2YNNA

Yeast betaprime cop 1-304 with ktktn motif
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
300
structure length
300
Chain Sequence
b'KLDIKKTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVELWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLSLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COATOMER SUBUNIT BETA'
publication title Molecular Basis for Recognition of Dilysine Trafficking Motifs by Copi.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 90
structure length 300
sequence length 300
ec nomenclature
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ynnA01
1XIPA 3SBQA 2I0RA 3AL8A 2P9LC 4ESGA 4CI2A 3A0FA 4CY5A 5THAA 3AL9A 5B4WA 2O9KA 4UI9R 4CZVA 2CN2A 3SN6B 2UZXB 3GFCA 3SBPA 1L0QA 4H5IA 3MZLA 3NVQA 2XL3A 5KDOB 1GOTB 5EAPA 1FWXA 3OKWA 4A7JA 2OK6A 4L3HD 5FLXg 3DSMA 1P22A 1U2VC 4FAVD 2OJYA 3C5MA 4O3UB 2P9SC 2H9PA 2H6NA 2P9UC 4L9OA 3I7NA 2AGWA 4KFMB 1B9XA 3N0DA 4Y7RA 4CI8A 3I8CA 4QL1A 5EMJB 3IJCA 2HKRA 3I7OA 3F3FA 2PM7B 3JZHA 3BG1A 4E5ZA 4E54B 3JAMg 2IUQA 3U4YA 2CN3A 1JJUB 3SLED 5CYKA 4ERYA 1QNIA 3EI4A 4FWWA 4GGDA 4JT5C 4G56B 2B4EA 3ODTA 3SFZA 4CY3A 5GXHA 4QT8A 1R5MA 4QQEA 3FM0A 3I2NA 5CXBA 4QRJA 2MTAH 2H9MA 3DWLC 2YNPA 2I3TA 1JOFA 4FAND 5AFU3 4NSXA 5EM2A 2Z2NA 5EARA 5IC7A 3UVOA 4GGAA 1SQJA 4XYHA 4GM9A 3VA6A 4YVDA 3JPXA 2H6QA 3GREA 3MKSB 3BWSA 4J86A 4GQBB 3P4FA 4X60B 4X61B 3EI1B 4JSXC 3JB9L 3L4OD 4J82A 1K8KC 3EU7A 4A0BA 3KRXB 1N6DA 3RFHA 4PSXB 4PXWA 5FXYA 2Z2PA 1MG3A 5H1MA 2BCJB 2PM9B 2XU7A 1XHMA 1Q47A 4J73A 2GC4A 3PE7A 3C99A 3SCYA 2AGLA 4OWRA 5IGQA 5EALA 3F3GA 3OL2A 3I8EA 3CFVA 2PM6B 1A0RB 4JSPC 4JSNC 4R7AB 4L3GD 4GMBA 5C9ZB 1VYHC 2I0SA 4J0WA 2H13A 4L1QD 3CIKB 2HJBA 1YFQA 4A2LA 4BH6A 2P9IC 5FQDA 2PBIB 4GM8A 4GZ8A 2H6KA 5IT9g 4FA9D 3AL8B 3ULEC 4X63B 3PXTD 1GXRA 1S4UX 3EG6A 2HJ4A 2EBSA 5C2VB 3AFCA 2B5NA 1JMZB 4A09A 3K26A 2J56H 2XYIA 2YB8B 3EI3A 5FA5B 2GC7A 4BL0A 1OLZA 2IUPA 3DM0A 4O45A 2J55H 3PVUB 4U1EI 2AGYA 3MZKA 3PXWD 3JZGA 4CZXA 3J80g 3J81g 4MK0B 3I7HA 4CZYA 4K3JB 4JD2C 3SWSD 4J79A 2HESX 2OIZA 2QXVA 4J84A 1XKSA 5AJAA 3RN1D 5HE0B 5EMMB 3OKYA 4CI1A 4A0AA 3F3PA 4A11B 4A2MA 4E5ZB 1SQ9A 2P9NC 3RN0D 2CO0A 2I3SA 3EI2A 4ZOXA 3RSEC 3OTTA 5IJ7E 5CYKB 2AGZA 3JZNA 5HE2B 5CXCB 3EI4B 5TDHB 2H47A 1PI6A 1PEVA 3IIWA 3RRMC 3N0EA 3AH8B 3RFGA 5GMKn 4ZOYA 4ZN4A 5EMLB 2IUVA 4A08B 5CXBB 1N6FA 2Q7QA 4GQ2P 5A2Qg 3PSCB 3DXKC 4D0KA 3MMYA 3OW8A 1RI6A 5FKSA 3CFSB 3EI1A 5HE1B 3FGBA 2YNOA 1B9YA 3DXMC 3JRPA 4LG9A 1K32A 2XL2A 4ZOVA 4CI3A 4TZ4A 4CC9A 4EWRA 4ERQA 4A0BB 3B7FA 2PM9A 4ZOZA 4PBZA 3PXSD 4U7AA 3HFQA 4K3ID 2Z2OA 3IIYA 4J77A 4AEZA 4HDJA 4GGCA 2HYEA 4PNKB 4X3EA 2TRCB 3PVWB 3UVKA 3MXXA 4D6VA 3SJLD 3EMHA 1N6EA 3OL2B 1GG2B 1MG2A 3MKQA 4ES0A 4FA1D 3I89A 2B5LA 5H17A 3C75H 3RMZD 4O3TB 2CNXA 3I7PA 3K27A 3JROA 2YBAA 2OVQB 5TEFA 3I7KA 5JWZA 5TF2A 2CO0C 3SHFA 4PBYA 3V5WB 5K19A 3SBRA 3UVMA 4XEIC 4LGNA 4GM3A 3OKTA 4IMMA 2CE9A 5TEEA 4J78A 4JT6C 4J87A 2I0TA 3EWEA 4FHLA 2IAAA 2HKMA 2YMUA 2CE8A 5GSAA 2OVPB 4A09B 5IGOA 3BG0A 5SXMA 3UVLA 3SVWD 3EI3B 5I5MA 2AH1A 1PGUA 2P9KC 4J8GA 4J0XA 3VGZA 5C2WB 4J81A 5AMSA 2H9NA 3IJ0A 2GNQA 1SHYB 4I79A 4E54A 4Z8LA 4IA9A 4PC0A 3FRXA 2G99A 2IWKA 3E0CA 4A11A 5I5IA 1NR0A 5HQGA 5HE3B 1OMWB 3OKYB 1TBGA 4A0AB 2H3XA 5IJ8E 4O9DA 3NVNA 5FKRA 2H68A 3IJ1A 2OK4A 1TYQC 2IURA 4JXMA 3VH0A 5HYNB 4N14A 3W15A 1ERJA 5CXCA 3EI2B 3IKOA 5K1CC 1NEXB 1JMXB 3L4MD 2B5MA 4GQ1A 3PSLA 2W18A 4CY1A 3V7DB 5GXIA 5H14A 4A08A 4JSVC 2BBKH 3ORVD 2YNNA 4FA5D 4FB1D 2P9PC 4PSWB 5EM2B 2H9LA 3UKRC 1U4CA 4FA4D 3RLMD 3UVNA 4H5JA 4OZUA 3NVXA 2H14A 3UR4A 4LG8A 2AH0A 5EMKB 3UKUC 2AQ5A 5FKTA 4BUJC 5FKQA 4J8BA 3I7LA 2AGXA 2OVRB 3V9FA 2HXCA 5EAMA 3ZWLB 1PBYB 4Y5RD 2G9AA 3SXTD 4AOWA 3C9CA 1MDAH 4O1QD 2UZYB 4XYIA 2IWFA 2QC5A 4CY2A 1GP2B 2J57G 5I5JA 3SMRA 4ERZA 3KRWB
