5K19A

Crystal structure of wd repeat-containing protein 20
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
553
structure length
376
Chain Sequence
NEIKTQFTTREGLYKLLPHSEYSRPNRVPFNSSNPVRVSFVNLNSGNGDRLCFNVGRELYFYIYKGVRKAADLSKPIDKRIYKGTQPTCHDFNHLTATAESVSLLVGFSAGQVQLIDPIKKETSKLFNEERLIDKSRVTCVKWVPGSESLFLVAHSSGNMYLYNVEHTCGTTAPHYQLLKQGESFAVHTCKTRNPLLKWTVGEGALNEFAFSPDGKFLACVSQDGFLRVFNFDSVELHGTMKSYFGGLLCVCWSPDGKYIVTGGEDDLVTVWSFVDCRVIARGHGHKSWVSVVAFDPYTTSVEEGDVTYRFGSVGQDTQLCLWDLTEDILFPVPLLEPLICKKIAHERLTVLIFLEDCIVTACQEGFICTWGRPGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 20
publication title Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Unknown function
total genus 86
structure length 376
sequence length 553
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5k19A00
4QT8A 3SCYA 4A09A 3I7HA 1JMXB 4ESGA 3F3FA 1OLZA 4GZ8A 3MZLA 4JT5C 4A7JA 1FWXA 3ULEC 3UKUC 5FA5B 3IJCA 4HDJA 4L9OA 3CIKB 4IMMA 1N6DA 4CC9A 4U7AA 2Z2OA 5IGOA 2AGWA 4GM9A 3EI3B 2XL2A 2P9LC 3ODTA 4TZ4A 5IJ7E 2PM9B 1B9YA 3NVQA 4LG8A 4CI2A 4MK0B 3K27A 1YFQA 3EI2A 5CYKA 4Y7RA 3PSLA 3OW8A 3C99A 2IWFA 4FHLA 4FA4D 4PSWB 3SVWD 4JSVC 4AOWA 3JZNA 4ZN4A 4R7AB 3KRXB 1TBGA 5AMSA 3FGBA 4H5JA 3SBQA 3MMYA 4GGCA 2PM6B 2CNXA 3MKQA 4QL1A 5C9ZB 3RN0D 4CY1A 3FRXA 2I0RA 2IUVA 4FB1D 2B5NA 3SHFA 4ZOVA 3SBRA 3EMHA 2P9SC 2AGLA 5H1MA 4J84A 3BWSA 2H6NA 4L3HD 3RFHA 2B4EA 2HYEA 5B4WA 1PI6A 5GMKn 4ZOZA 3UVMA 4G56B 4E5ZA 3I2NA 2OK4A 2IURA 4JSPC 5I5MA 1RI6A 1XHMA 3L4OD 2PBIB 3SXTD 4PBYA 4X63B 2CN3A 4ERYA 2P9UC 5CXCA 5I5IA 1XIPA 5IT9g 5TEEA 4BH6A 3EWEA 3EI4A 2OJYA 5HQGA 2H13A 4O1QD 5HE1B 5EMMB 2HKMA 5EARA 4LG9A 4CZXA 4D0KA 3DSMA 1U2VC 2MTAH 2OVPB 1GP2B 2YNNA 2XYIA 3I7PA 3IJ1A 3GREA 3PXTD 4BL0A 3J81g 3N0EA 4ZOXA 4GM3A 5FKSA 1S4UX 4CI1A 5IGQA 4BUJC 3DXMC 3EI2B 5C2WB 5CYKB 2GNQA 1NEXB 4J86A 2H3XA 1K8KC 2HESX 2OVQB 4OZUA 4GQ2P 5CXBA 5SXMA 4A0BB 2H6KA 4FAND 3C75H 2CO0C 3OKYA 2AGYA 4OWRA 4CZVA 1U4CA 2XU7A 2OK6A 3SWSD 4J0XA 4NSXA 4XYHA 4CZYA 2J55H 3DWLC 3PXWD 3EI1A 2YB8B 4A2LA 3PVWB 4K3JB 3OKTA 4GQ1A 3BG0A 3VA6A 2AH1A 3IIWA 3UR4A 2BBKH 4A11A 4O45A 5H17A 1A0RB 4E5ZB 5H14A 3EI3A 4U1EI 1JJUB 1SHYB 1Q47A 5I5JA 4GMBA 4AEZA 3MKSB 4J73A 4X60B 3UVOA 5IJ8E 3JB9L 5EAPA 4GGDA 4N14A 4Y5RD 5GXHA 4D6VA 2H68A 2J56H 4QQEA 5CXCB 3PE7A 4J8BA 4E54A 3SFZA 2EBSA 2H47A 4FA1D 4Z8LA 3I7NA 4ERQA 1OMWB 2UZYB 4KFMB 1B9XA 5C2VB 3EI4B 4PNKB 4PBZA 3AL8A 3CFVA 2OIZA 3W15A 5THAA 3UVKA 4QRJA 5AFU3 2QXVA 3JZHA 5TF2A 5JWZA 3OL2B 2OVRB 4J77A 3PSCB 3C5MA 4I79A 4JSXC 4JD2C 2AGZA 3I7LA 5EAMA 3BG1A 4A0AA 5HYNB 5FKTA 4A09B 3MXXA 5TDHB 2H9PA 1GOTB 3JPXA 4J82A 2YNPA 5EALA 3JZGA 3K26A 3OTTA 2YNOA 4PC0A 4FAVD 3V7DB 3SMRA 3P4FA 3VH0A 2W18A 4O3TB 3J80g 2I3SA 2P9IC 2H6QA 5GXIA 3AL9A 1PBYB 1MDAH 3AFCA 1N6FA 3FM0A 2O9KA 4XYIA 3NVXA 2YMUA 2B5MA 4A08A 2AGXA 2IWKA 3SJLD 5CXBB 3CFSB 4J0WA 3IJ0A 1MG3A 3OKYB 2PM7B 3ZWLB 2H9NA 3JAMg 3I89A 2G99A 3IIYA 5EM2A 3EI1B 2Z2NA 3EG6A 1SQ9A 2I0SA 2Q7QA 2CN2A 2H9LA 2IUPA 1ERJA 3RFGA 4LGNA 3F3PA 3I8EA 4FA9D 3RRMC 4A11B 3EU7A 4CI8A 3A0FA 4X61B 2HXCA 1QNIA 4PSXB 4L1QD 2B5LA 3OKWA 3GFCA 2H14A 3V5WB 2I0TA 3UVLA 1TYQC 2HJ4A 2XL3A 4J81A 2G9AA 4J79A 4EWRA 2IUQA 4O3UB 4CY2A 2AQ5A 2CE8A 4E54B 4J78A 3B7FA 1XKSA 5IC7A 1SQJA 2IAAA 2GC4A 2CE9A 2PM9A 3PVUB 4FWWA 3V9FA 4GM8A 2TRCB 4ERZA 5FXYA 3RSEC 4A0BA 5GSAA 1JMZB 4CI3A 3AL8B 2GC7A 3U4YA 1PEVA 4CY5A 3MZKA 2P9NC 4X3EA 4K3ID 1R5MA 4JSNC 3C9CA 4JT6C 4JXMA 