4BL0A

Crystal structure of yeast bub3-bub1 bound to phospho-spc105
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
340
structure length
331
Chain Sequence
MQIVQIEQAPKDYISDIKIIPSKSLLLITSWDGSLTVYKFDIQAKNVDLLQSLRYKHPLLCCNFIDNTDLQIYVGTVQGEILKVDLIGSPSFQALTNNEANLGICRICKYGDDKLIAASWDGLIEVIDPRNYGDGVIAVKNLNSNNTKVKNKIFTMDTNSSRLIVGMNNSQVQWFRLPLCEDDNGTIEESGLKYQIRDVALLPKEQEGYACSSIDGRVAVEFFSKRFAFRCHRLNLKDTNLAYPVNSIEFSPRHKFLYTAGSDGIISCWNLQTRKKIKNFAKFNEDSVVKIACSDNILCLATSDDTFKTNAAIDQTIELNASSIYIIFDYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL CYCLE ARREST PROTEIN BUB3
publication title Bub3 Reads Phosphorylated Melt Repeats to Promote Spindle Assembly Checkpoint Signaling
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
total genus 76
structure length 331
sequence length 340
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4bl0A00
1SHYB 2J57G 4OZUA 3MZKA 1U2VC 2UZYB 2H9PA 5EAPA 1VYHC 3JAMg 3OKTA 4CZXA 2IUPA 1R5MA 2QC5A 4FWWA 5CYKB 4R7AB 5FKSA 3AH8B 5GMKn 4K3ID 2J56H 3IJ1A 4O9DA 3SCYA 5IT9g 4U1EI 2H14A 2B5NA 3KRXB 2QXVA 2IURA 3UVMA 4L3GD 5HYNB 3GREA 3JZHA 1N6DA 4JSPC 4QRJA 5TF2A 2TRCB 4FHLA 3SHFA 3JZNA 3JZGA 4CZYA 3I7PA 3CIKB 3N0DA 3PXWD 3DSMA 1TYQC 2H9NA 1ERJA 5C9ZB 2AH0A 3J80g 4A08A 2PM9A 5GXIA 2I0RA 1N6FA 4A2MA 1JMZB 2PM9B 4A08B 2YNOA 4A09A 4A11B 4BUJC 3B7FA 2H6QA 4OWRA 3BWSA 3RFGA 4I79A 4LGNA 3K27A 4JT5C 3I8EA 4J8BA 5IGOA 3BG0A 3UR4A 4BL0A 3V9FA 3C99A 4J77A 3C75H 3I89A 3UVKA 4CI1A 2AGLA 4QQEA 3RLMD 3UKUC 1XKSA 3I7OA 3MMYA 2CN2A 1A0RB 3ZWLB 3IKOA 3GFCA 2Z2OA 3MZLA 3OL2A 4J84A 2BCJB 4A0BA 5IJ7E 3KRWB 2PM7B 4PNKB 5H17A 2G9AA 4J78A 4GM9A 3SJLD 4X61B 2Q7QA 3EU7A 4FA1D 4J8GA 3MKQA 2W18A 1JJUB 4G56B 5HQGA 4PXWA 2P9IC 1XHMA 2H6NA 2H9MA 2I3SA 4A0AA 3EI3A 5CXBB 2UZXB 3NVXA 3NVQA 4CI8A 4E5ZA 3EI3B 5EALA 2XYIA 4U7AA 3SBRA 4KFMB 2H3XA 2YNNA 3JB9L 3I2NA 4XYHA 3EI1B 5EMMB 4PC0A 5HE1B 2CE8A 3PVWB 2OK6A 4JSNC 4YVDA 4PSWB 5CYKA 4GQ2P 4L3HD 3FM0A 4X3EA 5AJAA 4EWRA 3V5WB 1PGUA 1FWXA 5EARA 3I8CA 4O45A 2CE9A 4GZ8A 4GGDA 2P9SC 5KDOB 3DWLC 5CXCB 3UKRC 3I7LA 2HJ4A 2HXCA 3PVUB 3SXTD 4LG8A 3HFQA 2H68A 3UVLA 4D0KA 2I3TA 1SQJA 3BG1A 5TEEA 3W15A 3EWEA 2XL3A 1JOFA 3L4MD 2IUVA 2XL2A 4A11A 2BBKH 2Z2PA 1B9XA 1NEXB 1OLZA 2CO0A 3L4OD 4ZOYA 4ERYA 3OKYA 4K3JB 4GM8A 4BH6A 4N14A 5FKRA 5THAA 2AQ5A 3I7KA 3OKYB 4ZOXA 3IJCA 2HKRA 1K32A 4Z8LA 5IGQA 3JPXA 3A0FA 2H13A 2GC4A 5FKTA 3SN6B 3SMRA 4QT8A 2CNXA 4CY5A 4CI2A 3RMZD 3PE7A 5GSAA 3F3PA 4XYIA 3SVWD 4JXMA 4Y5RD 2AGYA 3U4YA 1GXRA 4IMMA 5EMLB 5FA5B 2P9NC 3FRXA 3CFVA 5HE3B 3EI4A 4CZVA 5A2Qg 4E54A 4ZN4A 3IIWA 1OMWB 3N0EA 4ZOZA 4ES0A 3EI4B 3IJ0A 2IWKA 3MKSB 4A2LA 3OKWA 4E54B 5EM2A 2YNPA 3RSEC 4J81A 2OJYA 1XIPA 2PBIB 5FQDA 4CY3A 3FGBA 4CY2A 5EM2B 5CXBA 3F3FA 4GGCA 2P9PC 4FA9D 2P9KC 4D6VA 1MG3A 2HYEA 3AL9A 3OTTA 5H1MA 3EI1A 1P22A 3EG6A 2CO0C 4FB1D 3SBQA 4J73A 4X63B 5K1CC 2HJBA 2YMUA 4IA9A 4MK0B 2MTAH 5I5IA 3SLED 5C2WB 3ULEC 1RI6A 3JROA 3C5MA 5FXYA 3RN0D 1GG2B 2B5LA 4QL1A 4ZOVA 5C2VB 2H9LA 3PSCB 3PXTD 4TZ4A 3UVNA 5HE0B 5CXCA 4J0WA 3OW8A 1PBYB 3F3GA 4FAND 4J0XA 2OIZA 4PSXB 2AGWA 2OVPB 3DXKC 2OVQB 1TBGA 4GM3A 1MDAH 3SBPA 4LG9A 2P9UC 5GXHA 4NSXA 5TDHB 2XU7A 3C9CA 2AGXA 4GQ1A 2P9LC 4O3TB 4UI9R 4X60B 3RRMC 4ERQA 1PEVA 1PI6A 3DXMC 4HDJA 1YFQA 4JSXC 5FLXg 4J86A 5IC7A 4PBYA 4AEZA 2IUQA 4L9OA 2GC7A 4Y7RA 2H6KA 3ORVD 1N6EA 4O1QD 3CFSB 1B9YA 5AMSA 1GP2B 4L1QD 4CY1A 5I5JA 1S4UX 2B5MA 1GOTB 2AGZA 3RFHA 4CI3A 3PSLA 