2YNNA

Yeast betaprime cop 1-304 with ktktn motif
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
300
structure length
300
Chain Sequence
KLDIKKTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVELWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COATOMER SUBUNIT BETA'
publication title Molecular Basis for Recognition of Dilysine Trafficking Motifs by Copi.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 90
structure length 300
sequence length 300
ec nomenclature
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ynnA01
1QNIA 3C5MA 1FWXA 4E5ZB 2HKRA 2B4EA 5CXBA 5C9ZB 3EI4A 1K8KC 2OIZA 3NVXA 3KRXB 5H1MA 4KFMB 3P4FA 4LGNA 3L4MD 3PXTD 3SHFA 4PBZA 3KRWB 4L3GD 3DSMA 2AQ5A 3RSEC 2AH0A 5I5MA 2XL2A 3JROA 3EI2B 3EMHA 4LG8A 2O9KA 4O3UB 3MMYA 2P9KC 2OVPB 4J0XA 4XYIA 4A0AB 3I7HA 4JXMA 3VH0A 2J55H 3SLED 4FAVD 1XKSA 3C75H 5TEFA 4PNKB 2HESX 5TEEA 1NEXB 2YB8B 3I8CA 3E0CA 5HE3B 5I5JA 4XYHA 2CO0C 4CY5A 4CY2A 3J81g 1GG2B 3PSCB 4GM9A 2H9NA 4J8BA 2IUVA 3OKWA 4TZ4A 2PM9A 1MDAH 1GP2B 5FKQA 2AGXA 2J57G 5THAA 4ESGA 3B7FA 3FRXA 1OLZA 5K19A 3NVNA 3IIWA 4GQ2P 2Z2NA 1B9YA 3AL9A 3OL2B 3BG0A 3PXWD 2H13A 1ERJA 2PBIB 2H47A 3V9FA 4FA9D 5HE1B 4FHLA 1RI6A 5CYKB 5CXCA 4ZN4A 4CI1A 5K1CC 4Y7RA 4BL0A 2P9LC 4D6VA 4A0BB 4A08B 4AOWA 3JZGA 4O9DA 4D0KA 1GXRA 4BUJC 2W18A 2H3XA 3PSLA 3ULEC 4U7AA 3RFGA 3UVKA 4XEIC 2UZXB 2H6QA 3RFHA 3MZKA 1MG2A 1XHMA 3DWLC 3SVWD 3AL8A 4L3HD 3SFZA 2OK4A 3EI4B 4AEZA 1XIPA 2IUQA 2H9PA 1PI6A 2XU7A 3EI3A 4JD2C 4PC0A 3EI1A 4I79A 3I8EA 4U1EI 4GQ1A 2HXCA 4QT8A 3RRMC 1TYQC 3MKQA 4GGCA 2J56H 3V5WB 1S4UX 4X61B 3I7NA 1B9XA 4L9OA 5FLXg 4E54A 3PVUB 5FXYA 3OKTA 3N0DA 2CO0A 4GM8A 2OVRB 4JSNC 3IKOA 5B4WA 3UKRC 4GM3A 3OTTA 4EWRA 1OMWB 4ZOZA 5EMJB 3UVMA 4X3EA 2PM9B 5IGOA 3JZHA 2P9PC 1PEVA 3MXXA 2I0RA 3GFCA 4FA1D 4K3JB 3SCYA 3RN1D 1P22A 3CFSB 3FGBA 4J0WA 3MKSB 3ZWLB 3IJCA 1PBYB 4O3TB 3I7OA 4ERZA 4FAND 2GC7A 2OJYA 3BWSA 3PXSD 4E5ZA 2B5MA 5EAMA 3SBPA 1TBGA 2YNOA 4QRJA 5IJ7E 4A2LA 3OKYB 2CN3A 5GMKn 2IUPA 3I7PA 3SXTD 4OZUA 5HYNB 3I7LA 3DXMC 3MZLA 3AFCA 4GQBB 1SQJA 3VA6A 1NR0A 4UI9R 4FB1D 3AH8B 4LG9A 4ERQA 4FA4D 1GOTB 5SXMA 3DXKC 3EI2A 1JMZB 5AJAA 3F3PA 5GSAA 4PXWA 5HE2B 5FA5B 4A0AA 4QL1A 4G56B 3EI3B 3I2NA 3EI1B 1JOFA 3CIKB 3JRPA 2QC5A 3UVLA 2G9AA 3A0FA 4J78A 5GXIA 2H6KA 1U4CA 2UZYB 4H5JA 2OK6A 4BH6A 2XL3A 4CI8A 4K3ID 4GGDA 4O45A 3I7KA 4A09B 1L0QA 4GZ8A 5HQGA 2GNQA 2AGLA 4JSXC 3PE7A 3J80g 5IGQA 4ZOYA 2H9MA 2I3SA 4E54B 5CXBB 4ZOVA 4J86A 3L4OD 4QQEA 1U2VC 3EU7A 4J81A 4A7JA 3JB9L 1VYHC 3UR4A 1R5MA 3C99A 3OL2A 2AGYA 4HDJA 4A11A 2I3TA 3DM0A 2P9IC 2CNXA 3F3GA 2IURA 1JJUB 2G99A 2GC4A 2PM7B 3FM0A 5EM2A 5EMKB 5C2WB 2XYIA 2YNNA 4FA5D 2P9UC 3JPXA 4J73A 1YFQA 4CZYA 3F3FA 4IMMA 1JMXB 2HJBA 2IAAA 5EARA 3OW8A 4GGAA 3K27A 3C9CA 2H68A 3U4YA 5AFU3 3V7DB 4CI3A 2CN2A 1PGUA 3CFVA 5H17A 3NVQA 5IC7A 5IT9g 4H5IA 2B5LA 1N6DA 3ORVD 4CI2A 3SN6B 2BBKH 2OVQB 4ERYA 3IIYA 5EMMB 4J77A 5GXHA 4ZOXA 3RLMD 5CXCB 1Q47A 3I89A 5KDOB 4Y5RD 5HE0B 3UVOA 3K26A 4IA9A 4R7AB 3UVNA 3SMRA 2YNPA 5TF2A 3BG1A 3W15A 2Z2PA 4J84A 4FWWA 3UKUC 5EALA 2I0TA 4J82A 4NSXA 4CZVA 2Z2OA 4J79A 4PSWB 5I5IA 2B5NA 4MK0B 3IJ0A 4JT5C 2H9LA 2YMUA 4PBYA 4CY1A 3AL8B 2AGZA 2P9SC 3EG6A 4JSVC 5AMSA 3SJLD 3IJ1A 4X60B 4J87A 4CY3A 2AGWA 3N0EA 2I0SA 4A11B 5C2VB 2IWKA 1K32A 2CE8A 3RN0D 4X63B 3GREA 4GMBA 2HYEA 1N6FA 5EM2B 3SWSD 4Z8LA 2HKMA 2TRCB 5H14A 5FKTA 4A2MA 5TDHB 4CC9A 2P9NC 3OKYA 3EWEA 3SBQA 2IWFA 4N14A 5JWZA 5EAPA 4L1QD 4YVDA 3JAMg 4J8GA 4CZXA 3VGZA 3HFQA 1SHYB 5EMLB 1MG3A 4JT6C 2AH1A 5FQDA 5CYKA 3ODTA 3RMZD 2Q7QA 2PM6B 4A0BA 4A08A 4ES0A 4PSXB 5FKRA 1SQ9A 2H14A 3JZNA 4O1QD 2QXVA 3PVWB 2H6NA 2MTAH 2HJ4A 1A0RB 2BCJB 4JSPC 3SBRA 5A2Qg 2YBAA 5IJ8E 1N6EA 4A09A 5FKSA 2EBSA 4OWRA 2CE9A
