5EALA

Crystal structure of human wdr5 in complex with compound 9h
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
b'VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title Crystal structure of human WDR5 in complex with compound 9h
rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
total genus 102
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5ealA00
2IWFA 5I5JA 3SFZA 4J87A 3RSEC 1MG2A 3GREA 1SHYB 1TYQC 4JSVC 1MG3A 4GM9A 5K19A 2J56H 1P22A 2XU7A 3DM0A 5HE3B 3JPXA 2YNOA 4CZXA 4FA9D 4ESGA 3AFCA 3N0DA 4A08A 3FRXA 2MTAH 5IJ7E 2BBKH 3OL2A 3KRXB 4CI8A 5FXYA 3EI2A 3UVLA 4Z8LA 4EWRA 2AQ5A 2H68A 2HKMA 3K27A 2HXCA 2OVPB 1JMXB 1K8KC 3EI3B 4JT5C 4PBYA 4GGCA 4L3GD 4XYIA 4A11B 2BCJB 3I8EA 4G56B 2GC4A 3BG1A 4TZ4A 3J81g 3I7NA 3A0FA 5CXBB 2G9AA 4O3UB 4J81A 3RN1D 4JD2C 2I0SA 4J86A 4OWRA 4PBZA 3JAMg 4J8GA 2H9MA 3NVQA 5FLXg 3E0CA 3RN0D 2P9IC 4A09B 4ERQA 2IUVA 4GGAA 3JB9L 4BUJC 4GMBA 4U7AA 2H14A 5EAPA 3ULEC 1S4UX 2H9PA 3W15A 4HDJA 5CYKA 3SN6B 2B5NA 3AL8B 5CXCB 4GM8A 2OJYA 5IC7A 2B5LA 1U4CA 3MMYA 3NVXA 4QL1A 2PM9B 5I5IA 3F3PA 1XIPA 1OLZA 4CY1A 2PM7B 3V7DB 3ORVD 5FA5B 4JT6C 4O1QD 1QNIA 5H17A 2J55H 3VGZA 2AH0A 3V9FA 4L1QD 4A2MA 2GNQA 4GQBB 2P9PC 2H6NA 4A0BB 2CN3A 4R7AB 4IA9A 1N6DA 4GQ1A 3IJCA 3AH8B 5GMKn 3JZNA 1NR0A 3EI4A 3FGBA 1Q47A 4AOWA 2B4EA 4GQ2P 3I89A 3RMZD 5HQGA 2G99A 5EMJB 1L0QA 4J78A 1B9XA 3PXTD 5EMKB 3RFGA 1GG2B 5HYNB 2IWKA 3DWLC 4J8BA 3I7KA 4J84A 3SHFA 4I79A 5IT9g 3OKYB 2YNPA 4FA5D 4FA1D 5EM2B 2P9UC 3MKQA 1B9YA 1VYHC 5EALA 4J82A 5C2VB 3CFSB 5IJ8E 2Z2PA 4Y5RD 3IJ0A 1RI6A 4MK0B 2P9LC 3EG6A 3C99A 5HE2B 3I7OA 5FKSA 4A0AA 3SBRA 5FQDA 3PE7A 5THAA 4A08B 2CE9A 4E54A 3OTTA 3SLED 3CIKB 4QRJA 4LG8A 3SWSD 5C2WB 1NEXB 3IIYA 3VA6A 4JSPC 4J0WA 1FWXA 4CY3A 5B4WA 1U2VC 2UZYB 4Y7RA 5EMLB 2Q7QA 3OW8A 4H5JA 5IGOA 3N0EA 3SBQA 3J80g 4X60B 5JWZA 2H47A 1N6FA 3BG0A 1ERJA 2YNNA 4QQEA 4J77A 2J57G 3SCYA 4JSNC 2XYIA 4XYHA 4O3TB 3RFHA 1TBGA 2AGYA 2AGWA 3BWSA 5SXMA 3KRWB 3PVUB 4PC0A 3L4MD 3EI1B 4UI9R 5AMSA 3ZWLB 3L4OD 5A2Qg 5CYKB 4A7JA 3V5WB 5GXIA 3F3FA 3MXXA 5GXHA 3UVOA 3JZHA 4U1EI 4PXWA 4BL0A 1SQ9A 4J73A 4PSWB 4ZOYA 2HYEA 2P9KC 3EWEA 3UKUC 4O9DA 5EAMA 2W18A 2AGLA 5EARA 2Z2OA 4CZYA 5I5MA 2YBAA 3ODTA 5TF2A 1OMWB 2H3XA 4X3EA 4A0BA 3SXTD 3UVNA 2O9KA 2IUQA 4AEZA 4CY5A 1K32A 5EMMB 2Z2NA 4FWWA 4E5ZA 4FHLA 3SMRA 3PSCB 4YVDA 2OK6A 1JJUB 4N14A 3OKTA 2XL2A 3RLMD 3UVKA 3DXKC 5AJAA 3JROA 1JOFA 2CO0C 4CY2A 3EMHA 3OKYA 2P9NC 4IMMA 2CN2A 3FM0A 2IURA 3MKSB 3VH0A 1GXRA 4NSXA 5H1MA 4A0AB 3OL2B 3IKOA 3PSLA 2PM6B 3DXMC 2TRCB 3EI2B 3EU7A 1XKSA 3C9CA 1PGUA 4D6VA 2PBIB 4E54B 2I3TA 2OVQB 1JMZB 4K3JB 4X63B 4BH6A 2OK4A 4LGNA 5H14A 2XL3A 1YFQA 4ES0A 4ZOXA 4LG9A 2H6KA 4ERZA 3K26A 3EI3A 2P9SC 4ZN4A 2H13A 4PNKB 5FKRA 5HE1B 1MDAH 5K1CC 4A11A 3C5MA 3JRPA 3JZGA 2AGZA 4L9OA 5KDOB 2YB8B 1GP2B 3PVWB 5CXBA 5TEEA 1R5MA 1SQJA 2QXVA 3CFVA 1GOTB 5FKQA 1XHMA 3F3GA 4JSXC 4J0XA 4PSXB 4FA4D 4GZ8A 5TEFA 3I7HA 4CZVA 4JXMA 4A09A 3IJ1A 4FB1D 3IIWA 2YMUA 2HJBA 4CI3A 2QC5A 3I2NA 4XEIC 3UVMA 3UKRC 3PXWD 4FAND 2CE8A 2H6QA 4GGDA 2IUPA 4FAVD 3MZLA 4QT8A 2I3SA 2I0RA 5HE0B 3AL8A 5CXCA 1N6EA 3EI1A 5AFU3 2AH1A 4OZUA 5FKTA 3PXSD 4O45A 2PM9A 1PI6A 2B5MA 5C9ZB 3MZKA 3DSMA 3U4YA 5GSAA 3GFCA 4ZOZA 4H5IA 2OVRB 2EBSA 4J79A 1A0RB 3RRMC 1PBYB 2H9NA 3C75H 3EI4B 3SJLD 3AL9A 2GC7A 2HJ4A 4KFMB 4A2LA 4ERYA 2AGXA 3OKWA 5TDHB 3I7LA 4CC9A 3P4FA 3NVNA 1PEVA 3SBPA 4ZOVA 4L3HD 3B7FA 2HESX 2CO0A 2IAAA 4E5ZB 3SVWD 2UZXB 2OIZA 4D0KA 2CNXA 2HKRA 2I0TA 3I7PA 4GM3A 4CI1A 3I8CA 4X61B 4K3ID 3HFQA 5IGQA 4CI2A 5EM2A 3UR4A 2H9LA
