2YNNA

Yeast betaprime cop 1-304 with ktktn motif
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
300
structure length
300
Chain Sequence
KLDIKKTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVELWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords COATOMER SUBUNIT BETA'
publication title Molecular Basis for Recognition of Dilysine Trafficking Motifs by Copi.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 90
structure length 300
sequence length 300
ec nomenclature
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ynnA01
3SWSD 2XL3A 3I8CA 5H1MA 3UVOA 2HJ4A 3MMYA 4J0XA 2P9IC 2IUVA 5EAMA 3RSEC 4A2MA 1XHMA 3BG0A 4XYHA 4IA9A 4D6VA 5CXCB 4L3GD 2Z2NA 5TEEA 4N14A 1N6EA 3IIYA 2G99A 2AGZA 3IJ0A 3F3PA 2XL2A 4TZ4A 3PVUB 4PC0A 2OVPB 5B4WA 2H6KA 4FA1D 1JJUB 2I0SA 4H5JA 5CYKB 1N6DA 4QL1A 2YNNA 1SQ9A 4A09B 1NEXB 4K3JB 3N0DA 4NSXA 3EI1A 4G56B 5HE0B 4L3HD 2O9KA 2W18A 1SHYB 2YBAA 4QT8A 5IJ8E 2CN2A 4ERYA 3RFHA 4D0KA 4PBYA 1GG2B 2P9NC 4IMMA 2J56H 4O45A 5C2WB 1K8KC 3V7DB 5FQDA 5HE1B 1JMZB 2IWFA 2MTAH 4JSPC 5AJAA 2H3XA 3UVLA 5A2Qg 2HKMA 4JT5C 3JZHA 3OTTA 3DXKC 4U1EI 1PGUA 3VGZA 3PSLA 5CXBA 2H14A 3I8EA 4J8BA 1U4CA 2GC4A 3IKOA 4J86A 4O3TB 3RRMC 4K3ID 1YFQA 3SXTD 4FAND 2HXCA 3SCYA 3SJLD 3EI3A 3F3GA 3I7NA 3EI1B 4LGNA 1OLZA 3V9FA 3EI4A 2YNOA 4Z8LA 2PM9A 4J0WA 2OK6A 4GGDA 2CO0C 3PXTD 1A0RB 5C9ZB 1GP2B 1VYHC 3I7HA 5HQGA 4CC9A 1MG2A 3OKYA 1N6FA 2H68A 2XYIA 3PE7A 3EWEA 4JSVC 4GM9A 2AGXA 2P9KC 4ZOVA 2AH1A 3L4OD 3SMRA 5KDOB 4J82A 3GFCA 4JXMA 4A7JA 5FKTA 5TEFA 2AGWA 5EALA 4U7AA 4CI1A 3UKUC 4J77A 4QQEA 5FKRA 2UZXB 3IIWA 2J57G 5EMJB 4CI8A 3P4FA 3ULEC 3JB9L 4BH6A 1PEVA 4KFMB 4LG8A 4E54A 2IUPA 3DXMC 5AFU3 3MZKA 3EI4B 3CIKB 2GNQA 4Y5RD 2I3TA 4I79A 4R7AB 3J81g 3C5MA 3L4MD 1R5MA 4X3EA 3BG1A 1JOFA 4A0AA 2EBSA 3EMHA 5GSAA 3RMZD 1RI6A 4CZYA 2YMUA 3OKYB 1P22A 3JZGA 3BWSA 3RLMD 5IC7A 4BL0A 3DSMA 5TDHB 3FRXA 4HDJA 3SVWD 2B5MA 4X60B 4CI2A 4ZOYA 3K26A 3AFCA 3NVQA 3PVWB 3I7KA 3AH8B 4A2LA 3GREA 3IJCA 3MKSB 2YNPA 2CE8A 4BUJC 2OVRB 4CZVA 5FLXg 3I7LA 5FKQA 5EM2A 4CZXA 2BCJB 4PNKB 1GXRA 2HESX 3C99A 5FA5B 1PI6A 3A0FA 2HJBA 4CI3A 3SBQA 1NR0A 4L1QD 4Y7RA 3OL2A 2AH0A 4H5IA 5K1CC 5EAPA 5K19A 3VH0A 2IURA 3W15A 1JMXB 4XYIA 4A0AB 4PBZA 2P9PC 5I5MA 4JD2C 4FA4D 3UR4A 5I5IA 2AGLA 3I7PA 1SQJA 3DWLC 4J87A 3MXXA 3E0CA 4LG9A 3RFGA 3VA6A 5THAA 5IT9g 2OJYA 3FM0A 2UZYB 2Z2PA 3N0EA 5HYNB 2H6QA 3MKQA 3NVNA 4GGAA 3EI2A 4YVDA 5CXCA 4FA9D 4MK0B 4OWRA 4E5ZA 4GM8A 1QNIA 1S4UX 4GZ8A 1TBGA 2H6NA 4XEIC 5EMMB 3PSCB 3J80g 3KRXB 1U2VC 4JT6C 4GQBB 3JROA 2QXVA 3RN1D 1FWXA 4J8GA 1Q47A 2XU7A 5CYKA 5AMSA 4EWRA 4FB1D 5EM2B 2AGYA 2H9NA 4A09A 4JSXC 2QC5A 4CY3A 5I5JA 3OL2B 5CXBB 3MZLA 4FWWA 1ERJA 3CFSB 1TYQC 2GC7A 2OIZA 2CE9A 4GMBA 3I2NA 3EI3B 2G9AA 2P9SC 4X63B 4OZUA 1MG3A 4JSNC 3FGBA 2Q7QA 4PXWA 2PM9B 2IUQA 3NVXA 3SN6B 3OW8A 2H47A 3EI2B 3F3FA 3I7OA 5IJ7E 4E5ZB 2B5NA 4UI9R 2CO0A 2YB8B 4J84A 4J81A 4FHLA 3C9CA 1MDAH 3JAMg 3ODTA 1XIPA 3SLED 4CY5A 3SHFA 4PSWB 3UVNA 4J78A 4A08A 3SBRA 4ZOXA 4ESGA 5IGQA 3DM0A 3AL9A 3EG6A 3ORVD 3CFVA 2OVQB 4QRJA 1PBYB 2HKRA 5H17A 3JPXA 4CY2A 2I0TA 3ZWLB 4CY1A 3AL8A 4AOWA 2P9LC 3C75H 5EMLB 4GGCA 1B9YA 4A0BA 2H13A 1L0QA 4E54B 4J73A 3IJ1A 2PM6B 3V5WB 2AQ5A 2OK4A 3UKRC 2TRCB 4ERQA 3B7FA 4GM3A 3KRWB 3JRPA 4X61B 3PXSD 3HFQA 3SBPA 4A11A 3RN0D 1K32A 4FAVD 2Z2OA 2CNXA 4A08B 4ZN4A 1B9XA 2PBIB 3OKWA 5TF2A 4GQ2P 2I3SA 4ZOZA 5GXHA 5H14A 5EARA 2PM7B 3EU7A 2B4EA 5HE2B 3PXWD 2I0RA 5C2VB 5GXIA 2BBKH 2H9LA 5FKSA 2B5LA 5JWZA 5SXMA 2H9MA 3AL8B 2P9UC 5HE3B 2H9PA 4O1QD 4J79A 4ERZA 4A0BB 4FA5D 1XKSA 3OKTA 3JZNA 3K27A 1GOTB 2J55H 1OMWB 4O9DA 3UVKA 2IWKA 4ES0A 3UVMA 2IAAA 4GQ1A 5GMKn 4O3UB 5FXYA 4AEZA 3SFZA 2CN3A 5IGOA 3I89A 5EMKB 4L9OA 3U4YA 4A11B 2HYEA 4PSXB
