5K19A

Crystal structure of wd repeat-containing protein 20
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
553
structure length
376
Chain Sequence
NEIKTQFTTREGLYKLLPHSEYSRPNRVPFNSSNPVRVSFVNLNSGNGDRLCFNVGRELYFYIYKGVRKAADLSKPIDKRIYKGTQPTCHDFNHLTATAESVSLLVGFSAGQVQLIDPIKKETSKLFNEERLIDKSRVTCVKWVPGSESLFLVAHSSGNMYLYNVEHTCGTTAPHYQLLKQGESFAVHTCKTRNPLLKWTVGEGALNEFAFSPDGKFLACVSQDGFLRVFNFDSVELHGTMKSYFGGLLCVCWSPDGKYIVTGGEDDLVTVWSFVDCRVIARGHGHKSWVSVVAFDPYTTSVEEGDVTYRFGSVGQDTQLCLWDLTEDILFPVPLLEPLICKKIAHERLTVLIFLEDCIVTACQEGFICTWGRPGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords WD repeat-containing protein 20
publication title Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
pubmed doi rcsb
source organism Homo sapiens
total genus 86
structure length 376
sequence length 553
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5k19A00
5CXBA 5EM2B 5EM2A 4J8BA 4J86A 2I3SA 3JZGA 3ODTA 4FA5D 3EI3B 1Q47A 1PI6A 3ULEC 3VA6A 3MZLA 4LG9A 3C9CA 4ERZA 4CZXA 2OIZA 4H5IA 5B4WA 3MZKA 4A11B 4CY2A 4CC9A 4A11A 4E54B 3UVMA 2HYEA 4E54A 3N0DA 1N6EA 4BL0A 2CO0C 3C5MA 3IJ0A 5CXCA 3JROA 3UKUC 4CY3A 3EI4B 4FAVD 3SLED 1B9YA 3I8EA 4J81A 4GZ8A 2I3TA 4FB1D 2H13A 4E5ZB 3I8CA 4XYIA 2P9UC 3L4MD 4K3ID 3PE7A 3MXXA 4AOWA 4GGDA 3SBRA 1B9XA 2AGXA 5TEEA 2PM7B 1N6FA 3RN1D 3FM0A 2AGLA 1NEXB 3I7NA 3J81g 4NSXA 1R5MA 2XL3A 3V9FA 3RFHA 4J73A 4L3GD 4O9DA 4A0BA 5C2WB 2UZYB 3V5WB 2IWFA 4U7AA 2YMUA 5CYKB 5C2VB 3SBPA 2CO0A 2XU7A 1JJUB 3IKOA 4ZN4A 1GP2B 3UVOA 1YFQA 4XYHA 1TYQC 4D0KA 2EBSA 4EWRA 5IC7A 4FA1D 2PM9B 2PM9A 3SBQA 5IJ8E 4J79A 2B5LA 5TEFA 1OMWB 2YNOA 4GGAA 5EAPA 5KDOB 2IWKA 2HKRA 1ERJA 2BCJB 1MG2A 3KRWB 2XYIA 2P9KC 3DWLC 4CY1A 4O3UB 4A09B 3P4FA 3RMZD 5HYNB 3J80g 4A09A 2IUPA 5FKSA 2UZXB 5I5JA 2I0RA 3SJLD 4D6VA 5K1CC 3RRMC 4ERYA 2W18A 3C75H 3CFSB 2J57G 2HESX 3OKYB 3CIKB 3V7DB 2H9LA 1GOTB 1U2VC 4X60B 3OKTA 3PSLA 3MKSB 3OKWA 3PXSD 5FA5B 3VGZA 2H6NA 5H17A 4CI3A 3I2NA 2CE9A 2HJBA 4FHLA 1K8KC 1A0RB 2H47A 3IJ1A 4QT8A 3RFGA 4KFMB 3B7FA 2OK4A 4G56B 3DSMA 2QXVA 4ZOVA 1JMXB 3F3GA 3EI3A 3I7KA 3GFCA 4ES0A 2Q7QA 4X63B 4FWWA 2J56H 2P9SC 4FAND 2PM6B 5EAMA 4TZ4A 2YB8B 3PSCB 4JSXC 4CY5A 2Z2PA 4J8GA 2P9LC 2H6QA 2H9MA 3HFQA 4UI9R 3EMHA 3RLMD 2IUVA 3EI4A 4HDJA 4JSNC 4PSXB 3I7HA 5EMKB 2AH0A 5HE0B 3GREA 4LG8A 5AFU3 4E5ZA 4J0WA 3K26A 5GMKn 1RI6A 5H14A 5IJ7E 4GQBB 5C9ZB 4CZYA 1OLZA 3I7PA 1K32A 3NVXA 5IGOA 2HJ4A 3U4YA 1L0QA 3MKQA 5CYKA 5EMLB 4CI1A 2HKMA 4CI2A 2CN3A 4IA9A 3DM0A 2H3XA 5A2Qg 4J78A 3NVNA 2GC4A 3SVWD 5SXMA 4A08B 3JRPA 4A08A 2OVQB 2QC5A 5EMMB 5IGQA 4L9OA 4JD2C 5HQGA 3UKRC 2H14A 4QRJA 2Z2OA 2CNXA 4L1QD 2I0TA 5H1MA 4OZUA 1QNIA 3JB9L 3OTTA 3SFZA 1XIPA 2H68A 2I0SA 5HE3B 2GC7A 3BG1A 2XL2A 3N0EA 4JT5C 1N6DA 3UR4A 4A2LA 3BG0A 4PSWB 3JZHA 5TDHB 3RN0D 2AQ5A 2O9KA 4BUJC 5FLXg 4J0XA 2IUQA 3OKYA 4GMBA 2IURA 4A2MA 4PNKB 1SQJA 4GQ1A 1SQ9A 2YNNA 3VH0A 4A0AB 4A0AA 2MTAH 4U1EI 3SMRA 3K27A 2H9NA 3AH8B 5AJAA 1SHYB 2YNPA 3DXKC 3IIYA 2PBIB 3ORVD 5I5MA 3JPXA 4N14A 4X61B 5AMSA 2BBKH 2AGWA 3EI2B 3I7LA 1TBGA 3EI1B 3EI1A 4GM9A 4ZOYA 1XKSA 1JOFA 4Z8LA 4GM8A 4A7JA 4ERQA 4PBYA 2G99A 3ZWLB 1JMZB 3F3FA 5CXBB 4FA9D 4J82A 4FA4D 1MG3A 2Z2NA 2TRCB 4I79A 4ESGA 3IJCA 3KRXB 2J55H 5HE1B 2P9NC 4ZOZA 5K19A 4JXMA 4YVDA 5FKQA 3AL9A 4MK0B 1PEVA 2B5MA 4JSPC 2IAAA 1GG2B 5CXCB 3AFCA 5I5IA 3OL2B 4X3EA 5IT9g 3OL2A 5EARA 2CN2A 3FRXA 5FKRA 3UVNA 4K3JB 2OVPB 2CE8A 3CFVA 4GQ2P 5GXIA 3EU7A 1VYHC 4Y7RA 4JT6C 4PBZA 