4A09B 2I0SA 4J79A 3I7NA 2OVRB 4PBZA 3IIYA 4FA5D 3P4FA 2CN3A 4JD2C 2YB8B 3NVNA 1JMXB 4O3UB 4JT6C 5EMKB 4FA4D 5JWZA 3VGZA 2IWFA 2YBAA 3VA6A 1QNIA 3I7HA 5HE2B 4XEIC 4CC9A 5EAMA 2HKMA 3UVOA 2OK4A 1L0QA 3RN1D 5I5MA 5EMJB 3EMHA 3J81g 2O9KA 3E0CA 4H5IA 4GMBA 3K26A 2HESX 2G99A 3AFCA 5SXMA 3AL8A 5H14A 1SQ9A 4A7JA 4J82A 1U4CA 3AL8B 4GQBB 3V7DB 3SWSD 3JRPA 3OL2B 1NR0A 4A0BB 2H47A 2GNQA 2EBSA 3PXSD 2B4EA 4ERZA 4ESGA 5AFU3 2I0TA 4H5JA 3MXXA 1MG2A 4J87A 4GGAA 3EI2A 1Q47A 5TEFA 3SFZA 2Z2NA 3VH0A 3EI2B 4JSVC 5FKQA 2AH1A 2PM6B 4A0AB 4AOWA 5K19A 2IAAA 2J55H 5B4WA 3ODTA 5IJ8E 4E5ZB 4FAVD 3DM0A 1K8KC
chains in the Genus database with same CATH superfamily
1SHYB 2J57G 4OZUA 3MZKA 1U2VC 2UZYB 2H9PA 1H2XA 5EAPA 1VYHC 4O02A 3IJEA 3JAMg 1VZ3A 3OKTA 4CZXA 1E5TA 3O4IA 2IUPA 1R5MA 2QC5A 4FWWA 3T3MA 4WK2A 5FFOA 5E6RA 5CYKB 4R7AB 2EIEA 5FKSA 3AH8B 3IUNA 5GMKn 4K3ID 2J56H 3IJ1A 4O9DA 3SCYA 5IT9g 4U1EI 2H14A 2B5NA 3KRXB 2QXVA 2IURA 3IULA 1C9IA 3UVMA 4L3GD 5HYNB 2WQ8A 3GREA 3JZHA 1N6DA 4JSPC 2EIBA 4QRJA 4DNVA 4AMYA 5TF2A 2TRCB 4FHLA 3SHFA 3JZNA 3JZGA 4O2WA 4CZYA 3I7PA 3ZE0A 3CIKB 3N0DA 3PXWD 2VDMA 3DSMA 1UOPA 1TYQC 2H9NA 4G1MA 1ERJA 4G1EA 3V4VA 2AH0A 5C9ZB 3J80g 4A08A 2PM9A 5GXIA 2VDPA 2I0RA 1N6FA 4A2MA 1JMZB 2PM9B 4A08B 2YNOA 4A09A 4A11B 4BUJC 2EIDA 3B7FA 1GOGA 2H6QA 4OWRA 3BWSA 3FCSA 3RFGA 4MMXA 4I79A 4LGNA 3K27A 4JT5C 3I8EA 4J8BA 2VDQA 5IGOA 5C86A 3BG0A 3UR4A 4BL0A 3V9FA 3C99A 4J77A 4AMZA 3C75H 1YR2A 1U8CA 3I89A 4JHPC 3UVKA 4CI1A 3VI3A 1QFSA 2AGLA 4QQEA 3RLMD 3UKUC 1XKSA 3I7OA 3FCUA 3MMYA 2CN2A 1A0RB 2VC2A 3ZWLB 3IKOA 4WK4A 3GFCA 2Z2OA 3MZLA 3OL2A 4J84A 2BCJB 2JKXA 5IJ7E 3KRWB 4A0BA 2PM7B 4PNKB 5H17A 2G9AA 3O4HA 1M1XA 4J78A 1TYEA 4GM9A 3SJLD 4X61B 3NIFA 2Q7QA 3EU7A 4WK0A 4FA1D 4J8GA 3MKQA 2W18A 1JJUB 4G56B 5HQGA 4PXWA 1I2MB 2P9IC 1XHMA 2H6NA 2H9MA 2I3SA 4BP9A 4A0AA 3EI3A 5CXBB 2UZXB 3NVXA 3NVQA 4CI8A 4E5ZA 3QI0A 3EI3B 5EALA 2XYIA 3K72A 4U7AA 5M61A 4MMYA 3SBRA 4KFMB 2H3XA 2YNNA 3JB9L 3I2NA 4XYHA 4Z7QA 3EI1B 5EMMB 4NAAA 4PC0A 4DNUA 1H2YA 5HE1B 2CE8A 3PVWB 2OK6A 4JSNC 4YVDA 4PSWB 5CYKA 4GQ2P 4L3HD 3FM0A 4X3EA 5AJAA 4EWRA 3V5WB 1PGUA 3O4GA 3MVDK 1FWXA 5EARA 3I8CA 4O45A 2CE9A 2BKLA 4GZ8A 4GGDA 2P9SC 5KDOB 2VDLA 3DWLC 5CXCB 3UKRC 3I7LA 2HJ4A 1C9LA 3O4JA 2HXCA 3PVUB 4RE5A 3SXTD 3QHYB 1UOQA 3K6SA 4LG8A 3HFQA 2H68A 3UVLA 4D0KA 2I3TA 1SQJA 3BG1A 1BPOA 5TEEA 3W15A 3EWEA 2XL3A 3T3PA 4JHNA 4BCDA 1JOFA 3L4MD 2IUVA 2XL2A 4A11A 2BBKH 2Z2PA 1B9XA 1NEXB 1OLZA 2CO0A 1K3IA 3L4OD 4ZOYA 2XDWA 4ERYA 3OKYA 2XZGA 4K3JB 1GOHA 4GM8A 4BH6A 4N14A 5FKRA 5M5SA 5THAA 2AQ5A 4G55A 3I7KA 3OKYB 4ZOXA 1O6FA 4NENA 1GOFA 3IJCA 3KCIA 2HKRA 1K32A 1O6GA 4Z8LA 1JTDB 1VZ2A 5IGQA 3JPXA 3A0FA 4DNWA 2H13A 2VDNA 1UTCA 2GC4A 5FKTA 3SN6B 3ZDZA 3SMRA 4D9SA 3EQ8A 4QT8A 2CNXA 1QFMA 4CY5A 4Z7OA 4IRZA 4CI2A 3RMZD 3PE7A 2VDKA 5GSAA 3F3PA 4XYIA 1VE7A 3SVWD 4JXMA 4Y5RD 2AGYA 3U4YA 1GXRA 4IMMA 5EMLB 5FA5B 2P9NC 3FRXA 3CFVA 5HE3B 3EI4A 4CZVA 5A2Qg 4E54A 3NIGA 4ZN4A 3IIWA 1OMWB 3N0EA 4ZOZA 4ES0A 3EI4B 3IJ0A 2IWKA 3MKSB 4A2LA 3OKWA 4E54B 3ZE1A 5EM2A 1L5GA 2YNPA 3RSEC 4J81A 2OJYA 1XIPA 2PBIB 5FQDA 4CY3A 3FGBA 4CY2A 5EM2B 5CXBA 3F3FA 4GGCA 1E8NA 2P9PC 3EQ9A 3ZDXA 4FA9D 4RE6A 5M5UA 2P9KC 3IURA 1E8MA 4D6VA 1MG3A 2HYEA 3AL9A 3OTTA 5H1MA 3EI1A 1P22A 1H2WA 3EG6A 2XE4A 2CO0C 5M5TA 4FB1D 3SBQA 3GD1I 3IUJA 4J73A 4AN1A 3IUQA 4X63B 5K1CC 2HJBA 2YMUA 4IA9A 4MK0B 2MTAH 5I5IA 3SLED 5C2WB 3ULEC 3JROA 1RI6A 3C5MA 5FXYA 