chains in the Genus database with same CATH superfamily
3ZDZA 1QNIA 4AX4A 3C5MA 1FWXA 4E5ZB 3V4VA 2HKRA 2B4EA 1O6FA 5CXBA 5C9ZB 3EI4A 1K8KC 4OWRA 2OIZA 3NVXA 3KRXB 5H1MA 4KFMB 3P4FA 1H2WA 4LGNA 3L4MD 1GOGA 3PXTD 3SHFA 1H2XA 4PBZA 3KRWB 4L3GD 3DSMA 3NIGA 2AQ5A 3RSEC 4BP8A 4WK4A 2AH0A 5I5MA 2XL2A 3VI4A 3JROA 3EI2B 3EMHA 4LG8A 4AN1A 2O9KA 4BP9A 4O3UB 3MMYA 2P9KC 2OVPB 4J0XA 4XYIA 4A0AB 2EIBA 3I7HA 4JXMA 3VH0A 2J55H 3SLED 4FAVD 1XKSA 3C75H 5TEFA 4PNKB 2HESX 5TEEA 1NEXB 2YB8B 3I8CA 3E0CA 5HE3B 5I5JA 4XYHA 5C86A 2CO0C 4CY5A 4CY2A 1E8MA 3J81g 1GG2B 3PSCB 1M1XA 4GM9A 1K3IA 2H9NA 4J8BA 2IUVA 3OKWA 4TZ4A 2PM9A 1MDAH 1GP2B 5FKQA 2AGXA 2J57G 5THAA 4ESGA 3IJEA 1C9LA 3B7FA 3FRXA 1OLZA 5K19A 5FFGA 3NVNA 5M61A 3IIWA 2Z2NA 4GQ2P 1B9YA 3AL9A 3OL2B 3BG0A 5HDBA 3PXWD 2H13A 1ERJA 2PBIB 1VE6A 2H47A 3V9FA 4FA9D 5HE1B 4FHLA 1RI6A 1TYEA 5CXCA 5CYKB 3MVDK 4ZN4A 4CI1A 5K1CC 4Y7RA 4BL0A 5M5RA 2P9LC 4D6VA 3IUNA 4A0BB 4A08B 2HU7A 4AOWA 3JZGA 1BPOA 4O9DA 4D0KA 3IUJA 1GXRA 3KCIA 4BUJC 4RE5A 2W18A 3ZE2A 2H3XA 3PSLA 3ULEC 4NC4A 4U7AA 3RFGA 2QR5A 3UVKA 4D9SA 4XEIC 2UZXB 2H6QA 1UTCA 3RFHA 3MZKA 1MG2A 1XHMA 3DWLC 3SVWD 2JKXA 3AL8A 4L3HD 3SFZA 2OK4A 3EI4B 4AEZA 1XIPA 2IUQA 2H9PA 1PI6A 2XU7A 3EI3A 4JD2C 3NIFA 4PC0A 3EI1A 4I79A 3I8EA 4U1EI 4GQ1A 5FFOA 2XE4A 2HXCA 2EIDA 4QT8A 5E6UA 3RRMC 1TYQC 4O2WA 3MKQA 4GGCA 4DNUA 2J56H 3V5WB 1S4UX 4X61B 5E6SA 4JHPC 3I7NA 1B9XA 4L9OA 5FLXg 4E54A 3PVUB 5M5UA 5FXYA 3OKTA 3N0DA 4BCBA 2CO0A 4GM8A 2OVRB 4JSNC 3IKOA 5B4WA 3UKRC 4GM3A 4UM9A 3OTTA 4EWRA 1OMWB 4ZOZA 5EMJB 1E8NA 4DNVA 3K71A 3UVMA 4X3EA 2QZPA 2PM9B 5IGOA 3JZHA 2P9PC 1UOQA 1PEVA 1UOPA 3MXXA 2I0RA 3GFCA 1QFSA 4AMYA 4FA1D 4K3JB 5M5VA 3SCYA 3RN1D 1P22A 3T3MA 1E5TA 3CFSB 3FGBA 4J0WA 3O4JA 3MKSB 3ZWLB 3IJCA 1PBYB 4O3TB 3I7OA 4ERZA 3FCUA 3O4IA 2VDNA 4FAND 2GC7A 2OJYA 3BWSA 3PXSD 4E5ZA 3T3PA 2B5MA 5EAMA 3SBPA 1TBGA 2YNOA 4QRJA 4MMYA 5IJ7E 4A2LA 3OKYB 2CN3A 2VDPA 5GMKn 2IUPA 2VDMA 3O4HA 3I7PA 3SXTD 4AMZA 4OZUA 5HYNB 3I7LA 3DXMC 3MZLA 3AFCA 2VDKA 4GQBB 1SQJA 3VA6A 1NR0A 4UI9R 4FB1D 3AH8B 4LG9A 3O4GA 4ERQA 4FA4D 1GOTB 5SXMA 3DXKC 3EI2A 4G1EA 1JMZB 5AJAA 3F3PA 1GOFA 5GSAA 4PXWA 5HE2B 5FA5B 4A0AA 4QL1A 4G56B 3EI3B 3I2NA 3EI1B 1JOFA 4BCDA 4BCCA 3CIKB 3JRPA 2QC5A 3UVLA 2VZ3A 1L5GA 2G9AA 3A0FA 4J78A 5GXIA 2H6KA 1U4CA 2UZYB 4WJKA 4Z7QA 4IRZA 4H5JA 2OK6A 4BH6A 2XL3A 4CI8A 4GGDA 4O45A 3I7KA 4A09B 1L0QA 2XZGA 4GZ8A 5HQGA 2GNQA 2AGLA 4JSXC 3PE7A 3J80g 5IGQA 4ZOYA 2H9MA 2I3SA 4E54B 2VDRA 5CXBB 4ZOVA 4J86A 3L4OD 4QQEA 1U2VC 3IVMA 3EU7A 4J81A 4A7JA 3JB9L 1VYHC 3UR4A 1R5MA 3C99A 3OL2A 4UM8A 2AGYA 4HDJA 4A11A 2I3TA 3DM0A 2P9IC 2CNXA 4AN0A 3F3GA 2IURA 4NAAA 1JJUB 2G99A 2GC4A 3OF7A 2PM7B 3FM0A 5EM2A 2WQ8A 5EMKB 5C2WB 2XYIA 4WK2A 4WK0A 2YNNA 3QHYB 3ZE0A 3ZDXA 4FA5D 3VI3A 2P9UC 3JPXA 4J73A 4MMZA 3K6SA 3ZDYA 1YFQA 4RE6A 4QAMA 2VDOA 4CZYA 3F3FA 4IMMA 1JMXB 2HJBA 2IAAA 5EARA 3OW8A 4GGAA 1VZ2A 2XDWA 3K27A 3C9CA 2H68A 3U4YA 5AFU3 1VZ3A 4NBMA 3V7DB 4G1MA 4CI3A 1O6GA 2CN2A 1PGUA 3CFVA 4Z7OA 5H17A 1A12A 3NVQA 5IC7A 3GC3B 5IT9g 4JHNA 3IUMA 1H2ZA 