4O1QD 1P22A 4GM3A 4IMMA 5FKTA 3MMYA 5JWZA 3EWEA 3PVWB 2AH1A 5GSAA 3UVLA 3L4OD 3PXWD 2H9PA 5TF2A 1MDAH 4OWRA 4A0BB 2P9IC 2G9AA 4LGNA 3SN6B 3E0CA 3W15A 2OJYA 3JAMg 4ZOXA 3EG6A 4Y5RD 1GXRA 1XHMA 5THAA 1S4UX 4R7AB 5FQDA 4J77A 2H6KA 3BWSA 1PGUA 3I7OA 4J84A 1U4CA 3C99A 4PC0A 2GNQA 4BH6A 4JSVC 4J87A 3NVQA 3UVKA 3SXTD 5EALA 2B4EA 3JZNA 2OK6A 4XEIC 1FWXA 3IIWA 4PXWA 4GGCA 2YBAA 3PXTD 5EMJB 2HXCA 4L3HD 5HE2B 4QL1A 3AL8B 3DXMC 3AL8A 3OW8A 3SWSD 5GXHA 3I89A 2OVRB 5FXYA 4O3TB 3EI2A 2P9PC 3SCYA 1PBYB 4CZVA 3RSEC 2AGYA 3PVUB 3F3PA 1NR0A 4O45A 2AGZA 2B5NA 3FGBA 4QQEA 4CI8A 3A0FA 3SHFA 4AEZA 4H5JA
chains in the Genus database with same CATH superfamily
1H2YA 5CXBA 3V4VA 5EM2B 5EM2A 4J8BA 3NIFA 4J86A 3V4PA 4AMYA 2I3SA 3JZGA 4AX4A 3ODTA 4FA5D 3EI3B 1A12A 1GOGA 1PI6A 1Q47A 3ULEC 3VA6A 3MZLA 4LG9A 3C9CA 4ERZA 4CZXA 2OIZA 4H5IA 5B4WA 3MZKA 4A11B 4CY2A 4CC9A 4A11A 4E54B 4RE5A 3UVMA 2HYEA 4E54A 3N0DA 1N6EA 4BL0A 2CO0C 3C5MA 3IJ0A 3VI4A 5CXCA 3JROA 3UKUC 1C9IA 4CY3A 5FFGA 4D9SA 3EI4B 4FAVD 3SLED 1B9YA 1UOPA 3I8EA 4J81A 4GZ8A 2I3TA 4FB1D 5M5UA 2H13A 4E5ZB 3I8CA 4XYIA 3MVDK 2P9UC 3L4MD 4K3ID 3PE7A 3MXXA 4AOWA 4GGDA 3SBRA 1B9XA 2AGXA 5TEEA 3VI3A 2PM7B 1N6FA 4G55A 3FM0A 3RN1D 2AGLA 1NEXB 3I7NA 3OF7A 3J81g 4NSXA 1R5MA 2XL3A 3V9FA 1O6FA 3RFHA 4J73A 4L3GD 4O9DA 4A0BA 5C2WB 3FCSA 2UZYB 4UM9A 3V5WB 2IWFA 4U7AA 1VE7A 2YMUA 5CYKB 3IULA 4BCBA 4WK4A 3SBPA 5C2VB 2CO0A 2XU7A 1JJUB 3IKOA 2VDLA 1GP2B 4ZN4A 1H2XA 1YFQA 4XYHA 3UVOA 4NAAA 1TYQC 4D0KA 1YR2A 2EBSA 4EWRA 5IC7A 4FA1D 5M5SA 2PM9B 2PM9A 3SBQA 5IJ8E 4J79A 3T3PA 2B5LA 5TEFA 1OMWB 2YNOA 4GGAA 3IUNA 5EAPA 5KDOB 2IWKA 2HKRA 1ERJA 2BCJB 5E6RA 1MG2A 3KRWB 2XYIA 2P9KC 3DWLC 4CY1A 4O3UB 4A09B 3P4FA 3RMZD 5HYNB 3J80g 4A09A 2IUPA 5FKSA 2UZXB 5I5JA 2I0RA 3SJLD 5M5RA 4D6VA 5K1CC 3RRMC 4ERYA 2W18A 3C75H 3CFSB 2JKXA 2J57G 2HESX 3MUNA 3OKYB 3CIKB 3V7DB 2H9LA 1GOTB 4UM8A 1U2VC 4X60B 3OKTA 3PSLA 3MKSB 3OKWA 4QAMA 3PXSD 4L1MA 5FA5B 3VGZA 2H6NA 5H17A 4CI3A 3I2NA 2CE9A 4WK2A 2HJBA 4O02A 4FHLA 1K8KC 1A0RB 4Z7NA 2H47A 3IJ1A 4QT8A 2HU5A 3RFGA 4KFMB 3B7FA 2OK4A 3ZDZA 4G56B 1E8MA 3DSMA 2QXVA 4ZOVA 1JMXB 3F3GA 3EI3A 3I7KA 3GFCA 4ES0A 2Q7QA 4DNWA 4X63B 4FWWA 2J56H 2P9SC 1UOOA 4FAND 2PM6B 5EAMA 4TZ4A 1H2ZA 2YB8B 3PSCB 3IUQA 4JSXC 4CY5A 2Z2PA 4J8GA 2QR5A 2P9LC 2H6QA 4RE6A 2H9MA 3HFQA 4UI9R 3MUOA 3EMHA 3RLMD 2HU8A 2IUVA 3EI4A 4HDJA 4JSNC 4PSXB 1L5GA 3I7HA 5EMKB 2AH0A 5HE0B 3GREA 1H2WA 3IJEA 4LG8A 5AFU3 4E5ZA 4J0WA 3K26A 5GMKn 3O4JA 1RI6A 5H14A 3FCUA 5IJ7E 3IURA 3NIGA 4GQBB 5C9ZB 3DDUA 4CZYA 1OLZA 2VDKA 3I7PA 1K32A 3NVXA 5IGOA 2HJ4A 1K3IA 3U4YA 1L0QA 3MKQA 4NENA 5CYKA 5EMLB 3ZDXA 4CI1A 2HKMA 4CI2A 2CN3A 4IA9A 3DM0A 2H3XA 5A2Qg 4J78A 3NVNA 2GC4A 3SVWD 2XE4A 3EQ7A 5SXMA 4A08B 3JRPA 1JTDB 4A08A 2OVQB 2HU7A 2QC5A 5E6UA 5EMMB 5IGQA 4L9OA 4JD2C 4G1MA 5HQGA 1UTCA 3UKRC 1O6GA 2H14A 4QRJA 2Z2OA 2CNXA 3K71A 4L1QD 2I0TA 5H1MA 4OZUA 5M61A 1QNIA 3JB9L 3OTTA 3SFZA 1XIPA 2H68A 4Z7QA 2I0SA 5HE3B 2GC7A 3KCIA 3BG1A 2XL2A 3N0EA 4JT5C 1N6DA 3UR4A 4A2LA 3BG0A 4PSWB 3JZHA 5TDHB 3RN0D 2AQ5A 2O9KA 4BUJC 2EIEA 5FLXg 3ZDYA 4J0XA 2IUQA 3OKYA 4GMBA 2IURA 4A2MA 4PNKB 1SQJA 4GQ1A 1SQ9A 3ZE1A 1E8NA 2YNNA 3VH0A 4A0AB 2VZ1A 4A0AA 2MTAH 4U1EI 3SMRA 5M5TA 3K72A 1BPOA 1QFMA 1UOQA 3K27A 2H9NA 3AH8B 5AJAA 3ZE0A 1SHYB 2YNPA 3DXKC 3IIYA 2PBIB 3ORVD 4NC4A 5I5MA 2VDRA 3JPXA 4N14A 4X61B 5AMSA 2BBKH 3O4HA 4BCDA 2AGWA 2XZGA 3I7LA 3EI2B 1TBGA 3EI1B 4G1EA 3EI1A 4GM9A 4ZOYA 