5EALA

Crystal structure of human wdr5 in complex with compound 9h
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title Crystal structure of human WDR5 in complex with compound 9h
rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
total genus 102
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5ealA00
4QQEA 3GFCA 3SCYA 4PSXB 2XL3A 4L3GD 3OKWA 3C9CA 3SJLD 4CY2A 2EBSA 5CXCB 5K1CC 3C75H 2J57G 3SBRA 4JXMA 3RN1D 1JOFA 4X60B 5H17A 3NVNA 3V7DB 3DWLC 3AL8B 4GM8A 3V9FA 5EM2A 3J81g 3SVWD 4IA9A 2G99A 2IWKA 2PBIB 4CC9A 1MG3A 4J87A 4PNKB 4PBYA 4NSXA 1PEVA 4ZOYA 2HJ4A 4R7AB 2H6KA 1XIPA 3BG1A 3I7OA 4J0XA 3P4FA 2OIZA 3FM0A 4L1QD 3EU7A 3JPXA 5AMSA 2GC7A 3EI4B 2H68A 5EMMB 4CI3A 3UVMA 2Z2NA 3V5WB 2OK4A 3AFCA 3UVOA 4GZ8A 1U4CA 3MZLA 3OL2B 4A08B 4YVDA 2OJYA 4K3JB 3W15A 1SQ9A 4O3UB 3E0CA 5CYKB 4E5ZA 2PM9A 1S4UX 2XL2A 2H47A 4H5JA 4GGCA 5FKTA 4LG8A 1N6EA 3EI2B 1GOTB 2I0TA 3IIWA 2P9UC 4J73A 3F3FA 3PXTD 1MG2A 4FA1D 4ES0A 3UVNA 2CN2A 2IUQA 3DXMC 3VH0A 3PSCB 5THAA 3SN6B 1TBGA 4GQBB 3OW8A 4D0KA 4A0BB 4GQ1A 4O3TB 2H9LA 4A0AB 5IJ7E 3SMRA 2OVQB 2YMUA 1GXRA 3SWSD 5HE2B 4CZYA 2BBKH 3B7FA 3VA6A 4J78A 2P9LC 2YNPA 3NVQA 3DM0A 3N0EA 2HESX 3MZKA 3FGBA 4GQ2P 2H3XA 2Q7QA 1OMWB 1K8KC 4N14A 4A2LA 1RI6A 1XKSA 3CFVA 3SFZA 3MMYA 4JT5C 5H14A 4AOWA 3I89A 1NR0A 5I5IA 3SXTD 4H5IA 3EI1B 5FQDA 4ZN4A 4E54A 5AJAA 1ERJA 5HE3B 5FA5B 3UR4A 3PXSD 5HQGA 4FB1D 1SHYB 4ZOVA 3PE7A 4OWRA 4A11B 5C2VB 3JB9L 5C9ZB 3I7PA 3PVWB 4GGAA 4CI1A 4QRJA 3HFQA 5EALA 1R5MA 3IIYA 4A7JA 4J82A 5CXBA 4GGDA 3F3PA 3PXWD 3ULEC 1YFQA 2Z2PA 5EARA 4X63B 3EI3B 3JZGA 1TYQC 2CE9A 5IGOA 4ERYA 3RRMC 4TZ4A 3IJ1A 3J80g 4GM9A 3I7LA 3SLED 3L4OD 3CIKB 2H6QA 4CY5A 1FWXA 2O9KA 3RMZD 5H1MA 2B5LA 2H13A 5AFU3 3L4MD 3VGZA 3MXXA 3OKYB 3DSMA 2W18A 2Z2OA 2H9PA 3EI1A 4J79A 2UZYB 4L9OA 2IWFA 1PBYB 2YB8B 4QL1A 3UKUC 1VYHC 3SBPA 4PSWB 4J77A 3MKQA 3JAMg 5EMKB 5CXCA 2G9AA 3EMHA 4LGNA 4PC0A 3AL9A 5GXIA 4Z8LA 4JSPC 2AH0A 3ODTA 5I5MA 1SQJA 3AL8A 4EWRA 2BCJB 4A2MA 