chains in the Genus database with same CATH superfamily
5M5RA 2XL3A 3SWSD 5C86A 3I8CA 5H1MA 3UVOA 2HJ4A 3MMYA 4J0XA 4IRZA 2P9IC 1O6FA 2IUVA 3MUNA 5EAMA 3RSEC 4A2MA 4WK0A 1XHMA 3BG0A 4XYHA 4IA9A 4D6VA 5CXCB 4L3GD 4DNVA 2Z2NA 5TEEA 4N14A 1N6EA 3IIYA 1UOOA 2XDWA 2G99A 1GOFA 2AGZA 3IJ0A 3F3PA 2XL2A 4TZ4A 3PVUB 4PC0A 1VE7A 2OVPB 3FCSA 4UM8A 5B4WA 2H6KA 4FA1D 4AMYA 1JJUB 2I0SA 4H5JA 5CYKB 1N6DA 5E6RA 3GD1I 4QL1A 2YNNA 1SQ9A 4A09B 1NEXB 1VE6A 4K3JB 3N0DA 4NSXA 4Z7NA 3EI1A 3QI0A 4G56B 5HE0B 4L3HD 2O9KA 2W18A 2HU7A 1SHYB 2YBAA 4QT8A 4MMZA 3VI3A 5IJ8E 2CN2A 4ERYA 3RFHA 4D0KA 4PBYA 1GG2B 2P9NC 4IMMA 2J56H 4O45A 3O4IA 5C2WB 1K8KC 3V7DB 5FQDA 5HE1B 3K6SA 1JMZB 2IWFA 3ZDXA 2MTAH 2EIDA 4JSPC 5AJAA 2H3XA 3UVLA 5A2Qg 4JHPC 5M5TA 2HKMA 4JT5C 5C92A 3JZHA 3OTTA 1VZ3A 3NIGA 3DXKC 4U1EI 1PGUA 3VGZA 3PSLA 5CXBA 5E6SA 1E5TA 3KCIA 2H14A 3I8EA 1U4CA 2GC4A 3EQ8A 3IKOA 4J86A 4J8BA 4O3TB 3RRMC 5M5SA 4K3ID 1YFQA 4NBMA 3SXTD 4FAND 2HXCA 3SCYA 5FFGA 3SJLD 3EI3A 3F3GA 3I7NA 3EI1B 4LGNA 2VZ1A 1OLZA 4UM9A 3V9FA 3EI4A 1UOPA 3FCUA 2YNOA 3IURA 4Z8LA 2PM9A 4J0WA 4L1MA 2OK6A 2VDLA 4GGDA 2CO0C 3ZDYA 3PXTD 1A0RB 3IJEA 3IUQA 5C9ZB 1GP2B 1VYHC 3I7HA 5HQGA 3V4VA 4CC9A 1MG2A 3OKYA 1JTDB 1N6FA 2H68A 2XYIA 1H2ZA 3EWEA 3PE7A 2WQ8A 4JSVC 4GM9A 2AGXA 2EICA 2P9KC 4ZOVA 2AH1A 3L4OD 3SMRA 5KDOB 4J82A 3GFCA 4JXMA 1M1XA 4A7JA 5FKTA 3VI4A 5TEFA 2AGWA 2BKLA 5EALA 1UOQA 4U7AA 4CI1A 3UKUC 2VZ3A 4J77A 4QQEA 4G1EA 5M5VA 5FKRA 4Z7OA 2UZXB 3IIWA 2J57G 4NENA 5EMJB 4CI8A 3P4FA 2HU8A 3ULEC 3JB9L 4BH6A 1PEVA 4KFMB 4LG8A 4E54A 2IUPA 3DXMC 5AFU3 3MZKA 3EI4B 3CIKB 2GNQA 4Y5RD 2I3TA 4I79A 4R7AB 3J81g 3C5MA 3L4MD 1R5MA 4X3EA 3BG1A 1JOFA 4A0AA 2EBSA 3EMHA 5GSAA 4MMXA 5M5UA 3RMZD 1RI6A 4CZYA 2YMUA 3OKYB 1P22A 3JZGA 3BWSA 5FFOA 3O4GA 3IUJA 3RLMD 5IC7A 4BL0A 3DSMA 5TDHB 3FRXA 4HDJA 3SVWD 2B5MA 4X60B 4CI2A 1O6GA 2EIEA 4ZOYA 3K26A 3AFCA 3NVQA 3PVWB 3I7KA 3AH8B 4A2LA 4AN0A 4WK4A 3GREA 3QHYB 3IJCA 3MKSB 2YNPA 2CE8A 4BUJC 2OVRB 4CZVA 5FLXg 3I7LA 5FKQA 2VDKA 4QAMA 5EM2A 4CZXA 2BCJB 4PNKB 1GXRA 2HU5A 3C99A 2HESX 5FA5B 1PI6A 3A0FA 2HJBA 4CI3A 3SBQA 1NR0A 3MUOA 4L1QD 4Y7RA 3OL2A 2AH0A 4H5IA 5K1CC 5EAPA 3ZDZA 5K19A 3VH0A 2IURA 3W15A 1YR2A 1JMXB 4XYIA 4A0AB 4PBZA 2P9PC 5I5MA 4JD2C 4FA4D 3UR4A 5I5IA 2AGLA 3I7PA 1SQJA 3DWLC 4J87A 3MXXA 3E0CA 4LG9A 2QZPA 3RFGA 3VA6A 3ZE1A 5THAA 5IT9g 2OJYA 3FM0A 2UZYB 2Z2PA 4RE5A 3N0EA 5HYNB 2H6QA 3MKQA 3NVNA 4GGAA 3EI2A 1L5GA 4YVDA 5CXCA 4FA9D 3V4PA 4MK0B 4OWRA 2VDOA 4E5ZA 4GM8A 1QNIA 1H2YA 1S4UX 4GZ8A 1TBGA 2H6NA 4XEIC 5EMMB 3PSCB 3J80g 1U8CA 3KRXB 1U2VC 4MMYA 4JT6C 4NAAA 4GQBB 3JROA 2QXVA 3RN1D 1FWXA 3O4HA 4J8GA 1T2XA 1Q47A 3ZE2A 2XU7A 5CYKA 3NIFA 5AMSA 4EWRA 4G1MA 4FB1D 5EM2B 2QR5A 2AGYA 4G55A 3IUMA 2H9NA 4A09A 4JSXC 2QC5A 4CY3A 1C9LA 5I5JA 3T3PA 2XE4A 3K71A 3OL2B 5CXBB 3MZLA 4FWWA 1TYEA 1ERJA 3CFSB 1TYQC 2GC7A 2OIZA 2CE9A 4GMBA 2VDQA 3I2NA 3EI3B 2G9AA 2P9SC 4X63B 4OZUA 3IVMA 1MG3A 4JSNC 3FGBA 1I2MB 2Q7QA 2VDRA 3ZE0A 4PXWA 2PM9B 2IUQA 4BCCA 3NVXA 3SN6B 2H47A 3OW8A 3EI2B 3F3FA 3I7OA 4D9SA 4BP9A 5IJ7E 4AMZA 