3IULA 4H5IA 2B5LA 1N6DA 3ORVD 4CI2A 3ZE1A 3SN6B 2BBKH 2OVQB 4ERYA 3IIYA 5EMMB 4MMXA 2VZ1A 4G55A 4J77A 5GXHA 2VC2A 3EQ9A 1U8CA 4ZOXA 3RLMD 5CXCB 1Q47A 1QFMA 3I89A 2HU5A 5KDOB 4Y5RD 5HE0B 3UVOA 3K26A 4IA9A 4R7AB 3UVNA 3SMRA 2YNPA 5TF2A 3BG1A 3W15A 1UOOA 2Z2PA 4J84A 1H2YA 3EQ8A 4FWWA 3UKUC 5EALA 2I0TA 4J82A 4NSXA 4CZVA 2Z2OA 4J79A 4PSWB 2EICA 5I5IA 2B5NA 2HU8A 4MK0B 3IJ0A 4O02A 4JT5C 2H9LA 4DNWA 2YMUA 5E6RA 3DDUA 4PBYA 2VDQA 4CY1A 3AL8B 2AGZA 2P9SC 3EG6A 4JSVC 5M5TA 1I2MB 1VE7A 2BKLA 5AMSA 3SJLD 3IJ1A 4X60B 4J87A 1C9IA 4CY3A 2AGWA 3N0EA 2I0SA 4L1MA 3MUNA 4A11B 5C2VB 1T2XA 2IWKA 1K32A 2CE8A 3RN0D 4X63B 3GREA 3IURA 4GMBA 2HYEA 1N6FA 5EM2B 3SWSD 3V4PA 4Z8LA 3QI0A 3GD1I 2HKMA 2TRCB 5H14A 5FKTA 4A2MA 5M5SA 3EQ7A 5TDHB 4CC9A 2P9NC 3OKYA 3NIDA 3EWEA 3SBQA 3K72A 2IWFA 3MUOA 4N14A 1JTDB 5EAPA 5JWZA 3FCSA 4L1QD 4YVDA 3JAMg 4J8GA 4CZXA 3VGZA 3HFQA 1SHYB 1YR2A 5EMLB 1MG3A 4JT6C 2AH1A 3IUQA 5FQDA 5CYKA 3ODTA 3RMZD 2VDLA 2Q7QA 2PM6B 4A0BA 4A08A 4ES0A 4PSXB 5C92A 5FKRA 1SQ9A 2H14A 3JZNA 4O1QD 2QXVA 1JV2A 2H6NA 2MTAH 3PVWB 2HJ4A 1A0RB 2BCJB 4JSPC 3SBRA 5A2Qg 2YBAA 4Z7NA 5IJ8E 1N6EA 4A09A 5FKSA 2EIEA 1GOHA 4NENA 2EBSA 4K3ID 2CE9A
chains in the Genus database with same CATH topology
1QNIA 3C5MA 1FWXA 4E5ZB 2HKRA 2B4EA 5CXBA 5C9ZB 3EI4A 1K8KC 2OIZA 3NVXA 3KRXB 5H1MA 4KFMB 3P4FA 4LGNA 3L4MD 3PXTD 3SHFA 4PBZA 3KRWB 4L3GD 3DSMA 2AQ5A 3RSEC 2AH0A 5I5MA 2XL2A 3JROA 3EI2B 3EMHA 4LG8A 2O9KA 4O3UB 3MMYA 2P9KC 2OVPB 4J0XA 4XYIA 4A0AB 3I7HA 4JXMA 3VH0A 2J55H 3SLED 4FAVD 1XKSA 3C75H 5TEFA 4PNKB 2HESX 5TEEA 1NEXB 2YB8B 3I8CA 3E0CA 5HE3B 5I5JA 4XYHA 2CO0C 4CY5A 4CY2A 3J81g 1GG2B 3PSCB 4GM9A 2H9NA 4J8BA 2IUVA 3OKWA 4TZ4A 2PM9A 1MDAH 1GP2B 5FKQA 2AGXA 2J57G 5THAA 4ESGA 3B7FA 3FRXA 1OLZA 5K19A 3NVNA 3IIWA 4GQ2P 2Z2NA 1B9YA 3AL9A 3OL2B 3BG0A 3PXWD 2H13A 1ERJA 2PBIB 2H47A 3V9FA 4FA9D 5HE1B 4FHLA 1RI6A 5CYKB 5CXCA 4ZN4A 4CI1A 5K1CC 4Y7RA 4BL0A 2P9LC 4D6VA 4A0BB 4A08B 4AOWA 3JZGA 4O9DA 4D0KA 1GXRA 4BUJC 2W18A 2H3XA 3PSLA 3ULEC 4U7AA 3RFGA 3UVKA 4XEIC 2UZXB 2H6QA 3RFHA 3MZKA 1MG2A 1XHMA 3DWLC 3SVWD 3AL8A 4L3HD 3SFZA 2OK4A 3EI4B 4AEZA 1XIPA 2IUQA 2H9PA 1PI6A 2XU7A 3EI3A 4JD2C 4PC0A 3EI1A 4I79A 3I8EA 4U1EI 4GQ1A 2HXCA 4QT8A 3RRMC 1TYQC 3MKQA 4GGCA 2J56H 3V5WB 1S4UX 4X61B 3I7NA 1B9XA 4L9OA 5FLXg 4E54A 3PVUB 5FXYA 3OKTA 3N0DA 2CO0A 4GM8A 2OVRB 4JSNC 3IKOA 5B4WA 3UKRC 4GM3A 3OTTA 4EWRA 1OMWB 4ZOZA 5EMJB 3UVMA 4X3EA 2PM9B 5IGOA 3JZHA 2P9PC 1PEVA 3MXXA 2I0RA 3GFCA 4FA1D 4K3JB 3SCYA 3RN1D 1P22A 3CFSB 3FGBA 4J0WA 3MKSB 3ZWLB 3IJCA 1PBYB 4O3TB 3I7OA 4ERZA 4FAND 2GC7A 2OJYA 3BWSA 3PXSD 4E5ZA 2B5MA 5EAMA 3SBPA 1TBGA 2YNOA 4QRJA 5IJ7E 4A2LA 3OKYB 2CN3A 5GMKn 2IUPA 3I7PA 3SXTD 4OZUA 5HYNB 3I7LA 3DXMC 3MZLA 3AFCA 4GQBB 1SQJA 3VA6A 1NR0A 4UI9R 4FB1D 3AH8B 4LG9A 4ERQA 4FA4D 1GOTB 5SXMA 3DXKC 3EI2A 1JMZB 5AJAA 3F3PA 5GSAA 4PXWA 5HE2B 5FA5B 4A0AA 4QL1A 4G56B 3EI3B 3I2NA 3EI1B 1JOFA 3CIKB 3JRPA 2QC5A 3UVLA 2G9AA 3A0FA 4J78A 5GXIA 2H6KA 1U4CA 2UZYB 4H5JA 2OK6A 4BH6A 2XL3A 4CI8A 4K3ID 4GGDA 4O45A 3I7KA 4A09B 1L0QA 4GZ8A 5HQGA 2GNQA 2AGLA 4JSXC 3PE7A 3J80g 5IGQA 4ZOYA 2H9MA 2I3SA 4E54B 5CXBB 4ZOVA 4J86A 3L4OD 4QQEA 1U2VC 3EU7A 4J81A 4A7JA 3JB9L 1VYHC 3UR4A 1R5MA 3C99A 3OL2A 2AGYA 4HDJA 4A11A 2I3TA 3DM0A 2P9IC 2CNXA 3F3GA 2IURA 1JJUB 2G99A 2GC4A 2PM7B 3FM0A 5EM2A 5EMKB 5C2WB 2XYIA 2YNNA 4FA5D 2P9UC 3JPXA 4J73A 1YFQA 4CZYA 3F3FA 4IMMA 1JMXB 