3RFGA

Crystal structure of the yeast rack1 dimer in space group p63
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
312
structure length
288
Chain Sequence
VLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRVVNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVFSLAFSPNRYWLAAATATGIKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVIRVWQVMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanine nucleotide-binding protein subunit beta-like protein
publication title Structure of the RACK1 dimer from Saccharomyces cerevisiae
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 48
structure length 288
sequence length 312
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3rfgA00
3DXMC 2EBSA 3PXTD 5TEEA 3EWEA 2YBAA 2B5LA 2AGXA 2H14A 2O9KA 2AQ5A 2CN3A 2B4EA 2PM6B 5FA5B 5I5JA 4H5JA 3OTTA 5HE1B 2H9MA 3FGBA 3C9CA 2IWKA 2MTAH 3ORVD 2BCJB 3BG0A 3IJ0A 4J0XA 5GSAA 4BL0A 5H1MA 4D0KA 1ERJA 3EI2A 3OKYA 4OWRA 2OIZA 2G9AA 4ERYA 5FKQA 3L4MD 2XU7A 3HFQA 1N6EA 2P9UC 3JPXA 2P9NC 3OKYB 4ZOZA 3SXTD 5C2VB 5I5MA 4CY2A 4TZ4A 4CC9A 4E54A 3EI3A 4CY5A 2I3TA 4X63B 3BG1A 4PBYA 3JB9L 4J82A 3SFZA 3SLED 4J81A 4QRJA 4JSNC 4JSVC 2OK4A 5EAPA 3SBPA 2B5NA 1YFQA 2HKMA 3EI1A 3EI3B 3I7OA 5I5IA 4G56B 1PEVA 3SHFA 4GQ2P 3GFCA 2AGWA 3RFHA 4GM3A 2XL3A 3FRXA 5EALA 1PGUA 2IAAA 4A09A 5GXHA 3OW8A 5AMSA 4JSXC 4A0AB 1R5MA 3IIYA 5AJAA 2IUVA 4A09B 5EARA 3NVQA 4CI1A 4JSPC 2UZXB 3AH8B 3OKWA 5EMLB 2AGZA 1JOFA 2H68A 2J56H 4CY3A 3C5MA 4IMMA 5FQDA 3IJCA 4FAND 4AEZA 1N6DA 3OL2A 3C99A 2P9SC 4A7JA 3KRWB 3PE7A 5FKSA 4XYHA 3JAMg 3N0DA 3AFCA 4H5IA 5A2Qg 2UZYB 1PBYB 3V7DB 5IJ8E 1JJUB 4X61B 3OL2B 2OJYA 4XYIA 4PSWB 5HE3B 3RN1D 4ZOXA 3MKSB 2G99A 5IGQA 4O45A 4L3GD 5K19A 5CXCB 3C75H 1U2VC 2I3SA 2P9KC 3UKUC 4JD2C 3SWSD 3SBRA 2YMUA 5TF2A 3JZNA 3JRPA 3IJ1A 4GGDA 4R7AB 4YVDA 4J79A 3UVNA 3PXSD 2CN2A 2YNOA 3V9FA 5GXIA 1L0QA 3I7LA 3I2NA 3GREA 4CZYA 2P9LC 1OLZA 2H3XA 4J0WA 3FM0A 1PI6A 4Y7RA 1GP2B 3BWSA 5EM2A 1U4CA 4J78A 2I0TA 4ZN4A 1FWXA 3MZLA 4AOWA 2AGYA 3SN6B 3EG6A 5JWZA 5HE2B 5EMJB 3JZHA 4ES0A 3EI2B 1K32A 1B9YA 4K3JB 5FLXg 4U1EI 1XIPA 5HE0B 4A08A 1GXRA 4QL1A 3UVKA 4JXMA 3SBQA 4N14A 3DWLC 1SQ9A 4GMBA 3UKRC 1XKSA 4ERQA 4UI9R 2J57G 4K3ID 4EWRA 4A08B 3J80g 3IKOA 2IUQA 4E54B 2CO0C 3SCYA 4O3TB 4GM9A 3W15A 2GC7A 4NSXA 4GGCA 4PXWA 4JT6C 2CNXA 3PXWD 3IIWA 5C9ZB 3VH0A 4ZOVA 3RMZD 3EI1B 3MXXA 2OVPB 2W18A 4CI3A 4Y5RD 5EAMA 4E5ZA 3NVXA 1A0RB 3SMRA 2YNPA 4A0BA 4BUJC 3RFGA 1MG2A 3NVNA 4J8BA 2HJ4A 5IT9g 5HQGA 1N6FA 1TBGA 4MK0B 3F3FA 2GNQA 4X60B 3RRMC 5IJ7E 2YNNA 4Z8LA 2CE9A 1GOTB 5CYKA 4ZOYA 1SHYB 3EI4A 3MZKA 5FXYA 4FA1D 3EMHA 2IWFA 4D6VA 3B7FA 5CXBA 4J87A 4PBZA 5CYKB 3K27A 2HYEA 3K26A 5H17A 2HKRA 3F3GA 3MMYA 2P9PC 2AH0A 3PVWB 2CO0A 3AL8A 4BH6A 3PVUB 2OVQB 2XL2A 4KFMB 2B5MA 2I0RA 1JMZB 1RI6A 2P9IC 5KDOB 2Q7QA 3RLMD 3AL8B 3UVOA 5AFU3 2AH1A 3ODTA 4JT5C 1VYHC 5SXMA 5H14A 4PNKB 3RN0D 3ULEC 2IUPA 4GQ1A 1JMXB 4O1QD 5TDHB 5FKRA 1Q47A 2XYIA 4J73A 3I7KA 2Z2OA 3UVMA 4CY1A 4J84A 2AGLA 2HESX 1TYQC 3I7HA 2H9LA 3PSLA 2Z2PA 4LG9A 2OK6A 3DXKC 3I7NA 5EM2B 3F3PA 4FHLA 4FB1D 4J77A 3JROA 4L1QD 2H13A 2QC5A 4GGAA 4J8GA 5EMMB 1NEXB 1XHMA 4ERZA 3V5WB 2Z2NA 2H6QA 2QXVA 3UR4A 4A11A 4CI2A 3VA6A 2TRCB 3MKQA 2H9PA 4PSXB 1NR0A 3I8CA 4A11B 4J86A 3DSMA 1GG2B 3U4YA 3P4FA 3CFVA 3N0EA 3A0FA 4U7AA 3SVWD 2PM9A 1K8KC 3RSEC 2CE8A 2PM7B 5EMKB 4FWWA 5IGOA 4IA9A 4GZ8A 4A2LA 3I89A 2PM9B 4FA9D 2H9NA 4CZXA 5K1CC 4O3UB 2J55H 4A2MA 5HYNB 5C2WB 4QT8A 4E5ZB 4PC0A 5B4WA 4X3EA 4A0AA 3E0CA 4ESGA 2BBKH 3PSCB 4FAVD 4A0BB 2YB8B 3JZGA 1MDAH 3OKTA 3EU7A 5GMKn 1S4UX 4FA5D 3CFSB 2IURA 3I7PA 1OMWB 1P22A 2PBIB 4XEIC 4FA4D 3EI4B 4GQBB 2OVRB 3J81g 4CI8A 1QNIA 3DM0A 5CXBB 4L3HD 4O9DA 2H47A 4HDJA 2GC4A 3VGZA 4L9OA 4LGNA 2H6NA 3ZWLB 1MG3A 3AL9A 4QQEA 5CXCA 3I8EA 4CZVA 4I79A 5TEFA 5IC7A 3L4OD 2H6KA 3SJLD 4LG8A 4OZUA 3CIKB 3UVLA 5THAA 2HXCA 2I0SA 1B9XA 4GM8A 2HJBA 3KRXB 5FKTA 1SQJA