chains in the Genus database with same CATH superfamily
3IUNA 4WK0A 1XIPA 4AMZA 1O6GA 3SBQA 2I0RA 3AL8A 2P9LC 4ESGA 4CI2A 2XDWA 4Z7NA 3A0FA 4CY5A 5THAA 4BCDA 3AL9A 5B4WA 2O9KA 4UI9R 3ZE1A 4CZVA 2CN2A 4MMYA 3SN6B 2UZXB 4NC4A 3GFCA 3SBPA 1L0QA 1E8MA 4H5IA 3MZLA 3NVQA 2XL3A 1JTDB 5KDOB 4DNUA 1GOTB 5EAPA 1FWXA 3OKWA 1O6FA 2OK6A 4A7JA 4L3HD 1UTCA 5FLXg 3DSMA 1P22A 1U2VC 4FAVD 4UM8A 1GOGA 2OJYA 3C5MA 4O3UB 2P9SC 2H9PA 2H6NA 2P9UC 2VDMA 4L9OA 3I7NA 2AGWA 4KFMB 1B9XA 3N0DA 4Y7RA 4DNVA 4CI8A 3I8CA 2VDOA 4QL1A 5EMJB 3IJCA 2HKRA 3I7OA 3F3FA 1GOHA 3O4HA 1VE7A 2PM7B 3JZHA 3ZE0A 1VZ2A 3BG1A 4E5ZA 4E54B 3JAMg 2IUQA 3U4YA 2CN3A 4AX4A 1JJUB 5M5UA 3SLED 5CYKA 4ERYA 3NIDA 1QNIA 3EI4A 4FWWA 4GGDA 4JT5C 4G56B 2B4EA 3ODTA 3SFZA 4CY3A 4MMZA 4QT8A 5GXHA 1R5MA 4QQEA 3FM0A 1UOQA 3I2NA 2VZ1A 3FCSA 5CXBA 4QRJA 2MTAH 2H9MA 3DWLC 3O4JA 2YNPA 2I3TA 1JOFA 4FAND 5AFU3 4NSXA 5EM2A 1M1XA 2Z2NA 1VE6A 5EARA 5IC7A 3UVOA 4GGAA 2VC2A 1SQJA 4AN1A 4XYHA 4GM9A 3VA6A 4YVDA 3JPXA 1YR2A 2H6QA 3GREA 3BWSA 3MKSB 4GQBB 4J86A 3P4FA 4X60B 4X61B 3EI1B 4JSXC 3JB9L 4BP9A 3L4OD 1GOFA 4J82A 1K8KC 5FFGA 3EU7A 4A0BA 2XZGA 3KRXB 1N6DA 3RFHA 4WJKA 4PSXB 4PXWA 5FXYA 2Z2PA 1MG3A 5H1MA 2BCJB 2PM9B 2HU5A 2XU7A 1XHMA 1Q47A 4J73A 2VDQA 2GC4A 3PE7A 3C99A 3SCYA 3ZDXA 3VI3A 2AGLA 4OWRA 3V4VA 5IGQA 5EALA 3F3GA 3MVDK 3OL2A 3I8EA 3CFVA 2PM6B 1A0RB 4JSPC 5E6RA 4JSNC 4R7AB 4L3GD 4GMBA 1E5TA 1VYHC 5C9ZB 2I0SA 4J0WA 2H13A 4L1QD 3CIKB 3O4IA 2HJBA 1YFQA 4A2LA 4BH6A 2P9IC 3O4GA 4G1EA 2PBIB 5FQDA 3K71A 4GM8A 4GZ8A 2H6KA 1H2ZA 5IT9g 4FA9D 4UM9A 3AL8B 4JHNA 5HDBA 4X63B 3ULEC 3EQ7A 3PXTD 1GXRA 1S4UX 3EG6A 2HJ4A 2EBSA 3IUQA 5C2VB 3AFCA 2B5NA 1JMZB 2VDLA 4A09A 3K26A 2J56H 5E6UA 2XYIA 2YB8B 3GD1I 3EI3A 5FA5B 2GC7A 3QI0A 4BL0A 2EIBA 1OLZA 4IRZA 2IUPA 2BKLA 3DM0A 4O45A 2J55H 3PVUB 1E8NA 3ZDZA 4U1EI 1I2MB 3MZKA 2AGYA 3PXWD 3JZGA 4CZXA 3QHYB 3J80g 3J81g 4MK0B 3I7HA 4CZYA 4K3JB 4JD2C 3SWSD 4J79A 4WK4A 2HESX 3IUJA 2OIZA 2QXVA 4J84A 1XKSA 2EIEA 5AJAA 3RN1D 5HE0B 5EMMB 3OKYA 4CI1A 4A0AA 3F3PA 4A11B 4NENA 4O02A 4A2MA 2EICA 4E5ZB 1SQ9A 2P9NC 3RN0D 2CO0A 2I3SA 3EI2A 3GC3B 4ZOXA 3RSEC 4NAAA 3OTTA 3KCIA 5IJ7E 5CYKB 2AGZA 3JZNA 4D9SA 5HE2B 5CXCB 3EI4B 5TDHB 2H47A 1PI6A 1PEVA 3IIWA 3ZDYA 3RRMC 3N0EA 3AH8B 3RFGA 5GMKn 5C86A 4ZOYA 2QZPA 4ZN4A 5EMLB 2IUVA 4A08B 5CXBB 1N6FA 2Q7QA 4GQ2P 5A2Qg 3PSCB 3MUNA 3DXKC 3MUOA 4D0KA 1H2YA 3K72A 3MMYA 3OW8A 1RI6A 5FKSA 3CFSB 4WK2A 3EI1A 5HE1B 3FGBA 1UOPA 2YNOA 1VZ3A 1B9YA 3DXMC 3JRPA 4LG9A 4NBMA 1K32A 4BCCA 1K3IA 2XL2A 4ZOVA 4CI3A 4TZ4A 3T3PA 4CC9A 4EWRA 5C92A 4ERQA 1L5GA 3IURA 4A0BB 3B7FA 2PM9A 5M5RA 4G1MA 4ZOZA 4PBZA 3PXSD 4U7AA 3HFQA 4K3ID 2Z2OA 3IIYA 4J77A 4AEZA 2VDPA 4QAMA 4HDJA 3FCUA 1H2WA 4GGCA 2HYEA 4PNKB 1JV2A 4X3EA 2TRCB 3PVWB 3UVKA 3MXXA 4D6VA 3SJLD 3IVMA 3EMHA 1N6EA 3OL2B 1GG2B 1MG2A 3MKQA 4ES0A 4FA1D 3I89A 2B5LA 5H17A 3C75H 3RMZD 4O3TB 2CNXA 3I7PA 3K27A 3JROA 2YBAA 2OVQB 2EIDA 5TEFA 3ZE2A 1BPOA 3I7KA 5TF2A 2CO0C 5JWZA 5M61A 3SHFA 4PBYA 2VDNA 3V5WB 3IULA 5K19A 2WQ8A 3SBRA 