4JHNA 4E5ZB 2B5NA 4UI9R 2CO0A 2YB8B 4J84A 4J81A 4FHLA 3GC3B 3EQ9A 3C9CA 3OF7A 1MDAH 3O4JA 3JAMg 3ODTA 1XIPA 3SLED 4CY5A 3SHFA 3IULA 4PSWB 4J78A 3UVNA 4NC4A 4A08A 3SBRA 4ZOXA 4ESGA 1GOGA 3NIDA 5IGQA 1JV2A 3DM0A 3AL9A 3EG6A 3ORVD 3CFVA 2OVQB 4O2WA 4QRJA 1PBYB 2HKRA 5H17A 3JPXA 2VDNA 4CY2A 2I0TA 3ZWLB 4CY1A 3AL8A 4AOWA 2P9LC 4DNUA 3C75H 5EMLB 4WK2A 4GGCA 1B9YA 4A0BA 2H13A 4BP8A 1L0QA 1QFMA 4E54B 4J73A 3IJ1A 2PM6B 1E8MA 1H2WA 3V5WB 2AQ5A 2OK4A 3UKRC 2TRCB 1BPOA 3EQ7A 2VDMA 4ERQA 5E6UA 5HDBA 3B7FA 4GM3A 3KRWB 3DDUA 3JRPA 4X61B 3PXSD 4DNWA 3HFQA 3SBPA 1E8NA 4A11A 3RN0D 2HYEA 1K32A 4FAVD 1K3IA 1VZ2A 2Z2OA 3T3MA 2CNXA 4A08B 4ZN4A 1B9XA 2PBIB 3OKWA 5TF2A 4GQ2P 4WJKA 2I3SA 4BCBA 4BCDA 1C9IA 2VC2A 4ZOZA 5GXHA 5H14A 5EARA 2PM7B 3EU7A 2B4EA 5HE2B 3PXWD 2I0RA 5C2VB 5GXIA 2BBKH 2H9LA 5FKSA 2B5LA 5JWZA 2EIBA 5SXMA 2H9MA 3AL8B 2P9UC 5HE3B 2H9PA 2XZGA 4O1QD 5M61A 4J79A 4ERZA 4A0BB 2JKXA 1XKSA 4FA5D 3K72A 3OKTA 3JZNA 3IUNA 3K27A 1GOTB 1A12A 2J55H 1OMWB 4RE6A 4O9DA 4O02A 3UVKA 2IWKA 4ES0A 4AN1A 3UVMA 2IAAA 4GQ1A 1QFSA 5GMKn 1UTCA 4O3UB 3MVDK 5FXYA 1H2XA 4AEZA 3SFZA 2CN3A 4Z7QA 1GOHA 5IGOA 3I89A 5EMKB 4AX4A 4L9OA 3U4YA 4A11B 2VDPA 4PSXB
chains in the Genus database with same CATH topology
3SWSD 2XL3A 3I8CA 5H1MA 3UVOA 2HJ4A 3MMYA 4J0XA 2P9IC 2IUVA 5EAMA 3RSEC 4A2MA 1XHMA 3BG0A 4XYHA 4IA9A 4D6VA 5CXCB 4L3GD 2Z2NA 5TEEA 4N14A 1N6EA 3IIYA 2G99A 2AGZA 3IJ0A 3F3PA 2XL2A 4TZ4A 3PVUB 4PC0A 2OVPB 5B4WA 2H6KA 4FA1D 1JJUB 2I0SA 4H5JA 5CYKB 1N6DA 4QL1A 2YNNA 1SQ9A 4A09B 1NEXB 4K3JB 3N0DA 4NSXA 3EI1A 4G56B 5HE0B 4L3HD 2O9KA 2W18A 1SHYB 2YBAA 4QT8A 5IJ8E 2CN2A 4ERYA 3RFHA 4D0KA 4PBYA 1GG2B 2P9NC 4IMMA 2J56H 4O45A 5C2WB 1K8KC 3V7DB 5FQDA 5HE1B 1JMZB 2IWFA 2MTAH 4JSPC 5AJAA 2H3XA 3UVLA 5A2Qg 2HKMA 4JT5C 3JZHA 3OTTA 3DXKC 4U1EI 1PGUA 3VGZA 3PSLA 5CXBA 2H14A 3I8EA 4J8BA 1U4CA 2GC4A 3IKOA 4J86A 4O3TB 3RRMC 4K3ID 1YFQA 3SXTD 4FAND 2HXCA 3SCYA 3SJLD 3EI3A 3F3GA 3I7NA 3EI1B 4LGNA 1OLZA 3V9FA 3EI4A 2YNOA 4Z8LA 2PM9A 4J0WA 2OK6A 4GGDA 2CO0C 3PXTD 1A0RB 5C9ZB 1GP2B 1VYHC 3I7HA 5HQGA 4CC9A 1MG2A 3OKYA 1N6FA 2H68A 2XYIA 3PE7A 3EWEA 4JSVC 4GM9A 2AGXA 2P9KC 4ZOVA 2AH1A 3L4OD 3SMRA 5KDOB 4J82A 3GFCA 4JXMA 4A7JA 5FKTA 5TEFA 2AGWA 5EALA 4U7AA 4CI1A 3UKUC 4J77A 4QQEA 5FKRA 2UZXB 3IIWA 2J57G 5EMJB 4CI8A 3P4FA 3ULEC 3JB9L 4BH6A 1PEVA 4KFMB 4LG8A 4E54A 2IUPA 3DXMC 5AFU3 3MZKA 3EI4B 3CIKB 2GNQA 4Y5RD 2I3TA 4I79A 4R7AB 3J81g 3C5MA 3L4MD 1R5MA 4X3EA 3BG1A 1JOFA 4A0AA 2EBSA 3EMHA 5GSAA 3RMZD 1RI6A 4CZYA 2YMUA 3OKYB 1P22A 3JZGA 3BWSA 3RLMD 5IC7A 4BL0A 3DSMA 5TDHB 3FRXA 4HDJA 3SVWD 2B5MA 4X60B 4CI2A 4ZOYA 3K26A 3AFCA 3NVQA 3PVWB 3I7KA 3AH8B 4A2LA 3GREA 3IJCA 3MKSB 2YNPA 2CE8A 4BUJC 2OVRB 4CZVA 5FLXg 3I7LA 5FKQA 5EM2A 4CZXA 2BCJB 4PNKB 1GXRA 2HESX 3C99A 5FA5B 1PI6A 3A0FA 2HJBA 4CI3A 3SBQA 1NR0A 4L1QD 4Y7RA 3OL2A 2AH0A 4H5IA 5K1CC 5EAPA 5K19A 3VH0A 2IURA 3W15A 1JMXB 4XYIA 4A0AB 4PBZA 2P9PC 5I5MA 4JD2C 4FA4D 3UR4A 5I5IA 2AGLA 3I7PA 1SQJA 3DWLC 4J87A 3MXXA 3E0CA 4LG9A 3RFGA 3VA6A 5THAA 5IT9g 2OJYA 3FM0A 2UZYB 2Z2PA 3N0EA 5HYNB 2H6QA 3MKQA 3NVNA 4GGAA 3EI2A 4YVDA 5CXCA 4FA9D 4MK0B 4OWRA 4E5ZA 4GM8A 1QNIA 1S4UX 4GZ8A 1TBGA 2H6NA 4XEIC 5EMMB 3PSCB 3J80g 3KRXB 1U2VC 4JT6C 4GQBB 3JROA 2QXVA 3RN1D 1FWXA 4J8GA 1Q47A 2XU7A 5CYKA 5AMSA 4EWRA 4FB1D 5EM2B 2AGYA 2H9NA 4A09A 4JSXC 2QC5A 4CY3A 5I5JA 3OL2B 5CXBB 3MZLA 4FWWA 1ERJA 3CFSB 1TYQC 2GC7A 2OIZA 