2VDQA 1XKSA 1JOFA 4JHPC 4Z8LA 4GM8A 4A7JA 4ERQA 4PBYA 3GD1I 5C86A 2G99A 2VDMA 3ZWLB 1VE6A 2EIDA 4AMZA 1JMZB 3F3FA 4AN1A 1VZ3A 5FFOA 5CXBB 4FA9D 4J82A 4FA4D 1MG3A 1U8CA 3ZE2A 2Z2NA 3K6SA 2TRCB 3IUMA 5M5VA 4I79A 4ESGA 3IJCA 3KRXB 2J55H 5HE1B 2P9NC 4ZOZA 4DNUA 3NIDA 5K19A 4JXMA 4YVDA 5FKQA 4MMYA 4JHNA 3AL9A 1M1XA 4MK0B 1PEVA 2B5MA 4JSPC 2IAAA 1GG2B 5CXCB 3T3MA 2VDNA 3AFCA 5I5IA 2QZPA 3OL2B 4X3EA 1E5TA 5IT9g 3OL2A 5EARA 2CN2A 3FRXA 5FKRA 3UVNA 4K3JB 2OVPB 2CE8A 3CFVA 4GQ2P 5GXIA 3EU7A 4DNVA 3EQ8A 2XDWA 3IVMA 1VYHC 4Y7RA 4JT6C 3QHYB 4PBZA 4O1QD 1P22A 1QFSA 1VZ2A 4GM3A 3IUJA 4IMMA 5FKTA 3MMYA 4MMZA 5JWZA 3EWEA 3PVWB 2AH1A 5GSAA 5E6SA 3UVLA 3L4OD 1JV2A 3PXWD 2H9PA 5TF2A 1MDAH 4Z7OA 4OWRA 4A0BB 2P9IC 4WK0A 4NBMA 2G9AA 4LGNA 3SN6B 3E0CA 2EIBA 3W15A 2OJYA 3JAMg 2EICA 4ZOXA 3QI0A 3EG6A 4Y5RD 1C9LA 1GXRA 1XHMA 2WQ8A 2VZ3A 1I2MB 4O2WA 5THAA 1S4UX 3O4GA 4R7AB 5FQDA 4J77A 2H6KA 3BWSA 1PGUA 3I7OA 3GC3B 4J84A 1U4CA 3C99A 4PC0A 2VDOA 2GNQA 4BH6A 4JSVC 4J87A 3NVQA 1TYEA 1GOHA 3UVKA 4AN0A 3SXTD 5EALA 2B4EA 3JZNA 2OK6A 4XEIC 2BKLA 5HDBA 1FWXA 3IIWA 4PXWA 4GGCA 2YBAA 4BP8A 4IRZA 2VDPA 4MMXA 3PXTD 5EMJB 2HXCA 4L3HD 5HE2B 4QL1A 4WJKA 3AL8B 3DXMC 3AL8A 3OW8A 3SWSD 5GXHA 3I89A 2OVRB 4BP9A 5C92A 5FXYA 4O3TB 3EI2A 2P9PC 3SCYA 3O4IA 1PBYB 4CZVA 1GOFA 3RSEC 2AGYA 3PVUB 4BCCA 1T2XA 3F3PA 3EQ9A 1NR0A 4O45A 2VC2A 2AGZA 2B5NA 3FGBA 4QQEA 4CI8A 3A0FA 3SHFA 4AEZA 4H5JA
chains in the Genus database with same CATH topology
5CXBA 5EM2B 5EM2A 4J8BA 4J86A 2I3SA 3JZGA 3ODTA 4FA5D 3EI3B 1Q47A 1PI6A 3ULEC 3VA6A 3MZLA 4LG9A 3C9CA 4ERZA 4CZXA 2OIZA 4H5IA 5B4WA 3MZKA 4A11B 4CY2A 4CC9A 4A11A 4E54B 3UVMA 2HYEA 4E54A 3N0DA 1N6EA 4BL0A 2CO0C 3C5MA 3IJ0A 5CXCA 3JROA 3UKUC 4CY3A 3EI4B 4FAVD 3SLED 1B9YA 3I8EA 4J81A 4GZ8A 2I3TA 4FB1D 2H13A 4E5ZB 3I8CA 4XYIA 2P9UC 3L4MD 4K3ID 3PE7A 3MXXA 4AOWA 4GGDA 3SBRA 1B9XA 2AGXA 5TEEA 2PM7B 1N6FA 3RN1D 3FM0A 2AGLA 1NEXB 3I7NA 3J81g 4NSXA 1R5MA 2XL3A 3V9FA 3RFHA 4J73A 4L3GD 4O9DA 4A0BA 5C2WB 2UZYB 3V5WB 2IWFA 4U7AA 2YMUA 5CYKB 5C2VB 3SBPA 2CO0A 2XU7A 1JJUB 3IKOA 4ZN4A 1GP2B 3UVOA 1YFQA 4XYHA 1TYQC 4D0KA 2EBSA 4EWRA 5IC7A 4FA1D 2PM9B 2PM9A 3SBQA 5IJ8E 4J79A 2B5LA 5TEFA 1OMWB 2YNOA 4GGAA 5EAPA 5KDOB 2IWKA 2HKRA 1ERJA 2BCJB 1MG2A 3KRWB 2XYIA 2P9KC 3DWLC 4CY1A 4O3UB 4A09B 3P4FA 3RMZD 5HYNB 3J80g 4A09A 2IUPA 5FKSA 2UZXB 5I5JA 2I0RA 3SJLD 4D6VA 5K1CC 3RRMC 4ERYA 2W18A 3C75H 3CFSB 2J57G 2HESX 3OKYB 3CIKB 3V7DB 2H9LA 1GOTB 1U2VC 4X60B 3OKTA 3PSLA 3MKSB 3OKWA 3PXSD 5FA5B 3VGZA 2H6NA 5H17A 4CI3A 3I2NA 2CE9A 2HJBA 4FHLA 1K8KC 1A0RB 2H47A 3IJ1A 4QT8A 3RFGA 4KFMB 3B7FA 2OK4A 4G56B 3DSMA 2QXVA 4ZOVA 1JMXB 3F3GA 3EI3A 3I7KA 3GFCA 4ES0A 2Q7QA 4X63B 4FWWA 2J56H 2P9SC 4FAND 2PM6B 5EAMA 4TZ4A 2YB8B 3PSCB 4JSXC 4CY5A 2Z2PA 4J8GA 2P9LC 2H6QA 2H9MA 3HFQA 4UI9R 3EMHA 3RLMD 2IUVA 3EI4A 4HDJA 4JSNC 4PSXB 3I7HA 5EMKB 2AH0A 5HE0B 3GREA 4LG8A 5AFU3 4E5ZA 4J0WA 3K26A 5GMKn 1RI6A 5H14A 5IJ7E 4GQBB 5C9ZB 4CZYA 1OLZA 3I7PA 1K32A 3NVXA 5IGOA 2HJ4A 3U4YA 1L0QA 3MKQA 5CYKA 5EMLB 4CI1A 2HKMA 4CI2A 2CN3A 4IA9A 3DM0A 2H3XA 5A2Qg 4J78A 3NVNA 2GC4A 3SVWD 5SXMA 4A08B 3JRPA 4A08A 2OVQB 2QC5A 5EMMB 5IGQA 4L9OA 4JD2C 5HQGA 3UKRC 2H14A 4QRJA 2Z2OA 2CNXA 4L1QD 2I0TA 5H1MA 4OZUA 1QNIA 3JB9L 3OTTA 3SFZA 1XIPA 2H68A 2I0SA 5HE3B 2GC7A 3BG1A 2XL2A 3N0EA 4JT5C 1N6DA 3UR4A 4A2LA 3BG0A 4PSWB 3JZHA 5TDHB 3RN0D 2AQ5A 2O9KA 4BUJC 5FLXg 4J0XA 2IUQA 3OKYA 4GMBA 2IURA 4A2MA 4PNKB 1SQJA 