3UVMA 4XEIC 3NIGA 4LGNA 4Z7QA 4GM3A 3OKTA 4IMMA 4AMYA 2CE9A 3T3MA 5TEEA 4J78A 4JT6C 4J87A 2I0TA 3EWEA 3NIFA 4FHLA 4MMXA 2IAAA 2HKMA 2YMUA 2CE8A 5GSAA 2OVPB 4A09B 5IGOA 3BG0A 5SXMA 5FFOA 3UVLA 3SVWD 2HU7A 3EI3B 5I5MA 4DNWA 3V4PA 2AH1A 3K6SA 1PGUA 2P9KC 4J8GA 1QFMA 4J0XA 3VGZA 4Z7OA 2JKXA 2VDRA 5C2WB 3DDUA 4J81A 5AMSA 1TYEA 2H9NA 3IJ0A 2XE4A 2GNQA 1SHYB 4I79A 4E54A 4Z8LA 5E6SA 2QR5A 4IA9A 1UOOA 4PC0A 3FRXA 4L1MA 2G99A 3OF7A 1U8CA 2IWKA 3E0CA 4O2WA 4A11A 5I5IA 1NR0A 5HQGA 5HE3B 1OMWB 3OKYB 1TBGA 4A0AB 2H3XA 5IJ8E 4O9DA 3NVNA 5FKRA 2H68A 3IJ1A 2OK4A 1TYQC 1T2XA 2IURA 1H2XA 1QFSA 4JXMA 3VH0A 5HYNB 4N14A 3W15A 1ERJA 5CXCA 3EI2B 3IKOA 5K1CC 1NEXB 1JMXB 3L4MD 2B5MA 4GQ1A 3PSLA 4RE6A 5M5TA 2W18A 4CY1A 1C9IA 3V7DB 3VI4A 5GXIA 5H14A 4A08A 3EQ9A 3EQ8A 4JHPC 4JSVC 2BBKH 3ORVD 2YNNA 4FA5D 4FB1D 2P9PC 4PSWB 5EM2B 2H9LA 3UKRC 1U4CA 4FA4D 4G55A 3RLMD 3UVNA 4H5JA 4OZUA 3NVXA 2H14A 4BP8A 2VDKA 3UR4A 4LG8A 2AH0A 5EMKB 3UKUC 2AQ5A 5FKTA 3IJEA 4BUJC 5FKQA 4J8BA 3I7LA 2AGXA 2OVRB 3V9FA 2HXCA 5M5SA 5EAMA 3ZWLB 1PBYB 4Y5RD 2G9AA 3SXTD 1A12A 5M5VA 4AOWA 3C9CA 1MDAH 4O1QD 2UZYB 1C9LA 2IWFA 4XYIA 2HU8A 2VZ3A 2QC5A 4BCBA 4CY2A 3IUMA 1GP2B 2J57G 5I5JA 3SMRA 4ERZA 4AN0A 3KRWB 4RE5A
chains in the Genus database with same CATH topology
1XIPA 3SBQA 2I0RA 3AL8A 2P9LC 4ESGA 4CI2A 3A0FA 4CY5A 5THAA 3AL9A 5B4WA 2O9KA 4UI9R 4CZVA 2CN2A 3SN6B 2UZXB 3GFCA 3SBPA 1L0QA 4H5IA 3MZLA 3NVQA 2XL3A 5KDOB 1GOTB 5EAPA 1FWXA 3OKWA 4A7JA 2OK6A 4L3HD 5FLXg 3DSMA 1P22A 1U2VC 4FAVD 2OJYA 3C5MA 4O3UB 2P9SC 2H9PA 2H6NA 2P9UC 4L9OA 3I7NA 2AGWA 4KFMB 1B9XA 3N0DA 4Y7RA 4CI8A 3I8CA 4QL1A 5EMJB 3IJCA 2HKRA 3I7OA 3F3FA 2PM7B 3JZHA 3BG1A 4E5ZA 4E54B 3JAMg 2IUQA 3U4YA 2CN3A 1JJUB 3SLED 5CYKA 4ERYA 1QNIA 3EI4A 4FWWA 4GGDA 4JT5C 4G56B 2B4EA 3ODTA 3SFZA 4CY3A 5GXHA 4QT8A 1R5MA 4QQEA 3FM0A 3I2NA 5CXBA 4QRJA 2MTAH 2H9MA 3DWLC 2YNPA 2I3TA 1JOFA 4FAND 5AFU3 4NSXA 5EM2A 2Z2NA 5EARA 5IC7A 3UVOA 4GGAA 1SQJA 4XYHA 4GM9A 3VA6A 4YVDA 3JPXA 2H6QA 3GREA 3MKSB 3BWSA 4J86A 4GQBB 3P4FA 4X60B 4X61B 3EI1B 4JSXC 3JB9L 3L4OD 4J82A 1K8KC 3EU7A 4A0BA 3KRXB 1N6DA 3RFHA 4PSXB 4PXWA 5FXYA 2Z2PA 1MG3A 5H1MA 2BCJB 2PM9B 2XU7A 1XHMA 1Q47A 4J73A 2GC4A 3PE7A 3C99A 3SCYA 2AGLA 4OWRA 5IGQA 5EALA 3F3GA 3OL2A 3I8EA 3CFVA 2PM6B 1A0RB 4JSPC 4JSNC 4R7AB 4L3GD 4GMBA 5C9ZB 1VYHC 2I0SA 4J0WA 2H13A 4L1QD 3CIKB 2HJBA 1YFQA 4A2LA 4BH6A 2P9IC 5FQDA 2PBIB 4GM8A 4GZ8A 2H6KA 5IT9g 4FA9D 3AL8B 3ULEC 4X63B 3PXTD 1GXRA 1S4UX 3EG6A 2HJ4A 2EBSA 5C2VB 3AFCA 2B5NA 1JMZB 4A09A 3K26A 2J56H 2XYIA 2YB8B 3EI3A 5FA5B 2GC7A 4BL0A 1OLZA 2IUPA 3DM0A 4O45A 2J55H 3PVUB 4U1EI 2AGYA 3MZKA 3PXWD 3JZGA 4CZXA 3J80g 3J81g 4MK0B 3I7HA 4CZYA 4K3JB 4JD2C 3SWSD 4J79A 2HESX 2OIZA 2QXVA 4J84A 1XKSA 5AJAA 3RN1D 5HE0B 5EMMB 3OKYA 4CI1A 4A0AA 3F3PA 4A11B 4A2MA 4E5ZB 1SQ9A 2P9NC 3RN0D 2CO0A 2I3SA 3EI2A 4ZOXA 3RSEC 3OTTA 5IJ7E 5CYKB 2AGZA 3JZNA 5HE2B 5CXCB 3EI4B 5TDHB 2H47A 1PI6A 1PEVA 3IIWA 3RRMC 3N0EA 3AH8B 3RFGA 5GMKn 4ZOYA 4ZN4A 5EMLB 2IUVA 4A08B 5CXBB 1N6FA 2Q7QA 4GQ2P 5A2Qg 3PSCB 3DXKC 4D0KA 3MMYA 3OW8A 1RI6A 5FKSA 3CFSB 3EI1A 5HE1B 3FGBA 2YNOA 1B9YA 3DXMC 3JRPA 4LG9A 1K32A 2XL2A 4ZOVA 4CI3A 4TZ4A 4CC9A 4EWRA 4ERQA 4A0BB 3B7FA 2PM9A 4ZOZA 4PBZA 3PXSD 4U7AA 3HFQA 4K3ID 2Z2OA 3IIYA 4J77A 4AEZA 4HDJA 4GGCA 2HYEA 4PNKB 4X3EA 2TRCB 3PVWB 3UVKA 3MXXA 4D6VA 3SJLD 3EMHA 1N6EA 3OL2B 1GG2B 1MG2A 3MKQA 4ES0A 4FA1D 3I89A 2B5LA 5H17A 