3RFGA

Crystal structure of the yeast rack1 dimer in space group p63
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
312
structure length
288
Chain Sequence
VLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRVVNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVFSLAFSPNRYWLAAATATGIKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVIRVWQVMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Guanine nucleotide-binding protein subunit beta-like protein
publication title Structure of the RACK1 dimer from Saccharomyces cerevisiae
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 48
structure length 288
sequence length 312
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3rfgA00
5GMKn 2H9LA 4J8GA 5CXBA 1XKSA 1A0RB 3IIYA 2HYEA 2QXVA 4GGCA 5JWZA 4K3ID 5SXMA 2OIZA 2OVQB 3AFCA 3RLMD 4A0BB 1RI6A 2B5MA 3SLED 4CI1A 4X63B 3KRXB 3OTTA 2AGWA 2PM9A 2B5LA 5H17A 5TF2A 5HQGA 1U2VC 4GM9A 3FRXA 1N6DA 4ERZA 2IUVA 2HJ4A 4PSXB 4Y7RA 1JMZB 4H5IA 4XYHA 4TZ4A 1JOFA 4R7AB 5IGOA 5TEFA 2AH1A 4CZXA 3I8CA 4O1QD 1K8KC 1JMXB 3I7KA 3I89A 5HE3B 4JT5C 4CY3A 3HFQA 1GXRA 1SHYB 1GOTB 3GREA 4IMMA 3SWSD 4A2LA 2IAAA 3A0FA 3PVWB 2H6NA 4H5JA 4HDJA 2I3SA 4J81A 4MK0B 2EBSA 3VA6A 5FKSA 5FLXg 3UKRC 4BUJC 2IUQA 5H14A 4A09B 2H13A 4L3GD 2AGXA 4CI8A 3W15A 1K32A 4X60B 4GQ1A 3K27A 3V5WB 5EAPA 2YNOA 4ZOXA 3FM0A 2G9AA 4E5ZB 4A2MA 2CE8A 3CFSB 2B5NA 4J73A 1N6EA 4GMBA 4GGAA 1R5MA 4D6VA 3F3PA 2CNXA 1U4CA 3F3FA 4J86A 1PBYB 1QNIA 4FB1D 5C9ZB 3SBPA 3VH0A 4IA9A 3ZWLB 2YNPA 2Q7QA 4OWRA 3JZHA 1B9YA 3SCYA 5GXHA 2I0SA 2AGYA 4O3UB 4JXMA 4QQEA 2XL2A 5GSAA 2BCJB 3V9FA 3DSMA 4A0AA 4J82A 4PSWB 4FA9D 3IJ0A 4BL0A 4JT6C 3RN0D 4ES0A 1MG2A 4PXWA 4EWRA 4ERQA 1MG3A 2CN3A 1TYQC 4E54A 5AJAA 2P9NC 3UKUC 3MKSB 3EU7A 5AFU3 3PXSD 3EI2B 3RFGA 4CY1A 5GXIA 4QT8A 2P9LC 5I5JA 3EMHA 4FAVD 3OKYA 2H68A 2Z2PA 5FXYA 2UZXB 3ORVD 4KFMB 4J8BA 2J57G 4LG8A 3PSCB 3PXTD 3UVNA 3OW8A 3FGBA 2P9PC 4O9DA 4JSNC 3UVKA 3AL8A 4YVDA 1VYHC 3V7DB 1GG2B 5FKQA 2OVRB 5IC7A 4ZOVA 5HE1B 4JSVC 2MTAH 2P9UC 3E0CA 4JSPC 3SN6B 4ZN4A 4Z8LA 5I5MA 4QRJA 2H14A 3OKWA 3MZLA 3EI3B 5AMSA 4ESGA 3SXTD 1OLZA 4A0BA 4BH6A 5EALA 5EAMA 4CI3A 4A7JA 3C9CA 2IUPA 3ULEC 5A2Qg 3BWSA 4U1EI 2OVPB 2I0TA 3SFZA 3MZKA 2W18A 1N6FA 5EMLB 2HJBA 3DXMC 2XYIA 4XEIC 4CY2A 2IWFA 2OK4A 3DXKC 3RFHA 3SBRA 4J87A 4A11B 3UVMA 3IJCA 2P9SC 5K1CC 3CIKB 3EI1B 4L9OA 4CC9A 2J55H 3JROA 3I7NA 3UVOA 3JB9L 4PNKB 2GNQA 3J80g 2J56H 3J81g 3EI4B 4O45A 1NEXB 2OJYA 3C75H 2CE9A 2GC4A 4ZOYA 4I79A 1ERJA 4QL1A 2AQ5A 2AGLA 4J79A 3RSEC 5HYNB 4FA1D 3N0EA 4A09A 4A08B 3JRPA 3JZGA 5H1MA 5IGQA 3PXWD 5CXBB 1B9XA 4AOWA 4J0WA 3B7FA 3RRMC 2G99A 4JD2C 3SJLD 4ERYA 4N14A 5C2VB 5HE0B 3I2NA 3DWLC 4E5ZA 1MDAH 1L0QA 5IJ7E 5THAA 3P4FA 3MXXA 4J78A 3SMRA 3PSLA 3SBQA 3VGZA 3EI4A 4L1QD 3SVWD 4CI2A 2I3TA 2YNNA 3IKOA 3UR4A 4FA5D 4D0KA 4ZOZA 3I7HA 4CY5A 4FWWA 2TRCB 3BG0A 1XIPA 1OMWB 1NR0A 4PC0A 3MKQA 1PEVA 2H9MA 5CXCB 3OKTA 1TBGA 4FHLA 2PM6B 4FAND 2HKMA 2P9KC 2GC7A 4X61B 4X3EA 2HESX 2O9KA 4K3JB 5B4WA 1PGUA 1S4UX 3PE7A 2HKRA 4GQ2P 2B4EA 5K19A 1YFQA 5IT9g 2H6KA 2YMUA 2BBKH 5FQDA 4G56B 3F3GA 4J0XA 2AH0A 1SQ9A 3EI2A 4GM3A 3RN1D 2YBAA 5EMJB 1JJUB 5FKRA 2AGZA 3K26A 3I7LA 4CZVA 5CYKB 2PM7B 5TDHB 3OL2B 2QC5A 4FA4D 4GZ8A 4OZUA 5CXCA 3MMYA 5FKTA 5C2WB 1GP2B 2H9NA 1FWXA 3C5MA 3I7PA 3ODTA 3NVXA 1PI6A 4GQBB 2IURA 3C99A 3IJ1A 3IIWA 4GM8A 5EARA 3BG1A 2IWKA 4UI9R 5EM2B 3JZNA 2H6QA 2UZYB 3L4MD 3DM0A 3SHFA 2CN2A 3CFVA 4A0AB 3JPXA 4GGDA 3EI3A 2Z2OA 5CYKA 2HXCA 3NVQA 3UVLA 2H3XA 3OL2A 3I7OA 3RMZD 2XL3A 3JAMg 2Z2NA 3L4OD 5IJ8E 4JSXC 5I5IA 4AEZA 4LGNA 4E54B 2XU7A 4J84A 5EMMB 3GFCA 3NVNA 1SQJA 2H47A 2P9IC 2CO0A 4PBYA 5HE2B 3AH8B 3I8EA 4L3HD 1P22A 4A11A 3EG6A 3EI1A 3OKYB 5EM2A 3AL9A 5EMKB 2I0RA 2OK6A 4LG9A 5KDOB 2PM9B 1XHMA 2H9PA 3KRWB 3PVUB 4O3TB 4PBZA 2YB8B 2PBIB 4XYIA 2CO0C 3AL8B 4U7AA 4Y5RD 4NSXA 5FA5B 3U4YA 4CZYA 3EWEA 1Q47A 4J77A 4A08A 3N0DA 5TEEA