4GQ1A 1SQ9A 2YNNA 3VH0A 4A0AB 4A0AA 2MTAH 4U1EI 3SMRA 3K27A 2H9NA 3AH8B 5AJAA 1SHYB 2YNPA 3DXKC 3IIYA 2PBIB 3ORVD 5I5MA 3JPXA 4N14A 4X61B 5AMSA 2BBKH 2AGWA 3EI2B 3I7LA 1TBGA 3EI1B 3EI1A 4GM9A 4ZOYA 1XKSA 1JOFA 4Z8LA 4GM8A 4A7JA 4ERQA 4PBYA 2G99A 3ZWLB 1JMZB 3F3FA 5CXBB 4FA9D 4J82A 4FA4D 1MG3A 2Z2NA 2TRCB 4I79A 4ESGA 3IJCA 3KRXB 2J55H 5HE1B 2P9NC 4ZOZA 5K19A 4JXMA 4YVDA 5FKQA 3AL9A 4MK0B 1PEVA 2B5MA 4JSPC 2IAAA 1GG2B 5CXCB 3AFCA 5I5IA 3OL2B 4X3EA 5IT9g 3OL2A 5EARA 2CN2A 3FRXA 5FKRA 3UVNA 4K3JB 2OVPB 2CE8A 3CFVA 4GQ2P 5GXIA 3EU7A 1VYHC 4Y7RA 4JT6C 4PBZA 4O1QD 1P22A 4GM3A 4IMMA 5FKTA 3MMYA 5JWZA 3EWEA 3PVWB 2AH1A 5GSAA 3UVLA 3L4OD 3PXWD 2H9PA 5TF2A 1MDAH 4OWRA 4A0BB 2P9IC 2G9AA 4LGNA 3SN6B 3E0CA 3W15A 2OJYA 3JAMg 4ZOXA 3EG6A 4Y5RD 1GXRA 1XHMA 5THAA 1S4UX 4R7AB 5FQDA 4J77A 2H6KA 3BWSA 1PGUA 3I7OA 4J84A 1U4CA 3C99A 4PC0A 2GNQA 4BH6A 4JSVC 4J87A 3NVQA 3UVKA 3SXTD 5EALA 2B4EA 3JZNA 2OK6A 4XEIC 1FWXA 3IIWA 4PXWA 4GGCA 2YBAA 3PXTD 5EMJB 2HXCA 4L3HD 5HE2B 4QL1A 3AL8B 3DXMC 3AL8A 3OW8A 3SWSD 5GXHA 3I89A 2OVRB 5FXYA 4O3TB 3EI2A 2P9PC 3SCYA 1PBYB 4CZVA 3RSEC 2AGYA 3PVUB 3F3PA 1NR0A 4O45A 2AGZA 2B5NA 3FGBA 4QQEA 4CI8A 3A0FA 3SHFA 4AEZA 4H5JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CXB A;  5EM2 B;  5EM2 A;  4J8B A;  4J86 A;  2I3S A;  3JZG A;  3ODT A;  4FA5 D;  3EI3 B;  1Q47 A;  1PI6 A;  3ULE C;  3VA6 A;  3MZL A;  4LG9 A;  3C9C A;  4ERZ A;  4CZX A;  2OIZ A;  4H5I A;  5B4W A;  3MZK A;  4A11 B;  4CY2 A;  4CC9 A;  4A11 A;  4E54 B;  3UVM A;  2HYE A;  4E54 A;  3N0D A;  1N6E A;  4BL0 A;  2CO0 C;  3C5M A;  3IJ0 A;  5CXC A;  3JRO A;  3UKU C;  4CY3 A;  3EI4 B;  4FAV D;  3SLE D;  1B9Y A;  3I8E A;  4J81 A;  4GZ8 A;  2I3T A;  4FB1 D;  2H13 A;  4E5Z B;  3I8C A;  4XYI A;  2P9U C;  3L4M D;  4K3I D;  3PE7 A;  3MXX A;  4AOW A;  4GGD A;  3SBR A;  1B9X A;  2AGX A;  5TEE A;  2PM7 B;  1N6F A;  3RN1 D;  3FM0 A;  2AGL A;  1NEX B;  3I7N A;  3J81 g;  4NSX A;  1R5M A;  2XL3 A;  3V9F A;  3RFH A;  4J73 A;  4L3G D;  4O9D A;  4A0B A;  5C2W B;  2UZY B;  3V5W B;  2IWF A;  4U7A A;  2YMU A;  5CYK B;  5C2V B;  3SBP A;  2CO0 A;  2XU7 A;  1JJU B;  3IKO A;  4ZN4 A;  1GP2 B;  3UVO A;  1YFQ A;  4XYH A;  1TYQ C;  4D0K A;  2EBS A;  4EWR A;  5IC7 A;  4FA1 D;  2PM9 B;  2PM9 A;  3SBQ A;  5IJ8 E;  4J79 A;  2B5L A;  5TEF A;  1OMW B;  2YNO A;  4GGA A;  5EAP A;  5KDO B;  2IWK A;  2HKR A;  1ERJ A;  2BCJ B;  1MG2 A;  3KRW B;  2XYI A;  2P9K C;  3DWL C;  4CY1 A;  4O3U B;  4A09 B;  3P4F A;  3RMZ D;  5HYN B;  3J80 g;  4A09 A;  2IUP A;  5FKS A;  2UZX B;  5I5J A;  2I0R A;  3SJL D;  4D6V A;  5K1C C;  3RRM C;  4ERY A;  2W18 A;  3C75 H;  3CFS B;  2J57 G;  2HES X;  3OKY B;  3CIK B;  3V7D B;  2H9L A;  1GOT B;  1U2V C;  4X60 B;  3OKT A;  3PSL A;  3MKS B;  3OKW A;  3PXS D;  5FA5 B;  3VGZ A;  2H6N A;  5H17 A;  4CI3 A;  3I2N A;  2CE9 A;  2HJB A;  4FHL A;  1K8K C;  1A0R B;  2H47 A;  3IJ1 A;  4QT8 A;  3RFG A;  4KFM B;  3B7F A;  2OK4 A;  4G56 B;  3DSM A;  2QXV A;  4ZOV A;  1JMX B;  3F3G A;  3EI3 A;  3I7K A;  3GFC A;  4ES0 A;  2Q7Q A;  4X63 B;  4FWW A;  2J56 H;  2P9S C;  4FAN D;  2PM6 B;  5EAM A;  4TZ4 A;  2YB8 B;  3PSC B;  4JSX C;  4CY5 A;  2Z2P A;  4J8G A;  2P9L C;  2H6Q A;  2H9M A;  3HFQ A;  4UI9 R;  3EMH A;  3RLM D;  2IUV A;  3EI4 A;  4HDJ A;  4JSN C;  4PSX B;  3I7H A;  5EMK B;  2AH0 A;  5HE0 B;  3GRE A;  4LG8 A;  5AFU 3;  4E5Z A;  4J0W A;  3K26 A;  5GMK n;  1RI6 A;  5H14 A;  5IJ7 