3C75H 3RMZD 4O3TB 2CNXA 3I7PA 3K27A 3JROA 2YBAA 2OVQB 5TEFA 3I7KA 5JWZA 5TF2A 2CO0C 3SHFA 4PBYA 3V5WB 5K19A 3SBRA 3UVMA 4XEIC 4LGNA 4GM3A 3OKTA 4IMMA 2CE9A 5TEEA 4J78A 4JT6C 4J87A 2I0TA 3EWEA 4FHLA 2IAAA 2HKMA 2YMUA 2CE8A 5GSAA 2OVPB 4A09B 5IGOA 3BG0A 5SXMA 3UVLA 3SVWD 3EI3B 5I5MA 2AH1A 1PGUA 2P9KC 4J8GA 4J0XA 3VGZA 5C2WB 4J81A 5AMSA 2H9NA 3IJ0A 2GNQA 1SHYB 4I79A 4E54A 4Z8LA 4IA9A 4PC0A 3FRXA 2G99A 2IWKA 3E0CA 4A11A 5I5IA 1NR0A 5HQGA 5HE3B 1OMWB 3OKYB 1TBGA 4A0AB 2H3XA 5IJ8E 4O9DA 3NVNA 5FKRA 2H68A 3IJ1A 2OK4A 1TYQC 2IURA 4JXMA 3VH0A 5HYNB 4N14A 3W15A 1ERJA 5CXCA 3EI2B 3IKOA 5K1CC 1NEXB 1JMXB 3L4MD 2B5MA 4GQ1A 3PSLA 2W18A 4CY1A 3V7DB 5GXIA 5H14A 4A08A 4JSVC 2BBKH 3ORVD 2YNNA 4FA5D 4FB1D 2P9PC 4PSWB 5EM2B 2H9LA 3UKRC 1U4CA 4FA4D 3RLMD 3UVNA 4H5JA 4OZUA 3NVXA 2H14A 3UR4A 4LG8A 2AH0A 5EMKB 3UKUC 2AQ5A 5FKTA 4BUJC 5FKQA 4J8BA 3I7LA 2AGXA 2OVRB 3V9FA 2HXCA 5EAMA 3ZWLB 1PBYB 4Y5RD 2G9AA 3SXTD 4AOWA 3C9CA 1MDAH 4O1QD 2UZYB 4XYIA 2IWFA 2QC5A 4CY2A 1GP2B 2J57G 5I5JA 3SMRA 4ERZA 3KRWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XIP A;  3SBQ A;  2I0R A;  3AL8 A;  2P9L C;  4ESG A;  4CI2 A;  3A0F A;  4CY5 A;  5THA A;  3AL9 A;  5B4W A;  2O9K A;  4UI9 R;  4CZV A;  2CN2 A;  3SN6 B;  2UZX B;  3GFC A;  3SBP A;  1L0Q A;  4H5I A;  3MZL A;  3NVQ A;  2XL3 A;  5KDO B;  1GOT B;  5EAP A;  1FWX A;  3OKW A;  4A7J A;  2OK6 A;  4L3H D;  5FLX g;  3DSM A;  1P22 A;  1U2V C;  4FAV D;  2OJY A;  3C5M A;  4O3U B;  2P9S C;  2H9P A;  2H6N A;  2P9U C;  4L9O A;  3I7N A;  2AGW A;  4KFM B;  1B9X A;  3N0D A;  4Y7R A;  4CI8 A;  3I8C A;  4QL1 A;  5EMJ B;  3IJC A;  2HKR A;  3I7O A;  3F3F A;  2PM7 B;  3JZH A;  3BG1 A;  4E5Z A;  4E54 B;  3JAM g;  2IUQ A;  3U4Y A;  2CN3 A;  1JJU B;  3SLE D;  5CYK A;  4ERY A;  1QNI A;  3EI4 A;  4FWW A;  4GGD A;  4JT5 C;  4G56 B;  2B4E A;  3ODT A;  3SFZ A;  4CY3 A;  5GXH A;  4QT8 A;  1R5M A;  4QQE A;  3FM0 A;  3I2N A;  5CXB A;  4QRJ A;  2MTA H;  2H9M A;  3DWL C;  2YNP A;  2I3T A;  1JOF A;  4FAN D;  5AFU 3;  4NSX A;  5EM2 A;  2Z2N A;  5EAR A;  5IC7 A;  3UVO A;  4GGA A;  1SQJ A;  4XYH A;  4GM9 A;  3VA6 A;  4YVD A;  3JPX A;  2H6Q A;  3GRE A;  3MKS B;  3BWS A;  4J86 A;  4GQB B;  3P4F A;  4X60 B;  4X61 B;  3EI1 B;  4JSX C;  3JB9 L;  3L4O D;  4J82 A;  1K8K C;  3EU7 A;  4A0B A;  3KRX B;  1N6D A;  3RFH A;  4PSX B;  4PXW A;  5FXY A;  2Z2P A;  1MG3 A;  5H1M A;  2BCJ B;  2PM9 B;  2XU7 A;  1XHM A;  1Q47 A;  4J73 A;  2GC4 A;  3PE7 A;  3C99 A;  3SCY A;  2AGL A;  4OWR A;  5IGQ A;  5EAL A;  3F3G A;  3OL2 A;  3I8E A;  3CFV A;  2PM6 B;  1A0R B;  4JSP C;  4JSN C;  4R7A B;  4L3G D;  4GMB A;  5C9Z B;  1VYH C;  2I0S A;  4J0W A;  2H13 A;  4L1Q D;  3CIK B;  2HJB A;  1YFQ A;  4A2L A;  4BH6 A;  2P9I C;  5FQD A;  2PBI B;  4GM8 A;  4GZ8 A;  2H6K A;  5IT9 g;  4FA9 D;  3AL8 B;  3ULE C;  4X63 B;  3PXT D;  1GXR A;  1S4U X;  3EG6 A;  2HJ4 A;  2EBS A;  5C2V B;  3AFC A;  2B5N A;  1JMZ B;  4A09 A;  3K26 A;  2J56 H;  2XYI A;  2YB8 B;  3EI3 A;  5FA5 B;  2GC7 A;  4BL0 A;  1OLZ A;  2IUP A;  3DM0 A;  4O45 A;  2J55 H;  3PVU B;  4U1E I;  2AGY A;  3MZK A;  3PXW D;  3JZG A;  4CZX A;  3J80 g;  3J81 g;  4MK0 B;  3I7H A;  4CZY A;  4K3J B;  4JD2 C;  3SWS D;  4J79 A;  2HES X;  2OIZ A;  2QXV A;  4J84 A;  1XKS A;  5AJA A;  3RN1 D;  5HE0 B;  5EMM B;  3OKY A;  4CI1 A;  4A0A A;  3F3P A;  4A11 B;  4A2M A;  4E5Z B;  1SQ9 A;  2P9N C;  3RN0 D;  2CO0 A;  2I3S A;  3EI2 A;  4ZOX A;  3RSE C;  3OTT A;  5IJ7 E;  5CYK B;  2AGZ A;  3JZN A;  5HE2 B;  5CXC B;  3EI4 B;  5TDH B;  2H47 A;  1PI6 A;  1PEV A;  3IIW A;  3RRM C;  3N0E A;  3AH8 B;  3RFG A;  5GMK n;  4ZOY A;  4ZN4 A;  5EML B;  2IUV A;  4A08 B;  5CXB B;  1N6F A;  2Q7Q A;  4GQ2 P;  5A2Q g;  3PSC B;  3DXK C;  4D0K A;  3MMY A;  3OW8 A;  1RI6 A;  5FKS A;  3CFS B;  3EI1 A;  5HE1 B;  3FGB A;  2YNO A;  1B9Y A;  3DXM C;  3JRP A;  4LG9 A;  1K32 A;  2XL2 A;  4ZOV A;  4CI3 A;  4TZ4 A;  4CC9 A;  4EWR A;  4ERQ A;  4A0B B;  3B7F A;  2PM9 A;  4ZOZ A;  4PBZ A;  3PXS D;  4U7A A;  3HFQ A;  4K3I D;  2Z2O A;  3IIY A;  4J77 A;  4AEZ A;  4HDJ A;  4GGC A;  2HYE A;  4PNK B;  4X3E A;  2TRC B;  3PVW B;  3UVK A;  3MXX A;  4D6V A;  3SJL D;  3EMH A;  1N6E A;  3OL2 B;  1GG2 B;  1MG2 A;  3MKQ A;  4ES0 A;  4FA1 D;  3I89 A;  2B5L A;  5H17 A;  3C75 H;  3RMZ D;  4O3T B;  2CNX A;  3I7P A;  3K27 A;  3JRO A;  2YBA A;  2OVQ B;  5TEF A;  3I7K A;  5JWZ A;  5TF2 A;  2CO0 C;  3SHF A;  4PBY A;  3V5W B;  5K19 A;  3SBR A;  3UVM A;  4XEI C;  4LGN A;  4GM3 A;  3OKT A;  4IMM A;  2CE9 A;  5TEE A;  4J78 A;  4JT6 C;  4J87 A;  2I0T A;  3EWE A;  4FHL A;  2IAA A;  2HKM A;  2YMU A;  2CE8 A;  5GSA A;  2OVP B;  4A09 B;  5IGO A;  3BG0 A;  5SXM A;  3UVL A;  3SVW D;  3EI3 B;  5I5M A;  2AH1 A;  1PGU A;  2P9K C;  4J8G A;  4J0X A;  3VGZ A;  5C2W B;  4J81 A;  5AMS A;  2H9N A;  3IJ0 A;  2GNQ A;  1SHY B;  4I79 A;  4E54 A;  4Z8L A;  4IA9 A;  4PC0 A;  3FRX A;  2G99 A;  2IWK A;  3E0C A;  4A11 A;  5I5I A;  1NR0 A;  5HQG A;  5HE3 B;  1OMW B;  3OKY B;  1TBG A;  4A0A B;  2H3X A;  5IJ8 E;  4O9D A;  3NVN A;  5FKR A;  2H68 A;  3IJ1 A;  2OK4 A;  1TYQ C;  2IUR A;  4JXM A;  3VH0 A;  5HYN B;  4N14 A;  3W15 A;  1ERJ A;  5CXC A;  3EI2 B;  3IKO A;  5K1C C;  1NEX B;  1JMX B;  3L4M D;  2B5M A;  4GQ1 A;  3PSL A;  2W18 A;  4CY1 A;  3V7D B;  5GXI A;  5H14 A;  4A08 A;  4JSV C;  2BBK H;  3ORV D;  2YNN A;  4FA5 D;  4FB1 D;  2P9P C;  4PSW B;  5EM2 B;  2H9L A;  3UKR C;  1U4C A;  4FA4 D;  3RLM D;  3UVN A;  4H5J A;  4OZU A;  3NVX A;  2H14 A;  3UR4 A;  4LG8 A;  2AH0 A;  5EMK B;  3UKU C;  2AQ5 A;  5FKT A;  4BUJ C;  5FKQ A;  4J8B A;  3I7L A;  2AGX A;  2OVR B;  3V9F A;  2HXC A;  5EAM A;  3ZWL B;  1PBY B;  4Y5R D;  2G9A A;  3SXT D;  4AOW A;  3C9C A;  1MDA H;  4O1Q D;  2UZY B;  4XYI A;  2IWF A;  2QC5 A;  4CY2 A;  1GP2 B;  2J57 G;  5I5J A;  3SMR A;  4ERZ A;  3KRW B; 
#chains in the Genus database with same CATH topology
 3IUN A;  4WK0 A;  1XIP A;  4AMZ A;  1O6G A;  3SBQ A;  2I0R A;  3AL8 A;  2P9L C;  4ESG A;  4CI2 A;  2XDW A;  4Z7N A;  3A0F A;  4CY5 A;  5THA A;  4BCD A;  3AL9 A;  5B4W A;  2O9K A;  4UI9 R;  3ZE1 A;  4CZV A;  2CN2 A;  4MMY A;  3SN6 B;  2UZX B;  4NC4 A;  3GFC A;  3SBP A;  1L0Q A;  1E8M A;  4H5I A;  3MZL A;  3NVQ A;  2XL3 A;  1JTD B;  5KDO B;  4DNU A;  1GOT B;  5EAP A;  1FWX A;  3OKW A;  1O6F A;  2OK6 A;  4A7J A;  4L3H D;  1UTC A;  5FLX g;  3DSM A;  1P22 A;  1U2V C;  4FAV D;  4UM8 A;  1GOG A;  2OJY A;  3C5M A;  4O3U B;  2P9S C;  2H9P A;  2H6N A;  2P9U C;  2VDM A;  4L9O A;  3I7N A;  2AGW A;  4KFM B;  1B9X A;  3N0D A;  4Y7R A;  4DNV A;  4CI8 A;  3I8C A;  2VDO A;  4QL1 A;  5EMJ B;  3IJC A;  2HKR A;  3I7O A;  3F3F A;  1GOH A;  3O4H A;  1VE7 A;  2PM7 B;  3JZH A;  3ZE0 A;  1VZ2 A;  3BG1 A;  4E5Z A;  4E54 B;  3JAM g;  2IUQ A;  3U4Y A;  2CN3 A;  4AX4 A;  1JJU B;  5M5U A;  