chains in the Genus database with same CATH superfamily
3DXMC 2EBSA 3PXTD 5TEEA 3EWEA 2YBAA 2B5LA 3OF7A 2AGXA 2H14A 2O9KA 2AQ5A 2CN3A 2B4EA 2PM6B 5FA5B 2QZPA 5I5JA 4H5JA 5E6UA 1U8CA 4NENA 3OTTA 1QFSA 5HE1B 2H9MA 3VI3A 4O02A 2VDPA 3FGBA 3C9CA 2IWKA 2MTAH 3ORVD 2BCJB 3BG0A 3IJ0A 4J0XA 5GSAA 4BL0A 5H1MA 5HDBA 4D0KA 1ERJA 3EI2A 3OKYA 4OWRA 2OIZA 2G9AA 4ERYA 5FKQA 2WQ8A 4AMZA 3L4MD 2XU7A 1GOHA 3HFQA 3IUJA 4G1EA 1N6EA 2P9UC 3O4JA 1BPOA 3JPXA 2P9NC 5M5RA 3OKYB 4ZOZA 3SXTD 3V4VA 3K71A 4BCBA 1C9IA 5C2VB 4O2WA 3MVDK 5I5MA 4CY2A 4TZ4A 4CC9A 4E54A 3EI3A 4CY5A 3GD1I 2I3TA 4X63B 3BG1A 4PBYA 3JB9L 3O4GA 4J82A 3SFZA 3SLED 4J81A 4QRJA 4JSNC 4DNUA 4JSVC 2OK4A 5EAPA 1JV2A 2B5NA 3SBPA 1YFQA 3EQ9A 2HKMA 4QAMA 3EI3B 3I7OA 3EI1A 5I5IA 4G56B 1PEVA 3SHFA 4GQ2P 3GFCA 2AGWA 3RFHA 4AX4A 3GC3B 4GM3A 2XL3A 1JTDB 4NC4A 3FRXA 5EALA 1PGUA 2IAAA 4A09A 1K3IA 5GXHA 3OW8A 4WK4A 3IJEA 5AMSA 4JSXC 4A0AB 1R5MA 3IIYA 5AJAA 2IUVA 3K72A 3K6SA 4A09B 1VE7A 5EARA 3NVQA 4CI1A 4JSPC 2UZXB 3AH8B 3OKWA 5EMLB 2AGZA 1JOFA 2H68A 2J56H 4CY3A 3C5MA 4IMMA 5FQDA 2XZGA 3IJCA 4G1MA 4FAND 4AEZA 1N6DA 3ZDXA 3C99A 3OL2A 2P9SC 4A7JA 3KRWB 3PE7A 5FKSA 4XYHA 3JAMg 3N0DA 3AFCA 1UOQA 4H5IA 5A2Qg 2UZYB 1PBYB 3V7DB 5IJ8E 2EICA 1E8NA 1JJUB 4X61B 1VE6A 3OL2B 2OJYA 4XYIA 4PSWB 5HE3B 3RN1D 4BCDA 4ZOXA 3MKSB 2G99A 5IGQA 4O45A 2VDNA 4L3GD 5K19A 5CXCB 3C75H 1U2VC 2I3SA 2P9KC 5E6RA 4BCCA 1H2XA 1H2WA 4JD2C 3UKUC 3SWSD 3SBRA 3T3PA 2YMUA 5TF2A 3JZNA 3JRPA 2VDKA 3IJ1A 4GGDA 4R7AB 5M5TA 4YVDA 3NIFA 4J79A 3UVNA 3PXSD 2CN2A 2YNOA 3IULA 3V9FA 5GXIA 4MMYA 3T3MA 1L0QA 3I7LA 3I2NA 3GREA 4CZYA 2P9LC 4IRZA 1OLZA 2H3XA 4J0WA 3FM0A 1PI6A 4Y7RA 1GP2B 3BWSA 5EM2A 3IUNA 1U4CA 4J78A 2I0TA 4ZN4A 1FWXA 3MZLA 4AOWA 3DDUA 4UM8A 3NIGA 2AGYA 3SN6B 3EG6A 5JWZA 5HE2B 5EMJB 3JZHA 4AMYA 4ES0A 1K32A 3EI2B 1B9YA 4K3JB 4Z7NA 5FLXg 4U1EI 5M5UA 1XIPA 5HE0B 4A08A 1GXRA 3O4HA 4QL1A 3UVKA 4JXMA 3SBQA 4N14A 3DWLC 1SQ9A 4GMBA 3UKRC 1XKSA 4ERQA 4UI9R 2J57G 1GOFA 4K3ID 3ZDYA 4EWRA 4A08B 3J80g 3IKOA 2IUQA 4E54B 2CO0C 3SCYA 4O3TB 4GM9A 3W15A 2JKXA 2GC7A 2VZ1A 4NSXA 1QFMA 4GGCA 4PXWA 4JT6C 4DNVA 2EIEA 3NIDA 2CNXA 4DNWA 3PXWD 3IIWA 4G55A 4UM9A 5C9ZB 3VH0A 4ZOVA 3RMZD 3EI1B 3MXXA 2OVPB 2VDOA 2W18A 4CI3A 4JHPC 4Y5RD 2EIBA 5EAMA 4E5ZA 4NBMA 3NVXA 1A0RB 3SMRA 2YNPA 4A0BA 4BUJC 4RE5A 3RFGA 3FCUA 4WJKA 3IUMA 1MG2A 3NVNA 1C9LA 4J8BA 2HJ4A 5IT9g 5HQGA 1N6FA 1TBGA 4JHNA 4MK0B 3F3FA 2GNQA 4X60B 3RRMC 5IJ7E 2YNNA 4Z8LA 2CE9A 1GOTB 5CYKA 4ZOYA 1SHYB 3EI4A 3MZKA 3FCSA 5FXYA 4BP8A 4FA1D 3EMHA 1T2XA 2IWFA 4D6VA 3B7FA 5CXBA 4J87A 4PBZA 5CYKB 3K27A 2HYEA 3K26A 5H17A 3IUQA 2HKRA 3F3GA 3MMYA 2P9PC 2AH0A 2HU7A 3PVWB 2CO0A 4L1MA 3AL8A 4BH6A 3PVUB 2OVQB 1H2YA 2XL2A 4KFMB 2B5MA 3QI0A 2I0RA 1JMZB 1RI6A 3MUOA 2P9IC 5KDOB 2Q7QA 3RLMD 3AL8B 3UVOA 5AFU3 2AH1A 3ODTA 4JT5C 1VYHC 5SXMA 3ZE0A 5H14A 4PNKB 3RN0D 3ULEC 1E8MA 5C86A 4Z7QA 2IUPA 4GQ1A 1JMXB 1A12A 4O1QD 5TDHB 5FKRA 1Q47A 2XYIA 4J73A 