4BL0A

Crystal structure of yeast bub3-bub1 bound to phospho-spc105
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
340
structure length
331
Chain Sequence
MQIVQIEQAPKDYISDIKIIPSKSLLLITSWDGSLTVYKFDIQAKNVDLLQSLRYKHPLLCCNFIDNTDLQIYVGTVQGEILKVDLIGSPSFQALTNNEANLGICRICKYGDDKLIAASWDGLIEVIDPRNYGDGVIAVKNLNSNNTKVKNKIFTMDTNSSRLIVGMNNSQVQWFRLPLCEDDNGTIEESGLKYQIRDVALLPKEQEGYACSSIDGRVAVEFFSKRFAFRCHRLNLKDTNLAYPVNSIEFSPRHKFLYTAGSDGIISCWNLQTRKKIKNFAKFNEDSVVKIACSDNILCLATSDDTFKTNAAIDQTIELNASSIYIIFDYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL CYCLE ARREST PROTEIN BUB3
publication title Bub3 Reads Phosphorylated Melt Repeats to Promote Spindle Assembly Checkpoint Signaling
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
total genus 76
structure length 331
sequence length 340
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4bl0A00
4GM3A 5THAA 4QRJA 1TBGA 4A7JA 4E5ZA 5GMKn 4J84A 4CY5A 3DXKC 2P9NC 2I0TA 5K1CC 3CFVA 4FA9D 5EARA 3UKUC 3MMYA 2PM7B 4FA1D 1P22A 3SFZA 3EI3A 2QC5A 1L0QA 4J73A 4ES0A 3FM0A 4J81A 2Z2PA 4IMMA 2H13A 5FKQA 2CO0A 5EAMA 4GQBB 3DXMC 4FAND 5FKRA 3BG0A 3PXTD 5FKSA 4NSXA 5EMLB 3IKOA 4PBYA 4G56B 3F3FA 2P9SC 5IJ8E 4A09B 2H6QA 1OLZA 2GC7A 4E54A 4PNKB 2H47A 5HQGA 5HE2B 4FWWA 2UZXB 3MZLA 3VA6A 2H9PA 2XYIA 2CN2A 5CXCB 3FRXA 5FXYA 4CC9A 2J56H 1SQJA 4JSNC 4A08A 2IURA 2B5NA 4JSPC 3RN1D 3RSEC 4PXWA 2HYEA 1GG2B 4GQ1A 3W15A 3EI2A 3EU7A 3RN0D 5I5IA 5CXBA 1B9XA 3SJLD 3IJ1A 4A0AB 5TF2A 3AH8B 4A11A 5EMJB 4PBZA 3NVQA 3ULEC 2H3XA 2I3TA 2MTAH 3OL2B 2PM9B 5FA5B 3J80g 3K27A 5C9ZB 2I0SA 2P9IC 1VYHC 3AFCA 2AH0A 3OKTA 5B4WA 2BCJB 2EBSA 1ERJA 3VH0A 3SVWD 5KDOB 1K8KC 2GNQA 3I7LA 4ZN4A 3IJ0A 4Z8LA 5SXMA 3RFHA 4CZYA 5C2WB 4ESGA 3I2NA 3EI4B 4D0KA 4L9OA 2YB8B 4JSXC 2GC4A 2OK6A 4J0XA 4EWRA 4FA5D 2XL2A 3DM0A 5TDHB 4U1EI 2PM6B 4N14A 4K3ID 5HE1B 3PVWB 4GGAA 4LG8A 1U4CA 2YBAA 3ORVD 5GSAA 2AGYA 3UR4A 2HKRA 5IGOA 3SHFA 4GM9A 5FQDA 1TYQC 1MG2A 4J0WA 5EM2B 2AH1A 1RI6A 5CXCA 1MG3A 5IGQA 1GOTB 1OMWB 5FLXg 3RRMC 3IIWA 4YVDA 4CI3A 3B7FA 5H1MA 4BUJC 2O9KA 3V5WB 2YNPA 3BG1A 3EG6A 3UVNA 1B9YA 4FHLA 5CYKB 1U2VC 4GQ2P 4O3TB 2IWFA 2H9NA 3OKYA 2Q7QA 3GFCA 2BBKH 1PEVA 2HESX 4MK0B 2H9LA 2AQ5A 2P9LC 4KFMB 3DSMA 5HE0B 2IUVA 3JRPA 3OW8A 4IA9A 3UKRC 4GGDA 5IJ7E 4A2MA 4XYHA 3VGZA 4JT6C 4JT5C 4A0BB 2YNOA 3I89A 1SQ9A 5GXHA 4CI1A 2P9KC 1NR0A 1Q47A 3MZKA 4FA4D 3RMZD 4GM8A 1JOFA 3V9FA 2XL3A 1N6FA 2OVPB 2CNXA 3JZGA 3K26A 3RLMD 3NVXA 4J8BA 3SXTD 3JAMg 2HJBA 2OIZA 3EMHA 3ODTA 5K19A 3SLED 5EM2A 5I5MA 4A2LA 2G9AA 5GXIA 4X3EA 4XYIA 4JSVC 2OVRB 4J78A 1XHMA 4AEZA 4X61B 1XKSA 3DWLC 3EI1B 3MKSB 4J8GA 2OVQB 4I79A 2IUQA 3N0EA 3L4OD 3C5MA 3EI3B 2H9MA 4ERYA 3UVMA 2IUPA 4PSWB 5JWZA 1K32A 4ZOXA 1FWXA 4H5JA 3PE7A 3FGBA 1JMZB 2W18A 1NEXB 5TEEA 4CY1A 1PI6A 4CZVA 3PSLA 1MDAH 3V7DB 4K3JB 3A0FA 3PSCB 5HE3B 2CN3A 2AGZA 4L1QD 5H17A 4J77A 4A09A 2AGXA 4FB1D 2YNNA 5EAPA 4H5IA 1N6DA 3I8EA 1JMXB 3AL8B 4E54B 3CIKB 4X63B 5FKTA 3C9CA 3J81g 3L4MD 1JJUB 3GREA 4GMBA 3F3GA 2I0RA 2TRCB 4QQEA 5EMKB 4O1QD 3I7NA 2HKMA 4OZUA 4CY2A 3I7KA 3EI2B 3I7HA 5A2Qg 3E0CA 4R7AB 2XU7A 2G99A 1GXRA 3C99A 4A0AA 4XEIC 5CXBB 4ZOYA 2H68A 1R5MA 4CZXA 2UZYB 3JROA 2PM9A 3OL2A 4O3UB 4OWRA 4A11B 5AMSA 4L3HD 1YFQA 3I7OA 3JPXA 4FAVD 2B5MA 4HDJA 3EI1A 2CE9A 3NVNA 3OTTA 4ZOVA 4JXMA 3SMRA 2H14A 3KRWB 3OKWA 4J79A 2HJ4A 2PBIB 3SBRA 5I5JA 3EI4A 4BL0A 3SWSD 3ZWLB 4CI2A 2J57G 2IAAA 2B4EA 2I3SA 3PXWD 4Y7RA 2B5LA 4ERQA 3C75H 