2QZPA 3RN0D 1GG2B 2B5LA 3IUMA 4QL1A 4ZOVA 3VI4A 5C2VB 2H9LA 3PSCB 3PXTD 2HU8A 4TZ4A 3UVNA 5HE0B 5CXCA 4BCCA 4J0WA 3OW8A 1PBYB 3F3GA 4FAND 2VDRA 4J0XA 2OIZA 4PSXB 2AGWA 2OVPB 3DXKC 2OVQB 2VZ3A 1TBGA 4GM3A 1MDAH 4Z7NA 3SBPA 1JV2A 4LG9A 2P9UC 5GXHA 3K71A 4NSXA 5TDHB 2VDOA 2XU7A 3C9CA 2AGXA 3MUNA 4GQ1A 2P9LC 4MMZA 3ZDYA 4O3TB 4UI9R 4X60B 3RRMC 4ERQA 1PEVA 1PI6A 4AN0A 3DXMC 1T2XA 4HDJA 4UM9A 3EQ7A 1YFQA 3ZE2A 4JSXC 5FLXg 1UOOA 4J86A 5E6SA 5IC7A 1A12A 3DDUA 4PBYA 4AEZA 2IUQA 4L9OA 2GC7A 4Y7RA 2H6KA 3ORVD 1N6EA 4O1QD 3CFSB 1B9YA 5AMSA 1GP2B 5E6UA 4L1QD 2EICA 3MUOA 4CY1A 5I5JA 1S4UX 2B5MA 1GOTB 2AGZA 3RFHA 4CI3A 3PSLA 4L1MA 5C92A 4A09B 2I0SA 4J79A 3I7NA 2OVRB 4PBZA 3IIYA 4BCBA 4FA5D 3P4FA 4NBMA 2CN3A 4JD2C 2YB8B 3NVNA 1JMXB 4O3UB 4JT6C 5EMKB 4FA4D 5JWZA 3OF7A 3VGZA 2IWFA 2YBAA 3VA6A 1QNIA 3I7HA 5HE2B 4XEIC 4AX4A 4CC9A 5M5VA 4UM8A 5EAMA 2HKMA 3UVOA 2OK4A 1L0QA 2QR5A 3RN1D 5I5MA 5EMJB 3EMHA 5FFGA 3J81g 2VZ1A 2O9KA 3E0CA 4H5IA 5M5RA 4GMBA 3K26A 5HDBA 2HESX 2G99A 3AFCA 3NIDA 5SXMA 3AL8A 5H14A 1SQ9A 4A7JA 4J82A 1U4CA 3AL8B 4GQBB 3V7DB 3SWSD 3JRPA 3OL2B 1NR0A 4A0BB 2H47A 2GNQA 2HU7A 2EBSA 3PXSD 2B4EA 4BP8A 4ERZA 3V4PA 4ESGA 5AFU3 3IVMA 2I0TA 4H5JA 3MXXA 1MG2A 4J87A 4QAMA 4GGAA 3EI2A 1Q47A 5TEFA 3SFZA 2Z2NA 3VH0A 3EI2B 4JSVC 5FKQA 3GC3B 2AH1A 2HU5A 2PM6B 4WJKA 4A0AB 4AOWA 1H2ZA 5K19A 2IAAA 1VE6A 2J55H 3ODTA 5B4WA 5IJ8E 4E5ZB 4FAVD 3DM0A 4NC4A 1K8KC
chains in the Genus database with same CATH topology
1SHYB 2J57G 4OZUA 3MZKA 1U2VC 2UZYB 2H9PA 5EAPA 1VYHC 3JAMg 3OKTA 4CZXA 2IUPA 1R5MA 2QC5A 4FWWA 5CYKB 4R7AB 5FKSA 3AH8B 5GMKn 4K3ID 2J56H 3IJ1A 4O9DA 3SCYA 5IT9g 4U1EI 2H14A 2B5NA 3KRXB 2QXVA 2IURA 3UVMA 4L3GD 5HYNB 3GREA 3JZHA 1N6DA 4JSPC 4QRJA 5TF2A 2TRCB 4FHLA 3SHFA 3JZNA 3JZGA 4CZYA 3I7PA 3CIKB 3N0DA 3PXWD 3DSMA 1TYQC 2H9NA 1ERJA 5C9ZB 2AH0A 3J80g 4A08A 2PM9A 5GXIA 2I0RA 1N6FA 4A2MA 1JMZB 2PM9B 4A08B 2YNOA 4A09A 4A11B 4BUJC 3B7FA 2H6QA 4OWRA 3BWSA 3RFGA 4I79A 4LGNA 3K27A 4JT5C 3I8EA 4J8BA 5IGOA 3BG0A 3UR4A 4BL0A 3V9FA 3C99A 4J77A 3C75H 3I89A 3UVKA 4CI1A 2AGLA 4QQEA 3RLMD 3UKUC 1XKSA 3I7OA 3MMYA 2CN2A 1A0RB 3ZWLB 3IKOA 3GFCA 2Z2OA 3MZLA 3OL2A 4J84A 2BCJB 4A0BA 5IJ7E 3KRWB 2PM7B 4PNKB 5H17A 2G9AA 4J78A 4GM9A 3SJLD 4X61B 2Q7QA 3EU7A 4FA1D 4J8GA 3MKQA 2W18A 1JJUB 4G56B 5HQGA 4PXWA 2P9IC 1XHMA 2H6NA 2H9MA 2I3SA 4A0AA 3EI3A 5CXBB 2UZXB 3NVXA 3NVQA 4CI8A 4E5ZA 3EI3B 5EALA 2XYIA 4U7AA 3SBRA 4KFMB 2H3XA 2YNNA 3JB9L 3I2NA 4XYHA 3EI1B 5EMMB 4PC0A 5HE1B 2CE8A 3PVWB 2OK6A 4JSNC 4YVDA 4PSWB 5CYKA 4GQ2P 4L3HD 3FM0A 4X3EA 5AJAA 4EWRA 3V5WB 1PGUA 1FWXA 5EARA 3I8CA 4O45A 2CE9A 4GZ8A 4GGDA 2P9SC 5KDOB 3DWLC 5CXCB 3UKRC 3I7LA 2HJ4A 2HXCA 3PVUB 3SXTD 4LG8A 3HFQA 2H68A 3UVLA 4D0KA 2I3TA 1SQJA 3BG1A 5TEEA 3W15A 3EWEA 2XL3A 1JOFA 3L4MD 2IUVA 2XL2A 4A11A 2BBKH 2Z2PA 1B9XA 1NEXB 1OLZA 2CO0A 3L4OD 4ZOYA 4ERYA 3OKYA 4K3JB 4GM8A 4BH6A 4N14A 5FKRA 5THAA 2AQ5A 3I7KA 3OKYB 4ZOXA 3IJCA 2HKRA 1K32A 4Z8LA 5IGQA 3JPXA 3A0FA 2H13A 2GC4A 5FKTA 3SN6B 3SMRA 4QT8A 2CNXA 4CY5A 4CI2A 3RMZD 3PE7A 5GSAA 3F3PA 4XYIA 3SVWD 4JXMA 4Y5RD 2AGYA 3U4YA 1GXRA 4IMMA 5EMLB 5FA5B 2P9NC 3FRXA 3CFVA 5HE3B 3EI4A 4CZVA 5A2Qg 4E54A 4ZN4A 3IIWA 1OMWB 3N0EA 4ZOZA 4ES0A 3EI4B 3IJ0A 2IWKA 3MKSB 4A2LA 3OKWA 4E54B 5EM2A 2YNPA 3RSEC 4J81A 2OJYA 1XIPA 2PBIB 5FQDA 4CY3A 3FGBA 4CY2A 5EM2B 5CXBA 3F3FA 4GGCA 2P9PC 4FA9D 2P9KC 4D6VA 1MG3A 2HYEA 3AL9A 3OTTA 5H1MA 3EI1A 1P22A 3EG6A 2CO0C 4FB1D 3SBQA 