4ZOYA 2J57G 1P22A 4J8GA 4UI9R 4YVDA 4A0AB 2I3TA 5HE0B 3I8CA 3SLED 3UVNA 2P9PC 1VYHC 5EMJB 2Z2PA 1K32A 4FA5D 1GG2B 5FQDA 3NVNA 4PXWA 1L0QA 4GQBB 3SN6B 3F3GA 2P9KC 1MG2A 3IKOA 5FKRA 5FLXg 1NR0A 1GXRA 3JRPA 1JOFA 4O9DA 3I7OA 3I7KA 3L4MD 5A2Qg 5KDOB 2BCJB 2HJBA 2AH0A 3RMZD 4A08B 3VGZA 3N0DA 3AH8B 5K19A 5AJAA 4H5IA 3RN1D 4GGAA 4L3GD 3E0CA 5HE2B 2H9MA 3DM0A 4A2MA 4XEIC 3ORVD 4ES0A 5HE3B 2HKRA 2UZXB 3JROA 4J87A 1PGUA 3HFQA 5TEFA 3RLMD 3UKRC 3SBPA 1N6EA 2YBAA 3OL2A 5EMKB 3KRWB 5FKQA 2QC5A 3DXKC 5EM2B 5EMLB 3PXSD 5K1CC 4CY3A 2CO0A 4IA9A
chains in the Genus database with same CATH superfamily
4QT8A 3SCYA 4AN1A 4A09A 3I7HA 1JMXB 4ESGA 3F3FA 1OLZA 4GZ8A 3MZLA 5HDBA 3EQ7A 4JT5C 4A7JA 4WK4A 2EIEA 4BCBA 1FWXA 3ULEC 3UKUC 5FA5B 2VDRA 3IJCA 4HDJA 4L9OA 3CIKB 4IMMA 1N6DA 2XZGA 4CC9A 4AX4A 4U7AA 4Z7OA 2Z2OA 4RE5A 4WK2A 5IGOA 2AGWA 4GM9A 3EI3B 2XL2A 2P9LC 2VDQA 3ODTA 4MMZA 4TZ4A 5IJ7E 2PM9B 3VI4A 3K6SA 1B9YA 3NVQA 4LG8A 4BP9A 4IRZA 4CI2A 4MK0B 3K27A 4L1MA 4NENA 1YFQA 3EI2A 5CYKA 4D9SA 4Y7RA 3PSLA 3OW8A 3C99A 2IWFA 4FHLA 4FA4D 4PSWB 3SVWD 3GC3B 4JSVC 4AOWA 3IULA 1K3IA 3JZNA 4O02A 4ZN4A 2BKLA 3KRXB 1TBGA 4R7AB 5AMSA 3FGBA 4H5JA 3SBQA 1H2XA 3V4PA 3MMYA 4GGCA 2PM6B 4UM9A 2CNXA 3MKQA 4QL1A 5C9ZB 3IVMA 2VC2A 3RN0D 4CY1A 3EQ8A 3FRXA 2I0RA 1GOGA 2IUVA 4FB1D 2B5NA 3SHFA 4ZOVA 3SBRA 3EMHA 2P9SC 2AGLA 5H1MA 4J84A 3BWSA 2H6NA 1VZ3A 4L3HD 4MMXA 2B4EA 3RFHA 2HYEA 5B4WA 3VI3A 1PI6A 5GMKn 4ZOZA 3UVMA 4G56B 4E5ZA 3K72A 3I2NA 2OK4A 2IURA 4JSPC 5I5MA 1RI6A 1XHMA 3L4OD 2PBIB 3ZDYA 3SXTD 4PBYA 2VZ3A 3IURA 4X63B 2CN3A 3KCIA 4ERYA 2P9UC 3FCUA 3T3PA 2EIBA 5CXCA 5I5IA 1XIPA 5IT9g 1E8NA 1E8MA 5TEEA 1GOFA 4DNUA 4BH6A 2HU7A 3EWEA 3EI4A 2OJYA 5HQGA 2H13A 4O1QD 5HE1B 5EMMB 5FFOA 2HKMA 5EARA 1L5GA 1O6GA 4LG9A 4CZXA 4D0KA 4DNWA 3DSMA 1U2VC 2MTAH 2OVPB 1GP2B 1QFMA 5FFGA 2YNNA 2VDMA 2XYIA 3I7PA 3IJ1A 3GREA 3PXTD 3ZE0A 4BL0A 3J81g 1C9IA 5M61A 3N0EA 4AMZA 4ZOXA 4GM3A 5FKSA 1QFSA 3V4VA 1S4UX 4CI1A 3K71A 5IGQA 3GD1I 3IUQA 1JTDB 4BUJC 3DXMC 2VDNA 3EI2B 5C2WB 5M5VA 5CYKB 2GNQA 1NEXB 4J86A 1T2XA 2H3XA 1K8KC 3NIDA 2HESX 2OVQB 4OZUA 4GQ2P 5CXBA 5SXMA 1I2MB 4A0BB 2H6KA 4FAND 5M5TA 3C75H 1H2YA 2CO0C 2AGYA 3OKYA 4OWRA 1VE7A 4CZVA 1U4CA 2XU7A 2OK6A 3SWSD 4J0XA 4NSXA 4XYHA 1H2ZA 4CZYA 1M1XA 5E6SA 2J55H 3DWLC 3PXWD 3EI1A 2YB8B 4A2LA 3PVWB 2QR5A 4K3JB 3OKTA 1O6FA 1H2WA 4GQ1A 4JHNA 3BG0A 3IJEA 3NIFA 3VA6A 2AH1A 3IIWA 3UR4A 2BBKH 4A11A 4O45A 5H17A 1A0RB 4E5ZB 3NIGA 3EQ9A 5H14A 3EI3A 4BP8A 4U1EI 1JJUB 4WK0A 1SHYB 1Q47A 5I5JA 4GMBA 4AEZA 3MKSB 4J73A 4X60B 3UVOA 5IJ8E 3JB9L 5EAPA 1GOHA 1UOOA 4GGDA 4N14A 4Y5RD 5GXHA 4D6VA 2H68A 4UM8A 2J56H 4QQEA 1BPOA 5CXCB 3PE7A 2XDWA 4J8BA 4E54A 3SFZA 2EBSA 5C92A 2H47A 3DDUA 4FA1D 4Z8LA 3I7NA 4ERQA 2JKXA 1OMWB 2UZYB 4KFMB 1B9XA 4Z7NA 5C2VB 4WJKA 3EI4B 4PNKB 4PBZA 3AL8A 3CFVA 2OIZA 3W15A 5THAA 3UVKA 4QRJA 5AFU3 2QXVA 3JZHA 5TF2A 5JWZA 3OL2B 2OVRB 4Z7QA 4J77A 3PSCB 3C5MA 4I79A 4JSXC 3ZDZA 4MMYA 3QI0A 4JD2C 2AGZA 3I7LA 5EAMA 3BG1A 4A0AA 4DNVA 5HYNB 5FKTA 4A09B 3MXXA 5TDHB 2H9PA 1GOTB 3JPXA 4J82A 2YNPA 5EALA 3JZGA 3K26A 3OTTA 2YNOA 4PC0A 3MUOA 4FAVD 1VE6A 3V7DB 5M5SA 3SMRA 4G1EA 3P4FA 3VH0A 1UTCA 2W18A 4O3TB 3IUNA 3J80g 2I3SA 2P9IC 2H6QA 5GXIA 3AL9A 1PBYB 1MDAH 3AFCA 1N6FA 3FM0A 2O9KA 4NC4A 4JHPC 4XYIA 3NVXA 2YMUA 2HU8A 2B5MA 4A08A 2AGXA 2IWKA 3SJLD 5CXBB 3CFSB 4J0WA 3IJ0A 3MVDK 1UOQA 1MG3A 3OKYB 1TYEA 2PM7B 3ZE1A 3QHYB 3ZWLB 2H9NA 3JAMg 3OF7A 