chains in the Genus database with same CATH superfamily
5GMKn 5M5RA 2H9LA 4J8GA 5CXBA 5M61A 1XKSA 1A0RB 3IIYA 2VDRA 2HYEA 2QXVA 4GGCA 1E5TA 4UM8A 5JWZA 4K3ID 5SXMA 2OIZA 2OVQB 2EICA 3AFCA 3RLMD 4A0BB 1RI6A 2B5MA 3SLED 4CI1A 3MUOA 4AN1A 4X63B 2VC2A 3KRXB 2AGWA 3OTTA 4JHPC 2PM9A 2B5LA 5H17A 5HDBA 5TF2A 5HQGA 1U2VC 4GM9A 5E6SA 3K71A 3FRXA 1N6DA 1C9LA 4ERZA 2IUVA 2HJ4A 4PSXB 1L5GA 4Y7RA 4BCBA 1JMZB 4H5IA 4XYHA 3IUQA 4TZ4A 1JTDB 1JOFA 4R7AB 1O6FA 3NIFA 5IGOA 5TEFA 2AH1A 4CZXA 1JV2A 3I8CA 4O1QD 1K8KC 1JMXB 3I7KA 4BP8A 3I89A 5HE3B 4JT5C 4BP9A 4CY3A 3HFQA 1GXRA 1SHYB 1GOTB 3GREA 4IMMA 3SWSD 4A2LA 2IAAA 3A0FA 5E6UA 3PVWB 2H6NA 4H5JA 5FFOA 4HDJA 2I3SA 4J81A 4MK0B 2EBSA 3VA6A 5FKSA 1UTCA 3UKRC 4RE5A 5FLXg 4BUJC 2IUQA 5H14A 4Z7OA 4A09B 2H13A 4L3GD 2AGXA 4CI8A 3W15A 1K32A 4QAMA 4X60B 4RE6A 4GQ1A 3K27A 3QHYB 3V5WB 5EAPA 2YNOA 3FCUA 3ZE2A 4ZOXA 3FM0A 2G9AA 4E5ZB 4A2MA 2CE8A 3CFSB 3GC3B 2B5NA 4J73A 4DNVA 1N6EA 4GMBA 4GGAA 1R5MA 4D6VA 4Z7QA 3F3PA 2CNXA 1U4CA 3F3FA 1UOQA 4J86A 1PBYB 3IJEA 3IVMA 1I2MB 1QNIA 4FB1D 5C9ZB 3SBPA 4NENA 3VH0A 3V4VA 3K72A 4IA9A 1VZ3A 3O4GA 3ZWLB 4BCCA 2YNPA 4UM9A 2Q7QA 4OWRA 3JZHA 5M5VA 1B9YA 3SCYA 5GXHA 2I0SA 2AGYA 4O3UB 4JXMA 2HU8A 5M5SA 4QQEA 2XL2A 4MMXA 2JKXA 2BCJB 5GSAA 3V9FA 3DSMA 4A0AA 4J82A 1TYEA 2QR5A 4JHNA 3KCIA 4PSWB 4FA9D 2WQ8A 3IJ0A 4BL0A 4JT6C 3RN0D 4ES0A 3O4IA 1MG2A 4PXWA 1M1XA 4EWRA 4ERQA 1MG3A 2CN3A 3O4HA 4NBMA 1H2XA 1TYQC 4E54A 4D9SA 5AJAA 1VE6A 2P9NC 3UKUC 3MKSB 3EU7A 4IRZA 3PXSD 5AFU3 3EI2B 4AMZA 3RFGA 4CY1A 4G1MA 5GXIA 3ZE0A 1GOGA 2P9LC 4QT8A 4O02A 5I5JA 3EMHA 4MMZA 4FAVD 5C92A 3OKYA 2H68A 2Z2PA 5FXYA 2UZXB 3ORVD 4KFMB 2VZ1A 4MMYA 2EIEA 4WK0A 2QZPA 4J8BA 1UOOA 5FFGA 1U8CA 2J57G 4L1MA 3ZDYA 4DNUA 3EQ7A 4LG8A 3PSCB 3PXTD 3UVNA 3OW8A 3FGBA 2P9PC 4O9DA 4JSNC 3UVKA 3AL8A 4YVDA 1VYHC 3V7DB 1GG2B 1QFSA 2OVRB 3QI0A 5FKQA 5IC7A 4ZOVA 5HE1B 4JSVC 2MTAH 2P9UC 3E0CA 3EQ8A 4JSPC 3SN6B 4ZN4A 4Z8LA 5I5MA 2VDPA 4QRJA 2H14A 3K6SA 3OKWA 3GD1I 3T3PA 3MZLA 3EI3B 5AMSA 3VI3A 4ESGA 3SXTD 1OLZA 4A0BA 2HU5A 5EALA 5EAMA 2VDKA 4BH6A 4CI3A 4A7JA 3C9CA 2IUPA 3ULEC 5A2Qg 3BWSA 4U1EI 2OVPB 2I0TA 3SFZA 3MZKA 2W18A 1N6FA 5EMLB 2HJBA 3DXMC 2XYIA 2VZ3A 4XEIC 1H2YA 4NAAA 4CY2A 2IWFA 3NIDA 2OK4A 3DXKC 3RFHA 1A12A 3SBRA 4J87A 4A11B 3UVMA 3IJCA 2P9SC 5K1CC 3CIKB 3EI1B 4L9OA 4AN0A 4Z7NA 4CC9A 2EIDA 2J55H 3JROA 3OF7A 3I7NA 3UVOA 3JB9L 4PNKB 2GNQA 1GOFA 3J80g 2J56H 3J81g 3EI4B 4O45A 1NEXB 2OJYA 3C75H 2CE9A 2GC4A 4ZOYA 4I79A 1ERJA 3ZDXA 4QL1A 2AQ5A 3NIGA 2AGLA 4J79A 3IUNA 1UOPA 3RSEC 5HYNB 4FA1D 4WK2A 3N0EA 4A09A 4A08B 3JRPA 3JZGA 4NC4A 5H1MA 5IGQA 3PXWD 5CXBB 1B9XA 4AOWA 4J0WA 3B7FA 3RRMC 2G99A 2HU7A 3IURA 4JD2C 3SJLD 4ERYA 4N14A 4AMYA 5C2VB 5HE0B 3I2NA 3DWLC 4E5ZA 1MDAH 1L0QA 5IJ7E 5THAA 1H2ZA 3MXXA 3P4FA 2VDLA 4J78A 3SMRA 3PSLA 2EIBA 2VDNA 3SBQA 3VGZA 3EI4A 4L1QD 1O6GA 3DDUA 3SVWD 4CI2A 2I3TA 2YNNA 3IKOA 3UR4A 4FA5D 4D0KA 4ZOZA 3I7HA 4CY5A 4FWWA 2TRCB 