2CE9A 4GMBA 3I2NA 3EI3B 2G9AA 2P9SC 4X63B 4OZUA 1MG3A 4JSNC 3FGBA 2Q7QA 4PXWA 2PM9B 2IUQA 3NVXA 3SN6B 3OW8A 2H47A 3EI2B 3F3FA 3I7OA 5IJ7E 4E5ZB 2B5NA 4UI9R 2CO0A 2YB8B 4J84A 4J81A 4FHLA 3C9CA 1MDAH 3JAMg 3ODTA 1XIPA 3SLED 4CY5A 3SHFA 4PSWB 3UVNA 4J78A 4A08A 3SBRA 4ZOXA 4ESGA 5IGQA 3DM0A 3AL9A 3EG6A 3ORVD 3CFVA 2OVQB 4QRJA 1PBYB 2HKRA 5H17A 3JPXA 4CY2A 2I0TA 3ZWLB 4CY1A 3AL8A 4AOWA 2P9LC 3C75H 5EMLB 4GGCA 1B9YA 4A0BA 2H13A 1L0QA 4E54B 4J73A 3IJ1A 2PM6B 3V5WB 2AQ5A 2OK4A 3UKRC 2TRCB 4ERQA 3B7FA 4GM3A 3KRWB 3JRPA 4X61B 3PXSD 3HFQA 3SBPA 4A11A 3RN0D 1K32A 4FAVD 2Z2OA 2CNXA 4A08B 4ZN4A 1B9XA 2PBIB 3OKWA 5TF2A 4GQ2P 2I3SA 4ZOZA 5GXHA 5H14A 5EARA 2PM7B 3EU7A 2B4EA 5HE2B 3PXWD 2I0RA 5C2VB 5GXIA 2BBKH 2H9LA 5FKSA 2B5LA 5JWZA 5SXMA 2H9MA 3AL8B 2P9UC 5HE3B 2H9PA 4O1QD 4J79A 4ERZA 4A0BB 4FA5D 1XKSA 3OKTA 3JZNA 3K27A 1GOTB 2J55H 1OMWB 4O9DA 3UVKA 2IWKA 4ES0A 3UVMA 2IAAA 4GQ1A 5GMKn 4O3UB 5FXYA 4AEZA 3SFZA 2CN3A 5IGOA 3I89A 5EMKB 4L9OA 3U4YA 4A11B 2HYEA 4PSXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SWS D;  2XL3 A;  3I8C A;  5H1M A;  3UVO A;  2HJ4 A;  3MMY A;  4J0X A;  2P9I C;  2IUV A;  5EAM A;  3RSE C;  4A2M A;  1XHM A;  3BG0 A;  4XYH A;  4IA9 A;  4D6V A;  5CXC B;  4L3G D;  2Z2N A;  5TEE A;  4N14 A;  1N6E A;  3IIY A;  2G99 A;  2AGZ A;  3IJ0 A;  3F3P A;  2XL2 A;  4TZ4 A;  3PVU B;  4PC0 A;  2OVP B;  5B4W A;  2H6K A;  4FA1 D;  1JJU B;  2I0S A;  4H5J A;  5CYK B;  1N6D A;  4QL1 A;  2YNN A;  1SQ9 A;  4A09 B;  1NEX B;  4K3J B;  3N0D A;  4NSX A;  3EI1 A;  4G56 B;  5HE0 B;  4L3H D;  2O9K A;  2W18 A;  1SHY B;  2YBA A;  4QT8 A;  5IJ8 E;  2CN2 A;  4ERY A;  3RFH A;  4D0K A;  4PBY A;  1GG2 B;  2P9N C;  4IMM A;  2J56 H;  4O45 A;  5C2W B;  1K8K C;  3V7D B;  5FQD A;  5HE1 B;  1JMZ B;  2IWF A;  2MTA H;  4JSP C;  5AJA A;  2H3X A;  3UVL A;  5A2Q g;  2HKM A;  4JT5 C;  3JZH A;  3OTT A;  3DXK C;  4U1E I;  1PGU A;  3VGZ A;  3PSL A;  5CXB A;  2H14 A;  3I8E A;  4J8B A;  1U4C A;  2GC4 A;  3IKO A;  4J86 A;  4O3T B;  3RRM C;  4K3I D;  1YFQ A;  3SXT D;  4FAN D;  2HXC A;  3SCY A;  3SJL D;  3EI3 A;  3F3G A;  3I7N A;  3EI1 B;  4LGN A;  1OLZ A;  3V9F A;  3EI4 A;  2YNO A;  4Z8L A;  2PM9 A;  4J0W A;  2OK6 A;  4GGD A;  2CO0 C;  3PXT D;  1A0R B;  5C9Z B;  1GP2 B;  1VYH C;  3I7H A;  5HQG A;  4CC9 A;  1MG2 A;  3OKY A;  1N6F A;  2H68 A;  2XYI A;  3PE7 A;  3EWE A;  4JSV C;  4GM9 A;  2AGX A;  2P9K C;  4ZOV A;  2AH1 A;  3L4O D;  3SMR A;  5KDO B;  4J82 A;  3GFC A;  4JXM A;  4A7J A;  5FKT A;  5TEF A;  2AGW A;  5EAL A;  4U7A A;  4CI1 A;  3UKU C;  4J77 A;  4QQE A;  5FKR A;  2UZX B;  3IIW A;  2J57 G;  5EMJ B;  4CI8 A;  3P4F A;  3ULE C;  3JB9 L;  4BH6 A;  1PEV A;  4KFM B;  4LG8 A;  4E54 A;  2IUP A;  3DXM C;  5AFU 3;  3MZK A;  3EI4 B;  3CIK B;  2GNQ A;  4Y5R D;  2I3T A;  4I79 A;  4R7A B;  3J81 g;  3C5M A;  3L4M D;  1R5M A;  4X3E A;  3BG1 A;  1JOF A;  4A0A A;  2EBS A;  3EMH A;  5GSA A;  3RMZ D;  1RI6 A;  4CZY A;  2YMU A;  3OKY B;  1P22 A;  3JZG A;  3BWS A;  3RLM D;  5IC7 A;  4BL0 A;  3DSM A;  5TDH B;  3FRX A;  4HDJ A;  3SVW D;  2B5M A;  4X60 B;  4CI2 A;  4ZOY A;  3K26 A;  3AFC A;  3NVQ A;  3PVW B;  3I7K A;  3AH8 B;  4A2L A;  3GRE A;  3IJC A;  3MKS B;  2YNP A;  2CE8 A;  4BUJ C;  2OVR B;  4CZV A;  5FLX g;  3I7L A;  5FKQ A;  5EM2 A;  4CZX A;  2BCJ B;  4PNK B;  1GXR A;  2HES X;  3C99 A;  5FA5 B;  1PI6 A;  3A0F A;  2HJB A;  4CI3 A;  