2EICA 3I89A 2G99A 3IIYA 5EM2A 3EI1B 2HU5A 2Z2NA 3EG6A 1SQ9A 2I0SA 2Q7QA 2CN2A 2H9LA 2VDKA 2IUPA 4BCDA 1ERJA 3RFGA 1C9LA 4LGNA 3F3PA 3I8EA 4BCCA 4FA9D 4G1MA 3RRMC 4A11B 3EU7A 4CI8A 3A0FA 4X61B 2HXCA 1QNIA 1JV2A 4PSXB 4L1QD 2B5LA 3OKWA 3GFCA 2H14A 3V5WB 2I0TA 1U8CA 1TYQC 3UVLA 2HJ4A 2XL3A 1UOPA 4J81A 2XE4A 2G9AA 4J79A 4EWRA 2IUQA 5M5RA 4O3UB 4CY2A 2AQ5A 3O4IA 2CE8A 4E54B 5E6RA 2VDOA 4J78A 3B7FA 1XKSA 2QZPA 5IC7A 1SQJA 2IAAA 2GC4A 4NAAA 2CE9A 2PM9A 3PVUB 4FWWA 3V9FA 4GM8A 2TRCB 4ERZA 5FXYA 3RSEC 4A0BA 5GSAA 1YR2A 1JMZB 4CI3A 3AL8B 2GC7A 5C86A 3U4YA 2VDPA 2VDLA 1PEVA 4AN0A 4CY5A 5M5UA 3MZKA 4QAMA 3O4JA 2P9NC 4X3EA 4K3ID 1R5MA 4JSNC 3C9CA 4JT6C 3IUMA 4JXMA 4ZOYA 3ZDXA 2J57G 1P22A 4J8GA 4UI9R 4YVDA 4A0AB 2VZ1A 2I3TA 5HE0B 3I8CA 3SLED 3UVNA 2P9PC 1VYHC 5EMJB 2Z2PA 1K32A 4FA5D 1GG2B 5FQDA 3NVNA 3FCSA 4PXWA 1L0QA 4GQBB 2EIDA 3SN6B 4NBMA 3F3GA 2WQ8A 1VZ2A 2P9KC 1MG2A 3T3MA 3IKOA 5FKRA 5FLXg 4G55A 4AMYA 1NR0A 1GXRA 3MUNA 3O4GA 3JRPA 1JOFA 4O9DA 3I7OA 3I7KA 3L4MD 5A2Qg 5KDOB 3O4HA 2BCJB 2HJBA 2AH0A 3RMZD 4A08B 3VGZA 3N0DA 3AH8B 1A12A 5K19A 5AJAA 4H5IA 3RN1D 4GGAA 1E5TA 5E6UA 4L3GD 3IUJA 3E0CA 5HE2B 2H9MA 3DM0A 4RE6A 4A2MA 4XEIC 3ORVD 4ES0A 5HE3B 2HKRA 2UZXB 3JROA 4J87A 1PGUA 3HFQA 5TEFA 3RLMD 3UKRC 3SBPA 1N6EA 2YBAA 3OL2A 5EMKB 3KRWB 3ZE2A 5FKQA 2QC5A 3DXKC 4O2WA 5EM2B 5EMLB 3PXSD 5K1CC 4CY3A 2CO0A 4IA9A
chains in the Genus database with same CATH topology
4QT8A 3SCYA 4A09A 3I7HA 1JMXB 4ESGA 3F3FA 1OLZA 4GZ8A 3MZLA 4JT5C 4A7JA 1FWXA 3ULEC 3UKUC 5FA5B 3IJCA 4HDJA 4L9OA 3CIKB 4IMMA 1N6DA 4CC9A 4U7AA 2Z2OA 5IGOA 2AGWA 4GM9A 3EI3B 2XL2A 2P9LC 3ODTA 4TZ4A 5IJ7E 2PM9B 1B9YA 3NVQA 4LG8A 4CI2A 4MK0B 3K27A 1YFQA 3EI2A 5CYKA 4Y7RA 3PSLA 3OW8A 3C99A 2IWFA 4FHLA 4FA4D 4PSWB 3SVWD 4JSVC 4AOWA 3JZNA 4ZN4A 4R7AB 3KRXB 1TBGA 5AMSA 3FGBA 4H5JA 3SBQA 3MMYA 4GGCA 2PM6B 2CNXA 3MKQA 4QL1A 5C9ZB 3RN0D 4CY1A 3FRXA 2I0RA 2IUVA 4FB1D 2B5NA 3SHFA 4ZOVA 3SBRA 3EMHA 2P9SC 2AGLA 5H1MA 4J84A 3BWSA 2H6NA 4L3HD 3RFHA 2B4EA 2HYEA 5B4WA 1PI6A 5GMKn 4ZOZA 3UVMA 4G56B 4E5ZA 3I2NA 2OK4A 2IURA 4JSPC 5I5MA 1RI6A 1XHMA 3L4OD 2PBIB 3SXTD 4PBYA 4X63B 2CN3A 4ERYA 2P9UC 5CXCA 5I5IA 1XIPA 5IT9g 5TEEA 4BH6A 3EWEA 3EI4A 2OJYA 5HQGA 2H13A 4O1QD 5HE1B 5EMMB 2HKMA 5EARA 4LG9A 4CZXA 4D0KA 3DSMA 1U2VC 2MTAH 2OVPB 1GP2B 2YNNA 2XYIA 3I7PA 3IJ1A 3GREA 3PXTD 4BL0A 3J81g 3N0EA 4ZOXA 4GM3A 5FKSA 1S4UX 4CI1A 5IGQA 4BUJC 3DXMC 3EI2B 5C2WB 5CYKB 2GNQA 1NEXB 4J86A 2H3XA 1K8KC 2HESX 2OVQB 4OZUA 4GQ2P 5CXBA 5SXMA 4A0BB 2H6KA 4FAND 3C75H 2CO0C 3OKYA 2AGYA 4OWRA 4CZVA 1U4CA 2XU7A 2OK6A 3SWSD 4J0XA 4NSXA 4XYHA 4CZYA 2J55H 3DWLC 3PXWD 3EI1A 2YB8B 4A2LA 3PVWB 4K3JB 3OKTA 4GQ1A 3BG0A 3VA6A 2AH1A 3IIWA 3UR4A 2BBKH 4A11A 4O45A 5H17A 1A0RB 4E5ZB 5H14A 3EI3A 4U1EI 1JJUB 1SHYB 1Q47A 5I5JA 4GMBA 4AEZA 3MKSB 4J73A 4X60B 3UVOA 5IJ8E 3JB9L 5EAPA 4GGDA 4N14A 4Y5RD 5GXHA 4D6VA 2H68A 2J56H 4QQEA 5CXCB 3PE7A 4J8BA 4E54A 3SFZA 2EBSA 2H47A 4FA1D 4Z8LA 3I7NA 4ERQA 1OMWB 2UZYB 4KFMB 1B9XA 5C2VB 3EI4B 4PNKB 4PBZA 3AL8A 3CFVA 2OIZA 3W15A 5THAA 3UVKA 4QRJA 5AFU3 2QXVA 3JZHA 5TF2A 5JWZA 3OL2B 2OVRB 4J77A 3PSCB 3C5MA 4I79A 4JSXC 4JD2C 2AGZA 3I7LA 5EAMA 3BG1A 4A0AA 5HYNB 5FKTA 4A09B 3MXXA 5TDHB 2H9PA 1GOTB 3JPXA 4J82A 2YNPA 5EALA 3JZGA 3K26A 3OTTA 2YNOA 4PC0A 4FAVD 3V7DB 3SMRA 3P4FA 3VH0A 2W18A 4O3TB 3J80g 2I3SA 2P9IC 2H6QA 5GXIA 3AL9A 1PBYB 1MDAH 3AFCA 1N6FA 3FM0A 2O9KA 4XYIA 3NVXA 2YMUA 2B5MA 4A08A 2AGXA 