2HJBA 2IAAA 5EARA 3OW8A 4GGAA 3K27A 3C9CA 2H68A 3U4YA 5AFU3 3V7DB 4CI3A 2CN2A 1PGUA 3CFVA 5H17A 3NVQA 5IC7A 5IT9g 4H5IA 2B5LA 1N6DA 3ORVD 4CI2A 3SN6B 2BBKH 2OVQB 4ERYA 3IIYA 5EMMB 4J77A 5GXHA 4ZOXA 3RLMD 5CXCB 1Q47A 3I89A 5KDOB 4Y5RD 5HE0B 3UVOA 3K26A 4IA9A 4R7AB 3UVNA 3SMRA 2YNPA 5TF2A 3BG1A 3W15A 2Z2PA 4J84A 4FWWA 3UKUC 5EALA 2I0TA 4J82A 4NSXA 4CZVA 2Z2OA 4J79A 4PSWB 5I5IA 2B5NA 4MK0B 3IJ0A 4JT5C 2H9LA 2YMUA 4PBYA 4CY1A 3AL8B 2AGZA 2P9SC 3EG6A 4JSVC 5AMSA 3SJLD 3IJ1A 4X60B 4J87A 4CY3A 2AGWA 3N0EA 2I0SA 4A11B 5C2VB 2IWKA 1K32A 2CE8A 3RN0D 4X63B 3GREA 4GMBA 2HYEA 1N6FA 5EM2B 3SWSD 4Z8LA 2HKMA 2TRCB 5H14A 5FKTA 4A2MA 5TDHB 4CC9A 2P9NC 3OKYA 3EWEA 3SBQA 2IWFA 4N14A 5JWZA 5EAPA 4L1QD 4YVDA 3JAMg 4J8GA 4CZXA 3VGZA 3HFQA 1SHYB 5EMLB 1MG3A 4JT6C 2AH1A 5FQDA 5CYKA 3ODTA 3RMZD 2Q7QA 2PM6B 4A0BA 4A08A 4ES0A 4PSXB 5FKRA 1SQ9A 2H14A 3JZNA 4O1QD 2QXVA 3PVWB 2H6NA 2MTAH 2HJ4A 1A0RB 2BCJB 4JSPC 3SBRA 5A2Qg 2YBAA 5IJ8E 1N6EA 4A09A 5FKSA 2EBSA 4OWRA 2CE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QNI A;  3C5M A;  1FWX A;  4E5Z B;  2HKR A;  2B4E A;  5CXB A;  5C9Z B;  3EI4 A;  1K8K C;  2OIZ A;  3NVX A;  3KRX B;  5H1M A;  4KFM B;  3P4F A;  4LGN A;  3L4M D;  3PXT D;  3SHF A;  4PBZ A;  3KRW B;  4L3G D;  3DSM A;  2AQ5 A;  3RSE C;  2AH0 A;  5I5M A;  2XL2 A;  3JRO A;  3EI2 B;  3EMH A;  4LG8 A;  2O9K A;  4O3U B;  3MMY A;  2P9K C;  2OVP B;  4J0X A;  4XYI A;  4A0A B;  3I7H A;  4JXM A;  3VH0 A;  2J55 H;  3SLE D;  4FAV D;  1XKS A;  3C75 H;  5TEF A;  4PNK B;  2HES X;  5TEE A;  1NEX B;  2YB8 B;  3I8C A;  3E0C A;  5HE3 B;  5I5J A;  4XYH A;  2CO0 C;  4CY5 A;  4CY2 A;  3J81 g;  1GG2 B;  3PSC B;  4GM9 A;  2H9N A;  4J8B A;  2IUV A;  3OKW A;  4TZ4 A;  2PM9 A;  1MDA H;  1GP2 B;  5FKQ A;  2AGX A;  2J57 G;  5THA A;  4ESG A;  3B7F A;  3FRX A;  1OLZ A;  5K19 A;  3NVN A;  3IIW A;  4GQ2 P;  2Z2N A;  1B9Y A;  3AL9 A;  3OL2 B;  3BG0 A;  3PXW D;  2H13 A;  1ERJ A;  2PBI B;  2H47 A;  3V9F A;  4FA9 D;  5HE1 B;  4FHL A;  1RI6 A;  5CYK B;  5CXC A;  4ZN4 A;  4CI1 A;  5K1C C;  4Y7R A;  4BL0 A;  2P9L C;  4D6V A;  4A0B B;  4A08 B;  4AOW A;  3JZG A;  4O9D A;  4D0K A;  1GXR A;  4BUJ C;  2W18 A;  2H3X A;  3PSL A;  3ULE C;  4U7A A;  3RFG A;  3UVK A;  4XEI C;  2UZX B;  2H6Q A;  3RFH A;  3MZK A;  1MG2 A;  1XHM A;  3DWL C;  3SVW D;  3AL8 A;  4L3H D;  3SFZ A;  2OK4 A;  3EI4 B;  4AEZ A;  1XIP A;  2IUQ A;  2H9P A;  1PI6 A;  2XU7 A;  3EI3 A;  4JD2 C;  4PC0 A;  3EI1 A;  4I79 A;  3I8E A;  4U1E I;  4GQ1 A;  2HXC A;  4QT8 A;  3RRM C;  1TYQ C;  3MKQ A;  4GGC A;  2J56 H;  3V5W B;  1S4U X;  4X61 B;  3I7N A;  1B9X A;  4L9O A;  5FLX g;  4E54 A;  3PVU B;  5FXY A;  3OKT A;  3N0D A;  2CO0 A;  4GM8 A;  2OVR B;  4JSN C;  3IKO A;  5B4W A;  3UKR C;  4GM3 A;  3OTT A;  4EWR A;  1OMW B;  4ZOZ A;  5EMJ B;  3UVM A;  4X3E A;  2PM9 B;  5IGO A;  3JZH A;  2P9P C;  1PEV A;  3MXX A;  2I0R A;  3GFC A;  4FA1 D;  4K3J B;  3SCY A;  3RN1 D;  1P22 A;  3CFS B;  3FGB A;  4J0W A;  3MKS B;  3ZWL B;  3IJC A;  1PBY B;  4O3T B;  3I7O A;  4ERZ A;  4FAN D;  2GC7 A;  2OJY A;  3BWS A;  3PXS D;  4E5Z A;  2B5M A;  5EAM A;  3SBP A;  1TBG A;  2YNO A;  4QRJ A;  5IJ7 E;  4A2L A;  3OKY B;  2CN3 A;  5GMK n;  2IUP A;  3I7P A;  3SXT D;  4OZU A;  5HYN B;  3I7L A;  3DXM C;  3MZL A;  3AFC A;  4GQB B;  1SQJ A;  3VA6 A;  1NR0 A;  4UI9 R;  4FB1 D;  3AH8 B;  4LG9 A;  4ERQ A;  4FA4 D;  1GOT