4QT8A 4JD2C 4U7AA 3EWEA 3CFSB 3UVKA 3I7PA 3SBPA 4ZOZA 3AL8A 2YMUA 2AGWA 2OK4A 4X60B 3AL9A 2P9PC 1S4UX 4QL1A 4ERZA 4PC0A 3UVOA 4E5ZB 2AGLA 4O45A 3I8CA 2QXVA 1PBYB 5H14A 2H6KA 4LG9A 5EMMB 3UVLA 4O9DA 3RFGA 4Y5RD 3PVUB 5AFU3 5IT9g 1N6EA 5CYKA 3IIYA 3SCYA 4J86A 2Z2NA 3HFQA 3JZHA 1SHYB 3MKQA 5EALA 4GGCA 4CI8A 4TZ4A 3PXSD 2P9UC 2J55H 2IWKA 4BH6A 3OKYB 4L3GD 2CO0C 3N0DA 1PGUA 4J82A 4D6VA 4A0BA 3SBQA 3JB9L 4LGNA 1QNIA 3MXXA 3SN6B 4AOWA 5AJAA 3IJCA 3F3PA 2H6NA 5HYNB 5TEFA 1A0RB 2OJYA 4UI9R 4CY3A 2Z2OA 1XIPA 5C2VB 2CE8A 4PSXB 4GZ8A 3U4YA 5IC7A 1GP2B 4A08B 3P4FA 3JZNA 4J87A 2HXCA 3KRXB 3BWSA
chains in the Genus database with same CATH superfamily
4GM3A 5THAA 4QRJA 1TBGA 4A7JA 4E5ZA 5GMKn 4J84A 3V4PA 4CY5A 3DXKC 2P9NC 1UOOA 2VZ3A 2I0TA 5K1CC 1E8NA 3CFVA 4AN0A 1JTDB 4FA9D 5EARA 3UKUC 3MMYA 2PM7B 4WK2A 5E6UA 4FA1D 2VDKA 1P22A 3SFZA 3EI3A 2QC5A 2VDOA 3MUOA 1L0QA 4G1MA 4J73A 2QZPA 4ES0A 3FM0A 1GOFA 4J81A 2Z2PA 4IMMA 2H13A 5FKQA 2CO0A 3NIGA 4BCDA 5EAMA 1L5GA 5M5UA 4GQBB 1QFMA 3O4HA 3DXMC 3GD1I 4FAND 5FKRA 3BG0A 3PXTD 5FKSA 4NSXA 5EMLB 4UM8A 3IKOA 4PBYA 4G56B 3F3FA 4NENA 2P9SC 5IJ8E 1U8CA 1O6GA 4A09B 2H6QA 1OLZA 2GC7A 4E54A 4PNKB 5M5SA 2H47A 5HQGA 5HE2B 4FWWA 1GOHA 2UZXB 1E5TA 3MZLA 1BPOA 3VA6A 2H9PA 2XYIA 2CN2A 5CXCB 3FRXA 5FXYA 4CC9A 2J56H 1SQJA 3IUNA 4JSNC 4NC4A 4A08A 4IRZA 2IURA 2B5NA 4JSPC 3RN1D 3RSEC 4PXWA 2HYEA 1GG2B 4GQ1A 3W15A 3EI2A 4DNVA 3EU7A 4O2WA 3RN0D 5I5IA 5CXBA 3FCUA 1B9XA 3SJLD 3IJ1A 4A0AB 5TF2A 3AH8B 4A11A 5EMJB 4PBZA 5M5TA 2XE4A 3NVQA 3ULEC 2H3XA 2I3TA 2MTAH 2PM9B 1E8MA 3O4GA 1VE6A 3OL2B 5FA5B 3J80g 3K27A 5C9ZB 2I0SA 3DDUA 2P9IC 1VYHC 3AFCA 2AH0A 3OKTA 5B4WA 2BCJB 2EBSA 1ERJA 4O02A 3VH0A 3SVWD 5KDOB 1K8KC 2GNQA 3I7LA 4ZN4A 4MMZA 3IJ0A 4Z8LA 5SXMA 3RFHA 4CZYA 5C2WB 4ESGA 2EIDA 3I2NA 4BP9A 3EI4B 4D0KA 1H2YA 1T2XA 4L9OA 2YB8B 3IUMA 4JSXC 2GC4A 2OK6A 2EICA 4J0XA 4EWRA 4FA5D 2XL2A 3DM0A 5TDHB 4U1EI 2PM6B 4WK4A 4N14A 4K3ID 4NAAA 5HE1B 3PVWB 4GGAA 1YR2A 4LG8A 4BP8A 1U4CA 2YBAA 3ORVD 5GSAA 2AGYA 3UR4A 2HKRA 5IGOA 3SHFA 3VI4A 4GM9A 4NBMA 1TYQC 5FQDA 1MG2A 3QI0A 4JHPC 4J0WA 5EM2B 2AH1A 1RI6A 5E6SA 1O6FA 3ZE0A 5CXCA 2VDMA 1MG3A 5IGQA 1GOTB 1OMWB 5FLXg 3RRMC 2HU5A 3IIWA 1GOGA 4YVDA 4CI3A 3B7FA 1K3IA 5H1MA 4BUJC 2O9KA 3V5WB 2VDRA 2HU8A 2YNPA 3BG1A 3EG6A 5M5RA 3UVNA 1B9YA 4FHLA 5CYKB 1U2VC 4WJKA 3IVMA 4GQ2P 4O3TB 5C92A 2IWFA 1JV2A 3V4VA 2H9NA 3OKYA 3ZDZA 2Q7QA 3GFCA 2BBKH 3FCSA 3ZDXA 1PEVA 2HESX 4MK0B 2H9LA 2AQ5A 2P9LC 4KFMB 3DSMA 3QHYB 3EQ8A 5HE0B 4Z7QA 2IUVA 3JRPA 3OW8A 1H2ZA 4IA9A 3UKRC 4GGDA 5IJ7E 4A2MA 4XYHA 3VGZA 4JT6C 4JT5C 4A0BB 4DNWA 2YNOA 3I89A 1SQ9A 5GXHA 4Z7NA 4CI1A 2P9KC 3T3PA 1NR0A 1Q47A 3MZKA 4FA4D 3RMZD 4GM8A 1JOFA 4AX4A 3V9FA 2XL3A 3K71A 1N6FA 2OVPB 2CNXA 3JZGA 3K26A 3RLMD 5HDBA 3NVXA 4J8BA 3IJEA 2EIBA 4BCCA 4JHNA 2QR5A 3SXTD 3ZE2A 3JAMg 2HJBA 2OIZA 3EMHA 5E6RA 3ODTA 3OF7A 5K19A 3SLED 5EM2A 5I5MA 3O4JA 4A2LA 2G9AA 5GXIA 4X3EA 4XYIA 2VDLA 4JSVC 2OVRB 4J78A 1XHMA 4AEZA 4X61B 1XKSA 3DWLC 3EI1B 3ZDYA 5FFGA 2XDWA 3MKSB 4J8GA 2OVQB 4I79A 2IUQA 3N0EA 3L4OD 3C5MA 3EI3B 2H9MA 4RE6A 4ERYA 4UM9A 2IUPA 4PSWB 3UVMA 1K32A 4ZOXA 1FWXA 5JWZA 4H5JA 3PE7A 3FGBA 1A12A 1JMZB 3IUJA 2W18A 1NEXB 2VDNA 3T3MA 5TEEA 4CY1A 1PI6A 4CZVA 3PSLA 1MDAH 3V7DB 4K3JB 3A0FA 3PSCB 5HE3B 2CN3A 2AGZA 4L1QD 4D9SA 5H17A 4J77A 4A09A 2AGXA 4FB1D 2YNNA 5EAPA 4H5IA 1N6DA 3I8EA 1JMXB 2XZGA 3AL8B 4E54B 3K6SA 3CIKB 2JKXA 4DNUA 4X63B 5FKTA 3C9CA 5M61A 3J81g 