2IWKA 3SJLD 5CXBB 3CFSB 4J0WA 3IJ0A 1MG3A 3OKYB 2PM7B 3ZWLB 2H9NA 3JAMg 3I89A 2G99A 3IIYA 5EM2A 3EI1B 2Z2NA 3EG6A 1SQ9A 2I0SA 2Q7QA 2CN2A 2H9LA 2IUPA 1ERJA 3RFGA 4LGNA 3F3PA 3I8EA 4FA9D 3RRMC 4A11B 3EU7A 4CI8A 3A0FA 4X61B 2HXCA 1QNIA 4PSXB 4L1QD 2B5LA 3OKWA 3GFCA 2H14A 3V5WB 2I0TA 3UVLA 1TYQC 2HJ4A 2XL3A 4J81A 2G9AA 4J79A 4EWRA 2IUQA 4O3UB 4CY2A 2AQ5A 2CE8A 4E54B 4J78A 3B7FA 1XKSA 5IC7A 1SQJA 2IAAA 2GC4A 2CE9A 2PM9A 3PVUB 4FWWA 3V9FA 4GM8A 2TRCB 4ERZA 5FXYA 3RSEC 4A0BA 5GSAA 1JMZB 4CI3A 3AL8B 2GC7A 3U4YA 1PEVA 4CY5A 3MZKA 2P9NC 4X3EA 4K3ID 1R5MA 4JSNC 3C9CA 4JT6C 4JXMA 4ZOYA 2J57G 1P22A 4J8GA 4UI9R 4YVDA 4A0AB 2I3TA 5HE0B 3I8CA 3SLED 3UVNA 2P9PC 1VYHC 5EMJB 2Z2PA 1K32A 4FA5D 1GG2B 5FQDA 3NVNA 4PXWA 1L0QA 4GQBB 3SN6B 3F3GA 2P9KC 1MG2A 3IKOA 5FKRA 5FLXg 1NR0A 1GXRA 3JRPA 1JOFA 4O9DA 3I7OA 3I7KA 3L4MD 5A2Qg 5KDOB 2BCJB 2HJBA 2AH0A 3RMZD 4A08B 3VGZA 3N0DA 3AH8B 5K19A 5AJAA 4H5IA 3RN1D 4GGAA 4L3GD 3E0CA 5HE2B 2H9MA 3DM0A 4A2MA 4XEIC 3ORVD 4ES0A 5HE3B 2HKRA 2UZXB 3JROA 4J87A 1PGUA 3HFQA 5TEFA 3RLMD 3UKRC 3SBPA 1N6EA 2YBAA 3OL2A 5EMKB 3KRWB 5FKQA 2QC5A 3DXKC 5EM2B 5EMLB 3PXSD 5K1CC 4CY3A 2CO0A 4IA9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QT8 A;  3SCY A;  4A09 A;  3I7H A;  1JMX B;  4ESG A;  3F3F A;  1OLZ A;  4GZ8 A;  3MZL A;  4JT5 C;  4A7J A;  1FWX A;  3ULE C;  3UKU C;  5FA5 B;  3IJC A;  4HDJ A;  4L9O A;  3CIK B;  4IMM A;  1N6D A;  4CC9 A;  4U7A A;  2Z2O A;  5IGO A;  2AGW A;  4GM9 A;  3EI3 B;  2XL2 A;  2P9L C;  3ODT A;  4TZ4 A;  5IJ7 E;  2PM9 B;  1B9Y A;  3NVQ A;  4LG8 A;  4CI2 A;  4MK0 B;  3K27 A;  1YFQ A;  3EI2 A;  5CYK A;  4Y7R A;  3PSL A;  3OW8 A;  3C99 A;  2IWF A;  4FHL A;  4FA4 D;  4PSW B;  3SVW D;  4JSV C;  4AOW A;  3JZN A;  4ZN4 A;  4R7A B;  3KRX B;  1TBG A;  5AMS A;  3FGB A;  4H5J A;  3SBQ A;  3MMY A;  4GGC A;  2PM6 B;  2CNX A;  3MKQ A;  4QL1 A;  5C9Z B;  3RN0 D;  4CY1 A;  3FRX A;  2I0R A;  2IUV A;  4FB1 D;  2B5N A;  3SHF A;  4ZOV A;  3SBR A;  3EMH A;  2P9S C;  2AGL A;  5H1M A;  4J84 A;  3BWS A;  2H6N A;  4L3H D;  3RFH A;  2B4E A;  2HYE A;  5B4W A;  1PI6 A;  5GMK n;  4ZOZ A;  3UVM A;  4G56 B;  4E5Z A;  3I2N A;  2OK4 A;  2IUR A;  4JSP C;  5I5M A;  1RI6 A;  1XHM A;  3L4O D;  2PBI B;  3SXT D;  4PBY A;  4X63 B;  2CN3 A;  4ERY A;  2P9U C;  5CXC A;  5I5I A;  1XIP A;  5IT9 g;  5TEE A;  4BH6 A;  3EWE A;  3EI4 A;  2OJY A;  5HQG A;  2H13 A;  4O1Q D;  5HE1 B;  5EMM B;  2HKM A;  5EAR A;  4LG9 A;  4CZX A;  4D0K A;  3DSM A;  1U2V C;  2MTA H;  2OVP B;  1GP2 B;  2YNN A;  2XYI A;  3I7P A;  3IJ1 A;  3GRE A;  3PXT D;  4BL0 A;  3J81 g;  3N0E A;  4ZOX A;  4GM3 A;  5FKS A;  1S4U X;  4CI1 A;  5IGQ A;  4BUJ C;  3DXM C;  3EI2 B;  5C2W B;  5CYK B;  2GNQ A;  1NEX B;  4J86 A;  2H3X A;  1K8K C;  2HES X;  2OVQ B;  4OZU A;  4GQ2 P;  5CXB A;  5SXM A;  4A0B B;  2H6K A;  4FAN D;  3C75 H;  2CO0 C;  3OKY A;  2AGY A;  4OWR A;  4CZV A;  1U4C A;  2XU7 A;  2OK6 A;  3SWS D;  4J0X A;  4NSX A;  4XYH A;  4CZY A;  2J55 H;  3DWL C;  3PXW D;  3EI1 A;  2YB8 B;  4A2L A;  3PVW B;  4K3J B;  3OKT A;  4GQ1 A;  3BG0 A;  3VA6 A;  2AH1 A;  3IIW A;  3UR4 A;  2BBK H;  4A11 A;  4O45 A;  5H17 A;  1A0R B;  4E5Z B;  5H14 A;  3EI3 A;  4U1E I;  1JJU B;  1SHY B;  1Q47 A;  5I5J A;  4GMB A;  4AEZ A;  3MKS B;  4J73 A;  4X60 B;  3UVO A;  5IJ8 E;  3JB9 L;  5EAP A;  4GGD A;  4N14 A;  4Y5R D;  5GXH A;  4D6V A;  2H68 A;  2J56 H;  4QQE A;  5CXC B;  3PE7 A;  4J8B A;  