3SBQ A;  1NR0 A;  4L1Q D;  4Y7R A;  3OL2 A;  2AH0 A;  4H5I A;  5K1C C;  5EAP A;  5K19 A;  3VH0 A;  2IUR A;  3W15 A;  1JMX B;  4XYI A;  4A0A B;  4PBZ A;  2P9P C;  5I5M A;  4JD2 C;  4FA4 D;  3UR4 A;  5I5I A;  2AGL A;  3I7P A;  1SQJ A;  3DWL C;  4J87 A;  3MXX A;  3E0C A;  4LG9 A;  3RFG A;  3VA6 A;  5THA A;  5IT9 g;  2OJY A;  3FM0 A;  2UZY B;  2Z2P A;  3N0E A;  5HYN B;  2H6Q A;  3MKQ A;  3NVN A;  4GGA A;  3EI2 A;  4YVD A;  5CXC A;  4FA9 D;  4MK0 B;  4OWR A;  4E5Z A;  4GM8 A;  1QNI A;  1S4U X;  4GZ8 A;  1TBG A;  2H6N A;  4XEI C;  5EMM B;  3PSC B;  3J80 g;  3KRX B;  1U2V C;  4JT6 C;  4GQB B;  3JRO A;  2QXV A;  3RN1 D;  1FWX A;  4J8G A;  1Q47 A;  2XU7 A;  5CYK A;  5AMS A;  4EWR A;  4FB1 D;  5EM2 B;  2AGY A;  2H9N A;  4A09 A;  4JSX C;  2QC5 A;  4CY3 A;  5I5J A;  3OL2 B;  5CXB B;  3MZL A;  4FWW A;  1ERJ A;  3CFS B;  1TYQ C;  2GC7 A;  2OIZ A;  2CE9 A;  4GMB A;  3I2N A;  3EI3 B;  2G9A A;  2P9S C;  4X63 B;  4OZU A;  1MG3 A;  4JSN C;  3FGB A;  2Q7Q A;  4PXW A;  2PM9 B;  2IUQ A;  3NVX A;  3SN6 B;  3OW8 A;  2H47 A;  3EI2 B;  3F3F A;  3I7O A;  5IJ7 E;  4E5Z B;  2B5N A;  4UI9 R;  2CO0 A;  2YB8 B;  4J84 A;  4J81 A;  4FHL A;  3C9C A;  1MDA H;  3JAM g;  3ODT A;  1XIP A;  3SLE D;  4CY5 A;  3SHF A;  4PSW B;  3UVN A;  4J78 A;  4A08 A;  3SBR A;  4ZOX A;  4ESG A;  5IGQ A;  3DM0 A;  3AL9 A;  3EG6 A;  3ORV D;  3CFV A;  2OVQ B;  4QRJ A;  1PBY B;  2HKR A;  5H17 A;  3JPX A;  4CY2 A;  2I0T A;  3ZWL B;  4CY1 A;  3AL8 A;  4AOW A;  2P9L C;  3C75 H;  5EML B;  4GGC A;  1B9Y A;  4A0B A;  2H13 A;  1L0Q A;  4E54 B;  4J73 A;  3IJ1 A;  2PM6 B;  3V5W B;  2AQ5 A;  2OK4 A;  3UKR C;  2TRC B;  4ERQ A;  3B7F A;  4GM3 A;  3KRW B;  3JRP A;  4X61 B;  3PXS D;  3HFQ A;  3SBP A;  4A11 A;  3RN0 D;  1K32 A;  4FAV D;  2Z2O A;  2CNX A;  4A08 B;  4ZN4 A;  1B9X A;  2PBI B;  3OKW A;  5TF2 A;  4GQ2 P;  2I3S A;  4ZOZ A;  5GXH A;  5H14 A;  5EAR A;  2PM7 B;  3EU7 A;  2B4E A;  5HE2 B;  3PXW D;  2I0R A;  5C2V B;  5GXI A;  2BBK H;  2H9L A;  5FKS A;  2B5L A;  5JWZ A;  5SXM A;  2H9M A;  3AL8 B;  2P9U C;  5HE3 B;  2H9P A;  4O1Q D;  4J79 A;  4ERZ A;  4A0B B;  4FA5 D;  1XKS A;  3OKT A;  3JZN A;  3K27 A;  1GOT B;  2J55 H;  1OMW B;  4O9D A;  3UVK A;  2IWK A;  4ES0 A;  3UVM A;  2IAA A;  4GQ1 A;  5GMK n;  4O3U B;  5FXY A;  4AEZ A;  3SFZ A;  2CN3 A;  5IGO A;  3I89 A;  5EMK B;  4L9O A;  3U4Y A;  4A11 B;  2HYE A;  4PSX B; 
#chains in the Genus database with same CATH topology
 5M5R A;  2XL3 A;  3SWS D;  5C86 A;  3I8C A;  5H1M A;  3UVO A;  2HJ4 A;  3MMY A;  4J0X A;  4IRZ A;  2P9I C;  1O6F A;  2IUV A;  3MUN A;  5EAM A;  3RSE C;  4A2M A;  4WK0 A;  1XHM A;  3BG0 A;  4XYH A;  4IA9 A;  4D6V A;  5CXC B;  4L3G D;  4DNV A;  2Z2N A;  5TEE A;  4N14 A;  1N6E A;  3IIY A;  1UOO A;  2XDW A;  2G99 A;  1GOF A;  2AGZ A;  3IJ0 A;  3F3P A;  2XL2 A;  4TZ4 A;  3PVU B;  4PC0 A;  1VE7 A;  2OVP B;  3FCS A;  4UM8 A;  5B4W A;  2H6K A;  4FA1 D;  4AMY A;  1JJU B;  2I0S A;  4H5J A;  5CYK B;  1N6D A;  5E6R A;  3GD1 I;  4QL1 A;  2YNN A;  1SQ9 A;  4A09 B;  1NEX B;  1VE6 A;  4K3J B;  3N0D A;  4NSX A;  4Z7N A;  3EI1 A;  3QI0 A;  4G56 B;  5HE0 B;  4L3H D;  2O9K A;  2W18 A;  2HU7 A;  1SHY B;  2YBA A;  4QT8 A;  4MMZ A;  3VI3 A;  5IJ8 E;  2CN2 A;  4ERY A;  3RFH A;  4D0K A;  4PBY A;  1GG2 B;  2P9N C;  4IMM A;  2J56 H;  4O45 A;  3O4I A;  5C2W B;  1K8K C;  3V7D B;  5FQD A;  5HE1 B;  3K6S A;  