4J73A 4X63B 5K1CC 2HJBA 2YMUA 4IA9A 4MK0B 2MTAH 5I5IA 3SLED 5C2WB 3ULEC 1RI6A 3JROA 3C5MA 5FXYA 3RN0D 1GG2B 2B5LA 4QL1A 4ZOVA 5C2VB 2H9LA 3PSCB 3PXTD 4TZ4A 3UVNA 5HE0B 5CXCA 4J0WA 3OW8A 1PBYB 3F3GA 4FAND 4J0XA 2OIZA 4PSXB 2AGWA 2OVPB 3DXKC 2OVQB 1TBGA 4GM3A 1MDAH 3SBPA 4LG9A 2P9UC 5GXHA 4NSXA 5TDHB 2XU7A 3C9CA 2AGXA 4GQ1A 2P9LC 4O3TB 4UI9R 4X60B 3RRMC 4ERQA 1PEVA 1PI6A 3DXMC 4HDJA 1YFQA 4JSXC 5FLXg 4J86A 5IC7A 4PBYA 4AEZA 2IUQA 4L9OA 2GC7A 4Y7RA 2H6KA 3ORVD 1N6EA 4O1QD 3CFSB 1B9YA 5AMSA 1GP2B 4L1QD 4CY1A 5I5JA 1S4UX 2B5MA 1GOTB 2AGZA 3RFHA 4CI3A 3PSLA 4A09B 2I0SA 4J79A 3I7NA 2OVRB 4PBZA 3IIYA 4FA5D 3P4FA 2CN3A 4JD2C 2YB8B 3NVNA 1JMXB 4O3UB 4JT6C 5EMKB 4FA4D 5JWZA 3VGZA 2IWFA 2YBAA 3VA6A 1QNIA 3I7HA 5HE2B 4XEIC 4CC9A 5EAMA 2HKMA 3UVOA 2OK4A 1L0QA 3RN1D 5I5MA 5EMJB 3EMHA 3J81g 2O9KA 3E0CA 4H5IA 4GMBA 3K26A 2HESX 2G99A 3AFCA 5SXMA 3AL8A 5H14A 1SQ9A 4A7JA 4J82A 1U4CA 3AL8B 4GQBB 3V7DB 3SWSD 3JRPA 3OL2B 1NR0A 4A0BB 2H47A 2GNQA 2EBSA 3PXSD 2B4EA 4ERZA 4ESGA 5AFU3 2I0TA 4H5JA 3MXXA 1MG2A 4J87A 4GGAA 3EI2A 1Q47A 5TEFA 3SFZA 2Z2NA 3VH0A 3EI2B 4JSVC 5FKQA 2AH1A 2PM6B 4A0AB 4AOWA 5K19A 2IAAA 2J55H 5B4WA 3ODTA 5IJ8E 4E5ZB 4FAVD 3DM0A 1K8KC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SHY B;  2J57 G;  4OZU A;  3MZK A;  1U2V C;  2UZY B;  2H9P A;  5EAP A;  1VYH C;  3JAM g;  3OKT A;  4CZX A;  2IUP A;  1R5M A;  2QC5 A;  4FWW A;  5CYK B;  4R7A B;  5FKS A;  3AH8 B;  5GMK n;  4K3I D;  2J56 H;  3IJ1 A;  4O9D A;  3SCY A;  5IT9 g;  4U1E I;  2H14 A;  2B5N A;  3KRX B;  2QXV A;  2IUR A;  3UVM A;  4L3G D;  5HYN B;  3GRE A;  3JZH A;  1N6D A;  4JSP C;  4QRJ A;  5TF2 A;  2TRC B;  4FHL A;  3SHF A;  3JZN A;  3JZG A;  4CZY A;  3I7P A;  3CIK B;  3N0D A;  3PXW D;  3DSM A;  1TYQ C;  2H9N A;  1ERJ A;  5C9Z B;  2AH0 A;  3J80 g;  4A08 A;  2PM9 A;  5GXI A;  2I0R A;  1N6F A;  4A2M A;  1JMZ B;  2PM9 B;  4A08 B;  2YNO A;  4A09 A;  4A11 B;  4BUJ C;  3B7F A;  2H6Q A;  4OWR A;  3BWS A;  3RFG A;  4I79 A;  4LGN A;  3K27 A;  4JT5 C;  3I8E A;  4J8B A;  5IGO A;  3BG0 A;  3UR4 A;  4BL0 A;  3V9F A;  3C99 A;  4J77 A;  3C75 H;  3I89 A;  3UVK A;  4CI1 A;  2AGL A;  4QQE A;  3RLM D;  3UKU C;  1XKS A;  3I7O A;  3MMY A;  2CN2 A;  1A0R B;  3ZWL B;  3IKO A;  3GFC A;  2Z2O A;  3MZL A;  3OL2 A;  4J84 A;  2BCJ B;  4A0B A;  5IJ7 E;  3KRW B;  2PM7 B;  4PNK B;  5H17 A;  2G9A A;  4J78 A;  4GM9 A;  3SJL D;  4X61 B;  2Q7Q A;  3EU7 A;  4FA1 D;  4J8G A;  3MKQ A;  2W18 A;  1JJU B;  4G56 B;  5HQG A;  4PXW A;  2P9I C;  1XHM A;  2H6N A;  2H9M A;  2I3S A;  4A0A A;  3EI3 A;  5CXB B;  2UZX B;  3NVX A;  3NVQ A;  4CI8 A;  4E5Z A;  3EI3 B;  5EAL A;  2XYI A;  4U7A A;  3SBR A;  4KFM B;  2H3X A;  2YNN A;  3JB9 L;  3I2N A;  4XYH A;  3EI1 B;  5EMM B;  4PC0 A;  5HE1 B;  2CE8 A;  3PVW B;  2OK6 A;  4JSN C;  4YVD A;  4PSW B;  5CYK A;  4GQ2 P;  4L3H D;  3FM0 A;  4X3E A;  5AJA A;  4EWR A;  3V5W B;  1PGU A;  1FWX A;  5EAR A;  3I8C A;  4O45 A;  2CE9 A;  4GZ8 A;  4GGD A;  2P9S C;  5KDO B;  3DWL C;  5CXC B;  3UKR C;  3I7L A;  2HJ4 A;  2HXC A;  3PVU B;  3SXT D;  4LG8 A;  3HFQ A;  2H68 A;  3UVL A;  4D0K A;  2I3T A;  1SQJ A;  3BG1 A;  5TEE A;  3W15 A;  3EWE A;  2XL3 A;  1JOF A;  3L4M D;  2IUV A;  2XL2 A;  4A11 A;  2BBK H;  2Z2P A;  1B9X A;  1NEX B;  1OLZ A;  2CO0 A;  3L4O D;  4ZOY A;  4ERY A;  3OKY A;  4K3J B;  4GM8 A;  4BH6 A;  4N14 A;  5FKR A;  5THA A;  2AQ5 A;  3I7K A;  3OKY B;  4ZOX A;  3IJC A;  2HKR