3I7KA 2Z2OA 3UVMA 4CY1A 3ZDZA 4BP9A 4J84A 2AGLA 2HESX 1TYQC 4RE6A 2HU5A 3I7HA 2H9LA 3PSLA 2Z2PA 2BKLA 4LG9A 2OK6A 3DXKC 3V4PA 3I7NA 5EM2B 3F3PA 4FHLA 2VZ3A 4FB1D 2EIDA 4J77A 1TYEA 3JROA 4L1QD 2H13A 2QC5A 4GGAA 4J8GA 5EMMB 1NEXB 1XHMA 4ERZA 4NAAA 3V5WB 2Z2NA 2H6QA 2QXVA 1E5TA 3UR4A 4A11A 4CI2A 3VA6A 2TRCB 3MKQA 1VZ3A 2H9PA 4PSXB 1NR0A 4MMZA 2VDQA 3I8CA 4A11B 4J86A 3DSMA 1GG2B 5M5VA 5FFOA 4Z7OA 3P4FA 3CFVA 3N0EA 3IVMA 3O4IA 3U4YA 5M61A 1L5GA 3A0FA 4U7AA 2XE4A 3SVWD 2PM9A 1K8KC 3RSEC 2CE8A 2PM7B 5E6SA 5EMKB 4FWWA 3EQ8A 4MMXA 5IGOA 4IA9A 1YR2A 4GZ8A 2VDMA 4AN1A 4A2LA 3I89A 1O6FA 2PM9B 4FA9D 2H9NA 4CZXA 5K1CC 4O3UB 2J55H 4A2MA 5HYNB 5C2WB 4QT8A 3EQ7A 3KCIA 4E5ZB 4PC0A 5B4WA 4X3EA 4A0AA 3E0CA 1H2ZA 4ESGA 2BBKH 3PSCB 4FAVD 4A0BB 1GOGA 2YB8B 3JZGA 1MDAH 3OKTA 3EU7A 2HU8A 5GMKn 4AN0A 1S4UX 4FA5D 1VZ2A 3CFSB 1I2MB 2IURA 3I7PA 1OMWB 1P22A 2PBIB 4XEIC 2QR5A 5FFGA 4FA4D 3EI4B 4GQBB 2OVRB 3J81g 4CI8A 1QNIA 3DM0A 3QHYB 4L3HD 2VC2A 2H47A 4O9DA 5CXBB 1UTCA 4HDJA 5M5SA 2GC4A 3MUNA 3VGZA 1M1XA 3ZE1A 4L9OA 4LGNA 2H6NA 4WK0A 3ZWLB 1MG3A 3AL9A 1UOPA 3ZE2A 4QQEA 2XDWA 5CXCA 3I8EA 4WK2A 4CZVA 4I79A 5TEFA 4D9SA 3VI4A 1UOOA 5IC7A 3L4OD 2H6KA 3SJLD 1O6GA 4LG8A 4OZUA 2VDLA 3CIKB 3UVLA 5THAA 2VDRA 2HXCA 5C92A 2I0SA 1B9XA 4GM8A 3IURA 2HJBA 3KRXB 5FKTA 1SQJA
chains in the Genus database with same CATH topology
3DXMC 2EBSA 3PXTD 5TEEA 3EWEA 2YBAA 2B5LA 2AGXA 2H14A 2O9KA 2AQ5A 2CN3A 2B4EA 2PM6B 5FA5B 5I5JA 4H5JA 3OTTA 5HE1B 2H9MA 3FGBA 3C9CA 2IWKA 2MTAH 3ORVD 2BCJB 3BG0A 3IJ0A 4J0XA 5GSAA 4BL0A 5H1MA 4D0KA 1ERJA 3EI2A 3OKYA 4OWRA 2OIZA 2G9AA 4ERYA 5FKQA 3L4MD 2XU7A 3HFQA 1N6EA 2P9UC 3JPXA 2P9NC 3OKYB 4ZOZA 3SXTD 5C2VB 5I5MA 4CY2A 4TZ4A 4CC9A 4E54A 3EI3A 4CY5A 2I3TA 4X63B 3BG1A 4PBYA 3JB9L 4J82A 3SFZA 3SLED 4J81A 4QRJA 4JSNC 4JSVC 2OK4A 5EAPA 3SBPA 2B5NA 1YFQA 2HKMA 3EI1A 3EI3B 3I7OA 5I5IA 4G56B 1PEVA 3SHFA 4GQ2P 3GFCA 2AGWA 3RFHA 4GM3A 2XL3A 3FRXA 5EALA 1PGUA 2IAAA 4A09A 5GXHA 3OW8A 5AMSA 4JSXC 4A0AB 1R5MA 3IIYA 5AJAA 2IUVA 4A09B 5EARA 3NVQA 4CI1A 4JSPC 2UZXB 3AH8B 3OKWA 5EMLB 2AGZA 1JOFA 2H68A 2J56H 4CY3A 3C5MA 4IMMA 5FQDA 3IJCA 4FAND 4AEZA 1N6DA 3OL2A 3C99A 2P9SC 4A7JA 3KRWB 3PE7A 5FKSA 4XYHA 3JAMg 3N0DA 3AFCA 4H5IA 5A2Qg 2UZYB 1PBYB 3V7DB 5IJ8E 1JJUB 4X61B 3OL2B 2OJYA 4XYIA 4PSWB 5HE3B 3RN1D 4ZOXA 3MKSB 2G99A 5IGQA 4O45A 4L3GD 5K19A 5CXCB 3C75H 1U2VC 2I3SA 2P9KC 3UKUC 4JD2C 3SWSD 3SBRA 2YMUA 5TF2A 3JZNA 3JRPA 3IJ1A 4GGDA 4R7AB 4YVDA 4J79A 3UVNA 3PXSD 2CN2A 2YNOA 3V9FA 5GXIA 1L0QA 3I7LA 3I2NA 3GREA 4CZYA 2P9LC 1OLZA 2H3XA 4J0WA 3FM0A 1PI6A 4Y7RA 1GP2B 3BWSA 5EM2A 1U4CA 4J78A 2I0TA 4ZN4A 1FWXA 3MZLA 4AOWA 2AGYA 3SN6B 3EG6A 5JWZA 5HE2B 5EMJB 3JZHA 4ES0A 3EI2B 1K32A 1B9YA 4K3JB 5FLXg 4U1EI 1XIPA 5HE0B 4A08A 1GXRA 4QL1A 3UVKA 4JXMA 3SBQA 4N14A 3DWLC 1SQ9A 4GMBA 3UKRC 1XKSA 4ERQA 4UI9R 2J57G 4K3ID 4EWRA 4A08B 3J80g 3IKOA 2IUQA 4E54B 2CO0C 3SCYA 4O3TB 4GM9A 3W15A 2GC7A 4NSXA 4GGCA 4PXWA 4JT6C 2CNXA 3PXWD 3IIWA 5C9ZB 3VH0A 4ZOVA 3RMZD 3EI1B 3MXXA 2OVPB 2W18A 4CI3A 4Y5RD 5EAMA 4E5ZA 3NVXA 1A0RB 3SMRA 2YNPA 4A0BA 4BUJC 3RFGA 1MG2A 3NVNA 4J8BA 2HJ4A 5IT9g 5HQGA 1N6FA 1TBGA 4MK0B 3F3FA 2GNQA 4X60B 3RRMC 5IJ7E 2YNNA 4Z8LA 2CE9A 1GOTB 5CYKA 4ZOYA 1SHYB 3EI4A 3MZKA 5FXYA 4FA1D 3EMHA 2IWFA 4D6VA 3B7FA 5CXBA 4J87A 4PBZA 5CYKB 3K27A 2HYEA 3K26A 5H17A 2HKRA 3F3GA 3MMYA 2P9PC 2AH0A 3PVWB 2CO0A 3AL8A 4BH6A 3PVUB 2OVQB 2XL2A 4KFMB 2B5MA 2I0RA 