1JMZ B;  2IWF A;  3ZDX A;  2MTA H;  2EID A;  4JSP C;  5AJA A;  2H3X A;  3UVL A;  5A2Q g;  4JHP C;  5M5T A;  2HKM A;  4JT5 C;  5C92 A;  3JZH A;  3OTT A;  1VZ3 A;  3NIG A;  3DXK C;  4U1E I;  1PGU A;  3VGZ A;  3PSL A;  5CXB A;  5E6S A;  1E5T A;  3KCI A;  2H14 A;  3I8E A;  1U4C A;  2GC4 A;  3EQ8 A;  3IKO A;  4J86 A;  4J8B A;  4O3T B;  3RRM C;  5M5S A;  4K3I D;  1YFQ A;  4NBM A;  3SXT D;  4FAN D;  2HXC A;  3SCY A;  5FFG A;  3SJL D;  3EI3 A;  3F3G A;  3I7N A;  3EI1 B;  4LGN A;  2VZ1 A;  1OLZ A;  4UM9 A;  3V9F A;  3EI4 A;  1UOP A;  3FCU A;  2YNO A;  3IUR A;  4Z8L A;  2PM9 A;  4J0W A;  4L1M A;  2OK6 A;  2VDL A;  4GGD A;  2CO0 C;  3ZDY A;  3PXT D;  1A0R B;  3IJE A;  3IUQ A;  5C9Z B;  1GP2 B;  1VYH C;  3I7H A;  5HQG A;  3V4V A;  4CC9 A;  1MG2 A;  3OKY A;  1JTD B;  1N6F A;  2H68 A;  2XYI A;  1H2Z A;  3EWE A;  3PE7 A;  2WQ8 A;  4JSV C;  4GM9 A;  2AGX A;  2EIC A;  2P9K C;  4ZOV A;  2AH1 A;  3L4O D;  3SMR A;  5KDO B;  4J82 A;  3GFC A;  4JXM A;  1M1X A;  4A7J A;  5FKT A;  3VI4 A;  5TEF A;  2AGW A;  2BKL A;  5EAL A;  1UOQ A;  4U7A A;  4CI1 A;  3UKU C;  2VZ3 A;  4J77 A;  4QQE A;  4G1E A;  5M5V A;  5FKR A;  4Z7O A;  2UZX B;  3IIW A;  2J57 G;  4NEN A;  5EMJ B;  4CI8 A;  3P4F A;  2HU8 A;  3ULE C;  3JB9 L;  4BH6 A;  1PEV A;  4KFM B;  4LG8 A;  4E54 A;  2IUP A;  3DXM C;  5AFU 3;  3MZK A;  3EI4 B;  3CIK B;  2GNQ A;  4Y5R D;  2I3T A;  4I79 A;  4R7A B;  3J81 g;  3C5M A;  3L4M D;  1R5M A;  4X3E A;  3BG1 A;  1JOF A;  4A0A A;  2EBS A;  3EMH A;  5GSA A;  4MMX A;  5M5U A;  3RMZ D;  1RI6 A;  4CZY A;  2YMU A;  3OKY B;  1P22 A;  3JZG A;  3BWS A;  5FFO A;  3O4G A;  3IUJ A;  3RLM D;  5IC7 A;  4BL0 A;  3DSM A;  5TDH B;  3FRX A;  4HDJ A;  3SVW D;  2B5M A;  4X60 B;  4CI2 A;  1O6G A;  2EIE A;  4ZOY A;  3K26 A;  3AFC A;  3NVQ A;  3PVW B;  3I7K A;  3AH8 B;  4A2L A;  4AN0 A;  4WK4 A;  3GRE A;  3QHY B;  3IJC A;  3MKS B;  2YNP A;  2CE8 A;  4BUJ C;  2OVR B;  4CZV A;  5FLX g;  3I7L A;  5FKQ A;  2VDK A;  4QAM A;  5EM2 A;  4CZX A;  2BCJ B;  4PNK B;  1GXR A;  2HU5 A;  3C99 A;  2HES X;  5FA5 B;  1PI6 A;  3A0F A;  2HJB A;  4CI3 A;  3SBQ A;  1NR0 A;  3MUO A;  4L1Q D;  4Y7R A;  3OL2 A;  2AH0 A;  4H5I A;  5K1C C;  5EAP A;  3ZDZ A;  5K19 A;  3VH0 A;  2IUR A;  3W15 A;  1YR2 A;  1JMX B;  4XYI A;  4A0A B;  4PBZ A;  2P9P C;  5I5M A;  4JD2 C;  4FA4 D;  3UR4 A;  5I5I A;  2AGL A;  3I7P A;  1SQJ A;  3DWL C;  4J87 A;  3MXX A;  3E0C A;  4LG9 A;  2QZP A;  3RFG A;  3VA6 A;  3ZE1 A;  5THA A;  5IT9 g;  2OJY A;  3FM0 A;  2UZY B;  2Z2P A;  4RE5 A;  3N0E A;  5HYN B;  2H6Q A;  3MKQ A;  3NVN A;  4GGA A;  3EI2 A;  1L5G A;  4YVD A;  5CXC A;  4FA9 D;  3V4P A;  4MK0 B;  4OWR A;  2VDO A;  4E5Z A;  4GM8 A;  1QNI A;  1H2Y A;  1S4U X;  4GZ8 A;  1TBG A;  2H6N A;  4XEI C;  5EMM B;  3PSC B;  3J80 g;  1U8C A;  3KRX B;  1U2V C;  4MMY A;  4JT6 C;  4NAA A;  4GQB B;  3JRO A;  2QXV A;  3RN1 D;  1FWX A;  3O4H A;  4J8G A;  1T2X A;  1Q47 A;  3ZE2 A;  2XU7 A;  5CYK A;  3NIF A;  5AMS A;  4EWR A;  4G1M A;  4FB1 D;  5EM2 B;  2QR5 A;  2AGY A;  4G55 A;  3IUM A;  2H9N A;  4A09 A;  4JSX C;  2QC5 A;  4CY3 A;  1C9L A;  5I5J A;  3T3P A;  2XE4 A;  3K71 A;  3OL2 B;  5CXB B;  3MZL A;  4FWW A;  1TYE A;  1ERJ A;  3CFS B;  1TYQ C;  2GC7 A;  2OIZ A;  2CE9 A;  4GMB A;  2VDQ A;  3I2N A;  3EI3 B;  2G9A A;  2P9S C;  4X63 B;  4OZU A;  3IVM A;  1MG3 A;  4JSN C;  3FGB A;  1I2M B;  2Q7Q A;  2VDR