A;  1K32 A;  4Z8L A;  5IGQ A;  3JPX A;  3A0F A;  2H13 A;  2GC4 A;  5FKT A;  3SN6 B;  3SMR A;  4QT8 A;  2CNX A;  4CY5 A;  4CI2 A;  3RMZ D;  3PE7 A;  5GSA A;  3F3P A;  4XYI A;  3SVW D;  4JXM A;  4Y5R D;  2AGY A;  3U4Y A;  1GXR A;  4IMM A;  5EML B;  5FA5 B;  2P9N C;  3FRX A;  3CFV A;  5HE3 B;  3EI4 A;  4CZV A;  5A2Q g;  4E54 A;  4ZN4 A;  3IIW A;  1OMW B;  3N0E A;  4ZOZ A;  4ES0 A;  3EI4 B;  3IJ0 A;  2IWK A;  3MKS B;  4A2L A;  3OKW A;  4E54 B;  5EM2 A;  2YNP A;  3RSE C;  4J81 A;  2OJY A;  1XIP A;  2PBI B;  5FQD A;  4CY3 A;  3FGB A;  4CY2 A;  5EM2 B;  5CXB A;  3F3F A;  4GGC A;  2P9P C;  4FA9 D;  2P9K C;  4D6V A;  1MG3 A;  2HYE A;  3AL9 A;  3OTT A;  5H1M A;  3EI1 A;  1P22 A;  3EG6 A;  2CO0 C;  4FB1 D;  3SBQ A;  4J73 A;  4X63 B;  5K1C C;  2HJB A;  2YMU A;  4IA9 A;  4MK0 B;  2MTA H;  5I5I A;  3SLE D;  5C2W B;  3ULE C;  1RI6 A;  3JRO A;  3C5M A;  5FXY A;  3RN0 D;  1GG2 B;  2B5L A;  4QL1 A;  4ZOV A;  5C2V B;  2H9L A;  3PSC B;  3PXT D;  4TZ4 A;  3UVN A;  5HE0 B;  5CXC A;  4J0W A;  3OW8 A;  1PBY B;  3F3G A;  4FAN D;  4J0X A;  2OIZ A;  4PSX B;  2AGW A;  2OVP B;  3DXK C;  2OVQ B;  1TBG A;  4GM3 A;  1MDA H;  3SBP A;  4LG9 A;  2P9U C;  5GXH A;  4NSX A;  5TDH B;  2XU7 A;  3C9C A;  2AGX A;  4GQ1 A;  2P9L C;  4O3T B;  4UI9 R;  4X60 B;  3RRM C;  4ERQ A;  1PEV A;  1PI6 A;  3DXM C;  4HDJ A;  1YFQ A;  4JSX C;  5FLX g;  4J86 A;  5IC7 A;  4PBY A;  4AEZ A;  2IUQ A;  4L9O A;  2GC7 A;  4Y7R A;  2H6K A;  3ORV D;  1N6E A;  4O1Q D;  3CFS B;  1B9Y A;  5AMS A;  1GP2 B;  4L1Q D;  4CY1 A;  5I5J A;  1S4U X;  2B5M A;  1GOT B;  2AGZ A;  3RFH A;  4CI3 A;  3PSL A;  4A09 B;  2I0S A;  4J79 A;  3I7N A;  2OVR B;  4PBZ A;  3IIY A;  4FA5 D;  3P4F A;  2CN3 A;  4JD2 C;  2YB8 B;  3NVN A;  1JMX B;  4O3U B;  4JT6 C;  5EMK B;  4FA4 D;  5JWZ A;  3VGZ A;  2IWF A;  2YBA A;  3VA6 A;  1QNI A;  3I7H A;  5HE2 B;  4XEI C;  4CC9 A;  5EAM A;  2HKM A;  3UVO A;  2OK4 A;  1L0Q A;  3RN1 D;  5I5M A;  5EMJ B;  3EMH A;  3J81 g;  2O9K A;  3E0C A;  4H5I A;  4GMB A;  3K26 A;  2HES X;  2G99 A;  3AFC A;  5SXM A;  3AL8 A;  5H14 A;  1SQ9 A;  4A7J A;  4J82 A;  1U4C A;  3AL8 B;  4GQB B;  3V7D B;  3SWS D;  3JRP A;  3OL2 B;  1NR0 A;  4A0B B;  2H47 A;  2GNQ A;  2EBS A;  3PXS D;  2B4E A;  4ERZ A;  4ESG A;  5AFU 3;  2I0T A;  4H5J A;  3MXX A;  1MG2 A;  4J87 A;  4GGA A;  3EI2 A;  1Q47 A;  5TEF A;  3SFZ A;  2Z2N A;  3VH0 A;  3EI2 B;  4JSV C;  5FKQ A;  2AH1 A;  2PM6 B;  4A0A B;  4AOW A;  5K19 A;  2IAA A;  2J55 H;  5B4W A;  3ODT A;  5IJ8 E;  4E5Z B;  4FAV D;  3DM0 A;  1K8K C; 
#chains in the Genus database with same CATH topology
 1SHY B;  2J57 G;  4OZU A;  3MZK A;  1U2V C;  2UZY B;  2H9P A;  1H2X A;  5EAP A;  1VYH C;  4O02 A;  3IJE A;  3JAM g;  1VZ3 A;  3OKT A;  4CZX A;  1E5T A;  3O4I A;  2IUP A;  1R5M A;  2QC5 A;  4FWW A;  3T3M A;  4WK2 A;  5FFO A;  5E6R A;  5CYK B;  4R7A B;  2EIE A;  5FKS A;  3AH8 B;  3IUN A;  5GMK n;  4K3I D;  2J56 H;  3IJ1 A;  4O9D A;  3SCY A;  5IT9 g;  4U1E I;  2H14 A;  2B5N A;  3KRX B;  2QXV A;  2IUR A;  3IUL A;  1C9I A;  3UVM A;  4L3G D;  5HYN B;  2WQ8 A;  3GRE A;  3JZH A;  1N6D A;  4JSP C;  2EIB A;  4QRJ A;  4DNV A;  4AMY A;  5TF2 A;  2TRC B;  4FHL A;  3SHF A;  3JZN A;  3JZG A;  4O2W A;  4CZY A;  3I7P A;  3ZE0 A;  3CIK B;  3N0D A;  3PXW D;  2VDM A;  3DSM A;  1UOP A;  1TYQ C;  2H9N A;  4G1M A;  1ERJ A;  4G1E A;  3V4V A;  2AH0 A;  5C9Z B;  3J80 g;  4A08 A;  2PM9 A;  5GXI A;  