chains in the Genus database with same CATH superfamily
3VI3A 1H2WA 3K71A 2IWFA 5I5JA 3SFZA 1JV2A 4J87A 3RSEC 1MG2A 3GREA 1SHYB 1TYQC 3DDUA 3IUQA 4JSVC 1MG3A 4GM9A 5K19A 4WK0A 2J56H 1P22A 2XU7A 3DM0A 5HE3B 3JPXA 3ZDYA 5M5RA 2YNOA 4CZXA 4FA9D 4ESGA 3AFCA 2VDRA 3N0DA 4A08A 3FRXA 2MTAH 4NBMA 2BBKH 5IJ7E 3OL2A 3KRXB 4CI8A 5FXYA 3EI2A 3UVLA 4Z8LA 4EWRA 1TYEA 2AQ5A 2H68A 2HKMA 2VDQA 3K27A 2HXCA 2OVPB 1JMXB 1K8KC 3EI3B 4JT5C 4JHPC 4PBYA 4GGCA 4L3GD 4XYIA 4A11B 2BCJB 3I8EA 4G56B 2GC4A 3BG1A 4TZ4A 3J81g 3I7NA 3A0FA 1BPOA 5CXBB 5M5SA 2G9AA 4O3UB 3ZDZA 4J81A 3RN1D 1VZ3A 4JD2C 2I0SA 3V4VA 1QFMA 4J86A 4OWRA 4PBZA 3JAMg 4J8GA 2H9MA 3NVQA 5FLXg 3E0CA 3RN0D 2P9IC 4O2WA 4A09B 4ERQA 2IUVA 4GGAA 3JB9L 4BUJC 3EQ8A 3IUMA 4GMBA 4U7AA 2H14A 1GOFA 5EAPA 3ULEC 1S4UX 2H9PA 3W15A 4HDJA 5CYKA 3SN6B 2B5NA 3AL8B 5CXCB 4GM8A 2OJYA 4MMYA 5IC7A 2B5LA 1U4CA 3MMYA 2VZ1A 3NVXA 4QL1A 2PM9B 5I5IA 3F3PA 1XIPA 1OLZA 4CY1A 2PM7B 3T3PA 3V7DB 3ORVD 5FA5B 4JT6C 4O1QD 1QNIA 5H17A 2J55H 1C9LA 3VGZA 2AH0A 3V9FA 4L1QD 5M5UA 4A2MA 2GNQA 4GQBB 2P9PC 4BCDA 2H6NA 3EQ9A 4A0BB 4WJKA 4AX4A 2CN3A 3NIFA 4R7AB 4IA9A 1N6DA 4GQ1A 3IJCA 3AH8B 5GMKn 3JZNA 4DNVA 1NR0A 3EI4A 3T3MA 1A12A 1GOHA 3FGBA 1Q47A 1E5TA 4AOWA 2B4EA 4GQ2P 3I89A 3RMZD 2JKXA 5HQGA 2G99A 5EMJB 1L0QA 4J78A 1B9XA 3PXTD 5EMKB 3RFGA 1GG2B 5HYNB 2IWKA 3DWLC 4G1MA 4J8BA 3I7KA 4J84A 3SHFA 4I79A 5IT9g 3OKYB 2YNPA 4FA5D 4FA1D 5EM2B 5C92A 2P9UC 3MKQA 3IUJA 1B9YA 1VYHC 5EALA 4J82A 5C2VB 3CFSB 5IJ8E 4RE6A 2VDMA 2Z2PA 4Y5RD 3IJ0A 1RI6A 4MK0B 2P9LC 3EG6A 3C99A 5HE2B 4NENA 1UOQA 3I7OA 5FKSA 4A0AA 1JTDB 3SBRA 5FQDA 3PE7A 5THAA 4A08B 2CE9A 4E54A 2VDPA 3OTTA 3VI4A 2VDNA 3SLED 3CIKB 4QRJA 4LG8A 3SWSD 5C2WB 1NEXB 3IIYA 1VE7A 3VA6A 3K72A 2VDLA 1H2XA 3IUNA 3IJEA 4JSPC 4J0WA 1FWXA 4CY3A 5B4WA 2XZGA 1U2VC 2UZYB 2VC2A 4Y7RA 4G1EA 5EMLB 2Q7QA 3OW8A 4H5JA 5IGOA 4Z7QA 2EIBA 3N0EA 3MVDK 3SBQA 3J80g 5M5VA 4X60B 5JWZA 2H47A 1N6FA 5M5TA 3BG0A 3O4JA 1ERJA 1C9IA 2YNNA 1H2YA 4BCBA 4QQEA 4AMZA 4J77A 2J57G 3SCYA 4JSNC 2XYIA 4XYHA 4IRZA 1VE6A 4O3TB 3RFHA 1TBGA 3O4IA 2AGYA 3IVMA 2AGWA 3BWSA 1K3IA 5SXMA 3KRWB 3QHYB 3PVUB 4PC0A 3L4MD 3EI1B 4UI9R 1O6GA 5AMSA 3ZWLB 3L4OD 5A2Qg 5CYKB 4A7JA 4BP8A 3V5WB 3EQ7A 1E8NA 5GXIA 3F3FA 4O02A 3K6SA 3ZE1A 3MXXA 5GXHA 3UVOA 3JZHA 4U1EI 4PXWA 4BL0A 1SQ9A 2XE4A 4J73A 4PSWB 5HDBA 4ZOYA 2HYEA 2P9KC 3EWEA 4MMZA 3UKUC 4O9DA 4Z7NA 5EAMA 2W18A 5E6RA 4BCCA 3O4HA 2AGLA 5EARA 2Z2OA 4CZYA 5I5MA 2QZPA 2YBAA 4NC4A 3ODTA 5TF2A 1OMWB 2EIDA 2H3XA 4WK2A 4X3EA 4A0BA 3SXTD 3UVNA 4MMXA 2O9KA 2IUQA 1U8CA 4AEZA 4JHNA 4Z7OA 4CY5A 1K32A 2QR5A 3GD1I 5EMMB 2Z2NA 4FWWA 4E5ZA 4FHLA 3SMRA 3PSCB 4YVDA 2OK6A 1JJUB 1UOPA 3NIGA 4N14A 3OKTA 2XL2A 3RLMD 3UVKA 3DXKC 5AJAA 3JROA 1JOFA 2CO0C 4CY2A 3EMHA 3OKYA 2P9NC 4IMMA 2CN2A 1T2XA 2EIEA 5M61A 3FM0A 2XDWA 2IURA 3MKSB 3VH0A 1GXRA 4NSXA 5H1MA 4RE5A 4A0AB 3OL2B 3IKOA 3PSLA 4WK4A 2PM6B 3DXMC 2TRCB 3EI2B 1GOGA 3EU7A 1XKSA 3C9CA 1PGUA 4D6VA 2PBIB 4E54B 2I3TA 2OVQB 1JMZB 4K3JB 3ZE2A 4X63B 4BH6A 2OK4A 4LGNA 5H14A 2XL3A 1YFQA 1VZ2A 4ES0A 3QI0A 4ZOXA 4LG9A 2H6KA 4ERZA 3K26A 3EI3A 4AMYA 2P9SC 2VDKA 2H13A 4BP9A 4ZN4A 3GC3B 4PNKB 5FKRA 3IULA 5HE1B 1MDAH 1M1XA 5K1CC 4A11A 3C5MA 3JRPA 