E;  4GQB B;  5C9Z B;  4CZY A;  1OLZ A;  3I7P A;  1K32 A;  3NVX A;  5IGO A;  2HJ4 A;  3U4Y A;  1L0Q A;  3MKQ A;  5CYK A;  5EML B;  4CI1 A;  2HKM A;  4CI2 A;  2CN3 A;  4IA9 A;  3DM0 A;  2H3X A;  5A2Q g;  4J78 A;  3NVN A;  2GC4 A;  3SVW D;  5SXM A;  4A08 B;  3JRP A;  4A08 A;  2OVQ B;  2QC5 A;  5EMM B;  5IGQ A;  4L9O A;  4JD2 C;  5HQG A;  3UKR C;  2H14 A;  4QRJ A;  2Z2O A;  2CNX A;  4L1Q D;  2I0T A;  5H1M A;  4OZU A;  1QNI A;  3JB9 L;  3OTT A;  3SFZ A;  1XIP A;  2H68 A;  2I0S A;  5HE3 B;  2GC7 A;  3BG1 A;  2XL2 A;  3N0E A;  4JT5 C;  1N6D A;  3UR4 A;  4A2L A;  3BG0 A;  4PSW B;  3JZH A;  5TDH B;  3RN0 D;  2AQ5 A;  2O9K A;  4BUJ C;  5FLX g;  4J0X A;  2IUQ A;  3OKY A;  4GMB A;  2IUR A;  4A2M A;  4PNK B;  1SQJ A;  4GQ1 A;  1SQ9 A;  2YNN A;  3VH0 A;  4A0A B;  4A0A A;  2MTA H;  4U1E I;  3SMR A;  3K27 A;  2H9N A;  3AH8 B;  5AJA A;  1SHY B;  2YNP A;  3DXK C;  3IIY A;  2PBI B;  3ORV D;  5I5M A;  3JPX A;  4N14 A;  4X61 B;  5AMS A;  2BBK H;  2AGW A;  3EI2 B;  3I7L A;  1TBG A;  3EI1 B;  3EI1 A;  4GM9 A;  4ZOY A;  1XKS A;  1JOF A;  4Z8L A;  4GM8 A;  4A7J A;  4ERQ A;  4PBY A;  2G99 A;  3ZWL B;  1JMZ B;  3F3F A;  5CXB B;  4FA9 D;  4J82 A;  4FA4 D;  1MG3 A;  2Z2N A;  2TRC B;  4I79 A;  4ESG A;  3IJC A;  3KRX B;  2J55 H;  5HE1 B;  2P9N C;  4ZOZ A;  5K19 A;  4JXM A;  4YVD A;  5FKQ A;  3AL9 A;  4MK0 B;  1PEV A;  2B5M A;  4JSP C;  2IAA A;  1GG2 B;  5CXC B;  3AFC A;  5I5I A;  3OL2 B;  4X3E A;  5IT9 g;  3OL2 A;  5EAR A;  2CN2 A;  3FRX A;  5FKR A;  3UVN A;  4K3J B;  2OVP B;  2CE8 A;  3CFV A;  4GQ2 P;  5GXI A;  3EU7 A;  1VYH C;  4Y7R A;  4JT6 C;  4PBZ A;  4O1Q D;  1P22 A;  4GM3 A;  4IMM A;  5FKT A;  3MMY A;  5JWZ A;  3EWE A;  3PVW B;  2AH1 A;  5GSA A;  3UVL A;  3L4O D;  3PXW D;  2H9P A;  5TF2 A;  1MDA H;  4OWR A;  4A0B B;  2P9I C;  2G9A A;  4LGN A;  3SN6 B;  3E0C A;  3W15 A;  2OJY A;  3JAM g;  4ZOX A;  3EG6 A;  4Y5R D;  1GXR A;  1XHM A;  5THA A;  1S4U X;  4R7A B;  5FQD A;  4J77 A;  2H6K A;  3BWS A;  1PGU A;  3I7O A;  4J84 A;  1U4C A;  3C99 A;  4PC0 A;  2GNQ A;  4BH6 A;  4JSV C;  4J87 A;  3NVQ A;  3UVK A;  3SXT D;  5EAL A;  2B4E A;  3JZN A;  2OK6 A;  4XEI C;  1FWX A;  3IIW A;  4PXW A;  4GGC A;  2YBA A;  3PXT D;  5EMJ B;  2HXC A;  4L3H D;  5HE2 B;  4QL1 A;  3AL8 B;  3DXM C;  3AL8 A;  3OW8 A;  3SWS D;  5GXH A;  3I89 A;  2OVR B;  5FXY A;  4O3T B;  3EI2 A;  2P9P C;  3SCY A;  1PBY B;  4CZV A;  3RSE C;  2AGY A;  3PVU B;  3F3P A;  1NR0 A;  4O45 A;  2AGZ A;  2B5N A;  3FGB A;  4QQE A;  4CI8 A;  3A0F A;  3SHF A;  4AEZ A;  4H5J A; 
#chains in the Genus database with same CATH topology
 1H2Y A;  5CXB A;  3V4V A;  5EM2 B;  5EM2 A;  4J8B A;  3NIF A;  4J86 A;  3V4P A;  4AMY A;  2I3S A;  3JZG A;  4AX4 A;  3ODT A;  4FA5 D;  3EI3 B;  1A12 A;  1GOG A;  1PI6 A;  1Q47 A;  3ULE C;  3VA6 A;  3MZL A;  4LG9 A;  3C9C A;  4ERZ A;  4CZX A;  2OIZ A;  4H5I A;  5B4W A;  3MZK A;  4A11 B;  4CY2 A;  4CC9 A;  4A11 A;  4E54 B;  4RE5 A;  3UVM A;  2HYE A;  4E54 A;  3N0D A;  1N6E A;  4BL0 A;  2CO0 C;  3C5M A;  3IJ0 A;  3VI4 A;  5CXC A;  3JRO A;  3UKU C;  1C9I A;  4CY3 A;  5FFG A;  4D9S A;  3EI4 B;  4FAV D;  3SLE D;  1B9Y A;  1UOP A;  3I8E A;  4J81 A;  4GZ8 A;  2I3T A;  4FB1 D;  5M5U A;  2H13 A;  4E5Z B;  3I8C A;  4XYI A;  3MVD K;  2P9U C;  3L4M D;  4K3I D;  3PE7 A;  3MXX A;  4AOW A;  4GGD A;  3SBR A;  1B9X A;  2AGX A;  5TEE A;  3VI3 A;  2PM7 B;  1N6F A;  4G55 A;  3FM0 A;  3RN1 