1JMZB 1RI6A 2P9IC 5KDOB 2Q7QA 3RLMD 3AL8B 3UVOA 5AFU3 2AH1A 3ODTA 4JT5C 1VYHC 5SXMA 5H14A 4PNKB 3RN0D 3ULEC 2IUPA 4GQ1A 1JMXB 4O1QD 5TDHB 5FKRA 1Q47A 2XYIA 4J73A 3I7KA 2Z2OA 3UVMA 4CY1A 4J84A 2AGLA 2HESX 1TYQC 3I7HA 2H9LA 3PSLA 2Z2PA 4LG9A 2OK6A 3DXKC 3I7NA 5EM2B 3F3PA 4FHLA 4FB1D 4J77A 3JROA 4L1QD 2H13A 2QC5A 4GGAA 4J8GA 5EMMB 1NEXB 1XHMA 4ERZA 3V5WB 2Z2NA 2H6QA 2QXVA 3UR4A 4A11A 4CI2A 3VA6A 2TRCB 3MKQA 2H9PA 4PSXB 1NR0A 3I8CA 4A11B 4J86A 3DSMA 1GG2B 3U4YA 3P4FA 3CFVA 3N0EA 3A0FA 4U7AA 3SVWD 2PM9A 1K8KC 3RSEC 2CE8A 2PM7B 5EMKB 4FWWA 5IGOA 4IA9A 4GZ8A 4A2LA 3I89A 2PM9B 4FA9D 2H9NA 4CZXA 5K1CC 4O3UB 2J55H 4A2MA 5HYNB 5C2WB 4QT8A 4E5ZB 4PC0A 5B4WA 4X3EA 4A0AA 3E0CA 4ESGA 2BBKH 3PSCB 4FAVD 4A0BB 2YB8B 3JZGA 1MDAH 3OKTA 3EU7A 5GMKn 1S4UX 4FA5D 3CFSB 2IURA 3I7PA 1OMWB 1P22A 2PBIB 4XEIC 4FA4D 3EI4B 4GQBB 2OVRB 3J81g 4CI8A 1QNIA 3DM0A 5CXBB 4L3HD 4O9DA 2H47A 4HDJA 2GC4A 3VGZA 4L9OA 4LGNA 2H6NA 3ZWLB 1MG3A 3AL9A 4QQEA 5CXCA 3I8EA 4CZVA 4I79A 5TEFA 5IC7A 3L4OD 2H6KA 3SJLD 4LG8A 4OZUA 3CIKB 3UVLA 5THAA 2HXCA 2I0SA 1B9XA 4GM8A 2HJBA 3KRXB 5FKTA 1SQJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DXM C;  2EBS A;  3PXT D;  5TEE A;  3EWE A;  2YBA A;  2B5L A;  2AGX A;  2H14 A;  2O9K A;  2AQ5 A;  2CN3 A;  2B4E A;  2PM6 B;  5FA5 B;  5I5J A;  4H5J A;  3OTT A;  5HE1 B;  2H9M A;  3FGB A;  3C9C A;  2IWK A;  2MTA H;  3ORV D;  2BCJ B;  3BG0 A;  3IJ0 A;  4J0X A;  5GSA A;  4BL0 A;  5H1M A;  4D0K A;  1ERJ A;  3EI2 A;  3OKY A;  4OWR A;  2OIZ A;  2G9A A;  4ERY A;  5FKQ A;  3L4M D;  2XU7 A;  3HFQ A;  1N6E A;  2P9U C;  3JPX A;  2P9N C;  3OKY B;  4ZOZ A;  3SXT D;  5C2V B;  5I5M A;  4CY2 A;  4TZ4 A;  4CC9 A;  4E54 A;  3EI3 A;  4CY5 A;  2I3T A;  4X63 B;  3BG1 A;  4PBY A;  3JB9 L;  4J82 A;  3SFZ A;  3SLE D;  4J81 A;  4QRJ A;  4JSN C;  4JSV C;  2OK4 A;  5EAP A;  3SBP A;  2B5N A;  1YFQ A;  2HKM A;  3EI1 A;  3EI3 B;  3I7O A;  5I5I A;  4G56 B;  1PEV A;  3SHF A;  4GQ2 P;  3GFC A;  2AGW A;  3RFH A;  4GM3 A;  2XL3 A;  3FRX A;  5EAL A;  1PGU A;  2IAA A;  4A09 A;  5GXH A;  3OW8 A;  5AMS A;  4JSX C;  4A0A B;  1R5M A;  3IIY A;  5AJA A;  2IUV A;  4A09 B;  5EAR A;  3NVQ A;  4CI1 A;  4JSP C;  2UZX B;  3AH8 B;  3OKW A;  5EML B;  2AGZ A;  1JOF A;  2H68 A;  2J56 H;  4CY3 A;  3C5M A;  4IMM A;  5FQD A;  3IJC A;  4FAN D;  4AEZ A;  1N6D A;  3OL2 A;  3C99 A;  2P9S C;  4A7J A;  3KRW B;  3PE7 A;  5FKS A;  4XYH A;  3JAM g;  3N0D A;  3AFC A;  4H5I A;  5A2Q g;  2UZY B;  1PBY B;  3V7D B;  5IJ8 E;  1JJU B;  4X61 B;  3OL2 B;  2OJY A;  4XYI A;  4PSW B;  5HE3 B;  3RN1 D;  4ZOX A;  3MKS B;  2G99 A;  5IGQ A;  4O45 A;  4L3G D;  5K19 A;  5CXC B;  3C75 H;  1U2V C;  2I3S A;  2P9K C;  3UKU C;  4JD2 C;  3SWS D;  3SBR A;  2YMU A;  5TF2 A;  3JZN A;  3JRP A;  3IJ1 A;  4GGD A;  4R7A B;  4YVD A;  4J79 A;  3UVN A;  3PXS D;  2CN2 A;  2YNO A;  3V9F A;  5GXI A;  1L0Q A;  3I7L A;  3I2N A;  3GRE A;  4CZY A;  2P9L C;  1OLZ A;  2H3X A;  4J0W A;  3FM0 A;  1PI6 A;  4Y7R A;  1GP2 B;  3BWS A;  5EM2 A;  1U4C A;  4J78 A;  2I0T A;  4ZN4 A;  1FWX A;  3MZL A;  4AOW A;  2AGY A;  3SN6 B;  3EG6 A;  5JWZ A;  5HE2 B;  5EMJ B;  3JZH A;  4ES0 A;  3EI2 B;  1K32 A;  1B9Y A;  4K3J B;  5FLX g;  4U1E I;  1XIP A;  5HE0 B;  4A08 A;  1GXR A;  4QL1 A;  3UVK A;  4JXM A;  3SBQ A;  4N14 A;  3DWL C;  1SQ9 A;  4GMB A;  3UKR C;  1XKS A;  4ERQ A;  4UI9 R;  2J57 G;  4K3I D;  4EWR A;  4A08 B;  3J80 g;  3IKO