A;  3ZE0 A;  4PXW A;  2PM9 B;  2IUQ A;  4BCC A;  3NVX A;  3SN6 B;  2H47 A;  3OW8 A;  3EI2 B;  3F3F A;  3I7O A;  4D9S A;  4BP9 A;  5IJ7 E;  4AMZ A;  4JHN A;  4E5Z B;  2B5N A;  4UI9 R;  2CO0 A;  2YB8 B;  4J84 A;  4J81 A;  4FHL A;  3GC3 B;  3EQ9 A;  3C9C A;  3OF7 A;  1MDA H;  3O4J A;  3JAM g;  3ODT A;  1XIP A;  3SLE D;  4CY5 A;  3SHF A;  3IUL A;  4PSW B;  4J78 A;  3UVN A;  4NC4 A;  4A08 A;  3SBR A;  4ZOX A;  4ESG A;  1GOG A;  3NID A;  5IGQ A;  1JV2 A;  3DM0 A;  3AL9 A;  3EG6 A;  3ORV D;  3CFV A;  2OVQ B;  4O2W A;  4QRJ A;  1PBY B;  2HKR A;  5H17 A;  3JPX A;  2VDN A;  4CY2 A;  2I0T A;  3ZWL B;  4CY1 A;  3AL8 A;  4AOW A;  2P9L C;  4DNU A;  3C75 H;  5EML B;  4WK2 A;  4GGC A;  1B9Y A;  4A0B A;  2H13 A;  4BP8 A;  1L0Q A;  1QFM A;  4E54 B;  4J73 A;  3IJ1 A;  2PM6 B;  1E8M A;  1H2W A;  3V5W B;  2AQ5 A;  2OK4 A;  3UKR C;  2TRC B;  1BPO A;  3EQ7 A;  2VDM A;  4ERQ A;  5E6U A;  5HDB A;  3B7F A;  4GM3 A;  3KRW B;  3DDU A;  3JRP A;  4X61 B;  3PXS D;  4DNW A;  3HFQ A;  3SBP A;  1E8N A;  4A11 A;  3RN0 D;  2HYE A;  1K32 A;  4FAV D;  1K3I A;  1VZ2 A;  2Z2O A;  3T3M A;  2CNX A;  4A08 B;  4ZN4 A;  1B9X A;  2PBI B;  3OKW A;  5TF2 A;  4GQ2 P;  4WJK A;  2I3S A;  4BCB A;  4BCD A;  1C9I A;  2VC2 A;  4ZOZ A;  5GXH A;  5H14 A;  5EAR A;  2PM7 B;  3EU7 A;  2B4E A;  5HE2 B;  3PXW D;  2I0R A;  5C2V B;  5GXI A;  2BBK H;  2H9L A;  5FKS A;  2B5L A;  5JWZ A;  2EIB A;  5SXM A;  2H9M A;  3AL8 B;  2P9U C;  5HE3 B;  2H9P A;  2XZG A;  4O1Q D;  5M61 A;  4J79 A;  4ERZ A;  4A0B B;  2JKX A;  1XKS A;  4FA5 D;  3K72 A;  3OKT A;  3JZN A;  3IUN A;  3K27 A;  1GOT B;  1A12 A;  2J55 H;  1OMW B;  4RE6 A;  4O9D A;  4O02 A;  3UVK A;  2IWK A;  4ES0 A;  4AN1 A;  3UVM A;  2IAA A;  4GQ1 A;  1QFS A;  5GMK n;  1UTC A;  4O3U B;  3MVD K;  5FXY A;  1H2X A;  4AEZ A;  3SFZ A;  2CN3 A;  4Z7Q A;  1GOH A;  5IGO A;  3I89 A;  5EMK B;  4AX4 A;  4L9O A;  3U4Y A;  4A11 B;  2VDP A;  4PSX B; 
#chains in the Genus database with same CATH homology
 3SWS D;  2XL3 A;  3I8C A;  5H1M A;  3UVO A;  2HJ4 A;  3MMY A;  4J0X A;  2P9I C;  2IUV A;  5EAM A;  3RSE C;  4A2M A;  1XHM A;  3BG0 A;  4XYH A;  4IA9 A;  4D6V A;  5CXC B;  4L3G D;  2Z2N A;  5TEE A;  4N14 A;  1N6E A;  3IIY A;  2G99 A;  2AGZ A;  3IJ0 A;  3F3P A;  2XL2 A;  4TZ4 A;  3PVU B;  4PC0 A;  2OVP B;  5B4W A;  2H6K A;  4FA1 D;  1JJU B;  2I0S A;  4H5J A;  5CYK B;  1N6D A;  4QL1 A;  2YNN A;  1SQ9 A;  4A09 B;  1NEX B;  4K3J B;  3N0D A;  4NSX A;  3EI1 A;  4G56 B;  5HE0 B;  4L3H D;  2O9K A;  2W18 A;  1SHY B;  2YBA A;  4QT8 A;  5IJ8 E;  2CN2 A;  4ERY A;  3RFH A;  4D0K A;  4PBY A;  1GG2 B;  2P9N C;  4IMM A;  2J56 H;  4O45 A;  5C2W B;  1K8K C;  3V7D B;  5FQD A;  5HE1 B;  1JMZ B;  2IWF A;  2MTA H;  4JSP C;  5AJA A;  2H3X A;  3UVL A;  5A2Q g;  2HKM A;  4JT5 C;  3JZH A;  3OTT A;  3DXK C;  4U1E I;  1PGU A;  3VGZ A;  3PSL A;  5CXB A;  2H14 A;  3I8E A;  4J8B A;  1U4C A;  2GC4 A;  3IKO A;  4J86 A;  4O3T B;  3RRM C;  4K3I D;  1YFQ A;  3SXT D;  4FAN D;  2HXC A;  3SCY A;  3SJL D;  3EI3 A;  3F3G A;  3I7N A;  3EI1 B;  4LGN A;  1OLZ A;  3V9F A;  3EI4 A;  2YNO A;  4Z8L A;  2PM9 A;  4J0W A;  2OK6 A;  4GGD A;  2CO0 C;  3PXT D;  1A0R B;  5C9Z B;  1GP2 B;  1VYH C;  3I7H A;  5HQG A;  4CC9 A;  1MG2 A;  3OKY A;  1N6F A;  2H68 A;  2XYI A;  3PE7 A;  3EWE A;  4JSV C;  4GM9 A;  2AGX A;  2P9K C;  4ZOV A;  2AH1 A;  3L4O D;  3SMR A;  5KDO