D;  2AGL A;  1NEX B;  3I7N A;  3OF7 A;  3J81 g;  4NSX A;  1R5M A;  2XL3 A;  3V9F A;  1O6F A;  3RFH A;  4J73 A;  4L3G D;  4O9D A;  4A0B A;  5C2W B;  3FCS A;  2UZY B;  4UM9 A;  3V5W B;  2IWF A;  4U7A A;  1VE7 A;  2YMU A;  5CYK B;  3IUL A;  4BCB A;  4WK4 A;  3SBP A;  5C2V B;  2CO0 A;  2XU7 A;  1JJU B;  3IKO A;  2VDL A;  1GP2 B;  4ZN4 A;  1H2X A;  1YFQ A;  4XYH A;  3UVO A;  4NAA A;  1TYQ C;  4D0K A;  1YR2 A;  2EBS A;  4EWR A;  5IC7 A;  4FA1 D;  5M5S A;  2PM9 B;  2PM9 A;  3SBQ A;  5IJ8 E;  4J79 A;  3T3P A;  2B5L A;  5TEF A;  1OMW B;  2YNO A;  4GGA A;  3IUN A;  5EAP A;  5KDO B;  2IWK A;  2HKR A;  1ERJ A;  2BCJ B;  5E6R A;  1MG2 A;  3KRW B;  2XYI A;  2P9K C;  3DWL C;  4CY1 A;  4O3U B;  4A09 B;  3P4F A;  3RMZ D;  5HYN B;  3J80 g;  4A09 A;  2IUP A;  5FKS A;  2UZX B;  5I5J A;  2I0R A;  3SJL D;  5M5R A;  4D6V A;  5K1C C;  3RRM C;  4ERY A;  2W18 A;  3C75 H;  3CFS B;  2JKX A;  2J57 G;  2HES X;  3MUN A;  3OKY B;  3CIK B;  3V7D B;  2H9L A;  1GOT B;  4UM8 A;  1U2V C;  4X60 B;  3OKT A;  3PSL A;  3MKS B;  3OKW A;  4QAM A;  3PXS D;  4L1M A;  5FA5 B;  3VGZ A;  2H6N A;  5H17 A;  4CI3 A;  3I2N A;  2CE9 A;  4WK2 A;  2HJB A;  4O02 A;  4FHL A;  1K8K C;  1A0R B;  4Z7N A;  2H47 A;  3IJ1 A;  4QT8 A;  2HU5 A;  3RFG A;  4KFM B;  3B7F A;  2OK4 A;  3ZDZ A;  4G56 B;  1E8M A;  3DSM A;  2QXV A;  4ZOV A;  1JMX B;  3F3G A;  3EI3 A;  3I7K A;  3GFC A;  4ES0 A;  2Q7Q A;  4DNW A;  4X63 B;  4FWW A;  2J56 H;  2P9S C;  1UOO A;  4FAN D;  2PM6 B;  5EAM A;  4TZ4 A;  1H2Z A;  2YB8 B;  3PSC B;  3IUQ A;  4JSX C;  4CY5 A;  2Z2P A;  4J8G A;  2QR5 A;  2P9L C;  2H6Q A;  4RE6 A;  2H9M A;  3HFQ A;  4UI9 R;  3MUO A;  3EMH A;  3RLM D;  2HU8 A;  2IUV A;  3EI4 A;  4HDJ A;  4JSN C;  4PSX B;  1L5G A;  3I7H A;  5EMK B;  2AH0 A;  5HE0 B;  3GRE A;  1H2W A;  3IJE A;  4LG8 A;  5AFU 3;  4E5Z A;  4J0W A;  3K26 A;  5GMK n;  3O4J A;  1RI6 A;  5H14 A;  3FCU A;  5IJ7 E;  3IUR A;  3NIG A;  4GQB B;  5C9Z B;  3DDU A;  4CZY A;  1OLZ A;  2VDK A;  3I7P A;  1K32 A;  3NVX A;  5IGO A;  2HJ4 A;  1K3I A;  3U4Y A;  1L0Q A;  3MKQ A;  4NEN A;  5CYK A;  5EML B;  3ZDX A;  4CI1 A;  2HKM A;  4CI2 A;  2CN3 A;  4IA9 A;  3DM0 A;  2H3X A;  5A2Q g;  4J78 A;  3NVN A;  2GC4 A;  3SVW D;  2XE4 A;  3EQ7 A;  5SXM A;  4A08 B;  3JRP A;  1JTD B;  4A08 A;  2OVQ B;  2HU7 A;  2QC5 A;  5E6U A;  5EMM B;  5IGQ A;  4L9O A;  4JD2 C;  4G1M A;  5HQG A;  1UTC A;  3UKR C;  1O6G A;  2H14 A;  4QRJ A;  2Z2O A;  2CNX A;  3K71 A;  4L1Q D;  2I0T A;  5H1M A;  4OZU A;  5M61 A;  1QNI A;  3JB9 L;  3OTT A;  3SFZ A;  1XIP A;  2H68 A;  4Z7Q A;  2I0S A;  5HE3 B;  2GC7 A;  3KCI A;  3BG1 A;  2XL2 A;  3N0E A;  4JT5 C;  1N6D A;  3UR4 A;  4A2L A;  3BG0 A;  4PSW B;  3JZH A;  5TDH B;  3RN0 D;  2AQ5 A;  2O9K A;  4BUJ C;  2EIE A;  5FLX g;  3ZDY A;  4J0X A;  2IUQ A;  3OKY A;  4GMB A;  2IUR A;  4A2M A;  4PNK B;  1SQJ A;  4GQ1 A;  1SQ9 A;  3ZE1 A;  1E8N A;  2YNN A;  3VH0 A;  4A0A B;  2VZ1 A;  4A0A A;  2MTA H;  4U1E I;  3SMR A;  5M5T A;  3K72 A;  1BPO A;  1QFM A;  1UOQ A;  3K27 A;  2H9N A;  3AH8 B;  5AJA A;  3ZE0 A;  1SHY B;  2YNP A;  3DXK C;  3IIY A;  2PBI B;  3ORV D;  4NC4 A;  5I5M A;  2VDR A;  3JPX A;  4N14 A;  4X61 B;  5AMS A;  2BBK H;  3O4H A;  4BCD A;  2AGW A;  2XZG A;  3I7L A;  3EI2 B;  1TBG A;  3EI1 B;  4G1E A;  3EI1 A;  4GM9 A;  4ZOY A;  2VDQ A;  1XKS A;  1JOF A;  4JHP C;  4Z8L A;  4GM8 A;  4A7J A;  4ERQ A;  4PBY A;  3GD1 I;  5C86 A;  2G99 A;  