2VDP A;  2I0R A;  1N6F A;  4A2M A;  1JMZ B;  2PM9 B;  4A08 B;  2YNO A;  4A09 A;  4A11 B;  4BUJ C;  2EID A;  3B7F A;  1GOG A;  2H6Q A;  4OWR A;  3BWS A;  3FCS A;  3RFG A;  4MMX A;  4I79 A;  4LGN A;  3K27 A;  4JT5 C;  3I8E A;  4J8B A;  2VDQ A;  5IGO A;  5C86 A;  3BG0 A;  3UR4 A;  4BL0 A;  3V9F A;  3C99 A;  4J77 A;  4AMZ A;  3C75 H;  1YR2 A;  1U8C A;  3I89 A;  4JHP C;  3UVK A;  4CI1 A;  3VI3 A;  1QFS A;  2AGL A;  4QQE A;  3RLM D;  3UKU C;  1XKS A;  3I7O A;  3FCU A;  3MMY A;  2CN2 A;  1A0R B;  2VC2 A;  3ZWL B;  3IKO A;  4WK4 A;  3GFC A;  2Z2O A;  3MZL A;  3OL2 A;  4J84 A;  2BCJ B;  2JKX A;  5IJ7 E;  3KRW B;  4A0B A;  2PM7 B;  4PNK B;  5H17 A;  2G9A A;  3O4H A;  1M1X A;  4J78 A;  1TYE A;  4GM9 A;  3SJL D;  4X61 B;  3NIF A;  2Q7Q A;  3EU7 A;  4WK0 A;  4FA1 D;  4J8G A;  3MKQ A;  2W18 A;  1JJU B;  4G56 B;  5HQG A;  4PXW A;  1I2M B;  2P9I C;  1XHM A;  2H6N A;  2H9M A;  2I3S A;  4BP9 A;  4A0A A;  3EI3 A;  5CXB B;  2UZX B;  3NVX A;  3NVQ A;  4CI8 A;  4E5Z A;  3QI0 A;  3EI3 B;  5EAL A;  2XYI A;  3K72 A;  4U7A A;  5M61 A;  4MMY A;  3SBR A;  4KFM B;  2H3X A;  2YNN A;  3JB9 L;  3I2N A;  4XYH A;  4Z7Q A;  3EI1 B;  5EMM B;  4NAA A;  4PC0 A;  4DNU A;  1H2Y A;  5HE1 B;  2CE8 A;  3PVW B;  2OK6 A;  4JSN C;  4YVD A;  4PSW B;  5CYK A;  4GQ2 P;  4L3H D;  3FM0 A;  4X3E A;  5AJA A;  4EWR A;  3V5W B;  1PGU A;  3O4G A;  3MVD K;  1FWX A;  5EAR A;  3I8C A;  4O45 A;  2CE9 A;  2BKL A;  4GZ8 A;  4GGD A;  2P9S C;  5KDO B;  2VDL A;  3DWL C;  5CXC B;  3UKR C;  3I7L A;  2HJ4 A;  1C9L A;  3O4J A;  2HXC A;  3PVU B;  4RE5 A;  3SXT D;  3QHY B;  1UOQ A;  3K6S A;  4LG8 A;  3HFQ A;  2H68 A;  3UVL A;  4D0K A;  2I3T A;  1SQJ A;  3BG1 A;  1BPO A;  5TEE A;  3W15 A;  3EWE A;  2XL3 A;  3T3P A;  4JHN A;  4BCD A;  1JOF A;  3L4M D;  2IUV A;  2XL2 A;  4A11 A;  2BBK H;  2Z2P A;  1B9X A;  1NEX B;  1OLZ A;  2CO0 A;  1K3I A;  3L4O D;  4ZOY A;  2XDW A;  4ERY A;  3OKY A;  2XZG A;  4K3J B;  1GOH A;  4GM8 A;  4BH6 A;  4N14 A;  5FKR A;  5M5S A;  5THA A;  2AQ5 A;  4G55 A;  3I7K A;  3OKY B;  4ZOX A;  1O6F A;  4NEN A;  1GOF A;  3IJC A;  3KCI A;  2HKR A;  1K32 A;  1O6G A;  4Z8L A;  1JTD B;  1VZ2 A;  5IGQ A;  3JPX A;  3A0F A;  4DNW A;  2H13 A;  2VDN A;  1UTC A;  2GC4 A;  5FKT A;  3SN6 B;  3ZDZ A;  3SMR A;  4D9S A;  3EQ8 A;  4QT8 A;  2CNX A;  1QFM A;  4CY5 A;  4Z7O A;  4IRZ A;  4CI2 A;  3RMZ D;  3PE7 A;  2VDK A;  5GSA A;  3F3P A;  4XYI A;  1VE7 A;  3SVW D;  4JXM A;  4Y5R D;  2AGY A;  3U4Y A;  1GXR A;  4IMM A;  5EML B;  5FA5 B;  2P9N C;  3FRX A;  3CFV A;  5HE3 B;  3EI4 A;  4CZV A;  5A2Q g;  4E54 A;  3NIG A;  4ZN4 A;  3IIW A;  1OMW B;  3N0E A;  4ZOZ A;  4ES0 A;  3EI4 B;  3IJ0 A;  2IWK A;  3MKS B;  4A2L A;  3OKW A;  4E54 B;  3ZE1 A;  5EM2 A;  1L5G A;  2YNP A;  3RSE C;  4J81 A;  2OJY A;  1XIP A;  2PBI B;  5FQD A;  4CY3 A;  3FGB A;  4CY2 A;  5EM2 B;  5CXB A;  3F3F A;  4GGC A;  1E8N A;  2P9P C;  3EQ9 A;  3ZDX A;  4FA9 D;  4RE6 A;  5M5U A;  2P9K C;  3IUR A;  1E8M A;  4D6V A;  1MG3 A;  2HYE A;  3AL9 A;  3OTT A;  5H1M A;  3EI1 A;  1P22 A;  1H2W A;  3EG6 A;  2XE4 A;  2CO0 C;  5M5T A;  4FB1 D;  3SBQ A;  3GD1 I;  3IUJ A;  4J73 A;  4AN1 A;  3IUQ A;  4X63 B;  5K1C C;  2HJB A;  2YMU A;  4IA9 A;  4MK0 B;  2MTA H;  5I5I A;  3SLE D;  5C2W B;  3ULE C;  3JRO A;  1RI6 A;  3C5M A;  5FXY A;  2QZP A;  3RN0 D;  1GG2 B;  2B5L A;  3IUM A;  4QL1 A;  4ZOV A;  3VI4 A;  5C2V B;  2H9L A;  3PSC B;  3PXT D;  