4E54 A;  3SFZ A;  2EBS A;  2H47 A;  4FA1 D;  4Z8L A;  3I7N A;  4ERQ A;  1OMW B;  2UZY B;  4KFM B;  1B9X A;  5C2V B;  3EI4 B;  4PNK B;  4PBZ A;  3AL8 A;  3CFV A;  2OIZ A;  3W15 A;  5THA A;  3UVK A;  4QRJ A;  5AFU 3;  2QXV A;  3JZH A;  5TF2 A;  5JWZ A;  3OL2 B;  2OVR B;  4J77 A;  3PSC B;  3C5M A;  4I79 A;  4JSX C;  4JD2 C;  2AGZ A;  3I7L A;  5EAM A;  3BG1 A;  4A0A A;  5HYN B;  5FKT A;  4A09 B;  3MXX A;  5TDH B;  2H9P A;  1GOT B;  3JPX A;  4J82 A;  2YNP A;  5EAL A;  3JZG A;  3K26 A;  3OTT A;  2YNO A;  4PC0 A;  4FAV D;  3V7D B;  3SMR A;  3P4F A;  3VH0 A;  2W18 A;  4O3T B;  3J80 g;  2I3S A;  2P9I C;  2H6Q A;  5GXI A;  3AL9 A;  1PBY B;  1MDA H;  3AFC A;  1N6F A;  3FM0 A;  2O9K A;  4XYI A;  3NVX A;  2YMU A;  2B5M A;  4A08 A;  2AGX A;  2IWK A;  3SJL D;  5CXB B;  3CFS B;  4J0W A;  3IJ0 A;  1MG3 A;  3OKY B;  2PM7 B;  3ZWL B;  2H9N A;  3JAM g;  3I89 A;  2G99 A;  3IIY A;  5EM2 A;  3EI1 B;  2Z2N A;  3EG6 A;  1SQ9 A;  2I0S A;  2Q7Q A;  2CN2 A;  2H9L A;  2IUP A;  1ERJ A;  3RFG A;  4LGN A;  3F3P A;  3I8E A;  4FA9 D;  3RRM C;  4A11 B;  3EU7 A;  4CI8 A;  3A0F A;  4X61 B;  2HXC A;  1QNI A;  4PSX B;  4L1Q D;  2B5L A;  3OKW A;  3GFC A;  2H14 A;  3V5W B;  2I0T A;  3UVL A;  1TYQ C;  2HJ4 A;  2XL3 A;  4J81 A;  2G9A A;  4J79 A;  4EWR A;  2IUQ A;  4O3U B;  4CY2 A;  2AQ5 A;  2CE8 A;  4E54 B;  4J78 A;  3B7F A;  1XKS A;  5IC7 A;  1SQJ A;  2IAA A;  2GC4 A;  2CE9 A;  2PM9 A;  3PVU B;  4FWW A;  3V9F A;  4GM8 A;  2TRC B;  4ERZ A;  5FXY A;  3RSE C;  4A0B A;  5GSA A;  1JMZ B;  4CI3 A;  3AL8 B;  2GC7 A;  3U4Y A;  1PEV A;  4CY5 A;  3MZK A;  2P9N C;  4X3E A;  4K3I D;  1R5M A;  4JSN C;  3C9C A;  4JT6 C;  4JXM A;  4ZOY A;  2J57 G;  1P22 A;  4J8G A;  4UI9 R;  4YVD A;  4A0A B;  2I3T A;  5HE0 B;  3I8C A;  3SLE D;  3UVN A;  2P9P C;  1VYH C;  5EMJ B;  2Z2P A;  1K32 A;  4FA5 D;  1GG2 B;  5FQD A;  3NVN A;  4PXW A;  1L0Q A;  4GQB B;  3SN6 B;  3F3G A;  2P9K C;  1MG2 A;  3IKO A;  5FKR A;  5FLX g;  1NR0 A;  1GXR A;  3JRP A;  1JOF A;  4O9D A;  3I7O A;  3I7K A;  3L4M D;  5A2Q g;  5KDO B;  2BCJ B;  2HJB A;  2AH0 A;  3RMZ D;  4A08 B;  3VGZ A;  3N0D A;  3AH8 B;  5K19 A;  5AJA A;  4H5I A;  3RN1 D;  4GGA A;  4L3G D;  3E0C A;  5HE2 B;  2H9M A;  3DM0 A;  4A2M A;  4XEI C;  3ORV D;  4ES0 A;  5HE3 B;  2HKR A;  2UZX B;  3JRO A;  4J87 A;  1PGU A;  3HFQ A;  5TEF A;  3RLM D;  3UKR C;  3SBP A;  1N6E A;  2YBA A;  3OL2 A;  5EMK B;  3KRW B;  5FKQ A;  2QC5 A;  3DXK C;  5EM2 B;  5EML B;  3PXS D;  5K1C C;  4CY3 A;  2CO0 A;  4IA9 A; 
#chains in the Genus database with same CATH topology
 4QT8 A;  3SCY A;  4AN1 A;  4A09 A;  3I7H A;  1JMX B;  4ESG A;  3F3F A;  1OLZ A;  4GZ8 A;  3MZL A;  5HDB A;  3EQ7 A;  4JT5 C;  4A7J A;  4WK4 A;  2EIE A;  4BCB A;  1FWX A;  3ULE C;  3UKU C;  5FA5 B;  2VDR A;  3IJC A;  4HDJ A;  4L9O A;  3CIK B;  4IMM A;  1N6D A;  2XZG A;  4CC9 A;  4AX4 A;  4U7A A;  4Z7O A;  2Z2O A;  4RE5 A;  4WK2 A;  5IGO A;  2AGW A;  4GM9 A;  3EI3 B;  2XL2 A;  2P9L C;  2VDQ A;  3ODT A;  4MMZ A;  4TZ4 A;  5IJ7 E;  2PM9 B;  3VI4 A;  3K6S A;  1B9Y A;  3NVQ A;  4LG8 A;  4BP9 A;  4IRZ A;  4CI2 A;  4MK0 B;  3K27 A;  4L1M A;  4NEN A;  1YFQ A;  3EI2 A;  5CYK A;  4D9S A;  4Y7R A;  3PSL A;  3OW8 A;  3C99 A;  2IWF A;  4FHL A;  4FA4 D;  4PSW B;  3SVW D;  3GC3 B;  4JSV C;  4AOW A;  3IUL A;  1K3I A;  3JZN A;  4O02 A;  4ZN4 A;  2BKL A;  3KRX B;  1TBG A;  4R7A B;  5AMS A;  3FGB A;  4H5J A;  