B;  5SXM A;  3DXK C;  3EI2 A;  1JMZ B;  5AJA A;  3F3P A;  5GSA A;  4PXW A;  5HE2 B;  5FA5 B;  4A0A A;  4QL1 A;  4G56 B;  3EI3 B;  3I2N A;  3EI1 B;  1JOF A;  3CIK B;  3JRP A;  2QC5 A;  3UVL A;  2G9A A;  3A0F A;  4J78 A;  5GXI A;  2H6K A;  1U4C A;  2UZY B;  4H5J A;  2OK6 A;  4BH6 A;  2XL3 A;  4CI8 A;  4K3I D;  4GGD A;  4O45 A;  3I7K A;  4A09 B;  1L0Q A;  4GZ8 A;  5HQG A;  2GNQ A;  2AGL A;  4JSX C;  3PE7 A;  3J80 g;  5IGQ A;  4ZOY A;  2H9M A;  2I3S A;  4E54 B;  5CXB B;  4ZOV A;  4J86 A;  3L4O D;  4QQE A;  1U2V C;  3EU7 A;  4J81 A;  4A7J A;  3JB9 L;  1VYH C;  3UR4 A;  1R5M A;  3C99 A;  3OL2 A;  2AGY A;  4HDJ A;  4A11 A;  2I3T A;  3DM0 A;  2P9I C;  2CNX A;  3F3G A;  2IUR A;  1JJU B;  2G99 A;  2GC4 A;  2PM7 B;  3FM0 A;  5EM2 A;  5EMK B;  5C2W B;  2XYI A;  2YNN A;  4FA5 D;  2P9U C;  3JPX A;  4J73 A;  1YFQ A;  4CZY A;  3F3F A;  4IMM A;  1JMX B;  2HJB A;  2IAA A;  5EAR A;  3OW8 A;  4GGA A;  3K27 A;  3C9C A;  2H68 A;  3U4Y A;  5AFU 3;  3V7D B;  4CI3 A;  2CN2 A;  1PGU A;  3CFV A;  5H17 A;  3NVQ A;  5IC7 A;  5IT9 g;  4H5I A;  2B5L A;  1N6D A;  3ORV D;  4CI2 A;  3SN6 B;  2BBK H;  2OVQ B;  4ERY A;  3IIY A;  5EMM B;  4J77 A;  5GXH A;  4ZOX A;  3RLM D;  5CXC B;  1Q47 A;  3I89 A;  5KDO B;  4Y5R D;  5HE0 B;  3UVO A;  3K26 A;  4IA9 A;  4R7A B;  3UVN A;  3SMR A;  2YNP A;  5TF2 A;  3BG1 A;  3W15 A;  2Z2P A;  4J84 A;  4FWW A;  3UKU C;  5EAL A;  2I0T A;  4J82 A;  4NSX A;  4CZV A;  2Z2O A;  4J79 A;  4PSW B;  5I5I A;  2B5N A;  4MK0 B;  3IJ0 A;  4JT5 C;  2H9L A;  2YMU A;  4PBY A;  4CY1 A;  3AL8 B;  2AGZ A;  2P9S C;  3EG6 A;  4JSV C;  5AMS A;  3SJL D;  3IJ1 A;  4X60 B;  4J87 A;  4CY3 A;  2AGW A;  3N0E A;  2I0S A;  4A11 B;  5C2V B;  2IWK A;  1K32 A;  2CE8 A;  3RN0 D;  4X63 B;  3GRE A;  4GMB A;  2HYE A;  1N6F A;  5EM2 B;  3SWS D;  4Z8L A;  2HKM A;  2TRC B;  5H14 A;  5FKT A;  4A2M A;  5TDH B;  4CC9 A;  2P9N C;  3OKY A;  3EWE A;  3SBQ A;  2IWF A;  4N14 A;  5JWZ A;  5EAP A;  4L1Q D;  4YVD A;  3JAM g;  4J8G A;  4CZX A;  3VGZ A;  3HFQ A;  1SHY B;  5EML B;  1MG3 A;  4JT6 C;  2AH1 A;  5FQD A;  5CYK A;  3ODT A;  3RMZ D;  2Q7Q A;  2PM6 B;  4A0B A;  4A08 A;  4ES0 A;  4PSX B;  5FKR A;  1SQ9 A;  2H14 A;  3JZN A;  4O1Q D;  2QXV A;  3PVW B;  2H6N A;  2MTA H;  2HJ4 A;  1A0R B;  2BCJ B;  4JSP C;  3SBR A;  5A2Q g;  2YBA A;  5IJ8 E;  1N6E A;  4A09 A;  5FKS A;  2EBS A;  4OWR A;  2CE9 A; 
#chains in the Genus database with same CATH topology
 3ZDZ A;  1QNI A;  4AX4 A;  3C5M A;  1FWX A;  4E5Z B;  3V4V A;  2HKR A;  2B4E A;  1O6F A;  5CXB A;  5C9Z B;  3EI4 A;  1K8K C;  4OWR A;  2OIZ A;  3NVX A;  3KRX B;  5H1M A;  4KFM B;  3P4F A;  1H2W A;  4LGN A;  3L4M D;  1GOG A;  3PXT D;  3SHF A;  1H2X A;  4PBZ A;  3KRW B;  4L3G D;  3DSM A;  3NIG A;  2AQ5 A;  3RSE C;  4BP8 A;  4WK4 A;  2AH0 A;  5I5M A;  2XL2 A;  3VI4 A;  3JRO A;  3EI2 B;  3EMH A;  4LG8 A;  4AN1 A;  2O9K A;  4BP9 A;  4O3U B;  3MMY A;  2P9K C;  2OVP B;  4J0X A;  4XYI A;  4A0A B;  2EIB A;  3I7H A;  4JXM A;  3VH0 A;  2J55 H;  3SLE D;  4FAV D;  1XKS A;  3C75 H;  5TEF A;  4PNK B;  2HES X;  5TEE A;  1NEX B;  2YB8 B;  3I8C A;  3E0C A;  5HE3 B;  5I5J A;  4XYH A;  5C86 A;  2CO0 C;  4CY5 A;  4CY2 A;  1E8M A;  3J81 g;  1GG2 B;  3PSC B;  1M1X A;  4GM9 A;  1K3I A;  2H9N A;  4J8B A;  2IUV A;  3OKW A;  4TZ4 A;  2PM9 A;  1MDA H;  1GP2 B;  5FKQ A;  2AGX A;  2J57 G;  5THA A;  4ESG A;  3IJE