A;  2IUQ A;  4E54 B;  2CO0 C;  3SCY A;  4O3T B;  4GM9 A;  3W15 A;  2GC7 A;  4NSX A;  4GGC A;  4PXW A;  4JT6 C;  2CNX A;  3PXW D;  3IIW A;  5C9Z B;  3VH0 A;  4ZOV A;  3RMZ D;  3EI1 B;  3MXX A;  2OVP B;  2W18 A;  4CI3 A;  4Y5R D;  5EAM A;  4E5Z A;  3NVX A;  1A0R B;  3SMR A;  2YNP A;  4A0B A;  4BUJ C;  3RFG A;  1MG2 A;  3NVN A;  4J8B A;  2HJ4 A;  5IT9 g;  5HQG A;  1N6F A;  1TBG A;  4MK0 B;  3F3F A;  2GNQ A;  4X60 B;  3RRM C;  5IJ7 E;  2YNN A;  4Z8L A;  2CE9 A;  1GOT B;  5CYK A;  4ZOY A;  1SHY B;  3EI4 A;  3MZK A;  5FXY A;  4FA1 D;  3EMH A;  2IWF A;  4D6V A;  3B7F A;  5CXB A;  4J87 A;  4PBZ A;  5CYK B;  3K27 A;  2HYE A;  3K26 A;  5H17 A;  2HKR A;  3F3G A;  3MMY A;  2P9P C;  2AH0 A;  3PVW B;  2CO0 A;  3AL8 A;  4BH6 A;  3PVU B;  2OVQ B;  2XL2 A;  4KFM B;  2B5M A;  2I0R A;  1JMZ B;  1RI6 A;  2P9I C;  5KDO B;  2Q7Q A;  3RLM D;  3AL8 B;  3UVO A;  5AFU 3;  2AH1 A;  3ODT A;  4JT5 C;  1VYH C;  5SXM A;  5H14 A;  4PNK B;  3RN0 D;  3ULE C;  2IUP A;  4GQ1 A;  1JMX B;  4O1Q D;  5TDH B;  5FKR A;  1Q47 A;  2XYI A;  4J73 A;  3I7K A;  2Z2O A;  3UVM A;  4CY1 A;  4J84 A;  2AGL A;  2HES X;  1TYQ C;  3I7H A;  2H9L A;  3PSL A;  2Z2P A;  4LG9 A;  2OK6 A;  3DXK C;  3I7N A;  5EM2 B;  3F3P A;  4FHL A;  4FB1 D;  4J77 A;  3JRO A;  4L1Q D;  2H13 A;  2QC5 A;  4GGA A;  4J8G A;  5EMM B;  1NEX B;  1XHM A;  4ERZ A;  3V5W B;  2Z2N A;  2H6Q A;  2QXV A;  3UR4 A;  4A11 A;  4CI2 A;  3VA6 A;  2TRC B;  3MKQ A;  2H9P A;  4PSX B;  1NR0 A;  3I8C A;  4A11 B;  4J86 A;  3DSM A;  1GG2 B;  3U4Y A;  3P4F A;  3CFV A;  3N0E A;  3A0F A;  4U7A A;  3SVW D;  2PM9 A;  1K8K C;  3RSE C;  2CE8 A;  2PM7 B;  5EMK B;  4FWW A;  5IGO A;  4IA9 A;  4GZ8 A;  4A2L A;  3I89 A;  2PM9 B;  4FA9 D;  2H9N A;  4CZX A;  5K1C C;  4O3U B;  2J55 H;  4A2M A;  5HYN B;  5C2W B;  4QT8 A;  4E5Z B;  4PC0 A;  5B4W A;  4X3E A;  4A0A A;  3E0C A;  4ESG A;  2BBK H;  3PSC B;  4FAV D;  4A0B B;  2YB8 B;  3JZG A;  1MDA H;  3OKT A;  3EU7 A;  5GMK n;  1S4U X;  4FA5 D;  3CFS B;  2IUR A;  3I7P A;  1OMW B;  1P22 A;  2PBI B;  4XEI C;  4FA4 D;  3EI4 B;  4GQB B;  2OVR B;  3J81 g;  4CI8 A;  1QNI A;  3DM0 A;  5CXB B;  4L3H D;  4O9D A;  2H47 A;  4HDJ A;  2GC4 A;  3VGZ A;  4L9O A;  4LGN A;  2H6N A;  3ZWL B;  1MG3 A;  3AL9 A;  4QQE A;  5CXC A;  3I8E A;  4CZV A;  4I79 A;  5TEF A;  5IC7 A;  3L4O D;  2H6K A;  3SJL D;  4LG8 A;  4OZU A;  3CIK B;  3UVL A;  5THA A;  2HXC A;  2I0S A;  1B9X A;  4GM8 A;  2HJB A;  3KRX B;  5FKT A;  1SQJ A; 
#chains in the Genus database with same CATH topology
 3DXM C;  2EBS A;  3PXT D;  5TEE A;  3EWE A;  2YBA A;  2B5L A;  3OF7 A;  2AGX A;  2H14 A;  2O9K A;  2AQ5 A;  2CN3 A;  2B4E A;  2PM6 B;  5FA5 B;  2QZP A;  5I5J A;  4H5J A;  5E6U A;  1U8C A;  4NEN A;  3OTT A;  1QFS A;  5HE1 B;  2H9M A;  3VI3 A;  4O02 A;  2VDP A;  3FGB A;  3C9C A;  2IWK A;  2MTA H;  3ORV D;  2BCJ B;  3BG0 A;  3IJ0 A;  4J0X A;  5GSA A;  4BL0 A;  5H1M A;  5HDB A;  4D0K A;  1ERJ A;  3EI2 A;  3OKY A;  4OWR A;  2OIZ A;  2G9A A;  4ERY A;  5FKQ A;  2WQ8 A;  4AMZ A;  3L4M D;  2XU7 A;  1GOH A;  3HFQ A;  3IUJ A;  4G1E A;  1N6E A;  2P9U C;  3O4J A;  1BPO A;  3JPX A;  2P9N C;  5M5R A;  3OKY B;  4ZOZ A;  3SXT D;  3V4V A;  3K71 A;  4BCB A;  1C9I A;  5C2V B;  4O2W A;  3MVD K;  5I5M A;  4CY2 A;  4TZ4 A;  4CC9 A;  4E54 A;  3EI3 A;  4CY5 A;  3GD1 I;  2I3T A;  4X63 B;  3BG1 A;  4PBY A;  3JB9 L;  3O4G A;  4J82 A;  3SFZ A;  3SLE