3L4MD 1JJUB 3GREA 4GMBA 3F3GA 2I0RA 2TRCB 4QQEA 5EMKB 4O1QD 3I7NA 2HKMA 4OZUA 4CY2A 3I7KA 3EI2B 3I7HA 5A2Qg 3E0CA 4R7AB 2VC2A 2XU7A 2G99A 1GXRA 3C99A 4A0AA 4XEIC 3MUNA 5CXBB 4ZOYA 2VZ1A 2H68A 1R5MA 4CZXA 2UZYB 3JROA 2PM9A 3OL2A 4O3UB 4OWRA 4A11B 5AMSA 3ZE1A 4QAMA 4L3HD 1H2XA 1YFQA 3I7OA 3JPXA 4FAVD 2B5MA 4HDJA 3EI1A 2CE9A 2HU7A 3NVNA 3OTTA 4L1MA 2VDPA 4ZOVA 4JXMA 3IUQA 3SMRA 2H14A 3KRWB 3OKWA 4J79A 2HJ4A 2PBIB 3SBRA 5I5JA 3EI4A 4BL0A 3K72A 3SWSD 3ZWLB 4AMZA 4CI2A 1C9LA 2J57G 1UOQA 2IAAA 2B4EA 2I3SA 3PXWD 1C9IA 4G1EA 1UOPA 4Y7RA 4BCBA 2B5LA 4ERQA 3VI3A 3C75H 4QT8A 4JD2C 3EQ9A 4U7AA 3GC3B 3EWEA 3CFSB 3UVKA 3I7PA 3O4IA 3SBPA 4ZOZA 3AL8A 2YMUA 2AGWA 2OK4A 4X60B 4MMYA 3AL9A 2P9PC 4Z7OA 1S4UX 4QL1A 4ERZA 4PC0A 3UVOA 4E5ZB 2AGLA 4O45A 3I8CA 2QXVA 3IULA 1PBYB 5H14A 2H6KA 4LG9A 5EMMB 2WQ8A 1TYEA 4O9DA 3UVLA 3RFGA 4Y5RD 3PVUB 5AFU3 4RE5A 5IT9g 1N6EA 1UTCA 5CYKA 3IIYA 3SCYA 4J86A 2Z2NA 3HFQA 1M1XA 3JZHA 1SHYB 3MKQA 5EALA 4GGCA 4CI8A 4TZ4A 3PXSD 2P9UC 2J55H 2IWKA 1H2WA 4BH6A 3OKYB 4L3GD 3MVDK 2EIEA 2CO0C 3N0DA 3EQ7A 4AMYA 1PGUA 2BKLA 4WK0A 4J82A 4D6VA 1VZ2A 4A0BA 3IURA 3KCIA 3SBQA 3JB9L 1QFSA 4LGNA 1QNIA 3MXXA 1I2MB 3SN6B 3NIFA 2VDQA 4AOWA 5AJAA 3IJCA 3F3PA 2H6NA 5HYNB 5TEFA 5M5VA 1A0RB 2OJYA 4UI9R 4CY3A 5C86A 2Z2OA 1XIPA 5C2VB 2CE8A 4AN1A 3NIDA 4GZ8A 4PSXB 3U4YA 5IC7A 1VE7A 1GP2B 4A08B 4MMXA 3P4FA 3JZNA 4J87A 5FFOA 2HXCA 3KRXB 1VZ3A 3BWSA 4G55A
chains in the Genus database with same CATH topology
4GM3A 5THAA 4QRJA 1TBGA 4A7JA 4E5ZA 5GMKn 4J84A 4CY5A 3DXKC 2P9NC 2I0TA 5K1CC 3CFVA 4FA9D 5EARA 3UKUC 3MMYA 2PM7B 4FA1D 1P22A 3SFZA 3EI3A 2QC5A 1L0QA 4J73A 4ES0A 3FM0A 4J81A 2Z2PA 4IMMA 2H13A 5FKQA 2CO0A 5EAMA 4GQBB 3DXMC 4FAND 5FKRA 3BG0A 3PXTD 5FKSA 4NSXA 5EMLB 3IKOA 4PBYA 4G56B 3F3FA 2P9SC 5IJ8E 4A09B 2H6QA 1OLZA 2GC7A 4E54A 4PNKB 2H47A 5HQGA 5HE2B 4FWWA 2UZXB 3MZLA 3VA6A 2H9PA 2XYIA 2CN2A 5CXCB 3FRXA 5FXYA 4CC9A 2J56H 1SQJA 4JSNC 4A08A 2IURA 2B5NA 4JSPC 3RN1D 3RSEC 4PXWA 2HYEA 1GG2B 4GQ1A 3W15A 3EI2A 3EU7A 3RN0D 5I5IA 5CXBA 1B9XA 3SJLD 3IJ1A 4A0AB 5TF2A 3AH8B 4A11A 5EMJB 4PBZA 3NVQA 3ULEC 2H3XA 2I3TA 2MTAH 3OL2B 2PM9B 5FA5B 3J80g 3K27A 5C9ZB 2I0SA 2P9IC 1VYHC 3AFCA 2AH0A 3OKTA 5B4WA 2BCJB 2EBSA 1ERJA 3VH0A 3SVWD 5KDOB 1K8KC 2GNQA 3I7LA 4ZN4A 3IJ0A 4Z8LA 5SXMA 3RFHA 4CZYA 5C2WB 4ESGA 3I2NA 3EI4B 4D0KA 4L9OA 2YB8B 4JSXC 2GC4A 2OK6A 4J0XA 4EWRA 4FA5D 2XL2A 3DM0A 5TDHB 4U1EI 2PM6B 4N14A 4K3ID 5HE1B 3PVWB 4GGAA 4LG8A 1U4CA 2YBAA 3ORVD 5GSAA 2AGYA 3UR4A 2HKRA 5IGOA 3SHFA 4GM9A 5FQDA 1TYQC 1MG2A 4J0WA 5EM2B 2AH1A 1RI6A 5CXCA 1MG3A 5IGQA 1GOTB 1OMWB 5FLXg 3RRMC 3IIWA 4YVDA 4CI3A 3B7FA 5H1MA 4BUJC 2O9KA 3V5WB 2YNPA 3BG1A 3EG6A 3UVNA 1B9YA 4FHLA 5CYKB 1U2VC 4GQ2P 4O3TB 2IWFA 2H9NA 3OKYA 2Q7QA 3GFCA 2BBKH 1PEVA 2HESX 4MK0B 2H9LA 2AQ5A 2P9LC 4KFMB 3DSMA 5HE0B 2IUVA 3JRPA 3OW8A 4IA9A 3UKRC 4GGDA 5IJ7E 4A2MA 4XYHA 3VGZA 4JT6C 4JT5C 4A0BB 2YNOA 3I89A 1SQ9A 5GXHA 4CI1A 2P9KC 1NR0A 1Q47A 3MZKA 4FA4D 3RMZD 4GM8A 1JOFA 3V9FA 2XL3A 1N6FA 2OVPB 2CNXA 3JZGA 3K26A 3RLMD 3NVXA 4J8BA 3SXTD 3JAMg 2HJBA 2OIZA 3EMHA 3ODTA 5K19A 3SLED 5EM2A 5I5MA 4A2LA 2G9AA 5GXIA 4X3EA 4XYIA 4JSVC 2OVRB 4J78A 1XHMA 4AEZA 4X61B 1XKSA 3DWLC 3EI1B 3MKSB 4J8GA 2OVQB 4I79A 2IUQA 3N0EA 3L4OD 3C5MA 3EI3B 2H9MA 4ERYA 3UVMA 2IUPA 4PSWB 5JWZA 1K32A 4ZOXA 1FWXA 4H5JA 3PE7A 3FGBA 1JMZB 2W18A 1NEXB 5TEEA 4CY1A 1PI6A 4CZVA 3PSLA 1MDAH 3V7DB 4K3JB 3A0FA 3PSCB 5HE3B 2CN3A 2AGZA 4L1QD 