2VDM A;  3ZWL B;  1VE6 A;  2EID A;  4AMZ A;  1JMZ B;  3F3F A;  4AN1 A;  1VZ3 A;  5FFO A;  5CXB B;  4FA9 D;  4J82 A;  4FA4 D;  1MG3 A;  1U8C A;  3ZE2 A;  2Z2N A;  3K6S A;  2TRC B;  3IUM A;  5M5V A;  4I79 A;  4ESG A;  3IJC A;  3KRX B;  2J55 H;  5HE1 B;  2P9N C;  4ZOZ A;  4DNU A;  3NID A;  5K19 A;  4JXM A;  4YVD A;  5FKQ A;  4MMY A;  4JHN A;  3AL9 A;  1M1X A;  4MK0 B;  1PEV A;  2B5M A;  4JSP C;  2IAA A;  1GG2 B;  5CXC B;  3T3M A;  2VDN A;  3AFC A;  5I5I A;  2QZP A;  3OL2 B;  4X3E A;  1E5T A;  5IT9 g;  3OL2 A;  5EAR A;  2CN2 A;  3FRX A;  5FKR A;  3UVN A;  4K3J B;  2OVP B;  2CE8 A;  3CFV A;  4GQ2 P;  5GXI A;  3EU7 A;  4DNV A;  3EQ8 A;  2XDW A;  3IVM A;  1VYH C;  4Y7R A;  4JT6 C;  3QHY B;  4PBZ A;  4O1Q D;  1P22 A;  1QFS A;  1VZ2 A;  4GM3 A;  3IUJ A;  4IMM A;  5FKT A;  3MMY A;  4MMZ A;  5JWZ A;  3EWE A;  3PVW B;  2AH1 A;  5GSA A;  5E6S A;  3UVL A;  3L4O D;  1JV2 A;  3PXW D;  2H9P A;  5TF2 A;  1MDA H;  4Z7O A;  4OWR A;  4A0B B;  2P9I C;  4WK0 A;  4NBM A;  2G9A A;  4LGN A;  3SN6 B;  3E0C A;  2EIB A;  3W15 A;  2OJY A;  3JAM g;  2EIC A;  4ZOX A;  3QI0 A;  3EG6 A;  4Y5R D;  1C9L A;  1GXR A;  1XHM A;  2WQ8 A;  2VZ3 A;  1I2M B;  4O2W A;  5THA A;  1S4U X;  3O4G A;  4R7A B;  5FQD A;  4J77 A;  2H6K A;  3BWS A;  1PGU A;  3I7O A;  3GC3 B;  4J84 A;  1U4C A;  3C99 A;  4PC0 A;  2VDO A;  2GNQ A;  4BH6 A;  4JSV C;  4J87 A;  3NVQ A;  1TYE A;  1GOH A;  3UVK A;  4AN0 A;  3SXT D;  5EAL A;  2B4E A;  3JZN A;  2OK6 A;  4XEI C;  2BKL A;  5HDB A;  1FWX A;  3IIW A;  4PXW A;  4GGC A;  2YBA A;  4BP8 A;  4IRZ A;  2VDP A;  4MMX A;  3PXT D;  5EMJ B;  2HXC A;  4L3H D;  5HE2 B;  4QL1 A;  4WJK A;  3AL8 B;  3DXM C;  3AL8 A;  3OW8 A;  3SWS D;  5GXH A;  3I89 A;  2OVR B;  4BP9 A;  5C92 A;  5FXY A;  4O3T B;  3EI2 A;  2P9P C;  3SCY A;  3O4I A;  1PBY B;  4CZV A;  1GOF A;  3RSE C;  2AGY A;  3PVU B;  4BCC A;  1T2X A;  3F3P A;  3EQ9 A;  1NR0 A;  4O45 A;  2VC2 A;  2AGZ A;  2B5N A;  3FGB A;  4QQE A;  4CI8 A;  3A0F A;  3SHF A;  4AEZ A;  4H5J A; 
#chains in the Genus database with same CATH homology
 5CXB A;  5EM2 B;  5EM2 A;  4J8B A;  4J86 A;  2I3S A;  3JZG A;  3ODT A;  4FA5 D;  3EI3 B;  1Q47 A;  1PI6 A;  3ULE C;  3VA6 A;  3MZL A;  4LG9 A;  3C9C A;  4ERZ A;  4CZX A;  2OIZ A;  4H5I A;  5B4W A;  3MZK A;  4A11 B;  4CY2 A;  4CC9 A;  4A11 A;  4E54 B;  3UVM A;  2HYE A;  4E54 A;  3N0D A;  1N6E A;  4BL0 A;  2CO0 C;  3C5M A;  3IJ0 A;  5CXC A;  3JRO A;  3UKU C;  4CY3 A;  3EI4 B;  4FAV D;  3SLE D;  1B9Y A;  3I8E A;  4J81 A;  4GZ8 A;  2I3T A;  4FB1 D;  2H13 A;  4E5Z B;  3I8C A;  4XYI A;  2P9U C;  3L4M D;  4K3I D;  3PE7 A;  3MXX A;  4AOW A;  4GGD A;  3SBR A;  1B9X A;  2AGX A;  5TEE A;  2PM7 B;  1N6F A;  3RN1 D;  3FM0 A;  2AGL A;  1NEX B;  3I7N A;  3J81 g;  4NSX A;  1R5M A;  2XL3 A;  3V9F A;  3RFH A;  4J73 A;  4L3G D;  4O9D A;  4A0B A;  5C2W B;  2UZY B;  3V5W B;  2IWF A;  4U7A A;  2YMU A;  5CYK B;  5C2V B;  3SBP A;  2CO0 A;  2XU7 A;  1JJU B;  3IKO A;  4ZN4 A;  1GP2 B;  3UVO A;  1YFQ A;  4XYH A;  1TYQ C;  4D0K A;  2EBS A;  4EWR A;  5IC7 A;  4FA1 D;  2PM9 B;  2PM9 A;  3SBQ A;  5IJ8 E;  4J79 A;  2B5L A;  5TEF A;  1OMW B;  2YNO A;  4GGA A;  5EAP A;  5KDO B;  2IWK A;  2HKR A;  1ERJ A;  2BCJ B;  1MG2 A;  3KRW B;  2XYI A;  2P9K C;  3DWL C;  4CY1 A;  4O3U B;  4A09 B;  3P4F A;  3RMZ D;  5HYN B;  3J80 g;  4A09 A;  2IUP A;  5FKS A;  2UZX B;  5I5J A;  2I0R A;  3SJL D;  4D6V A;  5K1C C;  3RRM