1NEXB 2HKRA 4UI9R 4Y7RA 4PXWA 4CZVA 4CI8A 4A09B 5I5JA 2AGYA 1A0RB 4G56B 5JWZA 2H9MA 4JSXC 5FXYA 4MK0B 1JMZB 4CY1A 1N6FA 5FLXg 2OVRB 4CY3A 1B9YA 3EI4A 1N6DA 2HJBA 2UZXB 2AGWA 4BL0A 1B9XA 4JT6C 5IC7A 5SXMA 5EM2B 1JMXB 3DXKC 3A0FA 3NVXA 3OL2A 4A08A 2QXVA 2J55H 3JZNA 5EAMA 2CE8A 5CYKA 1K32A 3EWEA 5TDHB 4XYIA 4U7AA 4O45A 5KDOB 4Y5RD 3UKRC 3I7NA 4KFMB 3EI2A 4J0WA 3U4YA 2OVPB 3GREA 3SBQA 2P9SC 4JSNC 2HXCA 2YBAA 3BG0A 4ESGA 2IAAA 4A0BA 4A09A 4A0AA 4XYHA 2AH1A 4J8BA 3UVKA 4ERQA 4K3ID 4HDJA 5GMKn 5EMLB 5A2Qg 3IJ0A 1MDAH 2YNNA 2IURA 3EG6A 3JZHA 3RN0D 4J81A 4E5ZB 3OTTA 1GG2B 2PM9B 4IMMA 3JRPA 4ERZA 4X61B 3ORVD 1P22A 2AGLA 3PVUB 4ZOZA 5HE1B 2AGXA 3UVLA 4FA4D 2AGZA 5K19A 5IGQA 5TEFA 4FHLA 5IT9g 2YNOA 4JD2C 4PBZA 2QC5A 2HYEA 2B5NA 3K27A 4BH6A 1OLZA 4FAVD 5B4WA 2AQ5A 3I7HA 4D6VA 3MKSB 3K26A 4A11A 3KRXB 2P9NC 5C2WB 1PGUA 4FA5D 2CO0C 3RSEC 3IKOA 4OZUA 2CN3A 4XEIC 2PM6B 4I79A 4L3HD 3PSLA 4J86A 4O1QD 2TRCB 3F3GA 3RLMD 2PM7B 4CZXA 3RFGA 2CNXA 3EI3A 4JSVC 2HKMA 2MTAH 3FRXA 4FAND 3I8EA 4X3EA 4J84A 5TEEA 5IJ8E 2CO0A 1XHMA 3AH8B 5EMJB 4J8GA 4E54B 3C99A 3N0DA 2B4EA 1Q47A 2H9NA 2P9KC 4U1EI 3RFHA 2H6NA 3ZWLB 2I0SA 5GSAA 3OKYA 3CFSB 3KRWB 3I8CA 3OKTA 2I3SA 2B5MA 5CXBB 3I2NA 4LG9A 2H14A 5FKRA 2XYIA 4GM3A 2IUVA 2GC4A 3JROA 4BUJC 3BWSA 5GXHA 4CI2A 3IJCA 2I0RA 4ZOXA 5EAPA 1PI6A 5HYNB 2GNQA 4O9DA 2XU7A 4QT8A 5HE0B 3C5MA 2P9PC 4FA9D 2IUPA 1JJUB 5FKQA 2OK6A 5TF2A 3SHFA 5FKSA 1U2VC 2I3TA 2P9IC 3I7KA 1L0QA 4FWWA 1QNIA 4AEZA 2J56H 4GMBA 1GP2B
chains in the Genus database with same CATH superfamily
4QQEA 1H2YA 1O6FA 3GD1I 3GFCA 3SCYA 4PSXB 2XL3A 4L3GD 3NIGA 3OKWA 3C9CA 3SJLD 4CY2A 2VZ3A 3GC3B 2EBSA 3NIFA 3O4HA 5CXCB 5K1CC 3C75H 3K72A 2J57G 3SBRA 4JXMA 3RN1D 1JOFA 4X60B 5H17A 3IUNA 3NVNA 3V7DB 3DWLC 3AL8B 4GM8A 3V9FA 5EM2A 3J81g 4MMZA 3ZDZA 1C9IA 3SVWD 4IA9A 4QAMA 2G99A 2IWKA 2PBIB 4CC9A 1MG3A 4J87A 3EQ7A 4PNKB 4PBYA 3IJEA 4NSXA 1PEVA 4ZOYA 2HJ4A 1BPOA 4R7AB 2H6KA 1XIPA 3V4VA 3BG1A 4AN1A 3I7OA 4J0XA 3P4FA 