A;  1C9L A;  3B7F A;  3FRX A;  1OLZ A;  5K19 A;  5FFG A;  3NVN A;  5M61 A;  3IIW A;  2Z2N A;  4GQ2 P;  1B9Y A;  3AL9 A;  3OL2 B;  3BG0 A;  5HDB A;  3PXW D;  2H13 A;  1ERJ A;  2PBI B;  1VE6 A;  2H47 A;  3V9F A;  4FA9 D;  5HE1 B;  4FHL A;  1RI6 A;  1TYE A;  5CXC A;  5CYK B;  3MVD K;  4ZN4 A;  4CI1 A;  5K1C C;  4Y7R A;  4BL0 A;  5M5R A;  2P9L C;  4D6V A;  3IUN A;  4A0B B;  4A08 B;  2HU7 A;  4AOW A;  3JZG A;  1BPO A;  4O9D A;  4D0K A;  3IUJ A;  1GXR A;  3KCI A;  4BUJ C;  4RE5 A;  2W18 A;  3ZE2 A;  2H3X A;  3PSL A;  3ULE C;  4NC4 A;  4U7A A;  3RFG A;  2QR5 A;  3UVK A;  4D9S A;  4XEI C;  2UZX B;  2H6Q A;  1UTC A;  3RFH A;  3MZK A;  1MG2 A;  1XHM A;  3DWL C;  3SVW D;  2JKX A;  3AL8 A;  4L3H D;  3SFZ A;  2OK4 A;  3EI4 B;  4AEZ A;  1XIP A;  2IUQ A;  2H9P A;  1PI6 A;  2XU7 A;  3EI3 A;  4JD2 C;  3NIF A;  4PC0 A;  3EI1 A;  4I79 A;  3I8E A;  4U1E I;  4GQ1 A;  5FFO A;  2XE4 A;  2HXC A;  2EID A;  4QT8 A;  5E6U A;  3RRM C;  1TYQ C;  4O2W A;  3MKQ A;  4GGC A;  4DNU A;  2J56 H;  3V5W B;  1S4U X;  4X61 B;  5E6S A;  4JHP C;  3I7N A;  1B9X A;  4L9O A;  5FLX g;  4E54 A;  3PVU B;  5M5U A;  5FXY A;  3OKT A;  3N0D A;  4BCB A;  2CO0 A;  4GM8 A;  2OVR B;  4JSN C;  3IKO A;  5B4W A;  3UKR C;  4GM3 A;  4UM9 A;  3OTT A;  4EWR A;  1OMW B;  4ZOZ A;  5EMJ B;  1E8N A;  4DNV A;  3K71 A;  3UVM A;  4X3E A;  2QZP A;  2PM9 B;  5IGO A;  3JZH A;  2P9P C;  1UOQ A;  1PEV A;  1UOP A;  3MXX A;  2I0R A;  3GFC A;  1QFS A;  4AMY A;  4FA1 D;  4K3J B;  5M5V A;  3SCY A;  3RN1 D;  1P22 A;  3T3M A;  1E5T A;  3CFS B;  3FGB A;  4J0W A;  3O4J A;  3MKS B;  3ZWL B;  3IJC A;  1PBY B;  4O3T B;  3I7O A;  4ERZ A;  3FCU A;  3O4I A;  2VDN A;  4FAN D;  2GC7 A;  2OJY A;  3BWS A;  3PXS D;  4E5Z A;  3T3P A;  2B5M A;  5EAM A;  3SBP A;  1TBG A;  2YNO A;  4QRJ A;  4MMY A;  5IJ7 E;  4A2L A;  3OKY B;  2CN3 A;  2VDP A;  5GMK n;  2IUP A;  2VDM A;  3O4H A;  3I7P A;  3SXT D;  4AMZ A;  4OZU A;  5HYN B;  3I7L A;  3DXM C;  3MZL A;  3AFC A;  2VDK A;  4GQB B;  1SQJ A;  3VA6 A;  1NR0 A;  4UI9 R;  4FB1 D;  3AH8 B;  4LG9 A;  3O4G A;  4ERQ A;  4FA4 D;  1GOT B;  5SXM A;  3DXK C;  3EI2 A;  4G1E A;  1JMZ B;  5AJA A;  3F3P A;  1GOF A;  5GSA A;  4PXW A;  5HE2 B;  5FA5 B;  4A0A A;  4QL1 A;  4G56 B;  3EI3 B;  3I2N A;  3EI1 B;  1JOF A;  4BCD A;  4BCC A;  3CIK B;  3JRP A;  2QC5 A;  3UVL A;  2VZ3 A;  1L5G A;  2G9A A;  3A0F A;  4J78 A;  5GXI A;  2H6K A;  1U4C A;  2UZY B;  4WJK A;  4Z7Q A;  4IRZ A;  4H5J A;  2OK6 A;  4BH6 A;  2XL3 A;  4CI8 A;  4GGD A;  4O45 A;  3I7K A;  4A09 B;  1L0Q A;  2XZG A;  4GZ8 A;  5HQG A;  2GNQ A;  2AGL A;  4JSX C;  3PE7 A;  3J80 g;  5IGQ A;  4ZOY A;  2H9M A;  2I3S A;  4E54 B;  2VDR A;  5CXB B;  4ZOV A;  4J86 A;  3L4O D;  4QQE A;  1U2V C;  3IVM A;  3EU7 A;  4J81 A;  4A7J A;  3JB9 L;  1VYH C;  3UR4 A;  1R5M A;  3C99 A;  3OL2 A;  4UM8 A;  2AGY A;  4HDJ A;  4A11 A;  2I3T A;  3DM0 A;  2P9I C;  2CNX A;  4AN0 A;  3F3G A;  2IUR A;  4NAA A;  1JJU B;  2G99 A;  2GC4 A;  3OF7 A;  2PM7 B;  3FM0 A;  5EM2 A;  2WQ8 A;  5EMK B;  5C2W B;  2XYI A;  4WK2 A;  4WK0 A;  2YNN A;  3QHY B;  3ZE0 A;  3ZDX A;  4FA5 D;  3VI3 A;  2P9U C;  3JPX A;  4J73 A;  4MMZ A;  3K6S A;  3ZDY A;  1YFQ A;  4RE6 A;  4QAM A;  2VDO A;  4CZY A;  3F3F A;  4IMM A;  1JMX B;  2HJB A;  2IAA A;  5EAR A;  3OW8 A;  4GGA A;  1VZ2 A;  2XDW A;  3K27 A;  3C9C A;  2H68 A;  3U4Y A;  5AFU 3;  1VZ3 A;  4NBM