3SBQ A;  1H2X A;  3V4P A;  3MMY A;  4GGC A;  2PM6 B;  4UM9 A;  2CNX A;  3MKQ A;  4QL1 A;  5C9Z B;  3IVM A;  2VC2 A;  3RN0 D;  4CY1 A;  3EQ8 A;  3FRX A;  2I0R A;  1GOG A;  2IUV A;  4FB1 D;  2B5N A;  3SHF A;  4ZOV A;  3SBR A;  3EMH A;  2P9S C;  2AGL A;  5H1M A;  4J84 A;  3BWS A;  2H6N A;  1VZ3 A;  4L3H D;  4MMX A;  2B4E A;  3RFH A;  2HYE A;  5B4W A;  3VI3 A;  1PI6 A;  5GMK n;  4ZOZ A;  3UVM A;  4G56 B;  4E5Z A;  3K72 A;  3I2N A;  2OK4 A;  2IUR A;  4JSP C;  5I5M A;  1RI6 A;  1XHM A;  3L4O D;  2PBI B;  3ZDY A;  3SXT D;  4PBY A;  2VZ3 A;  3IUR A;  4X63 B;  2CN3 A;  3KCI A;  4ERY A;  2P9U C;  3FCU A;  3T3P A;  2EIB A;  5CXC A;  5I5I A;  1XIP A;  5IT9 g;  1E8N A;  1E8M A;  5TEE A;  1GOF A;  4DNU A;  4BH6 A;  2HU7 A;  3EWE A;  3EI4 A;  2OJY A;  5HQG A;  2H13 A;  4O1Q D;  5HE1 B;  5EMM B;  5FFO A;  2HKM A;  5EAR A;  1L5G A;  1O6G A;  4LG9 A;  4CZX A;  4D0K A;  4DNW A;  3DSM A;  1U2V C;  2MTA H;  2OVP B;  1GP2 B;  1QFM A;  5FFG A;  2YNN A;  2VDM A;  2XYI A;  3I7P A;  3IJ1 A;  3GRE A;  3PXT D;  3ZE0 A;  4BL0 A;  3J81 g;  1C9I A;  5M61 A;  3N0E A;  4AMZ A;  4ZOX A;  4GM3 A;  5FKS A;  1QFS A;  3V4V A;  1S4U X;  4CI1 A;  3K71 A;  5IGQ A;  3GD1 I;  3IUQ A;  1JTD B;  4BUJ C;  3DXM C;  2VDN A;  3EI2 B;  5C2W B;  5M5V A;  5CYK B;  2GNQ A;  1NEX B;  4J86 A;  1T2X A;  2H3X A;  1K8K C;  3NID A;  2HES X;  2OVQ B;  4OZU A;  4GQ2 P;  5CXB A;  5SXM A;  1I2M B;  4A0B B;  2H6K A;  4FAN D;  5M5T A;  3C75 H;  1H2Y A;  2CO0 C;  2AGY A;  3OKY A;  4OWR A;  1VE7 A;  4CZV A;  1U4C A;  2XU7 A;  2OK6 A;  3SWS D;  4J0X A;  4NSX A;  4XYH A;  1H2Z A;  4CZY A;  1M1X A;  5E6S A;  2J55 H;  3DWL C;  3PXW D;  3EI1 A;  2YB8 B;  4A2L A;  3PVW B;  2QR5 A;  4K3J B;  3OKT A;  1O6F A;  1H2W A;  4GQ1 A;  4JHN A;  3BG0 A;  3IJE A;  3NIF A;  3VA6 A;  2AH1 A;  3IIW A;  3UR4 A;  2BBK H;  4A11 A;  4O45 A;  5H17 A;  1A0R B;  4E5Z B;  3NIG A;  3EQ9 A;  5H14 A;  3EI3 A;  4BP8 A;  4U1E I;  1JJU B;  4WK0 A;  1SHY B;  1Q47 A;  5I5J A;  4GMB A;  4AEZ A;  3MKS B;  4J73 A;  4X60 B;  3UVO A;  5IJ8 E;  3JB9 L;  5EAP A;  1GOH A;  1UOO A;  4GGD A;  4N14 A;  4Y5R D;  5GXH A;  4D6V A;  2H68 A;  4UM8 A;  2J56 H;  4QQE A;  1BPO A;  5CXC B;  3PE7 A;  2XDW A;  4J8B A;  4E54 A;  3SFZ A;  2EBS A;  5C92 A;  2H47 A;  3DDU A;  4FA1 D;  4Z8L A;  3I7N A;  4ERQ A;  2JKX A;  1OMW B;  2UZY B;  4KFM B;  1B9X A;  4Z7N A;  5C2V B;  4WJK A;  3EI4 B;  4PNK B;  4PBZ A;  3AL8 A;  3CFV A;  2OIZ A;  3W15 A;  5THA A;  3UVK A;  4QRJ A;  5AFU 3;  2QXV A;  3JZH A;  5TF2 A;  5JWZ A;  3OL2 B;  2OVR B;  4Z7Q A;  4J77 A;  3PSC B;  3C5M A;  4I79 A;  4JSX C;  3ZDZ A;  4MMY A;  3QI0 A;  4JD2 C;  2AGZ A;  3I7L A;  5EAM A;  3BG1 A;  4A0A A;  4DNV A;  5HYN B;  5FKT A;  4A09 B;  3MXX A;  5TDH B;  2H9P A;  1GOT B;  3JPX A;  4J82 A;  2YNP A;  5EAL A;  3JZG A;  3K26 A;  3OTT A;  2YNO A;  4PC0 A;  3MUO A;  4FAV D;  1VE6 A;  3V7D B;  5M5S A;  3SMR A;  4G1E A;  3P4F A;  3VH0 A;  1UTC A;  2W18 A;  4O3T B;  3IUN A;  3J80 g;  2I3S A;  2P9I C;  2H6Q A;  5GXI A;  3AL9 A;  1PBY B;  1MDA H;  3AFC A;  1N6F A;  3FM0 A;  2O9K A;  4NC4 A;  4JHP C;  4XYI A;  3NVX A;  2YMU A;  2HU8 A;  2B5M A;  4A08 A;  2AGX A;  2IWK A;  3SJL D;  5CXB B;  3CFS B;  4J0W A;  3IJ0 A;  3MVD K;  1UOQ A;  1MG3 A;  3OKY B;  1TYE A;  2PM7 B;  3ZE1 A;  3QHY B;  3ZWL B;  2H9N A;  3JAM g;  3OF7 A;  2EIC A;  3I89 A;  2G99 A;  3IIY A;  5EM2 A;  3EI1 B;  2HU5 