2OIZA 4WJKA 3FM0A 4L1QD 4Z7OA 3EU7A 1E8NA 2XE4A 4NENA 3JPXA 5AMSA 2GC7A 3EI4B 2H68A 5EMMB 4CI3A 3UVMA 2Z2NA 3V5WB 2OK4A 3AFCA 1C9LA 1UOOA 4GZ8A 3UVOA 4JHNA 1U4CA 3MZLA 3OL2B 4A08B 4YVDA 2OJYA 4K3JB 3W15A 1SQ9A 1K3IA 4O3UB 3E0CA 5CYKB 4E5ZA 1GOGA 1S4UX 2PM9A 2XL2A 2H47A 4BCDA 4H5JA 2VDPA 4GGCA 5FKTA 4LG8A 1N6EA 3EI2B 1GOTB 3KCIA 1JTDB 2I0TA 3IIWA 2P9UC 4J73A 4NC4A 3F3FA 3PXTD 1MG2A 4FA1D 4ES0A 3UVNA 2CN2A 2IUQA 3DXMC 3T3PA 3VH0A 3PSCB 3MUNA 5THAA 3SN6B 1TBGA 4GQBB 3OW8A 4D0KA 4A0BB 4GQ1A 4O3TB 2H9LA 3K71A 4A0AB 5IJ7E 3SMRA 2OVQB 1VE7A 3VI4A 2YMUA 1GXRA 3SWSD 5HE2B 4CZYA 2BBKH 3IULA 3B7FA 3VA6A 2P9LC 4J78A 2YNPA 4WK2A 3NVQA 3DM0A 3N0EA 2HESX 3MZKA 1JV2A 2EIDA 3FGBA 4GQ2P 2H3XA 2Q7QA 1OMWB 1K8KC 4N14A 5E6SA 2JKXA 2WQ8A 4A2LA 1RI6A 1XKSA 3CFVA 3SFZA 2BKLA 3MMYA 4JT5C 5H14A 3ZE2A 4AOWA 3I89A 1NR0A 5I5IA 3SXTD 4H5IA 3EI1B 1U8CA 5FQDA 4ZN4A 4E54A 5AJAA 1ERJA 5HE3B 5FA5B 3UR4A 4NAAA 3PXSD 5HQGA 5E6RA 4FB1D 3MVDK 1SHYB 4ZOVA 3PE7A 4OWRA 4MMYA 4A11B 5C2VB 3JB9L 5C9ZB 4Z7QA 3I7PA 3PVWB 4GGAA 4CI1A 4QRJA 3HFQA 2VZ1A 1A12A 5EALA 1R5MA 3IIYA 4A7JA 4J82A 5CXBA 4GGDA 3F3PA 3PXWD 3ULEC 2QZPA 1YFQA 2Z2PA 5HDBA 4O2WA 2VDQA 5EARA 4X63B 3EI3B 3JZGA 1TYQC 4L1MA 2CE9A 5IGOA 4ERYA 3RRMC 4TZ4A 3IJ1A 3J80g 4BP8A 4G55A 4GM9A 3I7LA 3SLED 3L4OD 3O4JA 3CIKB 2H6QA 4CY5A 1E5TA 2XZGA 1H2ZA 1FWXA 2HU7A 2O9KA 3RMZD 1L5GA 3IUMA 5H1MA 3IVMA 2B5LA 2H13A 3K6SA 5AFU3 3L4MD 3VGZA 3MXXA 4IRZA 3OKYB 4G1EA 3DSMA 2W18A 2Z2OA 2H9PA 2EICA 4NBMA 3EI1A 4J79A 2UZYB 4L9OA 2IWFA 1PBYB 5C92A 2YB8B 1O6GA 4QL1A 3UKUC 1VYHC 3SBPA 4PSWB 4J77A 3MKQA 3JAMg 2VDKA 5EMKB 5CXCA 2G9AA 3EMHA 4LGNA 4PC0A 3AL9A 1QFSA 5GXIA 4Z8LA 4JSPC 2AH0A 3ODTA 5I5MA 1SQJA 5M5UA 2HU5A 2XDWA 3AL8A 3ZE0A 4EWRA 2BCJB 4AX4A 4A2MA 1NEXB 2HKRA 4D9SA 3O4GA 4UI9R 4Y7RA 4PXWA 4CZVA 4CI8A 4A09B 5I5JA 2AGYA 1A0RB 3IURA 1E8MA 4G56B 5JWZA 2H9MA 2VDMA 4JSXC 5FXYA 4MK0B 1JMZB 4CY1A 4AMZA 3QHYB 1N6FA 5FLXg 1UOQA 2OVRB 4CY3A 1B9YA 3EI4A 1N6DA 2HJBA 2UZXB 3OF7A 