5H17A 4J77A 4A09A 2AGXA 4FB1D 2YNNA 5EAPA 4H5IA 1N6DA 3I8EA 1JMXB 3AL8B 4E54B 3CIKB 4X63B 5FKTA 3C9CA 3J81g 3L4MD 1JJUB 3GREA 4GMBA 3F3GA 2I0RA 2TRCB 4QQEA 5EMKB 4O1QD 3I7NA 2HKMA 4OZUA 4CY2A 3I7KA 3EI2B 3I7HA 5A2Qg 3E0CA 4R7AB 2XU7A 2G99A 1GXRA 3C99A 4A0AA 4XEIC 5CXBB 4ZOYA 2H68A 1R5MA 4CZXA 2UZYB 3JROA 2PM9A 3OL2A 4O3UB 4OWRA 4A11B 5AMSA 4L3HD 1YFQA 3I7OA 3JPXA 4FAVD 2B5MA 4HDJA 3EI1A 2CE9A 3NVNA 3OTTA 4ZOVA 4JXMA 3SMRA 2H14A 3KRWB 3OKWA 4J79A 2HJ4A 2PBIB 3SBRA 5I5JA 3EI4A 4BL0A 3SWSD 3ZWLB 4CI2A 2J57G 2IAAA 2B4EA 2I3SA 3PXWD 4Y7RA 2B5LA 4ERQA 3C75H 4QT8A 4JD2C 4U7AA 3EWEA 3CFSB 3UVKA 3I7PA 3SBPA 4ZOZA 3AL8A 2YMUA 2AGWA 2OK4A 4X60B 3AL9A 2P9PC 1S4UX 4QL1A 4ERZA 4PC0A 3UVOA 4E5ZB 2AGLA 4O45A 3I8CA 2QXVA 1PBYB 5H14A 2H6KA 4LG9A 5EMMB 3UVLA 4O9DA 3RFGA 4Y5RD 3PVUB 5AFU3 5IT9g 1N6EA 5CYKA 3IIYA 3SCYA 4J86A 2Z2NA 3HFQA 3JZHA 1SHYB 3MKQA 5EALA 4GGCA 4CI8A 4TZ4A 3PXSD 2P9UC 2J55H 2IWKA 4BH6A 3OKYB 4L3GD 2CO0C 3N0DA 1PGUA 4J82A 4D6VA 4A0BA 3SBQA 3JB9L 4LGNA 1QNIA 3MXXA 3SN6B 4AOWA 5AJAA 3IJCA 3F3PA 2H6NA 5HYNB 5TEFA 1A0RB 2OJYA 4UI9R 4CY3A 2Z2OA 1XIPA 5C2VB 2CE8A 4PSXB 4GZ8A 3U4YA 5IC7A 1GP2B 4A08B 3P4FA 3JZNA 4J87A 2HXCA 3KRXB 3BWSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GM3 A;  5THA A;  4QRJ A;  1TBG A;  4A7J A;  4E5Z A;  5GMK n;  4J84 A;  4CY5 A;  3DXK C;  2P9N C;  2I0T A;  5K1C C;  3CFV A;  4FA9 D;  5EAR A;  3UKU C;  3MMY A;  2PM7 B;  4FA1 D;  1P22 A;  3SFZ A;  3EI3 A;  2QC5 A;  1L0Q A;  4J73 A;  4ES0 A;  3FM0 A;  4J81 A;  2Z2P A;  4IMM A;  2H13 A;  5FKQ A;  2CO0 A;  5EAM A;  4GQB B;  3DXM C;  4FAN D;  5FKR A;  3BG0 A;  3PXT D;  5FKS A;  4NSX A;  5EML B;  3IKO A;  4PBY A;  4G56 B;  3F3F A;  2P9S C;  5IJ8 E;  4A09 B;  2H6Q A;  1OLZ A;  2GC7 A;  4E54 A;  4PNK B;  2H47 A;  5HQG A;  5HE2 B;  4FWW A;  2UZX B;  3MZL A;  3VA6 A;  2H9P A;  2XYI A;  2CN2 A;  5CXC B;  3FRX A;  5FXY A;  4CC9 A;  2J56 H;  1SQJ A;  4JSN C;  4A08 A;  2IUR A;  2B5N A;  4JSP C;  3RN1 D;  3RSE C;  4PXW A;  2HYE A;  1GG2 B;  4GQ1 A;  3W15 A;  3EI2 A;  3EU7 A;  3RN0 D;  5I5I A;  5CXB A;  1B9X A;  3SJL D;  3IJ1 A;  4A0A B;  5TF2 A;  3AH8 B;  4A11 A;  5EMJ B;  4PBZ A;  3NVQ A;  3ULE C;  2H3X A;  2I3T A;  2MTA H;  3OL2 B;  2PM9 B;  5FA5 B;  3J80 g;  3K27 A;  5C9Z B;  2I0S A;  2P9I C;  1VYH C;  3AFC A;  2AH0 A;  3OKT A;  5B4W A;  2BCJ B;  2EBS A;  1ERJ A;  3VH0 A;  3SVW D;  5KDO B;  1K8K C;  2GNQ A;  3I7L A;  4ZN4 A;  3IJ0 A;  4Z8L A;  5SXM A;  3RFH A;  4CZY A;  5C2W B;  4ESG A;  3I2N A;  3EI4 B;  4D0K A;  4L9O A;  2YB8 B;  4JSX C;  2GC4 A;  2OK6 A;  4J0X A;  4EWR A;  4FA5 D;  2XL2 A;  3DM0 A;  5TDH B;  4U1E I;  2PM6 B;  4N14 A;  4K3I D;  5HE1 B;  3PVW B;  4GGA A;  4LG8 A;  1U4C A;  2YBA A;  3ORV D;  5GSA A;  2AGY A;  3UR4 A;  2HKR A;  5IGO A;  3SHF A;  4GM9 A;  5FQD A;  1TYQ C;  1MG2 A;  4J0W A;  5EM2 B;  2AH1 A;  1RI6 A;  5CXC A;  1MG3 A;  5IGQ A;  1GOT B;  1OMW B;  5FLX g;  3RRM C;  3IIW A;  4YVD A;  4CI3 A;  3B7F A;  5H1M A;  4BUJ C;  2O9K A;  3V5W B;  2YNP A;  3BG1 A;  3EG6 A;  3UVN A;  1B9Y A;  4FHL A;  5CYK B;  1U2V C;  4GQ2 P;  4O3T B;  2IWF A;  2H9N A;  3OKY A;  2Q7Q A;  3GFC A;  2BBK H;  1PEV A;  2HES X;  4MK0 B;  2H9L A;  2AQ5 A;  2P9L C;  4KFM B;  3DSM A;  5HE0 B;  2IUV A;  3JRP A;  3OW8 A;  4IA9 A;  3UKR C;  4GGD A;  5IJ7 E;  4A2M A;  4XYH A;  3VGZ A;  4JT6 C;  4JT5 C;  4A0B B;  2YNO A;  3I89 A;  1SQ9 A;  5GXH A;  4CI1 A;  2P9K