2HU5A 3JZGA 1I2MB 2AGZA 4L9OA 5KDOB 2YB8B 1GP2B 3PVWB 5CXBA 5TEEA 1R5MA 1SQJA 2QXVA 3CFVA 1GOTB 5FKQA 1XHMA 3F3GA 5E6SA 4JSXC 4J0XA 4PSXB 3IURA 4FA4D 4GZ8A 4QAMA 2VZ3A 1L5GA 5TEFA 3I7HA 4CZVA 4JXMA 4A09A 3IJ1A 4FB1D 3IIWA 1QFSA 1YR2A 2YMUA 3ZE0A 2HJBA 4CI3A 2QC5A 3I2NA 4XEIC 5FFGA 3UVMA 1O6FA 3PXWD 3UKRC 4FAND 2CE8A 2H6QA 3O4GA 4GGDA 2IUPA 4FAVD 5E6UA 3MZLA 4QT8A 2I3SA 2I0RA 5HE0B 3AL8A 5CXCA 1N6EA 3ZDXA 3EI1A 5AFU3 3FCSA 2AH1A 3MUNA 4OZUA 5FKTA 3PXSD 1E8MA 4O45A 2PM9A 4UM8A 1PI6A 3V4PA 4DNUA 2B5MA 5C9ZB 3MZKA 3DSMA 3NIDA 5GSAA 3U4YA 3GFCA 4ZOZA 2EICA 4UM9A 4H5IA 4D9SA 2OVRB 4NAAA 2EBSA 4J79A 4DNWA 1A0RB 3RRMC 2HU7A 1PBYB 2H9NA 3C75H 3EI4B 1H2ZA 3SJLD 1UOOA 3AL9A 4AN0A 2GC7A 2HJ4A 4KFMB 4A2LA 4ERYA 2VDOA 2AGXA 3OKWA 5TDHB 3FCUA 3I7LA 4CC9A 3P4FA 3NVNA 1PEVA 3SBPA 4ZOVA 4L3HD 5C86A 3B7FA 2HESX 2BKLA 2CO0A 2IAAA 4E5ZB 3SVWD 2UZXB 2OIZA 4D0KA 2CNXA 2HKRA 2I0TA 2WQ8A 3I7PA 3OF7A 4GM3A 4CI1A 3I8CA 3KCIA 5FFOA 3MUOA 1UTCA 2HU8A 4L1MA 4X61B 4K3ID 3HFQA 5IGQA 4CI2A 5EM2A 3UR4A 2H9LA 4AN1A 4G55A
chains in the Genus database with same CATH topology
2IWFA 5I5JA 3SFZA 4J87A 3RSEC 1MG2A 3GREA 1SHYB 1TYQC 4JSVC 1MG3A 4GM9A 5K19A 2J56H 1P22A 2XU7A 3DM0A 5HE3B 3JPXA 2YNOA 4CZXA 4FA9D 4ESGA 3AFCA 3N0DA 4A08A 3FRXA 2MTAH 5IJ7E 2BBKH 3OL2A 3KRXB 4CI8A 5FXYA 3EI2A 3UVLA 4Z8LA 4EWRA 2AQ5A 2H68A 2HKMA 3K27A 2HXCA 2OVPB 1JMXB 1K8KC 3EI3B 4JT5C 4PBYA 4GGCA 4L3GD 4XYIA 4A11B 2BCJB 3I8EA 4G56B 2GC4A 3BG1A 4TZ4A 3J81g 3I7NA 3A0FA 5CXBB 2G9AA 4O3UB 4J81A 3RN1D 4JD2C 2I0SA 4J86A 4OWRA 4PBZA 3JAMg 4J8GA 2H9MA 3NVQA 5FLXg 3E0CA 3RN0D 2P9IC 4A09B 4ERQA 2IUVA 4GGAA 3JB9L 4BUJC 4GMBA 4U7AA 2H14A 5EAPA 3ULEC 1S4UX 2H9PA 3W15A 4HDJA 5CYKA 3SN6B 2B5NA 3AL8B 5CXCB 4GM8A 2OJYA 5IC7A 2B5LA 1U4CA 3MMYA 3NVXA 4QL1A 2PM9B 5I5IA 3F3PA 1XIPA 1OLZA 4CY1A 2PM7B 3V7DB 3ORVD 5FA5B 4JT6C 4O1QD 1QNIA 5H17A 2J55H 3VGZA 2AH0A 3V9FA 4L1QD 4A2MA 2GNQA 4GQBB 2P9PC 2H6NA 4A0BB 2CN3A 4R7AB 4IA9A 1N6DA 4GQ1A 3IJCA 3AH8B 5GMKn 3JZNA 1NR0A 3EI4A 3FGBA 1Q47A 4AOWA 2B4EA 4GQ2P 3I89A 3RMZD 5HQGA 2G99A 5EMJB 1L0QA 4J78A 1B9XA 3PXTD 5EMKB 3RFGA 1GG2B 5HYNB 2IWKA 3DWLC 4J8BA 3I7KA 4J84A 3SHFA 4I79A 5IT9g 3OKYB 2YNPA 4FA5D 4FA1D 5EM2B 2P9UC 3MKQA 1B9YA 1VYHC 5EALA 4J82A 5C2VB 3CFSB 5IJ8E 2Z2PA 4Y5RD 3IJ0A 1RI6A 4MK0B 2P9LC 3EG6A 3C99A 5HE2B 3I7OA 5FKSA 4A0AA 3SBRA 5FQDA 3PE7A 5THAA 4A08B 2CE9A 4E54A 3OTTA 3SLED 3CIKB 4QRJA 4LG8A 3SWSD 5C2WB 1NEXB 3IIYA 3VA6A 4JSPC 4J0WA 1FWXA 4CY3A 5B4WA 1U2VC 2UZYB 4Y7RA 5EMLB 2Q7QA 3OW8A 4H5JA 5IGOA 3N0EA 3SBQA 3J80g 4X60B 5JWZA 2H47A 1N6FA 3BG0A 1ERJA 2YNNA 4QQEA 4J77A 2J57G 3SCYA 4JSNC 2XYIA 4XYHA 4O3TB 3RFHA 1TBGA 2AGYA 2AGWA 3BWSA 5SXMA 3KRWB 3PVUB 4PC0A 3L4MD 3EI1B 4UI9R 5AMSA 3ZWLB 3L4OD 5A2Qg 5CYKB 4A7JA 3V5WB 5GXIA 3F3FA 3MXXA 5GXHA 3UVOA 3JZHA 4U1EI 4PXWA 4BL0A 1SQ9A 4J73A 4PSWB 4ZOYA 2HYEA 2P9KC 3EWEA 3UKUC 4O9DA 5EAMA 2W18A 2AGLA 5EARA 2Z2OA 4CZYA 5I5MA 2YBAA 3ODTA 5TF2A 1OMWB 2H3XA 4X3EA 4A0BA 3SXTD 3UVNA 2O9KA 2IUQA 4AEZA 4CY5A 1K32A 5EMMB 2Z2NA 4FWWA 4E5ZA 4FHLA 3SMRA 3PSCB 4YVDA 2OK6A 1JJUB 4N14A 3OKTA 2XL2A 3RLMD 3UVKA 3DXKC 5AJAA 3JROA 1JOFA 2CO0C 4CY2A 3EMHA 3OKYA 2P9NC 4IMMA 2CN2A 3FM0A 2IURA 3MKSB 3VH0A 1GXRA 4NSXA 5H1MA 4A0AB 3OL2B 3IKOA 3PSLA 2PM6B 3DXMC 2TRCB 3EI2B 3EU7A 1XKSA 3C9CA 1PGUA 4D6VA 2PBIB 4E54B 2I3TA 2OVQB 1JMZB 4K3JB 4X63B 4BH6A 2OK4A 4LGNA 5H14A 2XL3A 