3SLE D;  5CYK A;  4ERY A;  3NID A;  1QNI A;  3EI4 A;  4FWW A;  4GGD A;  4JT5 C;  4G56 B;  2B4E A;  3ODT A;  3SFZ A;  4CY3 A;  4MMZ A;  4QT8 A;  5GXH A;  1R5M A;  4QQE A;  3FM0 A;  1UOQ A;  3I2N A;  2VZ1 A;  3FCS A;  5CXB A;  4QRJ A;  2MTA H;  2H9M A;  3DWL C;  3O4J A;  2YNP A;  2I3T A;  1JOF A;  4FAN D;  5AFU 3;  4NSX A;  5EM2 A;  1M1X A;  2Z2N A;  1VE6 A;  5EAR A;  5IC7 A;  3UVO A;  4GGA A;  2VC2 A;  1SQJ A;  4AN1 A;  4XYH A;  4GM9 A;  3VA6 A;  4YVD A;  3JPX A;  1YR2 A;  2H6Q A;  3GRE A;  3BWS A;  3MKS B;  4GQB B;  4J86 A;  3P4F A;  4X60 B;  4X61 B;  3EI1 B;  4JSX C;  3JB9 L;  4BP9 A;  3L4O D;  1GOF A;  4J82 A;  1K8K C;  5FFG A;  3EU7 A;  4A0B A;  2XZG A;  3KRX B;  1N6D A;  3RFH A;  4WJK A;  4PSX B;  4PXW A;  5FXY A;  2Z2P A;  1MG3 A;  5H1M A;  2BCJ B;  2PM9 B;  2HU5 A;  2XU7 A;  1XHM A;  1Q47 A;  4J73 A;  2VDQ A;  2GC4 A;  3PE7 A;  3C99 A;  3SCY A;  3ZDX A;  3VI3 A;  2AGL A;  4OWR A;  3V4V A;  5IGQ A;  5EAL A;  3F3G A;  3MVD K;  3OL2 A;  3I8E A;  3CFV A;  2PM6 B;  1A0R B;  4JSP C;  5E6R A;  4JSN C;  4R7A B;  4L3G D;  4GMB A;  1E5T A;  1VYH C;  5C9Z B;  2I0S A;  4J0W A;  2H13 A;  4L1Q D;  3CIK B;  3O4I A;  2HJB A;  1YFQ A;  4A2L A;  4BH6 A;  2P9I C;  3O4G A;  4G1E A;  2PBI B;  5FQD A;  3K71 A;  4GM8 A;  4GZ8 A;  2H6K A;  1H2Z A;  5IT9 g;  4FA9 D;  4UM9 A;  3AL8 B;  4JHN A;  5HDB A;  4X63 B;  3ULE C;  3EQ7 A;  3PXT D;  1GXR A;  1S4U X;  3EG6 A;  2HJ4 A;  2EBS A;  3IUQ A;  5C2V B;  3AFC A;  2B5N A;  1JMZ B;  2VDL A;  4A09 A;  3K26 A;  2J56 H;  5E6U A;  2XYI A;  2YB8 B;  3GD1 I;  3EI3 A;  5FA5 B;  2GC7 A;  3QI0 A;  4BL0 A;  2EIB A;  1OLZ A;  4IRZ A;  2IUP A;  2BKL A;  3DM0 A;  4O45 A;  2J55 H;  3PVU B;  1E8N A;  3ZDZ A;  4U1E I;  1I2M B;  3MZK A;  2AGY A;  3PXW D;  3JZG A;  4CZX A;  3QHY B;  3J80 g;  3J81 g;  4MK0 B;  3I7H A;  4CZY A;  4K3J B;  4JD2 C;  3SWS D;  4J79 A;  4WK4 A;  2HES X;  3IUJ A;  2OIZ A;  2QXV A;  4J84 A;  1XKS A;  2EIE A;  5AJA A;  3RN1 D;  5HE0 B;  5EMM B;  3OKY A;  4CI1 A;  4A0A A;  3F3P A;  4A11 B;  4NEN A;  4O02 A;  4A2M A;  2EIC A;  4E5Z B;  1SQ9 A;  2P9N C;  3RN0 D;  2CO0 A;  2I3S A;  3EI2 A;  3GC3 B;  4ZOX A;  3RSE C;  4NAA A;  3OTT A;  3KCI A;  5IJ7 E;  5CYK B;  2AGZ A;  3JZN A;  4D9S A;  5HE2 B;  5CXC B;  3EI4 B;  5TDH B;  2H47 A;  1PI6 A;  1PEV A;  3IIW A;  3ZDY A;  3RRM C;  3N0E A;  3AH8 B;  3RFG A;  5GMK n;  5C86 A;  4ZOY A;  2QZP A;  4ZN4 A;  5EML B;  2IUV A;  4A08 B;  5CXB B;  1N6F A;  2Q7Q A;  4GQ2 P;  5A2Q g;  3PSC B;  3MUN A;  3DXK C;  3MUO A;  4D0K A;  1H2Y A;  3K72 A;  3MMY A;  3OW8 A;  1RI6 A;  5FKS A;  3CFS B;  4WK2 A;  3EI1 A;  5HE1 B;  3FGB A;  1UOP A;  2YNO A;  1VZ3 A;  1B9Y A;  3DXM C;  3JRP A;  4LG9 A;  4NBM A;  1K32 A;  4BCC A;  1K3I A;  2XL2 A;  4ZOV A;  4CI3 A;  4TZ4 A;  3T3P A;  4CC9 A;  4EWR A;  5C92 A;  4ERQ A;  1L5G A;  3IUR A;  4A0B B;  3B7F A;  2PM9 A;  5M5R A;  4G1M A;  4ZOZ A;  4PBZ A;  3PXS D;  4U7A A;  3HFQ A;  4K3I D;  2Z2O A;  3IIY A;  4J77 A;  4AEZ A;  2VDP A;  4QAM A;  4HDJ A;  3FCU A;  1H2W A;  4GGC A;  2HYE A;  4PNK B;  1JV2 A;  4X3E A;  2TRC B;  3PVW B;  3UVK A;  3MXX A;  4D6V A;  3SJL D;  3IVM A;  3EMH A;  1N6E A;  3OL2 B;  1GG2 B;  1MG2 A;  3MKQ A;  4ES0 A;  4FA1 D;  3I89 A;  2B5L A;  5H17 A;  3C75 H;  3RMZ D;  4O3T B;  2CNX A;  3I7P A;  3K27 A;  3JRO A;  2YBA A;  2OVQ B;  2EID A;  5TEF A;  3ZE2 A;  1BPO A;  3I7K A;  