C;  1NR0 A;  1Q47 A;  3MZK A;  4FA4 D;  3RMZ D;  4GM8 A;  1JOF A;  3V9F A;  2XL3 A;  1N6F A;  2OVP B;  2CNX A;  3JZG A;  3K26 A;  3RLM D;  3NVX A;  4J8B A;  3SXT D;  3JAM g;  2HJB A;  2OIZ A;  3EMH A;  3ODT A;  5K19 A;  3SLE D;  5EM2 A;  5I5M A;  4A2L A;  2G9A A;  5GXI A;  4X3E A;  4XYI A;  4JSV C;  2OVR B;  4J78 A;  1XHM A;  4AEZ A;  4X61 B;  1XKS A;  3DWL C;  3EI1 B;  3MKS B;  4J8G A;  2OVQ B;  4I79 A;  2IUQ A;  3N0E A;  3L4O D;  3C5M A;  3EI3 B;  2H9M A;  4ERY A;  3UVM A;  2IUP A;  4PSW B;  5JWZ A;  1K32 A;  4ZOX A;  1FWX A;  4H5J A;  3PE7 A;  3FGB A;  1JMZ B;  2W18 A;  1NEX B;  5TEE A;  4CY1 A;  1PI6 A;  4CZV A;  3PSL A;  1MDA H;  3V7D B;  4K3J B;  3A0F A;  3PSC B;  5HE3 B;  2CN3 A;  2AGZ A;  4L1Q D;  5H17 A;  4J77 A;  4A09 A;  2AGX A;  4FB1 D;  2YNN A;  5EAP A;  4H5I A;  1N6D A;  3I8E A;  1JMX B;  3AL8 B;  4E54 B;  3CIK B;  4X63 B;  5FKT A;  3C9C A;  3J81 g;  3L4M D;  1JJU B;  3GRE A;  4GMB A;  3F3G A;  2I0R A;  2TRC B;  4QQE A;  5EMK B;  4O1Q D;  3I7N A;  2HKM A;  4OZU A;  4CY2 A;  3I7K A;  3EI2 B;  3I7H A;  5A2Q g;  3E0C A;  4R7A B;  2XU7 A;  2G99 A;  1GXR A;  3C99 A;  4A0A A;  4XEI C;  5CXB B;  4ZOY A;  2H68 A;  1R5M A;  4CZX A;  2UZY B;  3JRO A;  2PM9 A;  3OL2 A;  4O3U B;  4OWR A;  4A11 B;  5AMS A;  4L3H D;  1YFQ A;  3I7O A;  3JPX A;  4FAV D;  2B5M A;  4HDJ A;  3EI1 A;  2CE9 A;  3NVN A;  3OTT A;  4ZOV A;  4JXM A;  3SMR A;  2H14 A;  3KRW B;  3OKW A;  4J79 A;  2HJ4 A;  2PBI B;  3SBR A;  5I5J A;  3EI4 A;  4BL0 A;  3SWS D;  3ZWL B;  4CI2 A;  2J57 G;  2IAA A;  2B4E A;  2I3S A;  3PXW D;  4Y7R A;  2B5L A;  4ERQ A;  3C75 H;  4QT8 A;  4JD2 C;  4U7A A;  3EWE A;  3CFS B;  3UVK A;  3I7P A;  3SBP A;  4ZOZ A;  3AL8 A;  2YMU A;  2AGW A;  2OK4 A;  4X60 B;  3AL9 A;  2P9P C;  1S4U X;  4QL1 A;  4ERZ A;  4PC0 A;  3UVO A;  4E5Z B;  2AGL A;  4O45 A;  3I8C A;  2QXV A;  1PBY B;  5H14 A;  2H6K A;  4LG9 A;  5EMM B;  3UVL A;  4O9D A;  3RFG A;  4Y5R D;  3PVU B;  5AFU 3;  5IT9 g;  1N6E A;  5CYK A;  3IIY A;  3SCY A;  4J86 A;  2Z2N A;  3HFQ A;  3JZH A;  1SHY B;  3MKQ A;  5EAL A;  4GGC A;  4CI8 A;  4TZ4 A;  3PXS D;  2P9U C;  2J55 H;  2IWK A;  4BH6 A;  3OKY B;  4L3G D;  2CO0 C;  3N0D A;  1PGU A;  4J82 A;  4D6V A;  4A0B A;  3SBQ A;  3JB9 L;  4LGN A;  1QNI A;  3MXX A;  3SN6 B;  4AOW A;  5AJA A;  3IJC A;  3F3P A;  2H6N A;  5HYN B;  5TEF A;  1A0R B;  2OJY A;  4UI9 R;  4CY3 A;  2Z2O A;  1XIP A;  5C2V B;  2CE8 A;  4PSX B;  4GZ8 A;  3U4Y A;  5IC7 A;  1GP2 B;  4A08 B;  3P4F A;  3JZN A;  4J87 A;  2HXC A;  3KRX B;  3BWS A; 
#chains in the Genus database with same CATH topology
 4GM3 A;  5THA A;  4QRJ A;  1TBG A;  4A7J A;  4E5Z A;  5GMK n;  4J84 A;  3V4P A;  4CY5 A;  3DXK C;  2P9N C;  1UOO A;  2VZ3 A;  2I0T A;  5K1C C;  1E8N A;  3CFV A;  4AN0 A;  1JTD B;  4FA9 D;  5EAR A;  3UKU C;  3MMY A;  2PM7 B;  4WK2 A;  5E6U A;  4FA1 D;  2VDK A;  1P22 A;  3SFZ A;  3EI3 A;  2QC5 A;  2VDO A;  3MUO A;  1L0Q A;  4G1M A;  4J73 A;  2QZP A;  4ES0 A;  3FM0 A;  1GOF A;  4J81 A;  2Z2P A;  4IMM A;  2H13 A;  5FKQ A;  2CO0 A;  3NIG A;  4BCD A;  5EAM A;  1L5G A;  5M5U A;  4GQB B;  1QFM A;  3O4H A;  3DXM C;  3GD1 I;  4FAN D;  5FKR A;  3BG0 A;  3PXT D;  5FKS A;  4NSX A;  5EML B;  4UM8 A;  3IKO A;  4PBY A;  4G56 B;  3F3F A;  4NEN A;  2P9S C;  5IJ8 E;  1U8C A;  1O6G A;  4A09 B;  2H6Q A;  1OLZ A;  2GC7 A;  4E54 A;  4PNK B;  5M5S A;  2H47 A;  5HQG A;  5HE2 B;  4FWW A;  1GOH