1YFQA 4ES0A 4ZOXA 4LG9A 2H6KA 4ERZA 3K26A 3EI3A 2P9SC 4ZN4A 2H13A 4PNKB 5FKRA 5HE1B 1MDAH 5K1CC 4A11A 3C5MA 3JRPA 3JZGA 2AGZA 4L9OA 5KDOB 2YB8B 1GP2B 3PVWB 5CXBA 5TEEA 1R5MA 1SQJA 2QXVA 3CFVA 1GOTB 5FKQA 1XHMA 3F3GA 4JSXC 4J0XA 4PSXB 4FA4D 4GZ8A 5TEFA 3I7HA 4CZVA 4JXMA 4A09A 3IJ1A 4FB1D 3IIWA 2YMUA 2HJBA 4CI3A 2QC5A 3I2NA 4XEIC 3UVMA 3UKRC 3PXWD 4FAND 2CE8A 2H6QA 4GGDA 2IUPA 4FAVD 3MZLA 4QT8A 2I3SA 2I0RA 5HE0B 3AL8A 5CXCA 1N6EA 3EI1A 5AFU3 2AH1A 4OZUA 5FKTA 3PXSD 4O45A 2PM9A 1PI6A 2B5MA 5C9ZB 3MZKA 3DSMA 3U4YA 5GSAA 3GFCA 4ZOZA 4H5IA 2OVRB 2EBSA 4J79A 1A0RB 3RRMC 1PBYB 2H9NA 3C75H 3EI4B 3SJLD 3AL9A 2GC7A 2HJ4A 4KFMB 4A2LA 4ERYA 2AGXA 3OKWA 5TDHB 3I7LA 4CC9A 3P4FA 3NVNA 1PEVA 3SBPA 4ZOVA 4L3HD 3B7FA 2HESX 2CO0A 2IAAA 4E5ZB 3SVWD 2UZXB 2OIZA 4D0KA 2CNXA 2HKRA 2I0TA 3I7PA 4GM3A 4CI1A 3I8CA 4X61B 4K3ID 3HFQA 5IGQA 4CI2A 5EM2A 3UR4A 2H9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IWF A;  5I5J A;  3SFZ A;  4J87 A;  3RSE C;  1MG2 A;  3GRE A;  1SHY B;  1TYQ C;  4JSV C;  1MG3 A;  4GM9 A;  5K19 A;  2J56 H;  1P22 A;  2XU7 A;  3DM0 A;  5HE3 B;  3JPX A;  2YNO A;  4CZX A;  4FA9 D;  4ESG A;  3AFC A;  3N0D A;  4A08 A;  3FRX A;  2MTA H;  5IJ7 E;  2BBK H;  3OL2 A;  3KRX B;  4CI8 A;  5FXY A;  3EI2 A;  3UVL A;  4Z8L A;  4EWR A;  2AQ5 A;  2H68 A;  2HKM A;  3K27 A;  2HXC A;  2OVP B;  1JMX B;  1K8K C;  3EI3 B;  4JT5 C;  4PBY A;  4GGC A;  4L3G D;  4XYI A;  4A11 B;  2BCJ B;  3I8E A;  4G56 B;  2GC4 A;  3BG1 A;  4TZ4 A;  3J81 g;  3I7N A;  3A0F A;  5CXB B;  2G9A A;  4O3U B;  4J81 A;  3RN1 D;  4JD2 C;  2I0S A;  4J86 A;  4OWR A;  4PBZ A;  3JAM g;  4J8G A;  2H9M A;  3NVQ A;  5FLX g;  3E0C A;  3RN0 D;  2P9I C;  4A09 B;  4ERQ A;  2IUV A;  4GGA A;  3JB9 L;  4BUJ C;  4GMB A;  4U7A A;  2H14 A;  5EAP A;  3ULE C;  1S4U X;  2H9P A;  3W15 A;  4HDJ A;  5CYK A;  3SN6 B;  2B5N A;  3AL8 B;  5CXC B;  4GM8 A;  2OJY A;  5IC7 A;  2B5L A;  1U4C A;  3MMY A;  3NVX A;  4QL1 A;  2PM9 B;  5I5I A;  3F3P A;  1XIP A;  1OLZ A;  4CY1 A;  2PM7 B;  3V7D B;  3ORV D;  5FA5 B;  4JT6 C;  4O1Q D;  1QNI A;  5H17 A;  2J55 H;  3VGZ A;  2AH0 A;  3V9F A;  4L1Q D;  4A2M A;  2GNQ A;  4GQB B;  2P9P C;  2H6N A;  4A0B B;  2CN3 A;  4R7A B;  4IA9 A;  1N6D A;  4GQ1 A;  3IJC A;  3AH8 B;  5GMK n;  3JZN A;  1NR0 A;  3EI4 A;  3FGB A;  1Q47 A;  4AOW A;  2B4E A;  4GQ2 P;  3I89 A;  3RMZ D;  5HQG A;  2G99 A;  5EMJ B;  1L0Q A;  4J78 A;  1B9X A;  3PXT D;  5EMK B;  3RFG A;  1GG2 B;  5HYN B;  2IWK A;  3DWL C;  4J8B A;  3I7K A;  4J84 A;  3SHF A;  4I79 A;  5IT9 g;  3OKY B;  2YNP A;  4FA5 D;  4FA1 D;  5EM2 B;  2P9U C;  3MKQ A;  1B9Y A;  1VYH C;  5EAL A;  4J82 A;  5C2V B;  3CFS B;  5IJ8 E;  2Z2P A;  4Y5R D;  3IJ0 A;  1RI6 A;  4MK0 B;  2P9L C;  3EG6 A;  3C99 A;  5HE2 B;  3I7O A;  5FKS A;  4A0A A;  3SBR A;  5FQD A;  3PE7 A;  5THA A;  4A08 B;  2CE9 A;  4E54 A;  3OTT A;  3SLE D;  3CIK B;  4QRJ A;  4LG8 A;  3SWS D;  5C2W B;  1NEX B;  3IIY A;  3VA6 A;  4JSP C;  4J0W A;  1FWX A;  4CY3 A;  5B4W A;  1U2V C;  2UZY B;  4Y7R A;  5EML B;  2Q7Q A;  3OW8 A;  4H5J A;  5IGO A;  3N0E A;  3SBQ A;  3J80 g;  4X60 B;  5JWZ A;  2H47 A;  1N6F A;  3BG0 A;  1ERJ A;  2YNN A;  4QQE A;  4J77 A;  2J57 G;  3SCY A;  4JSN C;  2XYI A;  4XYH A;  4O3T B;  3RFH A;  1TBG A;  2AGY A;  2AGW A;  3BWS A;  5SXM A;  3KRW B;  3PVU B;  4PC0 A;  3L4M D;  3EI1 B;  4UI9 R;  5AMS A;  