5TF2 A;  2CO0 C;  5JWZ A;  5M61 A;  3SHF A;  4PBY A;  2VDN A;  3V5W B;  3IUL A;  5K19 A;  2WQ8 A;  3SBR A;  3UVM A;  4XEI C;  3NIG A;  4LGN A;  4Z7Q A;  4GM3 A;  3OKT A;  4IMM A;  4AMY A;  2CE9 A;  3T3M A;  5TEE A;  4J78 A;  4JT6 C;  4J87 A;  2I0T A;  3EWE A;  3NIF A;  4FHL A;  4MMX A;  2IAA A;  2HKM A;  2YMU A;  2CE8 A;  5GSA A;  2OVP B;  4A09 B;  5IGO A;  3BG0 A;  5SXM A;  5FFO A;  3UVL A;  3SVW D;  2HU7 A;  3EI3 B;  5I5M A;  4DNW A;  3V4P A;  2AH1 A;  3K6S A;  1PGU A;  2P9K C;  4J8G A;  1QFM A;  4J0X A;  3VGZ A;  4Z7O A;  2JKX A;  2VDR A;  5C2W B;  3DDU A;  4J81 A;  5AMS A;  1TYE A;  2H9N A;  3IJ0 A;  2XE4 A;  2GNQ A;  1SHY B;  4I79 A;  4E54 A;  4Z8L A;  5E6S A;  2QR5 A;  4IA9 A;  1UOO A;  4PC0 A;  3FRX A;  4L1M A;  2G99 A;  3OF7 A;  1U8C A;  2IWK A;  3E0C A;  4O2W A;  4A11 A;  5I5I A;  1NR0 A;  5HQG A;  5HE3 B;  1OMW B;  3OKY B;  1TBG A;  4A0A B;  2H3X A;  5IJ8 E;  4O9D A;  3NVN A;  5FKR A;  2H68 A;  3IJ1 A;  2OK4 A;  1TYQ C;  1T2X A;  2IUR A;  1H2X A;  1QFS A;  4JXM A;  3VH0 A;  5HYN B;  4N14 A;  3W15 A;  1ERJ A;  5CXC A;  3EI2 B;  3IKO A;  5K1C C;  1NEX B;  1JMX B;  3L4M D;  2B5M A;  4GQ1 A;  3PSL A;  4RE6 A;  5M5T A;  2W18 A;  4CY1 A;  1C9I A;  3V7D B;  3VI4 A;  5GXI A;  5H14 A;  4A08 A;  3EQ9 A;  3EQ8 A;  4JHP C;  4JSV C;  2BBK H;  3ORV D;  2YNN A;  4FA5 D;  4FB1 D;  2P9P C;  4PSW B;  5EM2 B;  2H9L A;  3UKR C;  1U4C A;  4FA4 D;  4G55 A;  3RLM D;  3UVN A;  4H5J A;  4OZU A;  3NVX A;  2H14 A;  4BP8 A;  2VDK A;  3UR4 A;  4LG8 A;  2AH0 A;  5EMK B;  3UKU C;  2AQ5 A;  5FKT A;  3IJE A;  4BUJ C;  5FKQ A;  4J8B A;  3I7L A;  2AGX A;  2OVR B;  3V9F A;  2HXC A;  5M5S A;  5EAM A;  3ZWL B;  1PBY B;  4Y5R D;  2G9A A;  3SXT D;  1A12 A;  5M5V A;  4AOW A;  3C9C A;  1MDA H;  4O1Q D;  2UZY B;  1C9L A;  2IWF A;  4XYI A;  2HU8 A;  2VZ3 A;  2QC5 A;  4BCB A;  4CY2 A;  3IUM A;  1GP2 B;  2J57 G;  5I5J A;  3SMR A;  4ERZ A;  4AN0 A;  3KRW B;  4RE5 A; 
#chains in the Genus database with same CATH homology
 1XIP A;  3SBQ A;  2I0R A;  3AL8 A;  2P9L C;  4ESG A;  4CI2 A;  3A0F A;  4CY5 A;  5THA A;  3AL9 A;  5B4W A;  2O9K A;  4UI9 R;  4CZV A;  2CN2 A;  3SN6 B;  2UZX B;  3GFC A;  3SBP A;  1L0Q A;  4H5I A;  3MZL A;  3NVQ A;  2XL3 A;  5KDO B;  1GOT B;  5EAP A;  1FWX A;  3OKW A;  4A7J A;  2OK6 A;  4L3H D;  5FLX g;  3DSM A;  1P22 A;  1U2V C;  4FAV D;  2OJY A;  3C5M A;  4O3U B;  2P9S C;  2H9P A;  2H6N A;  2P9U C;  4L9O A;  3I7N A;  2AGW A;  4KFM B;  1B9X A;  3N0D A;  4Y7R A;  4CI8 A;  3I8C A;  4QL1 A;  5EMJ B;  3IJC A;  2HKR A;  3I7O A;  3F3F A;  2PM7 B;  3JZH A;  3BG1 A;  4E5Z A;  4E54 B;  3JAM g;  2IUQ A;  3U4Y A;  2CN3 A;  1JJU B;  3SLE D;  5CYK A;  4ERY A;  1QNI A;  3EI4 A;  4FWW A;  4GGD A;  4JT5 C;  4G56 B;  2B4E A;  3ODT A;  3SFZ A;  4CY3 A;  5GXH A;  4QT8 A;  1R5M A;  4QQE A;  3FM0 A;  3I2N A;  5CXB A;  4QRJ A;  2MTA H;  2H9M A;  3DWL C;  2YNP A;  2I3T A;  1JOF A;  4FAN D;  5AFU 3;  4NSX A;  5EM2 A;  2Z2N A;  5EAR A;  5IC7 A;  3UVO A;  4GGA A;  1SQJ A;  4XYH A;  4GM9 A;  3VA6 A;  4YVD A;  3JPX A;  2H6Q A;  3GRE A;  3MKS B;  3BWS A;  4J86 A;  4GQB B;  3P4F A;  4X60 B;  4X61 B;  3EI1 B;  4JSX C;  3JB9 L;  3L4O D;  4J82 A;  1K8K C;  3EU7 A;  4A0B A;  3KRX B;  1N6D A;  3RFH A;  4PSX B;  4PXW A;  5FXY A;  2Z2P A;  1MG3 A;  5H1M A;  2BCJ B;  2PM9 B;  2XU7 A;  1XHM A;  1Q47 A;  4J73 A;  2GC4 A;  3PE7 A;  3C99 