2AGWA 4BL0A 1B9XA 4JT6C 5IC7A 5SXMA 5EM2B 3ZE1A 1JMXB 3DXKC 2VC2A 3A0FA 1UOPA 3NVXA 3OL2A 4A08A 2QXVA 2J55H 3DDUA 3JZNA 5EAMA 2CE8A 5CYKA 1K32A 3T3MA 3EWEA 4WK0A 5TDHB 4XYIA 4U7AA 4O45A 4Z7NA 5KDOB 4Y5RD 3QI0A 3UKRC 3I7NA 4KFMB 3EI2A 5M5RA 1GOFA 1VE6A 1TYEA 4J0WA 3U4YA 2OVPB 3GREA 5C86A 3SBQA 2P9SC 4JSNC 2HXCA 2YBAA 1UTCA 3BG0A 4ESGA 2IAAA 4A0BA 4A09A 1M1XA 4A0AA 4XYHA 3EQ8A 2AH1A 4J8BA 4UM8A 5FFOA 3UVKA 4ERQA 3FCUA 4K3ID 3ZDYA 3NIDA 4HDJA 5GMKn 5EMLB 5A2Qg 3IJ0A 1MDAH 2YNNA 2IURA 3EG6A 3JZHA 5E6UA 3RN0D 4J81A 4E5ZB 3OTTA 1GG2B 2PM9B 4IMMA 3JRPA 4ERZA 4X61B 3ORVD 1P22A 2AGLA 3PVUB 4ZOZA 5HE1B 2AGXA 3UVLA 4FA4D 2AGZA 5K19A 5IGQA 5TEFA 4FHLA 5IT9g 2YNOA 4JD2C 4PBZA 2QC5A 4JHPC 2HYEA 2B5NA 3K27A 4BH6A 1OLZA 4FAVD 5B4WA 2AQ5A 3I7HA 4D6VA 3MKSB 3K26A 4AMYA 1H2XA 4A11A 3KRXB 2P9NC 5C2WB 1PGUA 4FA5D 2CO0C 3RSEC 3IKOA 4OZUA 4AN0A 2CN3A 2VDLA 4XEIC 3IUQA 3V4PA 2PM6B 4I79A 4L3HD 3PSLA 4J86A 4O02A 4O1QD 2TRCB 3F3GA 2EIBA 3O4IA 4G1MA 3RLMD 2PM7B 4CZXA 3RFGA 2CNXA 3VI3A 3EI3A 4JSVC 4BCCA 2HKMA 2MTAH 3FRXA 4FAND 3I8EA 4X3EA 3ZDXA 4J84A 5TEEA 5M61A 4RE5A 2CO0A 5IJ8E 1XHMA 1T2XA 3AH8B 5EMJB 5M5VA 4J8GA 4E54B 3C99A 3N0DA 5FFGA 2B4EA 1Q47A 2EIEA 2H9NA 2P9KC 4U1EI 3RFHA 2H6NA 3ZWLB 2I0SA 1VZ3A 5GSAA 3OKYA 3CFSB 3KRWB 3I8CA 3OKTA 2VDRA 4BCBA 2I3SA 4UM9A 2B5MA 3IUJA 2VDNA 2QR5A 5CXBB 3I2NA 3EQ9A 4BP9A 2H14A 4LG9A 4WK4A 5FKRA 2XYIA 4RE6A 4DNVA 2IUVA 2GC4A 4GM3A 3JROA 4BUJC 3BWSA 5GXHA 4CI2A 2VDOA 3IJCA 5M5SA 2I0RA 4ZOXA 5EAPA 1PI6A 3FCSA 5HYNB 5M5TA 2GNQA 4O9DA 2XU7A 4QT8A 1VZ2A 5HE0B 3C5MA 4DNUA 2P9PC 4FA9D 1QFMA 2HU8A 2IUPA 4DNWA 1JJUB 5FKQA 2OK6A 5TF2A 1H2WA 3SHFA 5FKSA 1U2VC 1I2MB 2I3TA 2P9IC 1YR2A 3I7KA 1GOHA 1L0QA 4FWWA 1QNIA 4AEZA 3MUOA 2J56H 4GMBA 1GP2B 4MMXA
chains in the Genus database with same CATH topology