3ZWL B;  3L4O D;  5A2Q g;  5CYK B;  4A7J A;  3V5W B;  5GXI A;  3F3F A;  3MXX A;  5GXH A;  3UVO A;  3JZH A;  4U1E I;  4PXW A;  4BL0 A;  1SQ9 A;  4J73 A;  4PSW B;  4ZOY A;  2HYE A;  2P9K C;  3EWE A;  3UKU C;  4O9D A;  5EAM A;  2W18 A;  2AGL A;  5EAR A;  2Z2O A;  4CZY A;  5I5M A;  2YBA A;  3ODT A;  5TF2 A;  1OMW B;  2H3X A;  4X3E A;  4A0B A;  3SXT D;  3UVN A;  2O9K A;  2IUQ A;  4AEZ A;  4CY5 A;  1K32 A;  5EMM B;  2Z2N A;  4FWW A;  4E5Z A;  4FHL A;  3SMR A;  3PSC B;  4YVD A;  2OK6 A;  1JJU B;  4N14 A;  3OKT A;  2XL2 A;  3RLM D;  3UVK A;  3DXK C;  5AJA A;  3JRO A;  1JOF A;  2CO0 C;  4CY2 A;  3EMH A;  3OKY A;  2P9N C;  4IMM A;  2CN2 A;  3FM0 A;  2IUR A;  3MKS B;  3VH0 A;  1GXR A;  4NSX A;  5H1M A;  4A0A B;  3OL2 B;  3IKO A;  3PSL A;  2PM6 B;  3DXM C;  2TRC B;  3EI2 B;  3EU7 A;  1XKS A;  3C9C A;  1PGU A;  4D6V A;  2PBI B;  4E54 B;  2I3T A;  2OVQ B;  1JMZ B;  4K3J B;  4X63 B;  4BH6 A;  2OK4 A;  4LGN A;  5H14 A;  2XL3 A;  1YFQ A;  4ES0 A;  4ZOX A;  4LG9 A;  2H6K A;  4ERZ A;  3K26 A;  3EI3 A;  2P9S C;  4ZN4 A;  2H13 A;  4PNK B;  5FKR A;  5HE1 B;  1MDA H;  5K1C C;  4A11 A;  3C5M A;  3JRP A;  3JZG A;  2AGZ A;  4L9O A;  5KDO B;  2YB8 B;  1GP2 B;  3PVW B;  5CXB A;  5TEE A;  1R5M A;  1SQJ A;  2QXV A;  3CFV A;  1GOT B;  5FKQ A;  1XHM A;  3F3G A;  4JSX C;  4J0X A;  4PSX B;  4FA4 D;  4GZ8 A;  5TEF A;  3I7H A;  4CZV A;  4JXM A;  4A09 A;  3IJ1 A;  4FB1 D;  3IIW A;  2YMU A;  2HJB A;  4CI3 A;  2QC5 A;  3I2N A;  4XEI C;  3UVM A;  3UKR C;  3PXW D;  4FAN D;  2CE8 A;  2H6Q A;  4GGD A;  2IUP A;  4FAV D;  3MZL A;  4QT8 A;  2I3S A;  2I0R A;  5HE0 B;  3AL8 A;  5CXC A;  1N6E A;  3EI1 A;  5AFU 3;  2AH1 A;  4OZU A;  5FKT A;  3PXS D;  4O45 A;  2PM9 A;  1PI6 A;  2B5M A;  5C9Z B;  3MZK A;  3DSM A;  3U4Y A;  5GSA A;  3GFC A;  4ZOZ A;  4H5I A;  2OVR B;  2EBS A;  4J79 A;  1A0R B;  3RRM C;  1PBY B;  2H9N A;  3C75 H;  3EI4 B;  3SJL D;  3AL9 A;  2GC7 A;  2HJ4 A;  4KFM B;  4A2L A;  4ERY A;  2AGX A;  3OKW A;  5TDH B;  3I7L A;  4CC9 A;  3P4F A;  3NVN A;  1PEV A;  3SBP A;  4ZOV A;  4L3H D;  3B7F A;  2HES X;  2CO0 A;  2IAA A;  4E5Z B;  3SVW D;  2UZX B;  2OIZ A;  4D0K A;  2CNX A;  2HKR A;  2I0T A;  3I7P A;  4GM3 A;  4CI1 A;  3I8C A;  4X61 B;  4K3I D;  3HFQ A;  5IGQ A;  4CI2 A;  5EM2 A;  3UR4 A;  2H9L A; 
#chains in the Genus database with same CATH topology
 3VI3 A;  1H2W A;  3K71 A;  2IWF A;  5I5J A;  3SFZ A;  1JV2 A;  4J87 A;  3RSE C;  1MG2 A;  3GRE A;  1SHY B;  1TYQ C;  3DDU A;  3IUQ A;  4JSV C;  1MG3 A;  4GM9 A;  5K19 A;  4WK0 A;  2J56 H;  1P22 A;  2XU7 A;  3DM0 A;  5HE3 B;  3JPX A;  3ZDY A;  5M5R A;  2YNO A;  4CZX A;  4FA9 D;  4ESG A;  3AFC A;  2VDR A;  3N0D A;  4A08 A;  3FRX A;  2MTA H;  4NBM A;  2BBK H;  5IJ7 E;  3OL2 A;  3KRX B;  4CI8 A;  5FXY A;  3EI2 A;  3UVL A;  4Z8L A;  4EWR A;  1TYE A;  2AQ5 A;  2H68 A;  2HKM A;  2VDQ A;  3K27 A;  2HXC A;  2OVP B;  1JMX B;  1K8K C;  3EI3 B;  4JT5 C;  4JHP C;  4PBY A;  4GGC A;  4L3G D;  4XYI A;  4A11 B;  2BCJ B;  3I8E A;  4G56 B;  2GC4 A;  3BG1 A;  4TZ4 A;  3J81 g;  3I7N A;  3A0F A;  1BPO A;  5CXB B;  5M5S A;  2G9A A;  4O3U B;  3ZDZ A;  4J81 A;  3RN1 D;  1VZ3 A;  4JD2 C;  2I0S A;  3V4V A;  1QFM A;  4J86 A;  4OWR A;  4PBZ A;  3JAM g;  4J8G A;  2H9M A;  3NVQ A;  5FLX g;  3E0C A;  3RN0 D;  2P9I C;  4O2W A;  4A09 B;  4ERQ A;  2IUV A;  4GGA A;  3JB9 L;  4BUJ C;  3EQ8 A;  3IUM A;  4GMB A;  4U7A A;  2H14 A;  1GOF A;  5EAP A;  3ULE C;  1S4U X;  2H9P A;  3W15 A;  4HDJ A;  5CYK A;  3SN6 B;  2B5N A;  3AL8 B;  5CXC B;  4GM8 A;  2OJY A;  4MMY A;  5IC7 A;  2B5L A;  1U4C A;  3MMY A;  2VZ1 A;  3NVX A;  4QL1 A;  2PM9 B;  5I5I A;  3F3P A;  1XIP A;  1OLZ A;  4CY1 A;  2PM7 B;  3T3P A;  3V7D B;  3ORV D;  5FA5 B;  4JT6 C;  4O1Q D;  1QNI A;  5H17 A;  2J55 H;  1C9L A;  3VGZ A;  2AH0 A;  3V9F A;  4L1Q D;  5M5U A;  4A2M A;  2GNQ A;  4GQB B;  2P9P C;  4BCD A;  2H6N A;  3EQ9 A;  4A0B B;  4WJK A;  4AX4 A;  2CN3 A;  3NIF A;  4R7A B;  4IA9 A;  1N6D A;  4GQ1 A;  3IJC A;  3AH8 B;  5GMK n;  3JZN A;  4DNV A;  1NR0 A;  3EI4 A;  3T3M A;  1A12 A;  1GOH A;  3FGB A;  1Q47 A;  1E5T A;  4AOW A;  2B4E A;  4GQ2 P;  3I89 A;  3RMZ D;  2JKX A;  5HQG A;  2G99 A;  5EMJ B;  1L0Q A;  4J78 A;  1B9X A;  3PXT D;  5EMK B;  3RFG A;  1GG2 B;  5HYN B;  2IWK A;  3DWL C;  4G1M A;  4J8B A;  3I7K A;  4J84 A;  3SHF A;  4I79 A;  5IT9 g;  3OKY B;  2YNP A;  4FA5 D;  4FA1 D;  5EM2 B;  5C92 A;  2P9U C;  3MKQ A;  3IUJ A;  1B9Y A;  1VYH C;  5EAL A;  4J82 A;  5C2V B;  3CFS B;  5IJ8 E;  4RE6 A;  2VDM A;  2Z2P A;  4Y5R D;  3IJ0 A;  1RI6 A;  4MK0 B;  2P9L C;  3EG6 A;  3C99 A;  5HE2 B;  4NEN A;  1UOQ A;  3I7O A;  5FKS A;  4A0A A;  1JTD B;  3SBR A;  5FQD A;  3PE7 A;  5THA A;  4A08 B;  2CE9 A;  4E54 A;  2VDP A;  3OTT A;  3VI4 A;  2VDN A;  3SLE D;  3CIK B;  4QRJ A;  4LG8 A;  3SWS D;  5C2W B;  1NEX B;  3IIY A;  1VE7 A;  3VA6 A;  3K72 A;  2VDL A;  1H2X A;  3IUN A;  3IJE A;  4JSP C;  4J0W A;  1FWX A;  4CY3 A;  5B4W A;  2XZG A;  1U2V C;  2UZY B;  2VC2 A;  4Y7R A;  4G1E A;  5EML B;  2Q7Q A;  3OW8 A;  4H5J A;  5IGO A;  4Z7Q A;  2EIB A;  3N0E A;  3MVD K;  3SBQ A;  3J80 g;  5M5V A;  4X60 B;  5JWZ A;  2H47 A;  1N6F A;  5M5T A;  3BG0 A;  3O4J A;  1ERJ A;  1C9I A;  2YNN A;  1H2Y A;  4BCB A;  4QQE A;  4AMZ A;  4J77 A;  2J57 G;  3SCY A;  4JSN C;  2XYI A;  4XYH A;  4IRZ A;  1VE6 A;  4O3T B;  3RFH A;  1TBG A;  3O4I A;  2AGY A;  3IVM A;  2AGW A;  3BWS A;  1K3I A;  5SXM A;  3KRW B;  3QHY B;  3PVU B;  4PC0 A;  3L4M D;  3EI1 B;  4UI9 R;  1O6G A;  5AMS A;  3ZWL B;  3L4O D;  5A2Q g;  5CYK B;  4A7J A;  4BP8 A;  3V5W B;  3EQ7 A;  1E8N A;  5GXI A;  3F3F A;  4O02 A;  3K6S A;  3ZE1 A;  3MXX A;  5GXH A;  3UVO A;  3JZH A;  4U1E I;  4PXW A;  4BL0 A;  1SQ9 A;  2XE4 A;  4J73 A;  4PSW B;  5HDB A;  4ZOY A;  2HYE A;  2P9K C;  3EWE A;  4MMZ A;  3UKU C;  4O9D A;  4Z7N A;  5EAM A;  2W18 A;  5E6R A;  4BCC A;  3O4H A;  2AGL A;  5EAR A;  2Z2O A;  4CZY A;  5I5M A;  2QZP A;  2YBA A;  4NC4 A;  3ODT A;  5TF2 A;  1OMW B;  2EID A;  2H3X A;  4WK2 A;  4X3E A;  4A0B A;  3SXT D;  3UVN A;  4MMX A;  2O9K A;  2IUQ A;  1U8C A;  4AEZ A;  4JHN A;  4Z7O A;  4CY5 A;  1K32 A;  2QR5 A;  3GD1 I;  5EMM B;  2Z2N A;  4FWW A;  4E5Z A;  4FHL A;  3SMR A;  3PSC B;  4YVD A;  2OK6 A;  1JJU B;  1UOP A;  3NIG A;  4N14 A;  3OKT A;  2XL2 A;  3RLM D;  3UVK A;  3DXK C;  5AJA A;  3JRO A;  1JOF A;  2CO0 C;  4CY2 A;  3EMH A;  3OKY A;  2P9N C;  4IMM A;  2CN2 A;  1T2X A;  2EIE A;  5M61 A;  3FM0 A;  2XDW A;  2IUR A;  3MKS B;  3VH0 A;  1GXR A;  4NSX A;  5H1M A;  4RE5 A;  4A0A B;  3OL2 B;  3IKO A;  3PSL A;  4WK4 A;  2PM6 B;  3DXM C;  2TRC B;  3EI2 B;  1GOG A;  3EU7 A;  1XKS A;  3C9C A;  1PGU A;  4D6V A;  2PBI B;  4E54 B;  2I3T A;  2OVQ B;  1JMZ B;  4K3J B;  