A;  2UZX B;  1E5T A;  3MZL A;  1BPO A;  3VA6 A;  2H9P A;  2XYI A;  2CN2 A;  5CXC B;  3FRX A;  5FXY A;  4CC9 A;  2J56 H;  1SQJ A;  3IUN A;  4JSN C;  4NC4 A;  4A08 A;  4IRZ A;  2IUR A;  2B5N A;  4JSP C;  3RN1 D;  3RSE C;  4PXW A;  2HYE A;  1GG2 B;  4GQ1 A;  3W15 A;  3EI2 A;  4DNV A;  3EU7 A;  4O2W A;  3RN0 D;  5I5I A;  5CXB A;  3FCU A;  1B9X A;  3SJL D;  3IJ1 A;  4A0A B;  5TF2 A;  3AH8 B;  4A11 A;  5EMJ B;  4PBZ A;  5M5T A;  2XE4 A;  3NVQ A;  3ULE C;  2H3X A;  2I3T A;  2MTA H;  2PM9 B;  1E8M A;  3O4G A;  1VE6 A;  3OL2 B;  5FA5 B;  3J80 g;  3K27 A;  5C9Z B;  2I0S A;  3DDU A;  2P9I C;  1VYH C;  3AFC A;  2AH0 A;  3OKT A;  5B4W A;  2BCJ B;  2EBS A;  1ERJ A;  4O02 A;  3VH0 A;  3SVW D;  5KDO B;  1K8K C;  2GNQ A;  3I7L A;  4ZN4 A;  4MMZ A;  3IJ0 A;  4Z8L A;  5SXM A;  3RFH A;  4CZY A;  5C2W B;  4ESG A;  2EID A;  3I2N A;  4BP9 A;  3EI4 B;  4D0K A;  1H2Y A;  1T2X A;  4L9O A;  2YB8 B;  3IUM A;  4JSX C;  2GC4 A;  2OK6 A;  2EIC A;  4J0X A;  4EWR A;  4FA5 D;  2XL2 A;  3DM0 A;  5TDH B;  4U1E I;  2PM6 B;  4WK4 A;  4N14 A;  4K3I D;  4NAA A;  5HE1 B;  3PVW B;  4GGA A;  1YR2 A;  4LG8 A;  4BP8 A;  1U4C A;  2YBA A;  3ORV D;  5GSA A;  2AGY A;  3UR4 A;  2HKR A;  5IGO A;  3SHF A;  3VI4 A;  4GM9 A;  4NBM A;  1TYQ C;  5FQD A;  1MG2 A;  3QI0 A;  4JHP C;  4J0W A;  5EM2 B;  2AH1 A;  1RI6 A;  5E6S A;  1O6F A;  3ZE0 A;  5CXC A;  2VDM A;  1MG3 A;  5IGQ A;  1GOT B;  1OMW B;  5FLX g;  3RRM C;  2HU5 A;  3IIW A;  1GOG A;  4YVD A;  4CI3 A;  3B7F A;  1K3I A;  5H1M A;  4BUJ C;  2O9K A;  3V5W B;  2VDR A;  2HU8 A;  2YNP A;  3BG1 A;  3EG6 A;  5M5R A;  3UVN A;  1B9Y A;  4FHL A;  5CYK B;  1U2V C;  4WJK A;  3IVM A;  4GQ2 P;  4O3T B;  5C92 A;  2IWF A;  1JV2 A;  3V4V A;  2H9N A;  3OKY A;  3ZDZ A;  2Q7Q A;  3GFC A;  2BBK H;  3FCS A;  3ZDX A;  1PEV A;  2HES X;  4MK0 B;  2H9L A;  2AQ5 A;  2P9L C;  4KFM B;  3DSM A;  3QHY B;  3EQ8 A;  5HE0 B;  4Z7Q A;  2IUV A;  3JRP A;  3OW8 A;  1H2Z A;  4IA9 A;  3UKR C;  4GGD A;  5IJ7 E;  4A2M A;  4XYH A;  3VGZ A;  4JT6 C;  4JT5 C;  4A0B B;  4DNW A;  2YNO A;  3I89 A;  1SQ9 A;  5GXH A;  4Z7N A;  4CI1 A;  2P9K C;  3T3P A;  1NR0 A;  1Q47 A;  3MZK A;  4FA4 D;  3RMZ D;  4GM8 A;  1JOF A;  4AX4 A;  3V9F A;  2XL3 A;  3K71 A;  1N6F A;  2OVP B;  2CNX A;  3JZG A;  3K26 A;  3RLM D;  5HDB A;  3NVX A;  4J8B A;  3IJE A;  2EIB A;  4BCC A;  4JHN A;  2QR5 A;  3SXT D;  3ZE2 A;  3JAM g;  2HJB A;  2OIZ A;  3EMH A;  5E6R A;  3ODT A;  3OF7 A;  5K19 A;  3SLE D;  5EM2 A;  5I5M A;  3O4J A;  4A2L A;  2G9A A;  5GXI A;  4X3E A;  4XYI A;  2VDL A;  4JSV C;  2OVR B;  4J78 A;  1XHM A;  4AEZ A;  4X61 B;  1XKS A;  3DWL C;  3EI1 B;  3ZDY A;  5FFG A;  2XDW A;  3MKS B;  4J8G A;  2OVQ B;  4I79 A;  2IUQ A;  3N0E A;  3L4O D;  3C5M A;  3EI3 B;  2H9M A;  4RE6 A;  4ERY A;  4UM9 A;  2IUP A;  4PSW B;  3UVM A;  1K32 A;  4ZOX A;  1FWX A;  5JWZ A;  4H5J A;  3PE7 A;  3FGB A;  1A12 A;  1JMZ B;  3IUJ A;  2W18 A;  1NEX B;  2VDN A;  3T3M A;  5TEE A;  4CY1 A;  1PI6 A;  4CZV A;  3PSL A;  1MDA H;  3V7D B;  4K3J B;  3A0F A;  3PSC B;  5HE3 B;  2CN3 A;  2AGZ A;  4L1Q D;  4D9S A;  5H17 A;  4J77 A;  4A09 A;  2AGX A;  4FB1 D;  2YNN A;  5EAP A;  4H5I A;  1N6D A;  3I8E A;  1JMX B;  2XZG A;  3AL8 B;  4E54 B;  3K6S A;  3CIK B;  2JKX A;  4DNU A;  4X63 B;  5FKT A;  3C9C A;  5M61 A;  3J81 g;  3L4M D;  1JJU B;  3GRE A;  4GMB A;  3F3G A;  2I0R A;  2TRC B;  4QQE A;  5EMK B;  4O1Q D;  3I7N A;  2HKM A;  