4QQEA 3GFCA 3SCYA 4PSXB 2XL3A 4L3GD 3OKWA 3C9CA 3SJLD 4CY2A 2EBSA 5CXCB 5K1CC 3C75H 2J57G 3SBRA 4JXMA 3RN1D 1JOFA 4X60B 5H17A 3NVNA 3V7DB 3DWLC 3AL8B 4GM8A 3V9FA 5EM2A 3J81g 3SVWD 4IA9A 2G99A 2IWKA 2PBIB 4CC9A 1MG3A 4J87A 4PNKB 4PBYA 4NSXA 1PEVA 4ZOYA 2HJ4A 4R7AB 2H6KA 1XIPA 3BG1A 3I7OA 4J0XA 3P4FA 2OIZA 3FM0A 4L1QD 3EU7A 3JPXA 5AMSA 2GC7A 3EI4B 2H68A 5EMMB 4CI3A 3UVMA 2Z2NA 3V5WB 2OK4A 3AFCA 3UVOA 4GZ8A 1U4CA 3MZLA 3OL2B 4A08B 4YVDA 2OJYA 4K3JB 3W15A 1SQ9A 4O3UB 3E0CA 5CYKB 4E5ZA 2PM9A 1S4UX 2XL2A 2H47A 4H5JA 4GGCA 5FKTA 4LG8A 1N6EA 3EI2B 1GOTB 2I0TA 3IIWA 2P9UC 4J73A 3F3FA 3PXTD 1MG2A 4FA1D 4ES0A 3UVNA 2CN2A 2IUQA 3DXMC 3VH0A 3PSCB 5THAA 3SN6B 1TBGA 4GQBB 3OW8A 4D0KA 4A0BB 4GQ1A 4O3TB 2H9LA 4A0AB 5IJ7E 3SMRA 2OVQB 2YMUA 1GXRA 3SWSD 5HE2B 4CZYA 2BBKH 3B7FA 3VA6A 4J78A 2P9LC 2YNPA 3NVQA 3DM0A 3N0EA 2HESX 3MZKA 3FGBA 4GQ2P 2H3XA 2Q7QA 1OMWB 1K8KC 4N14A 4A2LA 1RI6A 1XKSA 3CFVA 3SFZA 3MMYA 4JT5C 5H14A 4AOWA 3I89A 1NR0A 5I5IA 3SXTD 4H5IA 3EI1B 5FQDA 4ZN4A 4E54A 5AJAA 1ERJA 5HE3B 5FA5B 3UR4A 3PXSD 5HQGA 4FB1D 1SHYB 4ZOVA 3PE7A 4OWRA 4A11B 5C2VB 3JB9L 5C9ZB 3I7PA 3PVWB 4GGAA 4CI1A 4QRJA 3HFQA 5EALA 1R5MA 3IIYA 4A7JA 4J82A 5CXBA 4GGDA 3F3PA 3PXWD 3ULEC 1YFQA 2Z2PA 5EARA 4X63B 3EI3B 3JZGA 1TYQC 2CE9A 5IGOA 4ERYA 3RRMC 4TZ4A 3IJ1A 3J80g 4GM9A 3I7LA 3SLED 3L4OD 3CIKB 2H6QA 4CY5A 1FWXA 2O9KA 3RMZD 5H1MA 2B5LA 2H13A 5AFU3 3L4MD 3VGZA 3MXXA 3OKYB 3DSMA 2W18A 2Z2OA 2H9PA 3EI1A 4J79A 2UZYB 4L9OA 2IWFA 1PBYB 2YB8B 4QL1A 3UKUC 1VYHC 3SBPA 4PSWB 4J77A 3MKQA 3JAMg 5EMKB 5CXCA 2G9AA 3EMHA 4LGNA 4PC0A 3AL9A 5GXIA 4Z8LA 4JSPC 2AH0A 3ODTA 5I5MA 1SQJA 3AL8A 4EWRA 2BCJB 4A2MA 1NEXB 2HKRA 4UI9R 4Y7RA 4PXWA 4CZVA 4CI8A 4A09B 5I5JA 2AGYA 1A0RB 4G56B 5JWZA 2H9MA 4JSXC 5FXYA 4MK0B 1JMZB 4CY1A 1N6FA 5FLXg 2OVRB 4CY3A 1B9YA 3EI4A 1N6DA 2HJBA 2UZXB 2AGWA 4BL0A 1B9XA 4JT6C 5IC7A 5SXMA 5EM2B 1JMXB 3DXKC 3A0FA 3NVXA 3OL2A 4A08A 2QXVA 2J55H 3JZNA 5EAMA 2CE8A 5CYKA 1K32A 3EWEA 5TDHB 4XYIA 4U7AA 4O45A 5KDOB 4Y5RD 3UKRC 3I7NA 4KFMB 3EI2A 4J0WA 3U4YA 2OVPB 3GREA 3SBQA 2P9SC 4JSNC 2HXCA 2YBAA 3BG0A 4ESGA 2IAAA 4A0BA 4A09A 4A0AA 4XYHA 2AH1A 4J8BA 3UVKA 4ERQA 4K3ID 4HDJA 