3BG0A 1XIPA 1OMWB 1NR0A 4PC0A 3MKQA 1PEVA 2H9MA 5CXCB 3OKTA 1TBGA 4FHLA 2PM6B 4FAND 2HKMA 2P9KC 2GC7A 2BKLA 3MVDK 4X61B 4X3EA 2HESX 2O9KA 4K3JB 5B4WA 1PGUA 1S4UX 3PE7A 2HKRA 2XZGA 4GQ2P 2B4EA 5K19A 1YFQA 5IT9g 1H2WA 2H6KA 2YMUA 1VZ2A 2BBKH 5FQDA 4G56B 3F3GA 3O4JA 1YR2A 2AH0A 4J0XA 1SQ9A 1C9IA 3MUNA 3EI2A 4GM3A 3RN1D 2YBAA 3EQ9A 1T2XA 5EMJB 2XDWA 1JJUB 5FKRA 2AGZA 3K26A 3I7LA 3T3MA 4CZVA 5M5TA 5E6RA 1QFMA 5CYKB 2PM7B 5TDHB 3IUJA 3OL2B 3VI4A 2QC5A 1BPOA 4FA4D 4GZ8A 4OZUA 5CXCA 5C86A 3MMYA 3FCSA 2VDQA 5FKTA 3ZE1A 1K3IA 5C2WB 1GP2B 2H9NA 2VDMA 1FWXA 3C5MA 3I7PA 3ODTA 3NVXA 1PI6A 4G55A 4GQBB 2IURA 3C99A 3IJ1A 3IIWA 4GM8A 5EARA 3BG1A 3IUMA 4DNWA 2IWKA 4UI9R 5EM2B 3JZNA 2H6QA 1E8MA 2UZYB 3L4MD 3DM0A 3SHFA 1E8NA 5M5UA 2CN2A 3CFVA 4A0AB 3JPXA 4GGDA 3EI3A 3V4PA 4WK4A 2Z2OA 5CYKA 4WJKA 2HXCA 1VE7A 3NVQA 3UVLA 2H3XA 3OL2A 3I7OA 3RMZD 2XL3A 3JAMg 2Z2NA 4BCDA 3L4OD 5IJ8E 4JSXC 5I5IA 4AEZA 2VDOA 4LGNA 4E54B 2XU7A 4J84A 5EMMB 3GFCA 3NVNA 4AX4A 1SQJA 2H47A 2P9IC 4O2WA 2CO0A 4PBYA 5HE2B 3AH8B 3I8EA 4L3HD 1P22A 4A11A 3EG6A 4G1EA 3EI1A 3OKYB 5EM2A 3AL9A 5EMKB 2I0RA 2OK6A 4LG9A 5KDOB 2PM9B 1XHMA 2H9PA 3KRWB 3PVUB 4O3TB 4PBZA 2YB8B 2PBIB 4XYIA 2CO0C 2XE4A 3AL8B 4U7AA 4Y5RD 1GOHA 3IULA 4NSXA 5FA5B 3U4YA 4CZYA 3EWEA 1Q47A 4J77A 3ZDZA 4A08A 3N0DA 5TEEA
chains in the Genus database with same CATH topology
5GMKn 2H9LA 4J8GA 5CXBA 1XKSA 1A0RB 3IIYA 2HYEA 2QXVA 4GGCA 5JWZA 4K3ID 5SXMA 2OIZA 2OVQB 3AFCA 3RLMD 4A0BB 1RI6A 2B5MA 3SLED 4CI1A 4X63B 3KRXB 3OTTA 2AGWA 2PM9A 2B5LA 5H17A 5TF2A 5HQGA 1U2VC 4GM9A 3FRXA 1N6DA 4ERZA 2IUVA 2HJ4A 4PSXB 4Y7RA 1JMZB 4H5IA 4XYHA 4TZ4A 1JOFA 4R7AB 5IGOA 5TEFA 2AH1A 4CZXA 3I8CA 4O1QD 1K8KC 1JMXB 3I7KA 3I89A 5HE3B 4JT5C 4CY3A 3HFQA 1GXRA 1SHYB 1GOTB 3GREA 4IMMA 3SWSD 4A2LA 2IAAA 3A0FA 3PVWB 2H6NA 4H5JA 4HDJA 2I3SA 4J81A 4MK0B 2EBSA 3VA6A 5FKSA 5FLXg 3UKRC 4BUJC 2IUQA 5H14A 4A09B 2H13A 4L3GD 2AGXA 4CI8A 3W15A 1K32A 4X60B 4GQ1A 3K27A 3V5WB 5EAPA 2YNOA 4ZOXA 3FM0A 2G9AA 4E5ZB 4A2MA 2CE8A 3CFSB 2B5NA 4J73A 1N6EA 4GMBA 4GGAA 1R5MA 4D6VA 3F3PA 2CNXA 1U4CA 3F3FA 4J86A 1PBYB 1QNIA 4FB1D 5C9ZB 3SBPA 3VH0A 4IA9A 3ZWLB 2YNPA 2Q7QA 4OWRA 3JZHA 1B9YA 3SCYA 5GXHA 2I0SA 2AGYA 4O3UB 4JXMA 4QQEA 2XL2A 5GSAA 2BCJB 3V9FA 3DSMA 4A0AA 4J82A 4PSWB 4FA9D 3IJ0A 4BL0A 4JT6C 3RN0D 4ES0A 1MG2A 4PXWA 4EWRA 4ERQA 1MG3A 2CN3A 1TYQC 4E54A 5AJAA 2P9NC 3UKUC 3MKSB 3EU7A 5AFU3 3PXSD 3EI2B 3RFGA 4CY1A 5GXIA 4QT8A 2P9LC 5I5JA 3EMHA 4FAVD 3OKYA 2H68A 2Z2PA 5FXYA 2UZXB 3ORVD 4KFMB 4J8BA 2J57G 4LG8A 3PSCB 3PXTD 3UVNA 3OW8A 3FGBA 2P9PC 4O9DA 4JSNC 3UVKA 3AL8A 4YVDA 1VYHC 3V7DB 1GG2B 5FKQA 2OVRB 5IC7A 4ZOVA 5HE1B 4JSVC 2MTAH 2P9UC 3E0CA 4JSPC 3SN6B 4ZN4A 4Z8LA 5I5MA 4QRJA 2H14A 3OKWA 3MZLA 3EI3B 5AMSA 4ESGA 3SXTD 1OLZA 4A0BA 4BH6A 5EALA 5EAMA 4CI3A 4A7JA 3C9CA 2IUPA 3ULEC 5A2Qg 3BWSA 4U1EI 2OVPB 2I0TA 3SFZA 3MZKA 2W18A 1N6FA 5EMLB 2HJBA 3DXMC 2XYIA 4XEIC 4CY2A 2IWFA 2OK4A 3DXKC 3RFHA 3SBRA 4J87A 4A11B 3UVMA 3IJCA 2P9SC 5K1CC 3CIKB 3EI1B 4L9OA 4CC9A 2J55H 3JROA 3I7NA 3UVOA 3JB9L 4PNKB 2GNQA 3J80g 2J56H 3J81g 3EI4B 4O45A 1NEXB 2OJYA 3C75H 2CE9A 2GC4A 4ZOYA 4I79A 1ERJA 4QL1A 2AQ5A 2AGLA 4J79A 3RSEC 5HYNB 4FA1D 3N0EA 4A09A 4A08B 3JRPA 3JZGA 5H1MA 5IGQA 3PXWD 5CXBB 1B9XA 4AOWA 4J0WA 3B7FA 3RRMC 2G99A 4JD2C 3SJLD 4ERYA 4N14A 5C2VB 5HE0B 3I2NA 3DWLC 4E5ZA 1MDAH 1L0QA 5IJ7E 5THAA 3P4FA 3MXXA 4J78A 3SMRA 3PSLA 3SBQA 3VGZA 3EI4A 4L1QD 3SVWD 