A;  3V7D B;  4G1M A;  4CI3 A;  1O6G A;  2CN2 A;  1PGU A;  3CFV A;  4Z7O A;  5H17 A;  1A12 A;  3NVQ A;  5IC7 A;  3GC3 B;  5IT9 g;  4JHN A;  3IUM A;  1H2Z A;  3IUL A;  4H5I A;  2B5L A;  1N6D A;  3ORV D;  4CI2 A;  3ZE1 A;  3SN6 B;  2BBK H;  2OVQ B;  4ERY A;  3IIY A;  5EMM B;  4MMX A;  2VZ1 A;  4G55 A;  4J77 A;  5GXH A;  2VC2 A;  3EQ9 A;  1U8C A;  4ZOX A;  3RLM D;  5CXC B;  1Q47 A;  1QFM A;  3I89 A;  2HU5 A;  5KDO B;  4Y5R D;  5HE0 B;  3UVO A;  3K26 A;  4IA9 A;  4R7A B;  3UVN A;  3SMR A;  2YNP A;  5TF2 A;  3BG1 A;  3W15 A;  1UOO A;  2Z2P A;  4J84 A;  1H2Y A;  3EQ8 A;  4FWW A;  3UKU C;  5EAL A;  2I0T A;  4J82 A;  4NSX A;  4CZV A;  2Z2O A;  4J79 A;  4PSW B;  2EIC A;  5I5I A;  2B5N A;  2HU8 A;  4MK0 B;  3IJ0 A;  4O02 A;  4JT5 C;  2H9L A;  4DNW A;  2YMU A;  5E6R A;  3DDU A;  4PBY A;  2VDQ A;  4CY1 A;  3AL8 B;  2AGZ A;  2P9S C;  3EG6 A;  4JSV C;  5M5T A;  1I2M B;  1VE7 A;  2BKL A;  5AMS A;  3SJL D;  3IJ1 A;  4X60 B;  4J87 A;  1C9I A;  4CY3 A;  2AGW A;  3N0E A;  2I0S A;  4L1M A;  3MUN A;  4A11 B;  5C2V B;  1T2X A;  2IWK A;  1K32 A;  2CE8 A;  3RN0 D;  4X63 B;  3GRE A;  3IUR A;  4GMB A;  2HYE A;  1N6F A;  5EM2 B;  3SWS D;  3V4P A;  4Z8L A;  3QI0 A;  3GD1 I;  2HKM A;  2TRC B;  5H14 A;  5FKT A;  4A2M A;  5M5S A;  3EQ7 A;  5TDH B;  4CC9 A;  2P9N C;  3OKY A;  3NID A;  3EWE A;  3SBQ A;  3K72 A;  2IWF A;  3MUO A;  4N14 A;  1JTD B;  5EAP A;  5JWZ A;  3FCS A;  4L1Q D;  4YVD A;  3JAM g;  4J8G A;  4CZX A;  3VGZ A;  3HFQ A;  1SHY B;  1YR2 A;  5EML B;  1MG3 A;  4JT6 C;  2AH1 A;  3IUQ A;  5FQD A;  5CYK A;  3ODT A;  3RMZ D;  2VDL A;  2Q7Q A;  2PM6 B;  4A0B A;  4A08 A;  4ES0 A;  4PSX B;  5C92 A;  5FKR A;  1SQ9 A;  2H14 A;  3JZN A;  4O1Q D;  2QXV A;  1JV2 A;  2H6N A;  2MTA H;  3PVW B;  2HJ4 A;  1A0R B;  2BCJ B;  4JSP C;  3SBR A;  5A2Q g;  2YBA A;  4Z7N A;  5IJ8 E;  1N6E A;  4A09 A;  5FKS A;  2EIE A;  1GOH A;  4NEN A;  2EBS A;  4K3I D;  2CE9 A; 
#chains in the Genus database with same CATH homology
 1QNI A;  3C5M A;  1FWX A;  4E5Z B;  2HKR A;  2B4E A;  5CXB A;  5C9Z B;  3EI4 A;  1K8K C;  2OIZ A;  3NVX A;  3KRX B;  5H1M A;  4KFM B;  3P4F A;  4LGN A;  3L4M D;  3PXT D;  3SHF A;  4PBZ A;  3KRW B;  4L3G D;  3DSM A;  2AQ5 A;  3RSE C;  2AH0 A;  5I5M A;  2XL2 A;  3JRO A;  3EI2 B;  3EMH A;  4LG8 A;  2O9K A;  4O3U B;  3MMY A;  2P9K C;  2OVP B;  4J0X A;  4XYI A;  4A0A B;  3I7H A;  4JXM A;  3VH0 A;  2J55 H;  3SLE D;  4FAV D;  1XKS A;  3C75 H;  5TEF A;  4PNK B;  2HES X;  5TEE A;  1NEX B;  2YB8 B;  3I8C A;  3E0C A;  5HE3 B;  5I5J A;  4XYH A;  2CO0 C;  4CY5 A;  4CY2 A;  3J81 g;  1GG2 B;  3PSC B;  4GM9 A;  2H9N A;  4J8B A;  2IUV A;  3OKW A;  4TZ4 A;  2PM9 A;  1MDA H;  1GP2 B;  5FKQ A;  2AGX A;  2J57 G;  5THA A;  4ESG A;  3B7F A;  3FRX A;  1OLZ A;  5K19 A;  3NVN A;  3IIW A;  4GQ2 P;  2Z2N A;  1B9Y A;  3AL9 A;  3OL2 B;  3BG0 A;  3PXW D;  2H13 A;  1ERJ A;  2PBI B;  2H47 A;  3V9F A;  4FA9 D;  5HE1 B;  4FHL A;  1RI6 A;  5CYK B;  5CXC A;  4ZN4 A;  4CI1 A;  5K1C C;  4Y7R A;  4BL0 A;  2P9L C;  4D6V A;  4A0B B;  4A08 B;  4AOW A;  3JZG A;  4O9D A;  4D0K A;  1GXR A;  4BUJ C;  2W18 A;  2H3X A;  3PSL A;  3ULE C;  4U7A A;  3RFG A;  3UVK A;  4XEI C;  2UZX B;  2H6Q A;  3RFH A;  3MZK A;  1MG2 A;  1XHM A;  3DWL C;  3SVW D;  3AL8 A;  4L3H D;  3SFZ A;  2OK4 A;  3EI4 B;  4AEZ A;  1XIP A;  2IUQ A;  2H9P A;  1PI6 A;  2XU7 A;  3EI3 A;  4JD2 