2HU8 A;  4TZ4 A;  3UVN A;  5HE0 B;  5CXC A;  4BCC A;  4J0W A;  3OW8 A;  1PBY B;  3F3G A;  4FAN D;  2VDR A;  4J0X A;  2OIZ A;  4PSX B;  2AGW A;  2OVP B;  3DXK C;  2OVQ B;  2VZ3 A;  1TBG A;  4GM3 A;  1MDA H;  4Z7N A;  3SBP A;  1JV2 A;  4LG9 A;  2P9U C;  5GXH A;  3K71 A;  4NSX A;  5TDH B;  2VDO A;  2XU7 A;  3C9C A;  2AGX A;  3MUN A;  4GQ1 A;  2P9L C;  4MMZ A;  3ZDY A;  4O3T B;  4UI9 R;  4X60 B;  3RRM C;  4ERQ A;  1PEV A;  1PI6 A;  4AN0 A;  3DXM C;  1T2X A;  4HDJ A;  4UM9 A;  3EQ7 A;  1YFQ A;  3ZE2 A;  4JSX C;  5FLX g;  1UOO A;  4J86 A;  5E6S A;  5IC7 A;  1A12 A;  3DDU A;  4PBY A;  4AEZ A;  2IUQ A;  4L9O A;  2GC7 A;  4Y7R A;  2H6K A;  3ORV D;  1N6E A;  4O1Q D;  3CFS B;  1B9Y A;  5AMS A;  1GP2 B;  5E6U A;  4L1Q D;  2EIC A;  3MUO A;  4CY1 A;  5I5J A;  1S4U X;  2B5M A;  1GOT B;  2AGZ A;  3RFH A;  4CI3 A;  3PSL A;  4L1M A;  5C92 A;  4A09 B;  2I0S A;  4J79 A;  3I7N A;  2OVR B;  4PBZ A;  3IIY A;  4BCB A;  4FA5 D;  3P4F A;  4NBM A;  2CN3 A;  4JD2 C;  2YB8 B;  3NVN A;  1JMX B;  4O3U B;  4JT6 C;  5EMK B;  4FA4 D;  5JWZ A;  3OF7 A;  3VGZ A;  2IWF A;  2YBA A;  3VA6 A;  1QNI A;  3I7H A;  5HE2 B;  4XEI C;  4AX4 A;  4CC9 A;  5M5V A;  4UM8 A;  5EAM A;  2HKM A;  3UVO A;  2OK4 A;  1L0Q A;  2QR5 A;  3RN1 D;  5I5M A;  5EMJ B;  3EMH A;  5FFG A;  3J81 g;  2VZ1 A;  2O9K A;  3E0C A;  4H5I A;  5M5R A;  4GMB A;  3K26 A;  5HDB A;  2HES X;  2G99 A;  3AFC A;  3NID A;  5SXM A;  3AL8 A;  5H14 A;  1SQ9 A;  4A7J A;  4J82 A;  1U4C A;  3AL8 B;  4GQB B;  3V7D B;  3SWS D;  3JRP A;  3OL2 B;  1NR0 A;  4A0B B;  2H47 A;  2GNQ A;  2HU7 A;  2EBS A;  3PXS D;  2B4E A;  4BP8 A;  4ERZ A;  3V4P A;  4ESG A;  5AFU 3;  3IVM A;  2I0T A;  4H5J A;  3MXX A;  1MG2 A;  4J87 A;  4QAM A;  4GGA A;  3EI2 A;  1Q47 A;  5TEF A;  3SFZ A;  2Z2N A;  3VH0 A;  3EI2 B;  4JSV C;  5FKQ A;  3GC3 B;  2AH1 A;  2HU5 A;  2PM6 B;  4WJK A;  4A0A B;  4AOW A;  1H2Z A;  5K19 A;  2IAA A;  1VE6 A;  2J55 H;  3ODT A;  5B4W A;  5IJ8 E;  4E5Z B;  4FAV D;  3DM0 A;  4NC4 A;  1K8K C; 
#chains in the Genus database with same CATH homology
 1SHY B;  2J57 G;  4OZU A;  3MZK A;  1U2V C;  2UZY B;  2H9P A;  5EAP A;  1VYH C;  3JAM g;  3OKT A;  4CZX A;  2IUP A;  1R5M A;  2QC5 A;  4FWW A;  5CYK B;  4R7A B;  5FKS A;  3AH8 B;  5GMK n;  4K3I D;  2J56 H;  3IJ1 A;  4O9D A;  3SCY A;  5IT9 g;  4U1E I;  2H14 A;  2B5N A;  3KRX B;  2QXV A;  2IUR A;  3UVM A;  4L3G D;  5HYN B;  3GRE A;  3JZH A;  1N6D A;  4JSP C;  4QRJ A;  5TF2 A;  2TRC B;  4FHL A;  3SHF A;  3JZN A;  3JZG A;  4CZY A;  3I7P A;  3CIK B;  3N0D A;  3PXW D;  3DSM A;  1TYQ C;  2H9N A;  1ERJ A;  5C9Z B;  2AH0 A;  3J80 g;  4A08 A;  2PM9 A;  5GXI A;  2I0R A;  1N6F A;  4A2M A;  1JMZ B;  2PM9 B;  4A08 B;  2YNO A;  4A09 A;  4A11 B;  4BUJ C;  3B7F A;  2H6Q A;  4OWR A;  3BWS A;  3RFG A;  4I79 A;  4LGN A;  3K27 A;  4JT5 C;  3I8E A;  4J8B A;  5IGO A;  3BG0 A;  3UR4 A;  4BL0 A;  3V9F A;  3C99 A;  4J77 A;  3C75 H;  3I89 A;  3UVK A;  4CI1 A;  2AGL A;  4QQE A;  3RLM D;  3UKU C;  1XKS A;  3I7O A;  3MMY A;  2CN2 A;  1A0R B;  3ZWL B;  3IKO A;  3GFC A;  2Z2O A;  3MZL A;  3OL2 A;  4J84 A;  2BCJ B;  4A0B A;  5IJ7 E;  3KRW B;  2PM7 B;  4PNK B;  5H17 A;  2G9A A;  4J78 A;  4GM9 A;  3SJL D;  4X61 B;  2Q7Q A;  3EU7 A;  4FA1 D;  4J8G A;  3MKQ A;  2W18 A;  1JJU B;  4G56 B;  5HQG A;  4PXW A;  2P9I C;  1XHM A;  2H6N A;  2H9M A;  2I3S A;  4A0A A;  3EI3 A;  5CXB B;  2UZX B;  3NVX A;  3NVQ A;  4CI8 