4CI2A 2I3TA 2YNNA 3IKOA 3UR4A 4FA5D 4D0KA 4ZOZA 3I7HA 4CY5A 4FWWA 2TRCB 3BG0A 1XIPA 1OMWB 1NR0A 4PC0A 3MKQA 1PEVA 2H9MA 5CXCB 3OKTA 1TBGA 4FHLA 2PM6B 4FAND 2HKMA 2P9KC 2GC7A 4X61B 4X3EA 2HESX 2O9KA 4K3JB 5B4WA 1PGUA 1S4UX 3PE7A 2HKRA 4GQ2P 2B4EA 5K19A 1YFQA 5IT9g 2H6KA 2YMUA 2BBKH 5FQDA 4G56B 3F3GA 4J0XA 2AH0A 1SQ9A 3EI2A 4GM3A 3RN1D 2YBAA 5EMJB 1JJUB 5FKRA 2AGZA 3K26A 3I7LA 4CZVA 5CYKB 2PM7B 5TDHB 3OL2B 2QC5A 4FA4D 4GZ8A 4OZUA 5CXCA 3MMYA 5FKTA 5C2WB 1GP2B 2H9NA 1FWXA 3C5MA 3I7PA 3ODTA 3NVXA 1PI6A 4GQBB 2IURA 3C99A 3IJ1A 3IIWA 4GM8A 5EARA 3BG1A 2IWKA 4UI9R 5EM2B 3JZNA 2H6QA 2UZYB 3L4MD 3DM0A 3SHFA 2CN2A 3CFVA 4A0AB 3JPXA 4GGDA 3EI3A 2Z2OA 5CYKA 2HXCA 3NVQA 3UVLA 2H3XA 3OL2A 3I7OA 3RMZD 2XL3A 3JAMg 2Z2NA 3L4OD 5IJ8E 4JSXC 5I5IA 4AEZA 4LGNA 4E54B 2XU7A 4J84A 5EMMB 3GFCA 3NVNA 1SQJA 2H47A 2P9IC 2CO0A 4PBYA 5HE2B 3AH8B 3I8EA 4L3HD 1P22A 4A11A 3EG6A 3EI1A 3OKYB 5EM2A 3AL9A 5EMKB 2I0RA 2OK6A 4LG9A 5KDOB 2PM9B 1XHMA 2H9PA 3KRWB 3PVUB 4O3TB 4PBZA 2YB8B 2PBIB 4XYIA 2CO0C 3AL8B 4U7AA 4Y5RD 4NSXA 5FA5B 3U4YA 4CZYA 3EWEA 1Q47A 4J77A 4A08A 3N0DA 5TEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GMK n;  2H9L A;  4J8G A;  5CXB A;  1XKS A;  1A0R B;  3IIY A;  2HYE A;  2QXV A;  4GGC A;  5JWZ A;  4K3I D;  5SXM A;  2OIZ A;  2OVQ B;  3AFC A;  3RLM D;  4A0B B;  1RI6 A;  2B5M A;  3SLE D;  4CI1 A;  4X63 B;  3KRX B;  3OTT A;  2AGW A;  2PM9 A;  2B5L A;  5H17 A;  5TF2 A;  5HQG A;  1U2V C;  4GM9 A;  3FRX A;  1N6D A;  4ERZ A;  2IUV A;  2HJ4 A;  4PSX B;  4Y7R A;  1JMZ B;  4H5I A;  4XYH A;  4TZ4 A;  1JOF A;  4R7A B;  5IGO A;  5TEF A;  2AH1 A;  4CZX A;  3I8C A;  4O1Q D;  1K8K C;  1JMX B;  3I7K A;  3I89 A;  5HE3 B;  4JT5 C;  4CY3 A;  3HFQ A;  1GXR A;  1SHY B;  1GOT B;  3GRE A;  4IMM A;  3SWS D;  4A2L A;  2IAA A;  3A0F A;  3PVW B;  2H6N A;  4H5J A;  4HDJ A;  2I3S A;  4J81 A;  4MK0 B;  2EBS A;  3VA6 A;  5FKS A;  5FLX g;  3UKR C;  4BUJ C;  2IUQ A;  5H14 A;  4A09 B;  2H13 A;  4L3G D;  2AGX A;  4CI8 A;  3W15 A;  1K32 A;  4X60 B;  4GQ1 A;  3K27 A;  3V5W B;  5EAP A;  2YNO A;  4ZOX A;  3FM0 A;  2G9A A;  4E5Z B;  4A2M A;  2CE8 A;  3CFS B;  2B5N A;  4J73 A;  1N6E A;  4GMB A;  4GGA A;  1R5M A;  4D6V A;  3F3P A;  2CNX A;  1U4C A;  3F3F A;  4J86 A;  1PBY B;  1QNI A;  4FB1 D;  5C9Z B;  3SBP A;  3VH0 A;  4IA9 A;  3ZWL B;  2YNP A;  2Q7Q A;  4OWR A;  3JZH A;  1B9Y A;  3SCY A;  5GXH A;  2I0S A;  2AGY A;  4O3U B;  4JXM A;  4QQE A;  2XL2 A;  5GSA A;  2BCJ B;  3V9F A;  3DSM A;  4A0A A;  4J82 A;  4PSW B;  4FA9 D;  3IJ0 A;  4BL0 A;  4JT6 C;  3RN0 D;  4ES0 A;  1MG2 A;  4PXW A;  4EWR A;  4ERQ A;  1MG3 A;  2CN3 A;  1TYQ C;  4E54 A;  5AJA A;  2P9N C;  3UKU C;  3MKS B;  3EU7 A;  5AFU 3;  3PXS D;  3EI2 B;  3RFG A;  4CY1 A;  5GXI A;  4QT8 A;  2P9L C;  5I5J A;  3EMH A;  4FAV D;  3OKY A;  2H68 A;  2Z2P A;  5FXY A;  2UZX B;  3ORV D;  4KFM B;  4J8B A;  2J57 G;  4LG8 A;  3PSC B;  3PXT D;  3UVN A;  3OW8 A;  3FGB A;  2P9P C;  4O9D A;  4JSN C;  3UVK A;  3AL8 A;  4YVD A;  1VYH C;  3V7D B;  1GG2 B;  5FKQ A;  2OVR B;  5IC7 A;  4ZOV A;  5HE1 B;  4JSV C;  2MTA H;  2P9U C;  3E0C A;  4JSP C;  3SN6 B;  4ZN4 A;  4Z8L A;  5I5M A;  4QRJ A;  2H14 A;  3OKW A;  3MZL A;  3EI3 B;  5AMS A;  4ESG A;  3SXT D;  1OLZ A;  4A0B A;  4BH6 A;  5EAL A;  5EAM A;  4CI3 A;  4A7J A;  3C9C A;  2IUP A;  3ULE C;  5A2Q g;  3BWS A;  4U1E I;  2OVP B;  2I0T A;  3SFZ A;  3MZK A;  2W18 A;  1N6F