D;  4J81 A;  4QRJ A;  4JSN C;  4DNU A;  4JSV C;  2OK4 A;  5EAP A;  1JV2 A;  2B5N A;  3SBP A;  1YFQ A;  3EQ9 A;  2HKM A;  4QAM A;  3EI3 B;  3I7O A;  3EI1 A;  5I5I A;  4G56 B;  1PEV A;  3SHF A;  4GQ2 P;  3GFC A;  2AGW A;  3RFH A;  4AX4 A;  3GC3 B;  4GM3 A;  2XL3 A;  1JTD B;  4NC4 A;  3FRX A;  5EAL A;  1PGU A;  2IAA A;  4A09 A;  1K3I A;  5GXH A;  3OW8 A;  4WK4 A;  3IJE A;  5AMS A;  4JSX C;  4A0A B;  1R5M A;  3IIY A;  5AJA A;  2IUV A;  3K72 A;  3K6S A;  4A09 B;  1VE7 A;  5EAR A;  3NVQ A;  4CI1 A;  4JSP C;  2UZX B;  3AH8 B;  3OKW A;  5EML B;  2AGZ A;  1JOF A;  2H68 A;  2J56 H;  4CY3 A;  3C5M A;  4IMM A;  5FQD A;  2XZG A;  3IJC A;  4G1M A;  4FAN D;  4AEZ A;  1N6D A;  3ZDX A;  3C99 A;  3OL2 A;  2P9S C;  4A7J A;  3KRW B;  3PE7 A;  5FKS A;  4XYH A;  3JAM g;  3N0D A;  3AFC A;  1UOQ A;  4H5I A;  5A2Q g;  2UZY B;  1PBY B;  3V7D B;  5IJ8 E;  2EIC A;  1E8N A;  1JJU B;  4X61 B;  1VE6 A;  3OL2 B;  2OJY A;  4XYI A;  4PSW B;  5HE3 B;  3RN1 D;  4BCD A;  4ZOX A;  3MKS B;  2G99 A;  5IGQ A;  4O45 A;  2VDN A;  4L3G D;  5K19 A;  5CXC B;  3C75 H;  1U2V C;  2I3S A;  2P9K C;  5E6R A;  4BCC A;  1H2X A;  1H2W A;  4JD2 C;  3UKU C;  3SWS D;  3SBR A;  3T3P A;  2YMU A;  5TF2 A;  3JZN A;  3JRP A;  2VDK A;  3IJ1 A;  4GGD A;  4R7A B;  5M5T A;  4YVD A;  3NIF A;  4J79 A;  3UVN A;  3PXS D;  2CN2 A;  2YNO A;  3IUL A;  3V9F A;  5GXI A;  4MMY A;  3T3M A;  1L0Q A;  3I7L A;  3I2N A;  3GRE A;  4CZY A;  2P9L C;  4IRZ A;  1OLZ A;  2H3X A;  4J0W A;  3FM0 A;  1PI6 A;  4Y7R A;  1GP2 B;  3BWS A;  5EM2 A;  3IUN A;  1U4C A;  4J78 A;  2I0T A;  4ZN4 A;  1FWX A;  3MZL A;  4AOW A;  3DDU A;  4UM8 A;  3NIG A;  2AGY A;  3SN6 B;  3EG6 A;  5JWZ A;  5HE2 B;  5EMJ B;  3JZH A;  4AMY A;  4ES0 A;  1K32 A;  3EI2 B;  1B9Y A;  4K3J B;  4Z7N A;  5FLX g;  4U1E I;  5M5U A;  1XIP A;  5HE0 B;  4A08 A;  1GXR A;  3O4H A;  4QL1 A;  3UVK A;  4JXM A;  3SBQ A;  4N14 A;  3DWL C;  1SQ9 A;  4GMB A;  3UKR C;  1XKS A;  4ERQ A;  4UI9 R;  2J57 G;  1GOF A;  4K3I D;  3ZDY A;  4EWR A;  4A08 B;  3J80 g;  3IKO A;  2IUQ A;  4E54 B;  2CO0 C;  3SCY A;  4O3T B;  4GM9 A;  3W15 A;  2JKX A;  2GC7 A;  2VZ1 A;  4NSX A;  1QFM A;  4GGC A;  4PXW A;  4JT6 C;  4DNV A;  2EIE A;  3NID A;  2CNX A;  4DNW A;  3PXW D;  3IIW A;  4G55 A;  4UM9 A;  5C9Z B;  3VH0 A;  4ZOV A;  3RMZ D;  3EI1 B;  3MXX A;  2OVP B;  2VDO A;  2W18 A;  4CI3 A;  4JHP C;  4Y5R D;  2EIB A;  5EAM A;  4E5Z A;  4NBM A;  3NVX A;  1A0R B;  3SMR A;  2YNP A;  4A0B A;  4BUJ C;  4RE5 A;  3RFG A;  3FCU A;  4WJK A;  3IUM A;  1MG2 A;  3NVN A;  1C9L A;  4J8B A;  2HJ4 A;  5IT9 g;  5HQG A;  1N6F A;  1TBG A;  4JHN A;  4MK0 B;  3F3F A;  2GNQ A;  4X60 B;  3RRM C;  5IJ7 E;  2YNN A;  4Z8L A;  2CE9 A;  1GOT B;  5CYK A;  4ZOY A;  1SHY B;  3EI4 A;  3MZK A;  3FCS A;  5FXY A;  4BP8 A;  4FA1 D;  3EMH A;  1T2X A;  2IWF A;  4D6V A;  3B7F A;  5CXB A;  4J87 A;  4PBZ A;  5CYK B;  3K27 A;  2HYE A;  3K26 A;  5H17 A;  3IUQ A;  2HKR A;  3F3G A;  3MMY A;  2P9P C;  2AH0 A;  2HU7 A;  3PVW B;  2CO0 A;  4L1M A;  3AL8 A;  4BH6 A;  3PVU B;  2OVQ B;  1H2Y A;  2XL2 A;  4KFM B;  2B5M A;  3QI0 A;  2I0R A;  1JMZ B;  1RI6 A;  3MUO A;  2P9I C;  5KDO B;  2Q7Q A;  3RLM D;  3AL8 B;  3UVO A;  5AFU 3;  2AH1 A;  3ODT A;  4JT5 C;  1VYH C;  5SXM A;  3ZE0 A;  5H14 A;  4PNK B;  3RN0 D;  3ULE C;  1E8M A;  5C86 A;  4Z7Q A;  2IUP A;  4GQ1 A;  1JMX B;  1A12 A;  4O1Q D;  5TDH B;  5FKR A;  1Q47 A;  