A;  4E5Z A;  3EI3 B;  5EAL A;  2XYI A;  4U7A A;  3SBR A;  4KFM B;  2H3X A;  2YNN A;  3JB9 L;  3I2N A;  4XYH A;  3EI1 B;  5EMM B;  4PC0 A;  5HE1 B;  2CE8 A;  3PVW B;  2OK6 A;  4JSN C;  4YVD A;  4PSW B;  5CYK A;  4GQ2 P;  4L3H D;  3FM0 A;  4X3E A;  5AJA A;  4EWR A;  3V5W B;  1PGU A;  1FWX A;  5EAR A;  3I8C A;  4O45 A;  2CE9 A;  4GZ8 A;  4GGD A;  2P9S C;  5KDO B;  3DWL C;  5CXC B;  3UKR C;  3I7L A;  2HJ4 A;  2HXC A;  3PVU B;  3SXT D;  4LG8 A;  3HFQ A;  2H68 A;  3UVL A;  4D0K A;  2I3T A;  1SQJ A;  3BG1 A;  5TEE A;  3W15 A;  3EWE A;  2XL3 A;  1JOF A;  3L4M D;  2IUV A;  2XL2 A;  4A11 A;  2BBK H;  2Z2P A;  1B9X A;  1NEX B;  1OLZ A;  2CO0 A;  3L4O D;  4ZOY A;  4ERY A;  3OKY A;  4K3J B;  4GM8 A;  4BH6 A;  4N14 A;  5FKR A;  5THA A;  2AQ5 A;  3I7K A;  3OKY B;  4ZOX A;  3IJC A;  2HKR A;  1K32 A;  4Z8L A;  5IGQ A;  3JPX A;  3A0F A;  2H13 A;  2GC4 A;  5FKT A;  3SN6 B;  3SMR A;  4QT8 A;  2CNX A;  4CY5 A;  4CI2 A;  3RMZ D;  3PE7 A;  5GSA A;  3F3P A;  4XYI A;  3SVW D;  4JXM A;  4Y5R D;  2AGY A;  3U4Y A;  1GXR A;  4IMM A;  5EML B;  5FA5 B;  2P9N C;  3FRX A;  3CFV A;  5HE3 B;  3EI4 A;  4CZV A;  5A2Q g;  4E54 A;  4ZN4 A;  3IIW A;  1OMW B;  3N0E A;  4ZOZ A;  4ES0 A;  3EI4 B;  3IJ0 A;  2IWK A;  3MKS B;  4A2L A;  3OKW A;  4E54 B;  5EM2 A;  2YNP A;  3RSE C;  4J81 A;  2OJY A;  1XIP A;  2PBI B;  5FQD A;  4CY3 A;  3FGB A;  4CY2 A;  5EM2 B;  5CXB A;  3F3F A;  4GGC A;  2P9P C;  4FA9 D;  2P9K C;  4D6V A;  1MG3 A;  2HYE A;  3AL9 A;  3OTT A;  5H1M A;  3EI1 A;  1P22 A;  3EG6 A;  2CO0 C;  4FB1 D;  3SBQ A;  4J73 A;  4X63 B;  5K1C C;  2HJB A;  2YMU A;  4IA9 A;  4MK0 B;  2MTA H;  5I5I A;  3SLE D;  5C2W B;  3ULE C;  1RI6 A;  3JRO A;  3C5M A;  5FXY A;  3RN0 D;  1GG2 B;  2B5L A;  4QL1 A;  4ZOV A;  5C2V B;  2H9L A;  3PSC B;  3PXT D;  4TZ4 A;  3UVN A;  5HE0 B;  5CXC A;  4J0W A;  3OW8 A;  1PBY B;  3F3G A;  4FAN D;  4J0X A;  2OIZ A;  4PSX B;  2AGW A;  2OVP B;  3DXK C;  2OVQ B;  1TBG A;  4GM3 A;  1MDA H;  3SBP A;  4LG9 A;  2P9U C;  5GXH A;  4NSX A;  5TDH B;  2XU7 A;  3C9C A;  2AGX A;  4GQ1 A;  2P9L C;  4O3T B;  4UI9 R;  4X60 B;  3RRM C;  4ERQ A;  1PEV A;  1PI6 A;  3DXM C;  4HDJ A;  1YFQ A;  4JSX C;  5FLX g;  4J86 A;  5IC7 A;  4PBY A;  4AEZ A;  2IUQ A;  4L9O A;  2GC7 A;  4Y7R A;  2H6K A;  3ORV D;  1N6E A;  4O1Q D;  3CFS B;  1B9Y A;  5AMS A;  1GP2 B;  4L1Q D;  4CY1 A;  5I5J A;  1S4U X;  2B5M A;  1GOT B;  2AGZ A;  3RFH A;  4CI3 A;  3PSL A;  4A09 B;  2I0S A;  4J79 A;  3I7N A;  2OVR B;  4PBZ A;  3IIY A;  4FA5 D;  3P4F A;  2CN3 A;  4JD2 C;  2YB8 B;  3NVN A;  1JMX B;  4O3U B;  4JT6 C;  5EMK B;  4FA4 D;  5JWZ A;  3VGZ A;  2IWF A;  2YBA A;  3VA6 A;  1QNI A;  3I7H A;  5HE2 B;  4XEI C;  4CC9 A;  5EAM A;  2HKM A;  3UVO A;  2OK4 A;  1L0Q A;  3RN1 D;  5I5M A;  5EMJ B;  3EMH A;  3J81 g;  2O9K A;  3E0C A;  4H5I A;  4GMB A;  3K26 A;  2HES X;  2G99 A;  3AFC A;  5SXM A;  3AL8 A;  5H14 A;  1SQ9 A;  4A7J A;  4J82 A;  1U4C A;  3AL8 B;  4GQB B;  3V7D B;  3SWS D;  3JRP A;  3OL2 B;  1NR0 A;  4A0B B;  2H47 A;  2GNQ A;  2EBS A;  3PXS D;  2B4E A;  4ERZ A;  4ESG A;  5AFU 3;  2I0T A;  4H5J A;  3MXX A;  1MG2 A;  4J87 A;  4GGA A;  3EI2 A;  1Q47 A;  5TEF A;  3SFZ A;  2Z2N A;  3VH0 A;  3EI2 B;  4JSV C;  5FKQ A;  2AH1 A;  2PM6 B;  4A0A B;  4AOW A;  5K19 A;  2IAA A;  2J55 H;  5B4W A;  3ODT A;  5IJ8 E;  4E5Z B;  4FAV D;  3DM0 A;  1K8K C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...