5GMKn 5EMLB 5A2Qg 3IJ0A 1MDAH 2YNNA 2IURA 3EG6A 3JZHA 3RN0D 4J81A 4E5ZB 3OTTA 1GG2B 2PM9B 4IMMA 3JRPA 4ERZA 4X61B 3ORVD 1P22A 2AGLA 3PVUB 4ZOZA 5HE1B 2AGXA 3UVLA 4FA4D 2AGZA 5K19A 5IGQA 5TEFA 4FHLA 5IT9g 2YNOA 4JD2C 4PBZA 2QC5A 2HYEA 2B5NA 3K27A 4BH6A 1OLZA 4FAVD 5B4WA 2AQ5A 3I7HA 4D6VA 3MKSB 3K26A 4A11A 3KRXB 2P9NC 5C2WB 1PGUA 4FA5D 2CO0C 3RSEC 3IKOA 4OZUA 2CN3A 4XEIC 2PM6B 4I79A 4L3HD 3PSLA 4J86A 4O1QD 2TRCB 3F3GA 3RLMD 2PM7B 4CZXA 3RFGA 2CNXA 3EI3A 4JSVC 2HKMA 2MTAH 3FRXA 4FAND 3I8EA 4X3EA 4J84A 5TEEA 5IJ8E 2CO0A 1XHMA 3AH8B 5EMJB 4J8GA 4E54B 3C99A 3N0DA 2B4EA 1Q47A 2H9NA 2P9KC 4U1EI 3RFHA 2H6NA 3ZWLB 2I0SA 5GSAA 3OKYA 3CFSB 3KRWB 3I8CA 3OKTA 2I3SA 2B5MA 5CXBB 3I2NA 4LG9A 2H14A 5FKRA 2XYIA 4GM3A 2IUVA 2GC4A 3JROA 4BUJC 3BWSA 5GXHA 4CI2A 3IJCA 2I0RA 4ZOXA 5EAPA 1PI6A 5HYNB 2GNQA 4O9DA 2XU7A 4QT8A 5HE0B 3C5MA 2P9PC 4FA9D 2IUPA 1JJUB 5FKQA 2OK6A 5TF2A 3SHFA 5FKSA 1U2VC 2I3TA 2P9IC 3I7KA 1L0QA 4FWWA 1QNIA 4AEZA 2J56H 4GMBA 1GP2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QQE A;  3GFC A;  3SCY A;  4PSX B;  2XL3 A;  4L3G D;  3OKW A;  3C9C A;  3SJL D;  4CY2 A;  2EBS A;  5CXC B;  5K1C C;  3C75 H;  2J57 G;  3SBR A;  4JXM A;  3RN1 D;  1JOF A;  4X60 B;  5H17 A;  3NVN A;  3V7D B;  3DWL C;  3AL8 B;  4GM8 A;  3V9F A;  5EM2 A;  3J81 g;  3SVW D;  4IA9 A;  2G99 A;  2IWK A;  2PBI B;  4CC9 A;  1MG3 A;  4J87 A;  4PNK B;  4PBY A;  4NSX A;  1PEV A;  4ZOY A;  2HJ4 A;  4R7A B;  2H6K A;  1XIP A;  3BG1 A;  3I7O A;  4J0X A;  3P4F A;  2OIZ A;  3FM0 A;  4L1Q D;  3EU7 A;  3JPX A;  5AMS A;  2GC7 A;  3EI4 B;  2H68 A;  5EMM B;  4CI3 A;  3UVM A;  2Z2N A;  3V5W B;  2OK4 A;  3AFC A;  3UVO A;  4GZ8 A;  1U4C A;  3MZL A;  3OL2 B;  4A08 B;  4YVD A;  2OJY A;  4K3J B;  3W15 A;  1SQ9 A;  4O3U B;  3E0C A;  5CYK B;  4E5Z A;  2PM9 A;  1S4U X;  2XL2 A;  2H47 A;  4H5J A;  4GGC A;  5FKT A;  4LG8 A;  1N6E A;  3EI2 B;  1GOT B;  2I0T A;  3IIW A;  2P9U C;  4J73 A;  3F3F A;  3PXT D;  1MG2 A;  4FA1 D;  4ES0 A;  