A;  2XU7 A;  4GGD A;  3UVN A;  3UR4 A;  3EI1 A;  1MG2 A;  4FB1 D;  2H13 A;  4J87 A;  3DM0 A;  1Q47 A;  4A7J A;  1ERJ A;  4NSX A;  4FA9 D;  3RN0 D;  2HKM A;  2PM9 A;  4JD2 C;  2HYE A;  3MMY A;  3C99 A;  2H9L A;  3OL2 B;  4O3U B;  3VH0 A;  3SN6 B;  4GM8 A;  1JJU B;  3RN1 D;  3MKS B;  4HDJ A;  2QC5 A;  4CZV A;  3PXT D;  4O9D A;  3EI2 B;  2OIZ A;  4GMB A;  2P9I C;  4J0X A;  4R7A B;  3UVK A;  1U4C A;  4PSW B;  2PM6 B;  3BWS A;  2IWK A;  4KFM B;  4IA9 A;  4A2M A;  2UZY B;  2W18 A;  4GQ1 A;  3FM0 A;  4IMM A;  3JAM g;  2CN3 A;  2AGW A;  5EM2 A;  3IJ0 A;  2CNX A;  3IKO A;  3L4O D;  4A08 B;  5GMK n;  2B4E A;  4ERZ A;  3ORV D;  5H17 A;  3IJ1 A;  3IJC A;  5I5I A;  4XYI A;  2J57 G;  4ZOV A;  3SBP A;  4X63 B;  5HQG A;  1PI6 A;  3EG6 A;  3CFV A;  3RRM C;  3UKR C;  5JWZ A;  5IC7 A;  2QXV A;  1XKS A;  3N0D A;  5I5M A;  5THA A;  5AFU 3;  1MG3 A;  1GP2 B;  5IGQ A;  1SQ9 A;  3JZN A;  4FA4 D;  3DXM C;  3KRW B;  4A0B A;  5KDO B;  2H6K A;  5FLX g;  2H3X A;  4ERQ A;  5CYK B;  3SHF A;  4ZOZ A;  2O9K A;  1GOT B;  3UVO A;  5GXI A;  4GQ2 P;  2PM7 B;  2AGL A;  3PXS D;  3IIY A;  4Z8L A;  3K26 A;  3GFC A;  4BL0 A;  3SVW D;  2I0R A;  3AL8 B;  4ZN4 A;  3BG1 A;  3EMH A;  1N6D A;  2OK6 A;  3SJL D;  1XIP A;  3I7O A;  5EMM B;  4O45 A;  3UKU C;  2XYI A;  1MDA H;  1PBY B;  3PXW D;  5HE3 B;  1K8K C;  3NVX A;  3MKQ A;  2OVP B;  4JSN C;  5AMS A;  2B5L A;  1QNI A;  3EI4 B;  2Q7Q A;  3I7N A;  4OWR A;  5CXB B;  4QL1 A;  1PEV A;  4MK0 B;  3AFC A;  4ERY A;  4A11 A;  4JXM A;  3JPX A;  4JT5 C;  4PNK B;  3DWL C;  4ESG A;  4CC9 A;  2H68 A;  4CI1 A;  2OJY A;  4A0A A;  4ES0 A;  3C75 H;  2IUQ A;  1P22 A;  1NEX B;  1JOF A;  3MZK A;  4JT6 C;  4E54 B;  3SXT D;  5IJ7 E;  5FA5 B;  4QT8 A;  1OMW B;  3OKY B;  3MXX A;  4E5Z B;  1JMX B;  3PVW B;  3B7F A;  3PE7 A;  3EI3 A;  1N6F A;  2HKR A;  5H1M A;  4ZOX A;  2H9M A;  4CI8 A;  5CXC A;  3U4Y A;  2IWF A;  3SCY A;  4CI2 A;  4FA1 D;  4J81 A;  4J82 A;  5C9Z B;  1A0R B;  3OTT A;  3L4M D;  3CIK B;  4H5J A;  4FWW A;  3V5W B;  2CO0 A;  2I3S A;  4PSX B;  3ZWL B;  3EI1 B;  1B9X A;  2YBA A;  3JZH A;  3I7L A;  4LGN A;  2J55 H;  1SHY B;  3EWE A;  4AEZ A;  2IUV A;  4BH6 A;  2IUR A;  2CN2 A;  4CY2 A;  5TF2 A;  2PM9 B;  3I2N A;  4GQB B;  4H5I A;  3F3F A;  2XL2 A;  2I0T A;  2CE8 A;  2H6Q A;  3VGZ A;  5C2V B;  5FKR A;  5AJA A;  5FKQ A;  4Y5R D;  4J8G A;  1N6E A;  3PSL A;  5HE1 B;  3A0F A;  2GNQ A;  3I89 A;  4A09 A;  4GM9 A;  1NR0 A;  2AGZ A;  3I7K A;  4AOW A;  4PC0 A;  4K3I D;  4CY1 A;  2YMU A;  1TBG A;  4OZU A;  5EM2 B;  2AH0 A;  2XL3 A;  5IT9 g;  5IGO A;  3VA6 A;  4J0W A;  2P9N C;  4G56 B;  5GSA A;  3UVM A;  2G9A A;  3SBQ A;  2Z2P A;  2Z2O A;  1OLZ A;  2OVQ B;  4JSV C;  3PVU B;  2BBK H;  3SFZ A;  1JMZ B;  5TEE A;  3NVN A;  4JSX C;  3SLE D;  3E0C A;  2H9P A;  3I7H A;  4L9O A;  4D0K A;  5SXM A;  4CY5 A;  4K3J B;  4J8B A;  4J78 A;  2MTA H;  1R5M A;  2PBI B;  4O1Q D;  2TRC B;  3KRX B;  4CZY A;  1GXR A;  1B9Y A;  3RLM D;  3EU7 A;  5EAP A;  2H6N A;  2HXC A;  2IAA A;  3JB9 L;  3I7P A;  4YVD A;  4CZX A;  2IUP A;  2P9S C;  3OKY A;  3OL2 A;  4FAN D;  5TDH B;  5TEF A;  3GRE A;  3EI2 A;  1FWX A;  4PBZ A;  2UZX B;  3F3G A;  3HFQ A;  1TYQ C;  3CFS B;  4PBY A;  2OK4 A;  4X60 B;  4BUJ C;  3ODT A;  4CY3 A;  3AH8 B;  3J80 g;  3UVL A;  4LG9 A;  4D6V A;  4UI9 R;  2P9K C;  5GXH A;  1RI6 A;  3W15 A;  2AH1 A;  3MZL A;  3P4F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...