4OZU A;  4CY2 A;  3I7K A;  3EI2 B;  3I7H A;  5A2Q g;  3E0C A;  4R7A B;  2VC2 A;  2XU7 A;  2G99 A;  1GXR A;  3C99 A;  4A0A A;  4XEI C;  3MUN A;  5CXB B;  4ZOY A;  2VZ1 A;  2H68 A;  1R5M A;  4CZX A;  2UZY B;  3JRO A;  2PM9 A;  3OL2 A;  4O3U B;  4OWR A;  4A11 B;  5AMS A;  3ZE1 A;  4QAM A;  4L3H D;  1H2X A;  1YFQ A;  3I7O A;  3JPX A;  4FAV D;  2B5M A;  4HDJ A;  3EI1 A;  2CE9 A;  2HU7 A;  3NVN A;  3OTT A;  4L1M A;  2VDP A;  4ZOV A;  4JXM A;  3IUQ A;  3SMR A;  2H14 A;  3KRW B;  3OKW A;  4J79 A;  2HJ4 A;  2PBI B;  3SBR A;  5I5J A;  3EI4 A;  4BL0 A;  3K72 A;  3SWS D;  3ZWL B;  4AMZ A;  4CI2 A;  1C9L A;  2J57 G;  1UOQ A;  2IAA A;  2B4E A;  2I3S A;  3PXW D;  1C9I A;  4G1E A;  1UOP A;  4Y7R A;  4BCB A;  2B5L A;  4ERQ A;  3VI3 A;  3C75 H;  4QT8 A;  4JD2 C;  3EQ9 A;  4U7A A;  3GC3 B;  3EWE A;  3CFS B;  3UVK A;  3I7P A;  3O4I A;  3SBP A;  4ZOZ A;  3AL8 A;  2YMU A;  2AGW A;  2OK4 A;  4X60 B;  4MMY A;  3AL9 A;  2P9P C;  4Z7O A;  1S4U X;  4QL1 A;  4ERZ A;  4PC0 A;  3UVO A;  4E5Z B;  2AGL A;  4O45 A;  3I8C A;  2QXV A;  3IUL A;  1PBY B;  5H14 A;  2H6K A;  4LG9 A;  5EMM B;  2WQ8 A;  1TYE A;  4O9D A;  3UVL A;  3RFG A;  4Y5R D;  3PVU B;  5AFU 3;  4RE5 A;  5IT9 g;  1N6E A;  1UTC A;  5CYK A;  3IIY A;  3SCY A;  4J86 A;  2Z2N A;  3HFQ A;  1M1X A;  3JZH A;  1SHY B;  3MKQ A;  5EAL A;  4GGC A;  4CI8 A;  4TZ4 A;  3PXS D;  2P9U C;  2J55 H;  2IWK A;  1H2W A;  4BH6 A;  3OKY B;  4L3G D;  3MVD K;  2EIE A;  2CO0 C;  3N0D A;  3EQ7 A;  4AMY A;  1PGU A;  2BKL A;  4WK0 A;  4J82 A;  4D6V A;  1VZ2 A;  4A0B A;  3IUR A;  3KCI A;  3SBQ A;  3JB9 L;  1QFS A;  4LGN A;  1QNI A;  3MXX A;  1I2M B;  3SN6 B;  3NIF A;  2VDQ A;  4AOW A;  5AJA A;  3IJC A;  3F3P A;  2H6N A;  5HYN B;  5TEF A;  5M5V A;  1A0R B;  2OJY A;  4UI9 R;  4CY3 A;  5C86 A;  2Z2O A;  1XIP A;  5C2V B;  2CE8 A;  4AN1 A;  3NID A;  4GZ8 A;  4PSX B;  3U4Y A;  5IC7 A;  1VE7 A;  1GP2 B;  4A08 B;  4MMX A;  3P4F A;  3JZN A;  4J87 A;  5FFO A;  2HXC A;  3KRX B;  1VZ3 A;  3BWS A;  4G55 A; 
#chains in the Genus database with same CATH homology
 4GM3 A;  5THA A;  4QRJ A;  1TBG A;  4A7J A;  4E5Z A;  5GMK n;  4J84 A;  4CY5 A;  3DXK C;  2P9N C;  2I0T A;  5K1C C;  3CFV A;  4FA9 D;  5EAR A;  3UKU C;  3MMY A;  2PM7 B;  4FA1 D;  1P22 A;  3SFZ A;  3EI3 A;  2QC5 A;  1L0Q A;  4J73 A;  4ES0 A;  3FM0 A;  4J81 A;  2Z2P A;  4IMM A;  2H13 A;  5FKQ A;  2CO0 A;  5EAM A;  4GQB B;  3DXM C;  4FAN D;  5FKR A;  3BG0 A;  3PXT D;  5FKS A;  4NSX A;  5EML B;  3IKO A;  4PBY A;  4G56 B;  3F3F A;  2P9S C;  5IJ8 E;  4A09 B;  2H6Q A;  1OLZ A;  2GC7 A;  4E54 A;  4PNK B;  2H47 A;  5HQG A;  5HE2 B;  4FWW A;  2UZX B;  3MZL A;  3VA6 A;  2H9P A;  2XYI A;  2CN2 A;  5CXC B;  3FRX A;  5FXY A;  4CC9 A;  2J56 H;  1SQJ A;  4JSN C;  4A08 A;  2IUR A;  2B5N A;  4JSP C;  3RN1 D;  3RSE C;  4PXW A;  2HYE A;  1GG2 B;  4GQ1 A;  3W15 A;  3EI2 A;  3EU7 A;  3RN0 D;  5I5I A;  5CXB A;  1B9X A;  3SJL D;  3IJ1 A;  4A0A B;  5TF2 A;  3AH8 B;  4A11 A;  5EMJ B;  4PBZ A;  3NVQ A;  3ULE C;  2H3X A;  2I3T A;  2MTA H;  3OL2 B;  2PM9 B;  5FA5 B;  3J80 g;  3K27 A;  5C9Z B;  2I0S A;  2P9I C;  1VYH C;  3AFC A;  2AH0 A;  3OKT A;  5B4W A;  2BCJ B;  2EBS A;  1ERJ A;  3VH0 A;  3SVW D;  5KDO B;  1K8K C;  2GNQ A;  3I7L A;  4ZN4 A;  3IJ0 A;  4Z8L A;  5SXM A;  3RFH A;  4CZY A;  5C2W B;  4ESG A;  3I2N A;  3EI4 B;  4D0K A;  4L9O A;  2YB8 B;  4JSX C;  2GC4 A;  2OK6 A;  4J0X A;  4EWR A;  4FA5 