3UVN A;  2CN2 A;  2IUQ A;  3DXM C;  3VH0 A;  3PSC B;  5THA A;  3SN6 B;  1TBG A;  4GQB B;  3OW8 A;  4D0K A;  4A0B B;  4GQ1 A;  4O3T B;  2H9L A;  4A0A B;  5IJ7 E;  3SMR A;  2OVQ B;  2YMU A;  1GXR A;  3SWS D;  5HE2 B;  4CZY A;  2BBK H;  3B7F A;  3VA6 A;  4J78 A;  2P9L C;  2YNP A;  3NVQ A;  3DM0 A;  3N0E A;  2HES X;  3MZK A;  3FGB A;  4GQ2 P;  2H3X A;  2Q7Q A;  1OMW B;  1K8K C;  4N14 A;  4A2L A;  1RI6 A;  1XKS A;  3CFV A;  3SFZ A;  3MMY A;  4JT5 C;  5H14 A;  4AOW A;  3I89 A;  1NR0 A;  5I5I A;  3SXT D;  4H5I A;  3EI1 B;  5FQD A;  4ZN4 A;  4E54 A;  5AJA A;  1ERJ A;  5HE3 B;  5FA5 B;  3UR4 A;  3PXS D;  5HQG A;  4FB1 D;  1SHY B;  4ZOV A;  3PE7 A;  4OWR A;  4A11 B;  5C2V B;  3JB9 L;  5C9Z B;  3I7P A;  3PVW B;  4GGA A;  4CI1 A;  4QRJ A;  3HFQ A;  5EAL A;  1R5M A;  3IIY A;  4A7J A;  4J82 A;  5CXB A;  4GGD A;  3F3P A;  3PXW D;  3ULE C;  1YFQ A;  2Z2P A;  5EAR A;  4X63 B;  3EI3 B;  3JZG A;  1TYQ C;  2CE9 A;  5IGO A;  4ERY A;  3RRM C;  4TZ4 A;  3IJ1 A;  3J80 g;  4GM9 A;  3I7L A;  3SLE D;  3L4O D;  3CIK B;  2H6Q A;  4CY5 A;  1FWX A;  2O9K A;  3RMZ D;  5H1M A;  2B5L A;  2H13 A;  5AFU 3;  3L4M D;  3VGZ A;  3MXX A;  3OKY B;  3DSM A;  2W18 A;  2Z2O A;  2H9P A;  3EI1 A;  4J79 A;  2UZY B;  4L9O A;  2IWF A;  1PBY B;  2YB8 B;  4QL1 A;  3UKU C;  1VYH C;  3SBP A;  4PSW B;  4J77 A;  3MKQ A;  3JAM g;  5EMK B;  5CXC A;  2G9A A;  3EMH A;  4LGN A;  4PC0 A;  3AL9 A;  5GXI A;  4Z8L A;  4JSP C;  2AH0 A;  3ODT A;  5I5M A;  1SQJ A;  3AL8 A;  4EWR A;  2BCJ B;  4A2M A;  1NEX B;  2HKR A;  4UI9 R;  4Y7R A;  4PXW A;  4CZV A;  4CI8 A;  4A09 B;  5I5J A;  2AGY A;  1A0R B;  4G56 B;  5JWZ A;  2H9M A;  4JSX C;  5FXY A;  4MK0 B;  1JMZ B;  4CY1 A;  1N6F A;  5FLX g;  2OVR B;  4CY3 A;  1B9Y A;  3EI4 A;  1N6D A;  2HJB A;  2UZX B;  2AGW A;  4BL0 A;  1B9X A;  4JT6 C;  5IC7 A;  5SXM A;  5EM2 B;  1JMX B;  3DXK C;  3A0F A;  3NVX A;  3OL2 A;  4A08 A;  2QXV A;  2J55 H;  3JZN A;  5EAM A;  2CE8 A;  5CYK A;  1K32 A;  3EWE