A;  2Z2N A;  3EG6 A;  1SQ9 A;  2I0S A;  2Q7Q A;  2CN2 A;  2H9L A;  2VDK A;  2IUP A;  4BCD A;  1ERJ A;  3RFG A;  1C9L A;  4LGN A;  3F3P A;  3I8E A;  4BCC A;  4FA9 D;  4G1M A;  3RRM C;  4A11 B;  3EU7 A;  4CI8 A;  3A0F A;  4X61 B;  2HXC A;  1QNI A;  1JV2 A;  4PSX B;  4L1Q D;  2B5L A;  3OKW A;  3GFC A;  2H14 A;  3V5W B;  2I0T A;  1U8C A;  1TYQ C;  3UVL A;  2HJ4 A;  2XL3 A;  1UOP A;  4J81 A;  2XE4 A;  2G9A A;  4J79 A;  4EWR A;  2IUQ A;  5M5R A;  4O3U B;  4CY2 A;  2AQ5 A;  3O4I A;  2CE8 A;  4E54 B;  5E6R A;  2VDO A;  4J78 A;  3B7F A;  1XKS A;  2QZP A;  5IC7 A;  1SQJ A;  2IAA A;  2GC4 A;  4NAA A;  2CE9 A;  2PM9 A;  3PVU B;  4FWW A;  3V9F A;  4GM8 A;  2TRC B;  4ERZ A;  5FXY A;  3RSE C;  4A0B A;  5GSA A;  1YR2 A;  1JMZ B;  4CI3 A;  3AL8 B;  2GC7 A;  5C86 A;  3U4Y A;  2VDP A;  2VDL A;  1PEV A;  4AN0 A;  4CY5 A;  5M5U A;  3MZK A;  4QAM A;  3O4J A;  2P9N C;  4X3E A;  4K3I D;  1R5M A;  4JSN C;  3C9C A;  4JT6 C;  3IUM A;  4JXM A;  4ZOY A;  3ZDX A;  2J57 G;  1P22 A;  4J8G A;  4UI9 R;  4YVD A;  4A0A B;  2VZ1 A;  2I3T A;  5HE0 B;  3I8C A;  3SLE D;  3UVN A;  2P9P C;  1VYH C;  5EMJ B;  2Z2P A;  1K32 A;  4FA5 D;  1GG2 B;  5FQD A;  3NVN A;  3FCS A;  4PXW A;  1L0Q A;  4GQB B;  2EID A;  3SN6 B;  4NBM A;  3F3G A;  2WQ8 A;  1VZ2 A;  2P9K C;  1MG2 A;  3T3M A;  3IKO A;  5FKR A;  5FLX g;  4G55 A;  4AMY A;  1NR0 A;  1GXR A;  3MUN A;  3O4G A;  3JRP A;  1JOF A;  4O9D A;  3I7O A;  3I7K A;  3L4M D;  5A2Q g;  5KDO B;  3O4H A;  2BCJ B;  2HJB A;  2AH0 A;  3RMZ D;  4A08 B;  3VGZ A;  3N0D A;  3AH8 B;  1A12 A;  5K19 A;  5AJA A;  4H5I A;  3RN1 D;  4GGA A;  1E5T A;  5E6U A;  4L3G D;  3IUJ A;  3E0C A;  5HE2 B;  2H9M A;  3DM0 A;  4RE6 A;  4A2M A;  4XEI C;  3ORV D;  4ES0 A;  5HE3 B;  2HKR A;  2UZX B;  3JRO A;  4J87 A;  1PGU A;  3HFQ A;  5TEF A;  3RLM D;  3UKR C;  3SBP A;  1N6E A;  2YBA A;  3OL2 A;  5EMK B;  3KRW B;  3ZE2 A;  5FKQ A;  2QC5 A;  3DXK C;  4O2W A;  5EM2 B;  5EML B;  3PXS D;  5K1C C;  4CY3 A;  2CO0 A;  4IA9 A; 
#chains in the Genus database with same CATH homology
 4QT8 A;  3SCY A;  4A09 A;  3I7H A;  1JMX B;  4ESG A;  3F3F A;  1OLZ A;  4GZ8 A;  3MZL A;  4JT5 C;  4A7J A;  1FWX A;  3ULE C;  3UKU C;  5FA5 B;  3IJC A;  4HDJ A;  4L9O A;  3CIK B;  4IMM A;  1N6D A;  4CC9 A;  4U7A A;  2Z2O A;  5IGO A;  2AGW A;  4GM9 A;  3EI3 B;  2XL2 A;  2P9L C;  3ODT A;  4TZ4 A;  5IJ7 E;  2PM9 B;  1B9Y A;  3NVQ A;  4LG8 A;  4CI2 A;  4MK0 B;  3K27 A;  1YFQ A;  3EI2 A;  5CYK A;  4Y7R A;  3PSL A;  3OW8 A;  3C99 A;  2IWF A;  4FHL A;  4FA4 D;  4PSW B;  3SVW D;  4JSV C;  4AOW A;  3JZN A;  4ZN4 A;  4R7A B;  3KRX B;  1TBG A;  5AMS A;  3FGB A;  4H5J A;  3SBQ A;  3MMY A;  4GGC A;  2PM6 B;  2CNX A;  3MKQ A;  4QL1 A;  5C9Z B;  3RN0 D;  4CY1 A;  3FRX A;  2I0R A;  2IUV A;  4FB1 D;  2B5N A;  3SHF A;  4ZOV A;  3SBR A;  3EMH A;  2P9S C;  2AGL A;  5H1M A;  4J84 A;  3BWS A;  2H6N A;  4L3H D;  3RFH A;  2B4E A;  2HYE A;  5B4W A;  1PI6 A;  5GMK n;  4ZOZ A;  3UVM A;  4G56 B;  4E5Z A;  3I2N A;  2OK4 A;  2IUR A;  4JSP C;  5I5M A;  1RI6 A;  1XHM A;  3L4O D;  2PBI B;  3SXT D;  4PBY A;  4X63 B;  2CN3 A;  4ERY A;  2P9U C;  5CXC A;  5I5I A;  1XIP A;  5IT9 g;  5TEE A;  4BH6 A;  3EWE A;  3EI4 A;  2OJY A;  5HQG A;  2H13 A;  4O1Q D;  5HE1 B;  5EMM B;  2HKM A;  5EAR A;  4LG9 A;  4CZX A;  4D0K A;  3DSM A;  1U2V C;  2MTA H;  2OVP B;  1GP2 B;  2YNN A;  2XYI A;  3I7P A;  3IJ1 A;  3GRE A;  3PXT D;  