2XYI A;  4J73 A;  3I7K A;  2Z2O A;  3UVM A;  4CY1 A;  3ZDZ A;  4BP9 A;  4J84 A;  2AGL A;  2HES X;  1TYQ C;  4RE6 A;  2HU5 A;  3I7H A;  2H9L A;  3PSL A;  2Z2P A;  2BKL A;  4LG9 A;  2OK6 A;  3DXK C;  3V4P A;  3I7N A;  5EM2 B;  3F3P A;  4FHL A;  2VZ3 A;  4FB1 D;  2EID A;  4J77 A;  1TYE A;  3JRO A;  4L1Q D;  2H13 A;  2QC5 A;  4GGA A;  4J8G A;  5EMM B;  1NEX B;  1XHM A;  4ERZ A;  4NAA A;  3V5W B;  2Z2N A;  2H6Q A;  2QXV A;  1E5T A;  3UR4 A;  4A11 A;  4CI2 A;  3VA6 A;  2TRC B;  3MKQ A;  1VZ3 A;  2H9P A;  4PSX B;  1NR0 A;  4MMZ A;  2VDQ A;  3I8C A;  4A11 B;  4J86 A;  3DSM A;  1GG2 B;  5M5V A;  5FFO A;  4Z7O A;  3P4F A;  3CFV A;  3N0E A;  3IVM A;  3O4I A;  3U4Y A;  5M61 A;  1L5G A;  3A0F A;  4U7A A;  2XE4 A;  3SVW D;  2PM9 A;  1K8K C;  3RSE C;  2CE8 A;  2PM7 B;  5E6S A;  5EMK B;  4FWW A;  3EQ8 A;  4MMX A;  5IGO A;  4IA9 A;  1YR2 A;  4GZ8 A;  2VDM A;  4AN1 A;  4A2L A;  3I89 A;  1O6F A;  2PM9 B;  4FA9 D;  2H9N A;  4CZX A;  5K1C C;  4O3U B;  2J55 H;  4A2M A;  5HYN B;  5C2W B;  4QT8 A;  3EQ7 A;  3KCI A;  4E5Z B;  4PC0 A;  5B4W A;  4X3E A;  4A0A A;  3E0C A;  1H2Z A;  4ESG A;  2BBK H;  3PSC B;  4FAV D;  4A0B B;  1GOG A;  2YB8 B;  3JZG A;  1MDA H;  3OKT A;  3EU7 A;  2HU8 A;  5GMK n;  4AN0 A;  1S4U X;  4FA5 D;  1VZ2 A;  3CFS B;  1I2M B;  2IUR A;  3I7P A;  1OMW B;  1P22 A;  2PBI B;  4XEI C;  2QR5 A;  5FFG A;  4FA4 D;  3EI4 B;  4GQB B;  2OVR B;  3J81 g;  4CI8 A;  1QNI A;  3DM0 A;  3QHY B;  4L3H D;  2VC2 A;  2H47 A;  4O9D A;  5CXB B;  1UTC A;  4HDJ A;  5M5S A;  2GC4 A;  3MUN A;  3VGZ A;  1M1X A;  3ZE1 A;  4L9O A;  4LGN A;  2H6N A;  4WK0 A;  3ZWL B;  1MG3 A;  3AL9 A;  1UOP A;  3ZE2 A;  4QQE A;  2XDW A;  5CXC A;  3I8E A;  4WK2 A;  4CZV A;  4I79 A;  5TEF A;  4D9S A;  3VI4 A;  1UOO A;  5IC7 A;  3L4O D;  2H6K A;  3SJL D;  1O6G A;  4LG8 A;  4OZU A;  2VDL A;  3CIK B;  3UVL A;  5THA A;  2VDR A;  2HXC A;  5C92 A;  2I0S A;  1B9X A;  4GM8 A;  3IUR A;  2HJB A;  3KRX B;  5FKT A;  1SQJ A; 
#chains in the Genus database with same CATH homology
 3DXM C;  2EBS A;  3PXT D;  5TEE A;  3EWE A;  2YBA A;  2B5L A;  2AGX A;  2H14 A;  2O9K A;  2AQ5 A;  2CN3 A;  2B4E A;  2PM6 B;  5FA5 B;  5I5J A;  4H5J A;  3OTT A;  5HE1 B;  2H9M A;  3FGB A;  3C9C A;  2IWK A;  2MTA H;  3ORV D;  2BCJ B;  3BG0 A;  3IJ0 A;  4J0X A;  5GSA A;  4BL0 A;  5H1M A;  4D0K A;  1ERJ A;  3EI2 A;  3OKY A;  4OWR A;  2OIZ A;  2G9A A;  4ERY A;  5FKQ A;  3L4M D;  2XU7 A;  3HFQ A;  1N6E A;  2P9U C;  3JPX A;  2P9N C;  3OKY B;  4ZOZ A;  3SXT D;  5C2V B;  5I5M A;  4CY2 A;  4TZ4 A;  4CC9 A;  4E54 A;  3EI3 A;  4CY5 A;  2I3T A;  4X63 B;  3BG1 A;  4PBY A;  3JB9 L;  4J82 A;  3SFZ A;  3SLE D;  4J81 A;  4QRJ A;  4JSN C;  4JSV C;  2OK4 A;  5EAP A;  3SBP A;  2B5N A;  1YFQ A;  2HKM A;  3EI1 A;  3EI3 B;  3I7O A;  5I5I A;  4G56 B;  1PEV A;  3SHF A;  4GQ2 P;  3GFC A;  2AGW A;  3RFH A;  4GM3 A;  2XL3 A;  3FRX A;  5EAL A;  1PGU A;  2IAA A;  4A09 A;  5GXH A;  3OW8 A;  5AMS A;  4JSX C;  4A0A B;  1R5M A;  3IIY A;  5AJA A;  2IUV A;  4A09 B;  5EAR A;  3NVQ A;  4CI1 A;  4JSP C;  2UZX B;  3AH8 B;  3OKW A;  5EML B;  2AGZ A;  1JOF A;  2H68 A;  2J56 H;  4CY3 A;  3C5M A;  4IMM A;  5FQD A;  3IJC A;  4FAN D;  4AEZ A;  1N6D A;  3OL2 A;  3C99 A;  2P9S C;  4A7J A;  3KRW B;  3PE7 A;  5FKS A;  4XYH A;  3JAM g;  3N0D A;  3AFC A;  4H5I A;  5A2Q g;  2UZY B;  1PBY B;  3V7D B;  5IJ8 E;  1JJU B;  4X61 B;  3OL2 B;  2OJY