C;  4PC0 A;  3EI1 A;  4I79 A;  3I8E A;  4U1E I;  4GQ1 A;  2HXC A;  4QT8 A;  3RRM C;  1TYQ C;  3MKQ A;  4GGC A;  2J56 H;  3V5W B;  1S4U X;  4X61 B;  3I7N A;  1B9X A;  4L9O A;  5FLX g;  4E54 A;  3PVU B;  5FXY A;  3OKT A;  3N0D A;  2CO0 A;  4GM8 A;  2OVR B;  4JSN C;  3IKO A;  5B4W A;  3UKR C;  4GM3 A;  3OTT A;  4EWR A;  1OMW B;  4ZOZ A;  5EMJ B;  3UVM A;  4X3E A;  2PM9 B;  5IGO A;  3JZH A;  2P9P C;  1PEV A;  3MXX A;  2I0R A;  3GFC A;  4FA1 D;  4K3J B;  3SCY A;  3RN1 D;  1P22 A;  3CFS B;  3FGB A;  4J0W A;  3MKS B;  3ZWL B;  3IJC A;  1PBY B;  4O3T B;  3I7O A;  4ERZ A;  4FAN D;  2GC7 A;  2OJY A;  3BWS A;  3PXS D;  4E5Z A;  2B5M A;  5EAM A;  3SBP A;  1TBG A;  2YNO A;  4QRJ A;  5IJ7 E;  4A2L A;  3OKY B;  2CN3 A;  5GMK n;  2IUP A;  3I7P A;  3SXT D;  4OZU A;  5HYN B;  3I7L A;  3DXM C;  3MZL A;  3AFC A;  4GQB B;  1SQJ A;  3VA6 A;  1NR0 A;  4UI9 R;  4FB1 D;  3AH8 B;  4LG9 A;  4ERQ A;  4FA4 D;  1GOT B;  5SXM A;  3DXK C;  3EI2 A;  1JMZ B;  5AJA A;  3F3P A;  5GSA A;  4PXW A;  5HE2 B;  5FA5 B;  4A0A A;  4QL1 A;  4G56 B;  3EI3 B;  3I2N A;  3EI1 B;  1JOF A;  3CIK B;  3JRP A;  2QC5 A;  3UVL A;  2G9A A;  3A0F A;  4J78 A;  5GXI A;  2H6K A;  1U4C A;  2UZY B;  4H5J A;  2OK6 A;  4BH6 A;  2XL3 A;  4CI8 A;  4K3I D;  4GGD A;  4O45 A;  3I7K A;  4A09 B;  1L0Q A;  4GZ8 A;  5HQG A;  2GNQ A;  2AGL A;  4JSX C;  3PE7 A;  3J80 g;  5IGQ A;  4ZOY A;  2H9M A;  2I3S A;  4E54 B;  5CXB B;  4ZOV A;  4J86 A;  3L4O D;  4QQE A;  1U2V C;  3EU7 A;  4J81 A;  4A7J A;  3JB9 L;  1VYH C;  3UR4 A;  1R5M A;  3C99 A;  3OL2 A;  2AGY A;  4HDJ A;  4A11 A;  2I3T A;  3DM0 A;  2P9I C;  2CNX A;  3F3G A;  2IUR A;  1JJU B;  2G99 A;  2GC4 A;  2PM7 B;  3FM0 A;  5EM2 A;  5EMK B;  5C2W B;  2XYI A;  2YNN A;  4FA5 D;  2P9U C;  3JPX A;  4J73 A;  1YFQ A;  4CZY A;  3F3F A;  4IMM A;  1JMX B;  2HJB A;  2IAA A;  5EAR A;  3OW8 A;  4GGA A;  3K27 A;  3C9C A;  2H68 A;  3U4Y A;  5AFU 3;  3V7D B;  4CI3 A;  2CN2 A;  1PGU A;  3CFV A;  5H17 A;  3NVQ A;  5IC7 A;  5IT9 g;  4H5I A;  2B5L A;  1N6D A;  3ORV D;  4CI2 A;  3SN6 B;  2BBK H;  2OVQ B;  4ERY A;  3IIY A;  5EMM B;  4J77 A;  5GXH A;  4ZOX A;  3RLM D;  5CXC B;  1Q47 A;  3I89 A;  5KDO B;  4Y5R D;  5HE0 B;  3UVO A;  3K26 A;  4IA9 A;  4R7A B;  3UVN A;  3SMR A;  2YNP A;  5TF2 A;  3BG1 A;  3W15 A;  2Z2P A;  4J84 A;  4FWW A;  3UKU C;  5EAL A;  2I0T A;  4J82 A;  4NSX A;  4CZV A;  2Z2O A;  4J79 A;  4PSW B;  5I5I A;  2B5N A;  4MK0 B;  3IJ0 A;  4JT5 C;  2H9L A;  2YMU A;  4PBY A;  4CY1 A;  3AL8 B;  2AGZ A;  2P9S C;  3EG6 A;  4JSV C;  5AMS A;  3SJL D;  3IJ1 A;  4X60 B;  4J87 A;  4CY3 A;  2AGW A;  3N0E A;  2I0S A;  4A11 B;  5C2V B;  2IWK A;  1K32 A;  2CE8 A;  3RN0 D;  4X63 B;  3GRE A;  4GMB A;  2HYE A;  1N6F A;  5EM2 B;  3SWS D;  4Z8L A;  2HKM A;  2TRC B;  5H14 A;  5FKT A;  4A2M A;  5TDH B;  4CC9 A;  2P9N C;  3OKY A;  3EWE A;  3SBQ A;  2IWF A;  4N14 A;  5JWZ A;  5EAP A;  4L1Q D;  4YVD A;  3JAM g;  4J8G A;  4CZX A;  3VGZ A;  3HFQ A;  1SHY B;  5EML B;  1MG3 A;  4JT6 C;  2AH1 A;  5FQD A;  5CYK A;  3ODT A;  3RMZ D;  2Q7Q A;  2PM6 B;  4A0B A;  4A08 A;  4ES0 A;  4PSX B;  5FKR A;  1SQ9 A;  2H14 A;  3JZN A;  4O1Q D;  2QXV A;  3PVW B;  2H6N A;  2MTA H;  2HJ4 A;  1A0R B;  2BCJ B;  4JSP C;  3SBR A;  5A2Q g;  2YBA A;  5IJ8 E;  1N6E A;  4A09 A;  5FKS A;  2EBS A;  4OWR A;  2CE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...