A;  5EML B;  2HJB A;  3DXM C;  2XYI A;  4XEI C;  4CY2 A;  2IWF A;  2OK4 A;  3DXK C;  3RFH A;  3SBR A;  4J87 A;  4A11 B;  3UVM A;  3IJC A;  2P9S C;  5K1C C;  3CIK B;  3EI1 B;  4L9O A;  4CC9 A;  2J55 H;  3JRO A;  3I7N A;  3UVO A;  3JB9 L;  4PNK B;  2GNQ A;  3J80 g;  2J56 H;  3J81 g;  3EI4 B;  4O45 A;  1NEX B;  2OJY A;  3C75 H;  2CE9 A;  2GC4 A;  4ZOY A;  4I79 A;  1ERJ A;  4QL1 A;  2AQ5 A;  2AGL A;  4J79 A;  3RSE C;  5HYN B;  4FA1 D;  3N0E A;  4A09 A;  4A08 B;  3JRP A;  3JZG A;  5H1M A;  5IGQ A;  3PXW D;  5CXB B;  1B9X A;  4AOW A;  4J0W A;  3B7F A;  3RRM C;  2G99 A;  4JD2 C;  3SJL D;  4ERY A;  4N14 A;  5C2V B;  5HE0 B;  3I2N A;  3DWL C;  4E5Z A;  1MDA H;  1L0Q A;  5IJ7 E;  5THA A;  3P4F A;  3MXX A;  4J78 A;  3SMR A;  3PSL A;  3SBQ A;  3VGZ A;  3EI4 A;  4L1Q D;  3SVW D;  4CI2 A;  2I3T A;  2YNN A;  3IKO A;  3UR4 A;  4FA5 D;  4D0K A;  4ZOZ A;  3I7H A;  4CY5 A;  4FWW A;  2TRC B;  3BG0 A;  1XIP A;  1OMW B;  1NR0 A;  4PC0 A;  3MKQ A;  1PEV A;  2H9M A;  5CXC B;  3OKT A;  1TBG A;  4FHL A;  2PM6 B;  4FAN D;  2HKM A;  2P9K C;  2GC7 A;  4X61 B;  4X3E A;  2HES X;  2O9K A;  4K3J B;  5B4W A;  1PGU A;  1S4U X;  3PE7 A;  2HKR A;  4GQ2 P;  2B4E A;  5K19 A;  1YFQ A;  5IT9 g;  2H6K A;  2YMU A;  2BBK H;  5FQD A;  4G56 B;  3F3G A;  4J0X A;  2AH0 A;  1SQ9 A;  3EI2 A;  4GM3 A;  3RN1 D;  2YBA A;  5EMJ B;  1JJU B;  5FKR A;  2AGZ A;  3K26 A;  3I7L A;  4CZV A;  5CYK B;  2PM7 B;  5TDH B;  3OL2 B;  2QC5 A;  4FA4 D;  4GZ8 A;  4OZU A;  5CXC A;  3MMY A;  5FKT A;  5C2W B;  1GP2 B;  2H9N A;  1FWX A;  3C5M A;  3I7P A;  3ODT A;  3NVX A;  1PI6 A;  4GQB B;  2IUR A;  3C99 A;  3IJ1 A;  3IIW A;  4GM8 A;  5EAR A;  3BG1 A;  2IWK A;  4UI9 R;  5EM2 B;  3JZN A;  2H6Q A;  2UZY B;  3L4M D;  3DM0 A;  3SHF A;  2CN2 A;  3CFV A;  4A0A B;  3JPX A;  4GGD A;  3EI3 A;  2Z2O A;  5CYK A;  2HXC A;  3NVQ A;  3UVL A;  2H3X A;  3OL2 A;  3I7O A;  3RMZ D;  2XL3 A;  3JAM g;  2Z2N A;  3L4O D;  5IJ8 E;  4JSX C;  5I5I A;  4AEZ A;  4LGN A;  4E54 B;  2XU7 A;  4J84 A;  5EMM B;  3GFC A;  3NVN A;  1SQJ A;  2H47 A;  2P9I C;  2CO0 A;  4PBY A;  5HE2 B;  3AH8 B;  3I8E A;  4L3H D;  1P22 A;  4A11 A;  3EG6 A;  3EI1 A;  3OKY B;  5EM2 A;  3AL9 A;  5EMK B;  2I0R A;  2OK6 A;  4LG9 A;  5KDO B;  2PM9 B;  1XHM A;  2H9P A;  3KRW B;  3PVU B;  4O3T B;  4PBZ A;  2YB8 B;  2PBI B;  4XYI A;  2CO0 C;  3AL8 B;  4U7A A;  4Y5R D;  4NSX A;  5FA5 B;  3U4Y A;  4CZY A;  3EWE A;  1Q47 A;  4J77 A;  4A08 A;  3N0D A;  5TEE A; 
#chains in the Genus database with same CATH topology
 5GMK n;  5M5R A;  2H9L A;  4J8G A;  5CXB A;  5M61 A;  1XKS A;  1A0R B;  3IIY A;  2VDR A;  2HYE A;  2QXV A;  4GGC A;  1E5T A;  4UM8 A;  5JWZ A;  4K3I D;  5SXM A;  2OIZ A;  2OVQ B;  2EIC A;  3AFC A;  3RLM D;  4A0B B;  1RI6 A;  2B5M A;  3SLE D;  4CI1 A;  3MUO A;  4AN1 A;  4X63 B;  2VC2 A;  3KRX B;  2AGW A;  3OTT A;  4JHP C;  2PM9 A;  2B5L A;  5H17 A;  5HDB A;  5TF2 A;  5HQG A;  1U2V C;  4GM9 A;  5E6S A;  3K71 A;  3FRX A;  1N6D A;  1C9L A;  4ERZ A;  2IUV A;  2HJ4 A;  4PSX B;  1L5G A;  4Y7R A;  4BCB A;  1JMZ B;  4H5I A;  4XYH A;  3IUQ A;  4TZ4 A;  1JTD B;  1JOF A;  4R7A B;  1O6F A;  3NIF A;  5IGO A;  5TEF A;  2AH1 A;  4CZX A;  1JV2 A;  3I8C A;  4O1Q D;  1K8K C;  1JMX B;  3I7K A;  4BP8 A;  3I89 A;  5HE3 B;  4JT5 C;  4BP9 A;  4CY3 A;  3HFQ A;  1GXR A;  1SHY B;  1GOT B;  3GRE A;  4IMM A;  3SWS D;  4A2L A;  2IAA A;  3A0F A;  5E6U