3ZE2 A;  4X63 B;  4BH6 A;  2OK4 A;  4LGN A;  5H14 A;  2XL3 A;  1YFQ A;  1VZ2 A;  4ES0 A;  3QI0 A;  4ZOX A;  4LG9 A;  2H6K A;  4ERZ A;  3K26 A;  3EI3 A;  4AMY A;  2P9S C;  2VDK A;  2H13 A;  4BP9 A;  4ZN4 A;  3GC3 B;  4PNK B;  5FKR A;  3IUL A;  5HE1 B;  1MDA H;  1M1X A;  5K1C C;  4A11 A;  3C5M A;  3JRP A;  2HU5 A;  3JZG A;  1I2M B;  2AGZ A;  4L9O A;  5KDO B;  2YB8 B;  1GP2 B;  3PVW B;  5CXB A;  5TEE A;  1R5M A;  1SQJ A;  2QXV A;  3CFV A;  1GOT B;  5FKQ A;  1XHM A;  3F3G A;  5E6S A;  4JSX C;  4J0X A;  4PSX B;  3IUR A;  4FA4 D;  4GZ8 A;  4QAM A;  2VZ3 A;  1L5G A;  5TEF A;  3I7H A;  4CZV A;  4JXM A;  4A09 A;  3IJ1 A;  4FB1 D;  3IIW A;  1QFS A;  1YR2 A;  2YMU A;  3ZE0 A;  2HJB A;  4CI3 A;  2QC5 A;  3I2N A;  4XEI C;  5FFG A;  3UVM A;  1O6F A;  3PXW D;  3UKR C;  4FAN D;  2CE8 A;  2H6Q A;  3O4G A;  4GGD A;  2IUP A;  4FAV D;  5E6U A;  3MZL A;  4QT8 A;  2I3S A;  2I0R A;  5HE0 B;  3AL8 A;  5CXC A;  1N6E A;  3ZDX A;  3EI1 A;  5AFU 3;  3FCS A;  2AH1 A;  3MUN A;  4OZU A;  5FKT A;  3PXS D;  1E8M A;  4O45 A;  2PM9 A;  4UM8 A;  1PI6 A;  3V4P A;  4DNU A;  2B5M A;  5C9Z B;  3MZK A;  3DSM A;  3NID A;  5GSA A;  3U4Y A;  3GFC A;  4ZOZ A;  2EIC A;  4UM9 A;  4H5I A;  4D9S A;  2OVR B;  4NAA A;  2EBS A;  4J79 A;  4DNW A;  1A0R B;  3RRM C;  2HU7 A;  1PBY B;  2H9N A;  3C75 H;  3EI4 B;  1H2Z A;  3SJL D;  1UOO A;  3AL9 A;  4AN0 A;  2GC7 A;  2HJ4 A;  4KFM B;  4A2L A;  4ERY A;  2VDO A;  2AGX A;  3OKW A;  5TDH B;  3FCU A;  3I7L A;  4CC9 A;  3P4F A;  3NVN A;  1PEV A;  3SBP A;  4ZOV A;  4L3H D;  5C86 A;  3B7F A;  2HES X;  2BKL A;  2CO0 A;  2IAA A;  4E5Z B;  3SVW D;  2UZX B;  2OIZ A;  4D0K A;  2CNX A;  2HKR A;  2I0T A;  2WQ8 A;  3I7P A;  3OF7 A;  4GM3 A;  4CI1 A;  3I8C A;  3KCI A;  5FFO A;  3MUO A;  1UTC A;  2HU8 A;  4L1M A;  4X61 B;  4K3I D;  3HFQ A;  5IGQ A;  4CI2 A;  5EM2 A;  3UR4 A;  2H9L A;  4AN1 A;  4G55 A; 
#chains in the Genus database with same CATH homology
 2IWF A;  5I5J A;  3SFZ A;  4J87 A;  3RSE C;  1MG2 A;  3GRE A;  1SHY B;  1TYQ C;  4JSV C;  1MG3 A;  4GM9 A;  5K19 A;  2J56 H;  1P22 A;  2XU7 A;  3DM0 A;  5HE3 B;  3JPX A;  2YNO A;  4CZX A;  4FA9 D;  4ESG A;  3AFC A;  3N0D A;  4A08 A;  3FRX A;  2MTA H;  5IJ7 E;  2BBK H;  3OL2 A;  3KRX B;  4CI8 A;  5FXY A;  3EI2 A;  3UVL A;  4Z8L A;  4EWR A;  2AQ5 A;  2H68 A;  2HKM A;  3K27 A;  2HXC A;  2OVP B;  1JMX B;  1K8K C;  3EI3 B;  4JT5 C;  4PBY A;  4GGC A;  4L3G D;  4XYI A;  4A11 B;  2BCJ B;  3I8E A;  4G56 B;  2GC4 A;  3BG1 A;  4TZ4 A;  3J81 g;  3I7N A;  3A0F A;  5CXB B;  2G9A A;  4O3U B;  4J81 A;  3RN1 D;  4JD2 C;  2I0S A;  4J86 A;  4OWR A;  4PBZ A;  3JAM g;  4J8G A;  2H9M A;  3NVQ A;  5FLX g;  3E0C A;  3RN0 D;  2P9I C;  4A09 B;  4ERQ A;  2IUV A;  4GGA A;  3JB9 L;  4BUJ C;  4GMB A;  4U7A A;  2H14 A;  5EAP A;  3ULE C;  1S4U X;  2H9P A;  3W15 A;  4HDJ A;  5CYK A;  3SN6 B;  2B5N A;  3AL8 B;  5CXC B;  4GM8 A;  2OJY A;  5IC7 A;  2B5L A;  1U4C A;  3MMY A;  3NVX A;  4QL1 A;  2PM9 B;  5I5I A;  3F3P A;  1XIP A;  1OLZ A;  4CY1 A;  2PM7 B;  3V7D B;  3ORV D;  5FA5 B;  4JT6 C;  4O1Q D;  1QNI A;  5H17 A;  2J55 H;  3VGZ A;  2AH0 A;  3V9F A;  4L1Q D;  4A2M A;  2GNQ A;  4GQB B;  2P9P C;  2H6N A;  4A0B B;  2CN3 A;  4R7A B;  4IA9 A;  1N6D A;  4GQ1 A;  3IJC A;  3AH8 B;  5GMK n;  3JZN A;  1NR0 A;  3EI4 A;  3FGB A;  1Q47 A;  4AOW A;  2B4E A;  4GQ2 P;  3I89 A;  