A;  4XYI A;  4PSW B;  5HE3 B;  3RN1 D;  4ZOX A;  3MKS B;  2G99 A;  5IGQ A;  4O45 A;  4L3G D;  5K19 A;  5CXC B;  3C75 H;  1U2V C;  2I3S A;  2P9K C;  3UKU C;  4JD2 C;  3SWS D;  3SBR A;  2YMU A;  5TF2 A;  3JZN A;  3JRP A;  3IJ1 A;  4GGD A;  4R7A B;  4YVD A;  4J79 A;  3UVN A;  3PXS D;  2CN2 A;  2YNO A;  3V9F A;  5GXI A;  1L0Q A;  3I7L A;  3I2N A;  3GRE A;  4CZY A;  2P9L C;  1OLZ A;  2H3X A;  4J0W A;  3FM0 A;  1PI6 A;  4Y7R A;  1GP2 B;  3BWS A;  5EM2 A;  1U4C A;  4J78 A;  2I0T A;  4ZN4 A;  1FWX A;  3MZL A;  4AOW A;  2AGY A;  3SN6 B;  3EG6 A;  5JWZ A;  5HE2 B;  5EMJ B;  3JZH A;  4ES0 A;  3EI2 B;  1K32 A;  1B9Y A;  4K3J B;  5FLX g;  4U1E I;  1XIP A;  5HE0 B;  4A08 A;  1GXR A;  4QL1 A;  3UVK A;  4JXM A;  3SBQ A;  4N14 A;  3DWL C;  1SQ9 A;  4GMB A;  3UKR C;  1XKS A;  4ERQ A;  4UI9 R;  2J57 G;  4K3I D;  4EWR A;  4A08 B;  3J80 g;  3IKO A;  2IUQ A;  4E54 B;  2CO0 C;  3SCY A;  4O3T B;  4GM9 A;  3W15 A;  2GC7 A;  4NSX A;  4GGC A;  4PXW A;  4JT6 C;  2CNX A;  3PXW D;  3IIW A;  5C9Z B;  3VH0 A;  4ZOV A;  3RMZ D;  3EI1 B;  3MXX A;  2OVP B;  2W18 A;  4CI3 A;  4Y5R D;  5EAM A;  4E5Z A;  3NVX A;  1A0R B;  3SMR A;  2YNP A;  4A0B A;  4BUJ C;  3RFG A;  1MG2 A;  3NVN A;  4J8B A;  2HJ4 A;  5IT9 g;  5HQG A;  1N6F A;  1TBG A;  4MK0 B;  3F3F A;  2GNQ A;  4X60 B;  3RRM C;  5IJ7 E;  2YNN A;  4Z8L A;  2CE9 A;  1GOT B;  5CYK A;  4ZOY A;  1SHY B;  3EI4 A;  3MZK A;  5FXY A;  4FA1 D;  3EMH A;  2IWF A;  4D6V A;  3B7F A;  5CXB A;  4J87 A;  4PBZ A;  5CYK B;  3K27 A;  2HYE A;  3K26 A;  5H17 A;  2HKR A;  3F3G A;  3MMY A;  2P9P C;  2AH0 A;  3PVW B;  2CO0 A;  3AL8 A;  4BH6 A;  3PVU B;  2OVQ B;  2XL2 A;  4KFM B;  2B5M A;  2I0R A;  1JMZ B;  1RI6 A;  2P9I C;  5KDO B;  2Q7Q A;  3RLM D;  3AL8 B;  3UVO A;  5AFU 3;  2AH1 A;  3ODT A;  4JT5 C;  1VYH C;  5SXM A;  5H14 A;  4PNK B;  3RN0 D;  3ULE C;  2IUP A;  4GQ1 A;  1JMX B;  4O1Q D;  5TDH B;  5FKR A;  1Q47 A;  2XYI A;  4J73 A;  3I7K A;  2Z2O A;  3UVM A;  4CY1 A;  4J84 A;  2AGL A;  2HES X;  1TYQ C;  3I7H A;  2H9L A;  3PSL A;  2Z2P A;  4LG9 A;  2OK6 A;  3DXK C;  3I7N A;  5EM2 B;  3F3P A;  4FHL A;  4FB1 D;  4J77 A;  3JRO A;  4L1Q D;  2H13 A;  2QC5 A;  4GGA A;  4J8G A;  5EMM B;  1NEX B;  1XHM A;  4ERZ A;  3V5W B;  2Z2N A;  2H6Q A;  2QXV A;  3UR4 A;  4A11 A;  4CI2 A;  3VA6 A;  2TRC B;  3MKQ A;  2H9P A;  4PSX B;  1NR0 A;  3I8C A;  4A11 B;  4J86 A;  3DSM A;  1GG2 B;  3U4Y A;  3P4F A;  3CFV A;  3N0E A;  3A0F A;  4U7A A;  3SVW D;  2PM9 A;  1K8K C;  3RSE C;  2CE8 A;  2PM7 B;  5EMK B;  4FWW A;  5IGO A;  4IA9 A;  4GZ8 A;  4A2L A;  3I89 A;  2PM9 B;  4FA9 D;  2H9N A;  4CZX A;  5K1C C;  4O3U B;  2J55 H;  4A2M A;  5HYN B;  5C2W B;  4QT8 A;  4E5Z B;  4PC0 A;  5B4W A;  4X3E A;  4A0A A;  3E0C A;  4ESG A;  2BBK H;  3PSC B;  4FAV D;  4A0B B;  2YB8 B;  3JZG A;  1MDA H;  3OKT A;  3EU7 A;  5GMK n;  1S4U X;  4FA5 D;  3CFS B;  2IUR A;  3I7P A;  1OMW B;  1P22 A;  2PBI B;  4XEI C;  4FA4 D;  3EI4 B;  4GQB B;  2OVR B;  3J81 g;  4CI8 A;  1QNI A;  3DM0 A;  5CXB B;  4L3H D;  4O9D A;  2H47 A;  4HDJ A;  2GC4 A;  3VGZ A;  4L9O A;  4LGN A;  2H6N A;  3ZWL B;  1MG3 A;  3AL9 A;  4QQE A;  5CXC A;  3I8E A;  4CZV A;  4I79 A;  5TEF A;  5IC7 A;  3L4O D;  2H6K A;  3SJL D;  4LG8 A;  4OZU A;  3CIK B;  3UVL A;  5THA A;  2HXC A;  2I0S A;  1B9X A;  4GM8 A;  2HJB A;  3KRX B;  5FKT A;  1SQJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...