A;  3PVW B;  2H6N A;  4H5J A;  5FFO A;  4HDJ A;  2I3S A;  4J81 A;  4MK0 B;  2EBS A;  3VA6 A;  5FKS A;  1UTC A;  3UKR C;  4RE5 A;  5FLX g;  4BUJ C;  2IUQ A;  5H14 A;  4Z7O A;  4A09 B;  2H13 A;  4L3G D;  2AGX A;  4CI8 A;  3W15 A;  1K32 A;  4QAM A;  4X60 B;  4RE6 A;  4GQ1 A;  3K27 A;  3QHY B;  3V5W B;  5EAP A;  2YNO A;  3FCU A;  3ZE2 A;  4ZOX A;  3FM0 A;  2G9A A;  4E5Z B;  4A2M A;  2CE8 A;  3CFS B;  3GC3 B;  2B5N A;  4J73 A;  4DNV A;  1N6E A;  4GMB A;  4GGA A;  1R5M A;  4D6V A;  4Z7Q A;  3F3P A;  2CNX A;  1U4C A;  3F3F A;  1UOQ A;  4J86 A;  1PBY B;  3IJE A;  3IVM A;  1I2M B;  1QNI A;  4FB1 D;  5C9Z B;  3SBP A;  4NEN A;  3VH0 A;  3V4V A;  3K72 A;  4IA9 A;  1VZ3 A;  3O4G A;  3ZWL B;  4BCC A;  2YNP A;  4UM9 A;  2Q7Q A;  4OWR A;  3JZH A;  5M5V A;  1B9Y A;  3SCY A;  5GXH A;  2I0S A;  2AGY A;  4O3U B;  4JXM A;  2HU8 A;  5M5S A;  4QQE A;  2XL2 A;  4MMX A;  2JKX A;  2BCJ B;  5GSA A;  3V9F A;  3DSM A;  4A0A A;  4J82 A;  1TYE A;  2QR5 A;  4JHN A;  3KCI A;  4PSW B;  4FA9 D;  2WQ8 A;  3IJ0 A;  4BL0 A;  4JT6 C;  3RN0 D;  4ES0 A;  3O4I A;  1MG2 A;  4PXW A;  1M1X A;  4EWR A;  4ERQ A;  1MG3 A;  2CN3 A;  3O4H A;  4NBM A;  1H2X A;  1TYQ C;  4E54 A;  4D9S A;  5AJA A;  1VE6 A;  2P9N C;  3UKU C;  3MKS B;  3EU7 A;  4IRZ A;  3PXS D;  5AFU 3;  3EI2 B;  4AMZ A;  3RFG A;  4CY1 A;  4G1M A;  5GXI A;  3ZE0 A;  1GOG A;  2P9L C;  4QT8 A;  4O02 A;  5I5J A;  3EMH A;  4MMZ A;  4FAV D;  5C92 A;  3OKY A;  2H68 A;  2Z2P A;  5FXY A;  2UZX B;  3ORV D;  4KFM B;  2VZ1 A;  4MMY A;  2EIE A;  4WK0 A;  2QZP A;  4J8B A;  1UOO A;  5FFG A;  1U8C A;  2J57 G;  4L1M A;  3ZDY A;  4DNU A;  3EQ7 A;  4LG8 A;  3PSC B;  3PXT D;  3UVN A;  3OW8 A;  3FGB A;  2P9P C;  4O9D A;  4JSN C;  3UVK A;  3AL8 A;  4YVD A;  1VYH C;  3V7D B;  1GG2 B;  1QFS A;  2OVR B;  3QI0 A;  5FKQ A;  5IC7 A;  4ZOV A;  5HE1 B;  4JSV C;  2MTA H;  2P9U C;  3E0C A;  3EQ8 A;  4JSP C;  3SN6 B;  4ZN4 A;  4Z8L A;  5I5M A;  2VDP A;  4QRJ A;  2H14 A;  3K6S A;  3OKW A;  3GD1 I;  3T3P A;  3MZL A;  3EI3 B;  5AMS A;  3VI3 A;  4ESG A;  3SXT D;  1OLZ A;  4A0B A;  2HU5 A;  5EAL A;  5EAM A;  2VDK A;  4BH6 A;  4CI3 A;  4A7J A;  3C9C A;  2IUP A;  3ULE C;  5A2Q g;  3BWS A;  4U1E I;  2OVP B;  2I0T A;  3SFZ A;  3MZK A;  2W18 A;  1N6F A;  5EML B;  2HJB A;  3DXM C;  2XYI A;  2VZ3 A;  4XEI C;  1H2Y A;  4NAA A;  4CY2 A;  2IWF A;  3NID A;  2OK4 A;  3DXK C;  3RFH A;  1A12 A;  3SBR A;  4J87 A;  4A11 B;  3UVM A;  3IJC A;  2P9S C;  5K1C C;  3CIK B;  3EI1 B;  4L9O A;  4AN0 A;  4Z7N A;  4CC9 A;  2EID A;  2J55 H;  3JRO A;  3OF7 A;  3I7N A;  3UVO A;  3JB9 L;  4PNK B;  2GNQ A;  1GOF A;  3J80 g;  2J56 H;  3J81 g;  3EI4 B;  4O45 A;  1NEX B;  2OJY A;  3C75 H;  2CE9 A;  2GC4 A;  4ZOY A;  4I79 A;  1ERJ A;  3ZDX A;  4QL1 A;  2AQ5 A;  3NIG A;  2AGL A;  4J79 A;  3IUN A;  1UOP A;  3RSE C;  5HYN B;  4FA1 D;  4WK2 A;  3N0E A;  4A09 A;  4A08 B;  3JRP A;  3JZG A;  4NC4 A;  5H1M A;  5IGQ A;  3PXW D;  5CXB B;  1B9X A;  4AOW A;  4J0W A;  3B7F A;  3RRM C;  2G99 A;  2HU7 A;  3IUR A;  4JD2 C;  3SJL D;  4ERY A;  4N14 A;  4AMY A;  5C2V B;  5HE0 B;  3I2N A;  3DWL C;  4E5Z A;  1MDA H;  1L0Q A;  5IJ7 E;  5THA A;  1H2Z A;  3MXX A;  3P4F A;  2VDL A;  4J78 A;  3SMR A;  3PSL A;  2EIB A;  2VDN A;  3SBQ A;  3VGZ A;  3EI4 A;  4L1Q D;  1O6G A;  3DDU A;  3SVW D;  4CI2 A;  2I3T A;  2YNN A;  3IKO A;  3UR4 A;  4FA5 D;  4D0K A;  4ZOZ A;  3I7H A;  4CY5 A;  