3RMZ D;  5HQG A;  2G99 A;  5EMJ B;  1L0Q A;  4J78 A;  1B9X A;  3PXT D;  5EMK B;  3RFG A;  1GG2 B;  5HYN B;  2IWK A;  3DWL C;  4J8B A;  3I7K A;  4J84 A;  3SHF A;  4I79 A;  5IT9 g;  3OKY B;  2YNP A;  4FA5 D;  4FA1 D;  5EM2 B;  2P9U C;  3MKQ A;  1B9Y A;  1VYH C;  5EAL A;  4J82 A;  5C2V B;  3CFS B;  5IJ8 E;  2Z2P A;  4Y5R D;  3IJ0 A;  1RI6 A;  4MK0 B;  2P9L C;  3EG6 A;  3C99 A;  5HE2 B;  3I7O A;  5FKS A;  4A0A A;  3SBR A;  5FQD A;  3PE7 A;  5THA A;  4A08 B;  2CE9 A;  4E54 A;  3OTT A;  3SLE D;  3CIK B;  4QRJ A;  4LG8 A;  3SWS D;  5C2W B;  1NEX B;  3IIY A;  3VA6 A;  4JSP C;  4J0W A;  1FWX A;  4CY3 A;  5B4W A;  1U2V C;  2UZY B;  4Y7R A;  5EML B;  2Q7Q A;  3OW8 A;  4H5J A;  5IGO A;  3N0E A;  3SBQ A;  3J80 g;  4X60 B;  5JWZ A;  2H47 A;  1N6F A;  3BG0 A;  1ERJ A;  2YNN A;  4QQE A;  4J77 A;  2J57 G;  3SCY A;  4JSN C;  2XYI A;  4XYH A;  4O3T B;  3RFH A;  1TBG A;  2AGY A;  2AGW A;  3BWS A;  5SXM A;  3KRW B;  3PVU B;  4PC0 A;  3L4M D;  3EI1 B;  4UI9 R;  5AMS A;  3ZWL B;  3L4O D;  5A2Q g;  5CYK B;  4A7J A;  3V5W B;  5GXI A;  3F3F A;  3MXX A;  5GXH A;  3UVO A;  3JZH A;  4U1E I;  4PXW A;  4BL0 A;  1SQ9 A;  4J73 A;  4PSW B;  4ZOY A;  2HYE A;  2P9K C;  3EWE A;  3UKU C;  4O9D A;  5EAM A;  2W18 A;  2AGL A;  5EAR A;  2Z2O A;  4CZY A;  5I5M A;  2YBA A;  3ODT A;  5TF2 A;  1OMW B;  2H3X A;  4X3E A;  4A0B A;  3SXT D;  3UVN A;  2O9K A;  2IUQ A;  4AEZ A;  4CY5 A;  1K32 A;  5EMM B;  2Z2N A;  4FWW A;  4E5Z A;  4FHL A;  3SMR A;  3PSC B;  4YVD A;  2OK6 A;  1JJU B;  4N14 A;  3OKT A;  2XL2 A;  3RLM D;  3UVK A;  3DXK C;  5AJA A;  3JRO A;  1JOF A;  2CO0 C;  4CY2 A;  3EMH A;  3OKY A;  2P9N C;  4IMM A;  2CN2 A;  3FM0 A;  2IUR A;  3MKS B;  3VH0 A;  1GXR A;  4NSX A;  5H1M A;  4A0A B;  3OL2 B;  3IKO A;  3PSL A;  2PM6 B;  3DXM C;  2TRC B;  3EI2 B;  3EU7 A;  1XKS A;  3C9C A;  1PGU A;  4D6V A;  2PBI B;  4E54 B;  2I3T A;  2OVQ B;  1JMZ B;  4K3J B;  4X63 B;  4BH6 A;  2OK4 A;  4LGN A;  5H14 A;  2XL3 A;  1YFQ A;  4ES0 A;  4ZOX A;  4LG9 A;  2H6K A;  4ERZ A;  3K26 A;  3EI3 A;  2P9S C;  4ZN4 A;  2H13 A;  4PNK B;  5FKR A;  5HE1 B;  1MDA H;  5K1C C;  4A11 A;  3C5M A;  3JRP A;  3JZG A;  2AGZ A;  4L9O A;  5KDO B;  2YB8 B;  1GP2 B;  3PVW B;  5CXB A;  5TEE A;  1R5M A;  1SQJ A;  2QXV A;  3CFV A;  1GOT B;  5FKQ A;  1XHM A;  3F3G A;  4JSX C;  4J0X A;  4PSX B;  4FA4 D;  4GZ8 A;  5TEF A;  3I7H A;  4CZV A;  4JXM A;  4A09 A;  3IJ1 A;  4FB1 D;  3IIW A;  2YMU A;  2HJB A;  4CI3 A;  2QC5 A;  3I2N A;  4XEI C;  3UVM A;  3UKR C;  3PXW D;  4FAN D;  2CE8 A;  2H6Q A;  4GGD A;  2IUP A;  4FAV D;  3MZL A;  4QT8 A;  2I3S A;  2I0R A;  5HE0 B;  3AL8 A;  5CXC A;  1N6E A;  3EI1 A;  5AFU 3;  2AH1 A;  4OZU A;  5FKT A;  3PXS D;  4O45 A;  2PM9 A;  1PI6 A;  2B5M A;  5C9Z B;  3MZK A;  3DSM A;  3U4Y A;  5GSA A;  3GFC A;  4ZOZ A;  4H5I A;  2OVR B;  2EBS A;  4J79 A;  1A0R B;  3RRM C;  1PBY B;  2H9N A;  3C75 H;  3EI4 B;  3SJL D;  3AL9 A;  2GC7 A;  2HJ4 A;  4KFM B;  4A2L A;  4ERY A;  2AGX A;  3OKW A;  5TDH B;  3I7L A;  4CC9 A;  3P4F A;  3NVN A;  1PEV A;  3SBP A;  4ZOV A;  4L3H D;  3B7F A;  2HES X;  2CO0 A;  2IAA A;  4E5Z B;  3SVW D;  2UZX B;  2OIZ A;  4D0K A;  2CNX A;  2HKR A;  2I0T A;  3I7P A;  4GM3 A;  4CI1 A;  3I8C A;  4X61 B;  4K3I D;  3HFQ A;  5IGQ A;  4CI2 A;  5EM2 A;  3UR4 A;  2H9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...