C;  4ERY A;  2W18 A;  3C75 H;  3CFS B;  2J57 G;  2HES X;  3OKY B;  3CIK B;  3V7D B;  2H9L A;  1GOT B;  1U2V C;  4X60 B;  3OKT A;  3PSL A;  3MKS B;  3OKW A;  3PXS D;  5FA5 B;  3VGZ A;  2H6N A;  5H17 A;  4CI3 A;  3I2N A;  2CE9 A;  2HJB A;  4FHL A;  1K8K C;  1A0R B;  2H47 A;  3IJ1 A;  4QT8 A;  3RFG A;  4KFM B;  3B7F A;  2OK4 A;  4G56 B;  3DSM A;  2QXV A;  4ZOV A;  1JMX B;  3F3G A;  3EI3 A;  3I7K A;  3GFC A;  4ES0 A;  2Q7Q A;  4X63 B;  4FWW A;  2J56 H;  2P9S C;  4FAN D;  2PM6 B;  5EAM A;  4TZ4 A;  2YB8 B;  3PSC B;  4JSX C;  4CY5 A;  2Z2P A;  4J8G A;  2P9L C;  2H6Q A;  2H9M A;  3HFQ A;  4UI9 R;  3EMH A;  3RLM D;  2IUV A;  3EI4 A;  4HDJ A;  4JSN C;  4PSX B;  3I7H A;  5EMK B;  2AH0 A;  5HE0 B;  3GRE A;  4LG8 A;  5AFU 3;  4E5Z A;  4J0W A;  3K26 A;  5GMK n;  1RI6 A;  5H14 A;  5IJ7 E;  4GQB B;  5C9Z B;  4CZY A;  1OLZ A;  3I7P A;  1K32 A;  3NVX A;  5IGO A;  2HJ4 A;  3U4Y A;  1L0Q A;  3MKQ A;  5CYK A;  5EML B;  4CI1 A;  2HKM A;  4CI2 A;  2CN3 A;  4IA9 A;  3DM0 A;  2H3X A;  5A2Q g;  4J78 A;  3NVN A;  2GC4 A;  3SVW D;  5SXM A;  4A08 B;  3JRP A;  4A08 A;  2OVQ B;  2QC5 A;  5EMM B;  5IGQ A;  4L9O A;  4JD2 C;  5HQG A;  3UKR C;  2H14 A;  4QRJ A;  2Z2O A;  2CNX A;  4L1Q D;  2I0T A;  5H1M A;  4OZU A;  1QNI A;  3JB9 L;  3OTT A;  3SFZ A;  1XIP A;  2H68 A;  2I0S A;  5HE3 B;  2GC7 A;  3BG1 A;  2XL2 A;  3N0E A;  4JT5 C;  1N6D A;  3UR4 A;  4A2L A;  3BG0 A;  4PSW B;  3JZH A;  5TDH B;  3RN0 D;  2AQ5 A;  2O9K A;  4BUJ C;  5FLX g;  4J0X A;  2IUQ A;  3OKY A;  4GMB A;  2IUR A;  4A2M A;  4PNK B;  1SQJ A;  4GQ1 A;  1SQ9 A;  2YNN A;  3VH0 A;  4A0A B;  4A0A A;  2MTA H;  4U1E I;  3SMR A;  3K27 A;  2H9N A;  3AH8 B;  5AJA A;  1SHY B;  2YNP A;  3DXK C;  3IIY A;  2PBI B;  3ORV D;  5I5M A;  3JPX A;  4N14 A;  4X61 B;  5AMS A;  2BBK H;  2AGW A;  3EI2 B;  3I7L A;  1TBG A;  3EI1 B;  3EI1 A;  4GM9 A;  4ZOY A;  1XKS A;  1JOF A;  4Z8L A;  4GM8 A;  4A7J A;  4ERQ A;  4PBY A;  2G99 A;  3ZWL B;  1JMZ B;  3F3F A;  5CXB B;  4FA9 D;  4J82 A;  4FA4 D;  1MG3 A;  2Z2N A;  2TRC B;  4I79 A;  4ESG A;  3IJC A;  3KRX B;  2J55 H;  5HE1 B;  2P9N C;  4ZOZ A;  5K19 A;  4JXM A;  4YVD A;  5FKQ A;  3AL9 A;  4MK0 B;  1PEV A;  2B5M A;  4JSP C;  2IAA A;  1GG2 B;  5CXC B;  3AFC A;  5I5I A;  3OL2 B;  4X3E A;  5IT9 g;  3OL2 A;  5EAR A;  2CN2 A;  3FRX A;  5FKR A;  3UVN A;  4K3J B;  2OVP B;  2CE8 A;  3CFV A;  4GQ2 P;  5GXI A;  3EU7 A;  1VYH C;  4Y7R A;  4JT6 C;  4PBZ A;  4O1Q D;  1P22 A;  4GM3 A;  4IMM A;  5FKT A;  3MMY A;  5JWZ A;  3EWE A;  3PVW B;  2AH1 A;  5GSA A;  3UVL A;  3L4O D;  3PXW D;  2H9P A;  5TF2 A;  1MDA H;  4OWR A;  4A0B B;  2P9I C;  2G9A A;  4LGN A;  3SN6 B;  3E0C A;  3W15 A;  2OJY A;  3JAM g;  4ZOX A;  3EG6 A;  4Y5R D;  1GXR A;  1XHM A;  5THA A;  1S4U X;  4R7A B;  5FQD A;  4J77 A;  2H6K A;  3BWS A;  1PGU A;  3I7O A;  4J84 A;  1U4C A;  3C99 A;  4PC0 A;  2GNQ A;  4BH6 A;  4JSV C;  4J87 A;  3NVQ A;  3UVK A;  3SXT D;  5EAL A;  2B4E A;  3JZN A;  2OK6 A;  4XEI C;  1FWX A;  3IIW A;  4PXW A;  4GGC A;  2YBA A;  3PXT D;  5EMJ B;  2HXC A;  4L3H D;  5HE2 B;  4QL1 A;  3AL8 B;  3DXM C;  3AL8 A;  3OW8 A;  3SWS D;  5GXH A;  3I89 A;  2OVR B;  5FXY A;  4O3T B;  3EI2 A;  2P9P C;  3SCY A;  1PBY B;  4CZV A;  3RSE C;  2AGY A;  3PVU B;  3F3P A;  1NR0 A;  4O45 A;  2AGZ A;  2B5N A;  3FGB A;  4QQE A;  4CI8 A;  3A0F A;  3SHF A;  4AEZ A;  4H5J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...