4FWW A;  2TRC B;  3BG0 A;  1XIP A;  1OMW B;  1NR0 A;  4PC0 A;  3MKQ A;  1PEV A;  2H9M A;  5CXC B;  3OKT A;  1TBG A;  4FHL A;  2PM6 B;  4FAN D;  2HKM A;  2P9K C;  2GC7 A;  2BKL A;  3MVD K;  4X61 B;  4X3E A;  2HES X;  2O9K A;  4K3J B;  5B4W A;  1PGU A;  1S4U X;  3PE7 A;  2HKR A;  2XZG A;  4GQ2 P;  2B4E A;  5K19 A;  1YFQ A;  5IT9 g;  1H2W A;  2H6K A;  2YMU A;  1VZ2 A;  2BBK H;  5FQD A;  4G56 B;  3F3G A;  3O4J A;  1YR2 A;  2AH0 A;  4J0X A;  1SQ9 A;  1C9I A;  3MUN A;  3EI2 A;  4GM3 A;  3RN1 D;  2YBA A;  3EQ9 A;  1T2X A;  5EMJ B;  2XDW A;  1JJU B;  5FKR A;  2AGZ A;  3K26 A;  3I7L A;  3T3M A;  4CZV A;  5M5T A;  5E6R A;  1QFM A;  5CYK B;  2PM7 B;  5TDH B;  3IUJ A;  3OL2 B;  3VI4 A;  2QC5 A;  1BPO A;  4FA4 D;  4GZ8 A;  4OZU A;  5CXC A;  5C86 A;  3MMY A;  3FCS A;  2VDQ A;  5FKT A;  3ZE1 A;  1K3I A;  5C2W B;  1GP2 B;  2H9N A;  2VDM A;  1FWX A;  3C5M A;  3I7P A;  3ODT A;  3NVX A;  1PI6 A;  4G55 A;  4GQB B;  2IUR A;  3C99 A;  3IJ1 A;  3IIW A;  4GM8 A;  5EAR A;  3BG1 A;  3IUM A;  4DNW A;  2IWK A;  4UI9 R;  5EM2 B;  3JZN A;  2H6Q A;  1E8M A;  2UZY B;  3L4M D;  3DM0 A;  3SHF A;  1E8N A;  5M5U A;  2CN2 A;  3CFV A;  4A0A B;  3JPX A;  4GGD A;  3EI3 A;  3V4P A;  4WK4 A;  2Z2O A;  5CYK A;  4WJK A;  2HXC A;  1VE7 A;  3NVQ A;  3UVL A;  2H3X A;  3OL2 A;  3I7O A;  3RMZ D;  2XL3 A;  3JAM g;  2Z2N A;  4BCD A;  3L4O D;  5IJ8 E;  4JSX C;  5I5I A;  4AEZ A;  2VDO A;  4LGN A;  4E54 B;  2XU7 A;  4J84 A;  5EMM B;  3GFC A;  3NVN A;  4AX4 A;  1SQJ A;  2H47 A;  2P9I C;  4O2W A;  2CO0 A;  4PBY A;  5HE2 B;  3AH8 B;  3I8E A;  4L3H D;  1P22 A;  4A11 A;  3EG6 A;  4G1E A;  3EI1 A;  3OKY B;  5EM2 A;  3AL9 A;  5EMK B;  2I0R A;  2OK6 A;  4LG9 A;  5KDO B;  2PM9 B;  1XHM A;  2H9P A;  3KRW B;  3PVU B;  4O3T B;  4PBZ A;  2YB8 B;  2PBI B;  4XYI A;  2CO0 C;  2XE4 A;  3AL8 B;  4U7A A;  4Y5R D;  1GOH A;  3IUL A;  4NSX A;  5FA5 B;  3U4Y A;  4CZY A;  3EWE A;  1Q47 A;  4J77 A;  3ZDZ A;  4A08 A;  3N0D A;  5TEE A; 
#chains in the Genus database with same CATH homology
 5GMK n;  2H9L A;  4J8G A;  5CXB A;  1XKS A;  1A0R B;  3IIY A;  2HYE A;  2QXV A;  4GGC A;  5JWZ A;  4K3I D;  5SXM A;  2OIZ A;  2OVQ B;  3AFC A;  3RLM D;  4A0B B;  1RI6 A;  2B5M A;  3SLE D;  4CI1 A;  4X63 B;  3KRX B;  3OTT A;  2AGW A;  2PM9 A;  2B5L A;  5H17 A;  5TF2 A;  5HQG A;  1U2V C;  4GM9 A;  3FRX A;  1N6D A;  4ERZ A;  2IUV A;  2HJ4 A;  4PSX B;  4Y7R A;  1JMZ B;  4H5I A;  4XYH A;  4TZ4 A;  1JOF A;  4R7A B;  5IGO A;  5TEF A;  2AH1 A;  4CZX A;  3I8C A;  4O1Q D;  1K8K C;  1JMX B;  3I7K A;  3I89 A;  5HE3 B;  4JT5 C;  4CY3 A;  3HFQ A;  1GXR A;  1SHY B;  1GOT B;  3GRE A;  4IMM A;  3SWS D;  4A2L A;  2IAA A;  3A0F A;  3PVW B;  2H6N A;  4H5J A;  4HDJ A;  2I3S A;  4J81 A;  4MK0 B;  2EBS A;  3VA6 A;  5FKS A;  5FLX g;  3UKR C;  4BUJ C;  2IUQ A;  5H14 A;  4A09 B;  2H13 A;  4L3G D;  2AGX A;  4CI8 A;  3W15 A;  1K32 A;  4X60 B;  4GQ1 A;  3K27 A;  3V5W B;  5EAP A;  2YNO A;  4ZOX A;  3FM0 A;  2G9A A;  4E5Z B;  4A2M A;  2CE8 A;  3CFS B;  2B5N A;  4J73 A;  1N6E A;  4GMB A;  4GGA A;  1R5M A;  4D6V A;  3F3P A;  2CNX A;  1U4C A;  3F3F A;  4J86 A;  1PBY B;  1QNI A;  4FB1 D;  5C9Z B;  3SBP A;  3VH0 A;  4IA9 A;  3ZWL B;  2YNP A;  2Q7Q A;  4OWR A;  3JZH A;  1B9Y A;  3SCY A;  5GXH A;  2I0S A;  2AGY A;  4O3U B;  4JXM A;  4QQE A;  2XL2 A;  5GSA A;  2BCJ B;  3V9F A;  3DSM A;  4A0A A;  4J82 A;  4PSW B;  4FA9 D;  