A;  3SCY A;  2AGL A;  4OWR A;  5IGQ A;  5EAL A;  3F3G A;  3OL2 A;  3I8E A;  3CFV A;  2PM6 B;  1A0R B;  4JSP C;  4JSN C;  4R7A B;  4L3G D;  4GMB A;  5C9Z B;  1VYH C;  2I0S A;  4J0W A;  2H13 A;  4L1Q D;  3CIK B;  2HJB A;  1YFQ A;  4A2L A;  4BH6 A;  2P9I C;  5FQD A;  2PBI B;  4GM8 A;  4GZ8 A;  2H6K A;  5IT9 g;  4FA9 D;  3AL8 B;  3ULE C;  4X63 B;  3PXT D;  1GXR A;  1S4U X;  3EG6 A;  2HJ4 A;  2EBS A;  5C2V B;  3AFC A;  2B5N A;  1JMZ B;  4A09 A;  3K26 A;  2J56 H;  2XYI A;  2YB8 B;  3EI3 A;  5FA5 B;  2GC7 A;  4BL0 A;  1OLZ A;  2IUP A;  3DM0 A;  4O45 A;  2J55 H;  3PVU B;  4U1E I;  2AGY A;  3MZK A;  3PXW D;  3JZG A;  4CZX A;  3J80 g;  3J81 g;  4MK0 B;  3I7H A;  4CZY A;  4K3J B;  4JD2 C;  3SWS D;  4J79 A;  2HES X;  2OIZ A;  2QXV A;  4J84 A;  1XKS A;  5AJA A;  3RN1 D;  5HE0 B;  5EMM B;  3OKY A;  4CI1 A;  4A0A A;  3F3P A;  4A11 B;  4A2M A;  4E5Z B;  1SQ9 A;  2P9N C;  3RN0 D;  2CO0 A;  2I3S A;  3EI2 A;  4ZOX A;  3RSE C;  3OTT A;  5IJ7 E;  5CYK B;  2AGZ A;  3JZN A;  5HE2 B;  5CXC B;  3EI4 B;  5TDH B;  2H47 A;  1PI6 A;  1PEV A;  3IIW A;  3RRM C;  3N0E A;  3AH8 B;  3RFG A;  5GMK n;  4ZOY A;  4ZN4 A;  5EML B;  2IUV A;  4A08 B;  5CXB B;  1N6F A;  2Q7Q A;  4GQ2 P;  5A2Q g;  3PSC B;  3DXK C;  4D0K A;  3MMY A;  3OW8 A;  1RI6 A;  5FKS A;  3CFS B;  3EI1 A;  5HE1 B;  3FGB A;  2YNO A;  1B9Y A;  3DXM C;  3JRP A;  4LG9 A;  1K32 A;  2XL2 A;  4ZOV A;  4CI3 A;  4TZ4 A;  4CC9 A;  4EWR A;  4ERQ A;  4A0B B;  3B7F A;  2PM9 A;  4ZOZ A;  4PBZ A;  3PXS D;  4U7A A;  3HFQ A;  4K3I D;  2Z2O A;  3IIY A;  4J77 A;  4AEZ A;  4HDJ A;  4GGC A;  2HYE A;  4PNK B;  4X3E A;  2TRC B;  3PVW B;  3UVK A;  3MXX A;  4D6V A;  3SJL D;  3EMH A;  1N6E A;  3OL2 B;  1GG2 B;  1MG2 A;  3MKQ A;  4ES0 A;  4FA1 D;  3I89 A;  2B5L A;  5H17 A;  3C75 H;  3RMZ D;  4O3T B;  2CNX A;  3I7P A;  3K27 A;  3JRO A;  2YBA A;  2OVQ B;  5TEF A;  3I7K A;  5JWZ A;  5TF2 A;  2CO0 C;  3SHF A;  4PBY A;  3V5W B;  5K19 A;  3SBR A;  3UVM A;  4XEI C;  4LGN A;  4GM3 A;  3OKT A;  4IMM A;  2CE9 A;  5TEE A;  4J78 A;  4JT6 C;  4J87 A;  2I0T A;  3EWE A;  4FHL A;  2IAA A;  2HKM A;  2YMU A;  2CE8 A;  5GSA A;  2OVP B;  4A09 B;  5IGO A;  3BG0 A;  5SXM A;  3UVL A;  3SVW D;  3EI3 B;  5I5M A;  2AH1 A;  1PGU A;  2P9K C;  4J8G A;  4J0X A;  3VGZ A;  5C2W B;  4J81 A;  5AMS A;  2H9N A;  3IJ0 A;  2GNQ A;  1SHY B;  4I79 A;  4E54 A;  4Z8L A;  4IA9 A;  4PC0 A;  3FRX A;  2G99 A;  2IWK A;  3E0C A;  4A11 A;  5I5I A;  1NR0 A;  5HQG A;  5HE3 B;  1OMW B;  3OKY B;  1TBG A;  4A0A B;  2H3X A;  5IJ8 E;  4O9D A;  3NVN A;  5FKR A;  2H68 A;  3IJ1 A;  2OK4 A;  1TYQ C;  2IUR A;  4JXM A;  3VH0 A;  5HYN B;  4N14 A;  3W15 A;  1ERJ A;  5CXC A;  3EI2 B;  3IKO A;  5K1C C;  1NEX B;  1JMX B;  3L4M D;  2B5M A;  4GQ1 A;  3PSL A;  2W18 A;  4CY1 A;  3V7D B;  5GXI A;  5H14 A;  4A08 A;  4JSV C;  2BBK H;  3ORV D;  2YNN A;  4FA5 D;  4FB1 D;  2P9P C;  4PSW B;  5EM2 B;  2H9L A;  3UKR C;  1U4C A;  4FA4 D;  3RLM D;  3UVN A;  4H5J A;  4OZU A;  3NVX A;  2H14 A;  3UR4 A;  4LG8 A;  2AH0 A;  5EMK B;  3UKU C;  2AQ5 A;  5FKT A;  4BUJ C;  5FKQ A;  4J8B A;  3I7L A;  2AGX A;  2OVR B;  3V9F A;  2HXC A;  5EAM A;  3ZWL B;  1PBY B;  4Y5R D;  2G9A A;  3SXT D;  4AOW A;  3C9C A;  1MDA H;  4O1Q D;  2UZY B;  4XYI A;  2IWF A;  2QC5 A;  4CY2 A;  1GP2 B;  2J57 G;  5I5J A;  3SMR A;  4ERZ A;  3KRW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...