B;  4J82 A;  3GFC A;  4JXM A;  4A7J A;  5FKT A;  5TEF A;  2AGW A;  5EAL A;  4U7A A;  4CI1 A;  3UKU C;  4J77 A;  4QQE A;  5FKR A;  2UZX B;  3IIW A;  2J57 G;  5EMJ B;  4CI8 A;  3P4F A;  3ULE C;  3JB9 L;  4BH6 A;  1PEV A;  4KFM B;  4LG8 A;  4E54 A;  2IUP A;  3DXM C;  5AFU 3;  3MZK A;  3EI4 B;  3CIK B;  2GNQ A;  4Y5R D;  2I3T A;  4I79 A;  4R7A B;  3J81 g;  3C5M A;  3L4M D;  1R5M A;  4X3E A;  3BG1 A;  1JOF A;  4A0A A;  2EBS A;  3EMH A;  5GSA A;  3RMZ D;  1RI6 A;  4CZY A;  2YMU A;  3OKY B;  1P22 A;  3JZG A;  3BWS A;  3RLM D;  5IC7 A;  4BL0 A;  3DSM A;  5TDH B;  3FRX A;  4HDJ A;  3SVW D;  2B5M A;  4X60 B;  4CI2 A;  4ZOY A;  3K26 A;  3AFC A;  3NVQ A;  3PVW B;  3I7K A;  3AH8 B;  4A2L A;  3GRE A;  3IJC A;  3MKS B;  2YNP A;  2CE8 A;  4BUJ C;  2OVR B;  4CZV A;  5FLX g;  3I7L A;  5FKQ A;  5EM2 A;  4CZX A;  2BCJ B;  4PNK B;  1GXR A;  2HES X;  3C99 A;  5FA5 B;  1PI6 A;  3A0F A;  2HJB A;  4CI3 A;  3SBQ A;  1NR0 A;  4L1Q D;  4Y7R A;  3OL2 A;  2AH0 A;  4H5I A;  5K1C C;  5EAP A;  5K19 A;  3VH0 A;  2IUR A;  3W15 A;  1JMX B;  4XYI A;  4A0A B;  4PBZ A;  2P9P C;  5I5M A;  4JD2 C;  4FA4 D;  3UR4 A;  5I5I A;  2AGL A;  3I7P A;  1SQJ A;  3DWL C;  4J87 A;  3MXX A;  3E0C A;  4LG9 A;  3RFG A;  3VA6 A;  5THA A;  5IT9 g;  2OJY A;  3FM0 A;  2UZY B;  2Z2P A;  3N0E A;  5HYN B;  2H6Q A;  3MKQ A;  3NVN A;  4GGA A;  3EI2 A;  4YVD A;  5CXC A;  4FA9 D;  4MK0 B;  4OWR A;  4E5Z A;  4GM8 A;  1QNI A;  1S4U X;  4GZ8 A;  1TBG A;  2H6N A;  4XEI C;  5EMM B;  3PSC B;  3J80 g;  3KRX B;  1U2V C;  4JT6 C;  4GQB B;  3JRO A;  2QXV A;  3RN1 D;  1FWX A;  4J8G A;  1Q47 A;  2XU7 A;  5CYK A;  5AMS A;  4EWR A;  4FB1 D;  5EM2 B;  2AGY A;  2H9N A;  4A09 A;  4JSX C;  2QC5 A;  4CY3 A;  5I5J A;  3OL2 B;  5CXB B;  3MZL A;  4FWW A;  1ERJ A;  3CFS B;  1TYQ C;  2GC7 A;  2OIZ A;  2CE9 A;  4GMB A;  3I2N A;  3EI3 B;  2G9A A;  2P9S C;  4X63 B;  4OZU A;  1MG3 A;  4JSN C;  3FGB A;  2Q7Q A;  4PXW A;  2PM9 B;  2IUQ A;  3NVX A;  3SN6 B;  3OW8 A;  2H47 A;  3EI2 B;  3F3F A;  3I7O A;  5IJ7 E;  4E5Z B;  2B5N A;  4UI9 R;  2CO0 A;  2YB8 B;  4J84 A;  4J81 A;  4FHL A;  3C9C A;  1MDA H;  3JAM g;  3ODT A;  1XIP A;  3SLE D;  4CY5 A;  3SHF A;  4PSW B;  3UVN A;  4J78 A;  4A08 A;  3SBR A;  4ZOX A;  4ESG A;  5IGQ A;  3DM0 A;  3AL9 A;  3EG6 A;  3ORV D;  3CFV A;  2OVQ B;  4QRJ A;  1PBY B;  2HKR A;  5H17 A;  3JPX A;  4CY2 A;  2I0T A;  3ZWL B;  4CY1 A;  3AL8 A;  4AOW A;  2P9L C;  3C75 H;  5EML B;  4GGC A;  1B9Y A;  4A0B A;  2H13 A;  1L0Q A;  4E54 B;  4J73 A;  3IJ1 A;  2PM6 B;  3V5W B;  2AQ5 A;  2OK4 A;  3UKR C;  2TRC B;  4ERQ A;  3B7F A;  4GM3 A;  3KRW B;  3JRP A;  4X61 B;  3PXS D;  3HFQ A;  3SBP A;  4A11 A;  3RN0 D;  1K32 A;  4FAV D;  2Z2O A;  2CNX A;  4A08 B;  4ZN4 A;  1B9X A;  2PBI B;  3OKW A;  5TF2 A;  4GQ2 P;  2I3S A;  4ZOZ A;  5GXH A;  5H14 A;  5EAR A;  2PM7 B;  3EU7 A;  2B4E A;  5HE2 B;  3PXW D;  2I0R A;  5C2V B;  5GXI A;  2BBK H;  2H9L A;  5FKS A;  2B5L A;  5JWZ A;  5SXM A;  2H9M A;  3AL8 B;  2P9U C;  5HE3 B;  2H9P A;  4O1Q D;  4J79 A;  4ERZ A;  4A0B B;  4FA5 D;  1XKS A;  3OKT A;  3JZN A;  3K27 A;  1GOT B;  2J55 H;  1OMW B;  4O9D A;  3UVK A;  2IWK A;  4ES0 A;  3UVM A;  2IAA A;  4GQ1 A;  5GMK n;  4O3U B;  5FXY A;  4AEZ A;  3SFZ A;  2CN3 A;  5IGO A;  3I89 A;  5EMK B;  4L9O A;  3U4Y A;  4A11 B;  2HYE A;  4PSX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...