4BL0 A;  3J81 g;  3N0E A;  4ZOX A;  4GM3 A;  5FKS A;  1S4U X;  4CI1 A;  5IGQ A;  4BUJ C;  3DXM C;  3EI2 B;  5C2W B;  5CYK B;  2GNQ A;  1NEX B;  4J86 A;  2H3X A;  1K8K C;  2HES X;  2OVQ B;  4OZU A;  4GQ2 P;  5CXB A;  5SXM A;  4A0B B;  2H6K A;  4FAN D;  3C75 H;  2CO0 C;  3OKY A;  2AGY A;  4OWR A;  4CZV A;  1U4C A;  2XU7 A;  2OK6 A;  3SWS D;  4J0X A;  4NSX A;  4XYH A;  4CZY A;  2J55 H;  3DWL C;  3PXW D;  3EI1 A;  2YB8 B;  4A2L A;  3PVW B;  4K3J B;  3OKT A;  4GQ1 A;  3BG0 A;  3VA6 A;  2AH1 A;  3IIW A;  3UR4 A;  2BBK H;  4A11 A;  4O45 A;  5H17 A;  1A0R B;  4E5Z B;  5H14 A;  3EI3 A;  4U1E I;  1JJU B;  1SHY B;  1Q47 A;  5I5J A;  4GMB A;  4AEZ A;  3MKS B;  4J73 A;  4X60 B;  3UVO A;  5IJ8 E;  3JB9 L;  5EAP A;  4GGD A;  4N14 A;  4Y5R D;  5GXH A;  4D6V A;  2H68 A;  2J56 H;  4QQE A;  5CXC B;  3PE7 A;  4J8B A;  4E54 A;  3SFZ A;  2EBS A;  2H47 A;  4FA1 D;  4Z8L A;  3I7N A;  4ERQ A;  1OMW B;  2UZY B;  4KFM B;  1B9X A;  5C2V B;  3EI4 B;  4PNK B;  4PBZ A;  3AL8 A;  3CFV A;  2OIZ A;  3W15 A;  5THA A;  3UVK A;  4QRJ A;  5AFU 3;  2QXV A;  3JZH A;  5TF2 A;  5JWZ A;  3OL2 B;  2OVR B;  4J77 A;  3PSC B;  3C5M A;  4I79 A;  4JSX C;  4JD2 C;  2AGZ A;  3I7L A;  5EAM A;  3BG1 A;  4A0A A;  5HYN B;  5FKT A;  4A09 B;  3MXX A;  5TDH B;  2H9P A;  1GOT B;  3JPX A;  4J82 A;  2YNP A;  5EAL A;  3JZG A;  3K26 A;  3OTT A;  2YNO A;  4PC0 A;  4FAV D;  3V7D B;  3SMR A;  3P4F A;  3VH0 A;  2W18 A;  4O3T B;  3J80 g;  2I3S A;  2P9I C;  2H6Q A;  5GXI A;  3AL9 A;  1PBY B;  1MDA H;  3AFC A;  1N6F A;  3FM0 A;  2O9K A;  4XYI A;  3NVX A;  2YMU A;  2B5M A;  4A08 A;  2AGX A;  2IWK A;  3SJL D;  5CXB B;  3CFS B;  4J0W A;  3IJ0 A;  1MG3 A;  3OKY B;  2PM7 B;  3ZWL B;  2H9N A;  3JAM g;  3I89 A;  2G99 A;  3IIY A;  5EM2 A;  3EI1 B;  2Z2N A;  3EG6 A;  1SQ9 A;  2I0S A;  2Q7Q A;  2CN2 A;  2H9L A;  2IUP A;  1ERJ A;  3RFG A;  4LGN A;  3F3P A;  3I8E A;  4FA9 D;  3RRM C;  4A11 B;  3EU7 A;  4CI8 A;  3A0F A;  4X61 B;  2HXC A;  1QNI A;  4PSX B;  4L1Q D;  2B5L A;  3OKW A;  3GFC A;  2H14 A;  3V5W B;  2I0T A;  3UVL A;  1TYQ C;  2HJ4 A;  2XL3 A;  4J81 A;  2G9A A;  4J79 A;  4EWR A;  2IUQ A;  4O3U B;  4CY2 A;  2AQ5 A;  2CE8 A;  4E54 B;  4J78 A;  3B7F A;  1XKS A;  5IC7 A;  1SQJ A;  2IAA A;  2GC4 A;  2CE9 A;  2PM9 A;  3PVU B;  4FWW A;  3V9F A;  4GM8 A;  2TRC B;  4ERZ A;  5FXY A;  3RSE C;  4A0B A;  5GSA A;  1JMZ B;  4CI3 A;  3AL8 B;  2GC7 A;  3U4Y A;  1PEV A;  4CY5 A;  3MZK A;  2P9N C;  4X3E A;  4K3I D;  1R5M A;  4JSN C;  3C9C A;  4JT6 C;  4JXM A;  4ZOY A;  2J57 G;  1P22 A;  4J8G A;  4UI9 R;  4YVD A;  4A0A B;  2I3T A;  5HE0 B;  3I8C A;  3SLE D;  3UVN A;  2P9P C;  1VYH C;  5EMJ B;  2Z2P A;  1K32 A;  4FA5 D;  1GG2 B;  5FQD A;  3NVN A;  4PXW A;  1L0Q A;  4GQB B;  3SN6 B;  3F3G A;  2P9K C;  1MG2 A;  3IKO A;  5FKR A;  5FLX g;  1NR0 A;  1GXR A;  3JRP A;  1JOF A;  4O9D A;  3I7O A;  3I7K A;  3L4M D;  5A2Q g;  5KDO B;  2BCJ B;  2HJB A;  2AH0 A;  3RMZ D;  4A08 B;  3VGZ A;  3N0D A;  3AH8 B;  5K19 A;  5AJA A;  4H5I A;  3RN1 D;  4GGA A;  4L3G D;  3E0C A;  5HE2 B;  2H9M A;  3DM0 A;  4A2M A;  4XEI C;  3ORV D;  4ES0 A;  5HE3 B;  2HKR A;  2UZX B;  3JRO A;  4J87 A;  1PGU A;  3HFQ A;  5TEF A;  3RLM D;  3UKR C;  3SBP A;  1N6E A;  2YBA A;  3OL2 A;  5EMK B;  3KRW B;  5FKQ A;  2QC5 A;  3DXK C;  5EM2 B;  5EML B;  3PXS D;  5K1C C;  4CY3 A;  2CO0 A;  4IA9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...