3IJ0 A;  4BL0 A;  4JT6 C;  3RN0 D;  4ES0 A;  1MG2 A;  4PXW A;  4EWR A;  4ERQ A;  1MG3 A;  2CN3 A;  1TYQ C;  4E54 A;  5AJA A;  2P9N C;  3UKU C;  3MKS B;  3EU7 A;  5AFU 3;  3PXS D;  3EI2 B;  3RFG A;  4CY1 A;  5GXI A;  4QT8 A;  2P9L C;  5I5J A;  3EMH A;  4FAV D;  3OKY A;  2H68 A;  2Z2P A;  5FXY A;  2UZX B;  3ORV D;  4KFM B;  4J8B A;  2J57 G;  4LG8 A;  3PSC B;  3PXT D;  3UVN A;  3OW8 A;  3FGB A;  2P9P C;  4O9D A;  4JSN C;  3UVK A;  3AL8 A;  4YVD A;  1VYH C;  3V7D B;  1GG2 B;  5FKQ A;  2OVR B;  5IC7 A;  4ZOV A;  5HE1 B;  4JSV C;  2MTA H;  2P9U C;  3E0C A;  4JSP C;  3SN6 B;  4ZN4 A;  4Z8L A;  5I5M A;  4QRJ A;  2H14 A;  3OKW A;  3MZL A;  3EI3 B;  5AMS A;  4ESG A;  3SXT D;  1OLZ A;  4A0B A;  4BH6 A;  5EAL A;  5EAM A;  4CI3 A;  4A7J A;  3C9C A;  2IUP A;  3ULE C;  5A2Q g;  3BWS A;  4U1E I;  2OVP B;  2I0T A;  3SFZ A;  3MZK A;  2W18 A;  1N6F A;  5EML B;  2HJB A;  3DXM C;  2XYI A;  4XEI C;  4CY2 A;  2IWF A;  2OK4 A;  3DXK C;  3RFH A;  3SBR A;  4J87 A;  4A11 B;  3UVM A;  3IJC A;  2P9S C;  5K1C C;  3CIK B;  3EI1 B;  4L9O A;  4CC9 A;  2J55 H;  3JRO A;  3I7N A;  3UVO A;  3JB9 L;  4PNK B;  2GNQ A;  3J80 g;  2J56 H;  3J81 g;  3EI4 B;  4O45 A;  1NEX B;  2OJY A;  3C75 H;  2CE9 A;  2GC4 A;  4ZOY A;  4I79 A;  1ERJ A;  4QL1 A;  2AQ5 A;  2AGL A;  4J79 A;  3RSE C;  5HYN B;  4FA1 D;  3N0E A;  4A09 A;  4A08 B;  3JRP A;  3JZG A;  5H1M A;  5IGQ A;  3PXW D;  5CXB B;  1B9X A;  4AOW A;  4J0W A;  3B7F A;  3RRM C;  2G99 A;  4JD2 C;  3SJL D;  4ERY A;  4N14 A;  5C2V B;  5HE0 B;  3I2N A;  3DWL C;  4E5Z A;  1MDA H;  1L0Q A;  5IJ7 E;  5THA A;  3P4F A;  3MXX A;  4J78 A;  3SMR A;  3PSL A;  3SBQ A;  3VGZ A;  3EI4 A;  4L1Q D;  3SVW D;  4CI2 A;  2I3T A;  2YNN A;  3IKO A;  3UR4 A;  4FA5 D;  4D0K A;  4ZOZ A;  3I7H A;  4CY5 A;  4FWW A;  2TRC B;  3BG0 A;  1XIP A;  1OMW B;  1NR0 A;  4PC0 A;  3MKQ A;  1PEV A;  2H9M A;  5CXC B;  3OKT A;  1TBG A;  4FHL A;  2PM6 B;  4FAN D;  2HKM A;  2P9K C;  2GC7 A;  4X61 B;  4X3E A;  2HES X;  2O9K A;  4K3J B;  5B4W A;  1PGU A;  1S4U X;  3PE7 A;  2HKR A;  4GQ2 P;  2B4E A;  5K19 A;  1YFQ A;  5IT9 g;  2H6K A;  2YMU A;  2BBK H;  5FQD A;  4G56 B;  3F3G A;  4J0X A;  2AH0 A;  1SQ9 A;  3EI2 A;  4GM3 A;  3RN1 D;  2YBA A;  5EMJ B;  1JJU B;  5FKR A;  2AGZ A;  3K26 A;  3I7L A;  4CZV A;  5CYK B;  2PM7 B;  5TDH B;  3OL2 B;  2QC5 A;  4FA4 D;  4GZ8 A;  4OZU A;  5CXC A;  3MMY A;  5FKT A;  5C2W B;  1GP2 B;  2H9N A;  1FWX A;  3C5M A;  3I7P A;  3ODT A;  3NVX A;  1PI6 A;  4GQB B;  2IUR A;  3C99 A;  3IJ1 A;  3IIW A;  4GM8 A;  5EAR A;  3BG1 A;  2IWK A;  4UI9 R;  5EM2 B;  3JZN A;  2H6Q A;  2UZY B;  3L4M D;  3DM0 A;  3SHF A;  2CN2 A;  3CFV A;  4A0A B;  3JPX A;  4GGD A;  3EI3 A;  2Z2O A;  5CYK A;  2HXC A;  3NVQ A;  3UVL A;  2H3X A;  3OL2 A;  3I7O A;  3RMZ D;  2XL3 A;  3JAM g;  2Z2N A;  3L4O D;  5IJ8 E;  4JSX C;  5I5I A;  4AEZ A;  4LGN A;  4E54 B;  2XU7 A;  4J84 A;  5EMM B;  3GFC A;  3NVN A;  1SQJ A;  2H47 A;  2P9I C;  2CO0 A;  4PBY A;  5HE2 B;  3AH8 B;  3I8E A;  4L3H D;  1P22 A;  4A11 A;  3EG6 A;  3EI1 A;  3OKY B;  5EM2 A;  3AL9 A;  5EMK B;  2I0R A;  2OK6 A;  4LG9 A;  5KDO B;  2PM9 B;  1XHM A;  2H9P A;  3KRW B;  3PVU B;  4O3T B;  4PBZ A;  2YB8 B;  2PBI B;  4XYI A;  2CO0 C;  3AL8 B;  4U7A A;  4Y5R D;  4NSX A;  5FA5 B;  3U4Y A;  4CZY A;  3EWE A;  1Q47 A;  4J77 A;  4A08 A;  3N0D A;  5TEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...