D;  2XL2 A;  3DM0 A;  5TDH B;  4U1E I;  2PM6 B;  4N14 A;  4K3I D;  5HE1 B;  3PVW B;  4GGA A;  4LG8 A;  1U4C A;  2YBA A;  3ORV D;  5GSA A;  2AGY A;  3UR4 A;  2HKR A;  5IGO A;  3SHF A;  4GM9 A;  5FQD A;  1TYQ C;  1MG2 A;  4J0W A;  5EM2 B;  2AH1 A;  1RI6 A;  5CXC A;  1MG3 A;  5IGQ A;  1GOT B;  1OMW B;  5FLX g;  3RRM C;  3IIW A;  4YVD A;  4CI3 A;  3B7F A;  5H1M A;  4BUJ C;  2O9K A;  3V5W B;  2YNP A;  3BG1 A;  3EG6 A;  3UVN A;  1B9Y A;  4FHL A;  5CYK B;  1U2V C;  4GQ2 P;  4O3T B;  2IWF A;  2H9N A;  3OKY A;  2Q7Q A;  3GFC A;  2BBK H;  1PEV A;  2HES X;  4MK0 B;  2H9L A;  2AQ5 A;  2P9L C;  4KFM B;  3DSM A;  5HE0 B;  2IUV A;  3JRP A;  3OW8 A;  4IA9 A;  3UKR C;  4GGD A;  5IJ7 E;  4A2M A;  4XYH A;  3VGZ A;  4JT6 C;  4JT5 C;  4A0B B;  2YNO A;  3I89 A;  1SQ9 A;  5GXH A;  4CI1 A;  2P9K C;  1NR0 A;  1Q47 A;  3MZK A;  4FA4 D;  3RMZ D;  4GM8 A;  1JOF A;  3V9F A;  2XL3 A;  1N6F A;  2OVP B;  2CNX A;  3JZG A;  3K26 A;  3RLM D;  3NVX A;  4J8B A;  3SXT D;  3JAM g;  2HJB A;  2OIZ A;  3EMH A;  3ODT A;  5K19 A;  3SLE D;  5EM2 A;  5I5M A;  4A2L A;  2G9A A;  5GXI A;  4X3E A;  4XYI A;  4JSV C;  2OVR B;  4J78 A;  1XHM A;  4AEZ A;  4X61 B;  1XKS A;  3DWL C;  3EI1 B;  3MKS B;  4J8G A;  2OVQ B;  4I79 A;  2IUQ A;  3N0E A;  3L4O D;  3C5M A;  3EI3 B;  2H9M A;  4ERY A;  3UVM A;  2IUP A;  4PSW B;  5JWZ A;  1K32 A;  4ZOX A;  1FWX A;  4H5J A;  3PE7 A;  3FGB A;  1JMZ B;  2W18 A;  1NEX B;  5TEE A;  4CY1 A;  1PI6 A;  4CZV A;  3PSL A;  1MDA H;  3V7D B;  4K3J B;  3A0F A;  3PSC B;  5HE3 B;  2CN3 A;  2AGZ A;  4L1Q D;  5H17 A;  4J77 A;  4A09 A;  2AGX A;  4FB1 D;  2YNN A;  5EAP A;  4H5I A;  1N6D A;  3I8E A;  1JMX B;  3AL8 B;  4E54 B;  3CIK B;  4X63 B;  5FKT A;  3C9C A;  3J81 g;  3L4M D;  1JJU B;  3GRE A;  4GMB A;  3F3G A;  2I0R A;  2TRC B;  4QQE A;  5EMK B;  4O1Q D;  3I7N A;  2HKM A;  4OZU A;  4CY2 A;  3I7K A;  3EI2 B;  3I7H A;  5A2Q g;  3E0C A;  4R7A B;  2XU7 A;  2G99 A;  1GXR A;  3C99 A;  4A0A A;  4XEI C;  5CXB B;  4ZOY A;  2H68 A;  1R5M A;  4CZX A;  2UZY B;  3JRO A;  2PM9 A;  3OL2 A;  4O3U B;  4OWR A;  4A11 B;  5AMS A;  4L3H D;  1YFQ A;  3I7O A;  3JPX A;  4FAV D;  2B5M A;  4HDJ A;  3EI1 A;  2CE9 A;  3NVN A;  3OTT A;  4ZOV A;  4JXM A;  3SMR A;  2H14 A;  3KRW B;  3OKW A;  4J79 A;  2HJ4 A;  2PBI B;  3SBR A;  5I5J A;  3EI4 A;  4BL0 A;  3SWS D;  3ZWL B;  4CI2 A;  2J57 G;  2IAA A;  2B4E A;  2I3S A;  3PXW D;  4Y7R A;  2B5L A;  4ERQ A;  3C75 H;  4QT8 A;  4JD2 C;  4U7A A;  3EWE A;  3CFS B;  3UVK A;  3I7P A;  3SBP A;  4ZOZ A;  3AL8 A;  2YMU A;  2AGW A;  2OK4 A;  4X60 B;  3AL9 A;  2P9P C;  1S4U X;  4QL1 A;  4ERZ A;  4PC0 A;  3UVO A;  4E5Z B;  2AGL A;  4O45 A;  3I8C A;  2QXV A;  1PBY B;  5H14 A;  2H6K A;  4LG9 A;  5EMM B;  3UVL A;  4O9D A;  3RFG A;  4Y5R D;  3PVU B;  5AFU 3;  5IT9 g;  1N6E A;  5CYK A;  3IIY A;  3SCY A;  4J86 A;  2Z2N A;  3HFQ A;  3JZH A;  1SHY B;  3MKQ A;  5EAL A;  4GGC A;  4CI8 A;  4TZ4 A;  3PXS D;  2P9U C;  2J55 H;  2IWK A;  4BH6 A;  3OKY B;  4L3G D;  2CO0 C;  3N0D A;  1PGU A;  4J82 A;  4D6V A;  4A0B A;  3SBQ A;  3JB9 L;  4LGN A;  1QNI A;  3MXX A;  3SN6 B;  4AOW A;  5AJA A;  3IJC A;  3F3P A;  2H6N A;  5HYN B;  5TEF A;  1A0R B;  2OJY A;  4UI9 R;  4CY3 A;  2Z2O A;  1XIP A;  5C2V B;  2CE8 A;  4PSX B;  4GZ8 A;  3U4Y A;  5IC7 A;  1GP2 B;  4A08 B;  3P4F A;  3JZN A;  4J87 A;  2HXC A;  3KRX B;  3BWS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...