A;  5TDH B;  4XYI A;  4U7A A;  4O45 A;  5KDO B;  4Y5R D;  3UKR C;  3I7N A;  4KFM B;  3EI2 A;  4J0W A;  3U4Y A;  2OVP B;  3GRE A;  3SBQ A;  2P9S C;  4JSN C;  2HXC A;  2YBA A;  3BG0 A;  4ESG A;  2IAA A;  4A0B A;  4A09 A;  4A0A A;  4XYH A;  2AH1 A;  4J8B A;  3UVK A;  4ERQ A;  4K3I D;  4HDJ A;  5GMK n;  5EML B;  5A2Q g;  3IJ0 A;  1MDA H;  2YNN A;  2IUR A;  3EG6 A;  3JZH A;  3RN0 D;  4J81 A;  4E5Z B;  3OTT A;  1GG2 B;  2PM9 B;  4IMM A;  3JRP A;  4ERZ A;  4X61 B;  3ORV D;  1P22 A;  2AGL A;  3PVU B;  4ZOZ A;  5HE1 B;  2AGX A;  3UVL A;  4FA4 D;  2AGZ A;  5K19 A;  5IGQ A;  5TEF A;  4FHL A;  5IT9 g;  2YNO A;  4JD2 C;  4PBZ A;  2QC5 A;  2HYE A;  2B5N A;  3K27 A;  4BH6 A;  1OLZ A;  4FAV D;  5B4W A;  2AQ5 A;  3I7H A;  4D6V A;  3MKS B;  3K26 A;  4A11 A;  3KRX B;  2P9N C;  5C2W B;  1PGU A;  4FA5 D;  2CO0 C;  3RSE C;  3IKO A;  4OZU A;  2CN3 A;  4XEI C;  2PM6 B;  4I79 A;  4L3H D;  3PSL A;  4J86 A;  4O1Q D;  2TRC B;  3F3G A;  3RLM D;  2PM7 B;  4CZX A;  3RFG A;  2CNX A;  3EI3 A;  4JSV C;  2HKM A;  2MTA H;  3FRX A;  4FAN D;  3I8E A;  4X3E A;  4J84 A;  5TEE A;  5IJ8 E;  2CO0 A;  1XHM A;  3AH8 B;  5EMJ B;  4J8G A;  4E54 B;  3C99 A;  3N0D A;  2B4E A;  1Q47 A;  2H9N A;  2P9K C;  4U1E I;  3RFH A;  2H6N A;  3ZWL B;  2I0S A;  5GSA A;  3OKY A;  3CFS B;  3KRW B;  3I8C A;  3OKT A;  2I3S A;  2B5M A;  5CXB B;  3I2N A;  4LG9 A;  2H14 A;  5FKR A;  2XYI A;  4GM3 A;  2IUV A;  2GC4 A;  3JRO A;  4BUJ C;  3BWS A;  5GXH A;  4CI2 A;  3IJC A;  2I0R A;  4ZOX A;  5EAP A;  1PI6 A;  5HYN B;  2GNQ A;  4O9D A;  2XU7 A;  4QT8 A;  5HE0 B;  3C5M A;  2P9P C;  4FA9 D;  2IUP A;  1JJU B;  5FKQ A;  2OK6 A;  5TF2 A;  3SHF A;  5FKS A;  1U2V C;  2I3T A;  2P9I C;  3I7K A;  1L0Q A;  4FWW A;  1QNI A;  4AEZ A;  2J56 H;  4GMB A;  1GP2 B; 
#chains in the Genus database with same CATH topology
 4QQE A;  1H2Y A;  1O6F A;  3GD1 I;  3GFC A;  3SCY A;  4PSX B;  2XL3 A;  4L3G D;  3NIG A;  3OKW A;  3C9C A;  3SJL D;  4CY2 A;  2VZ3 A;  3GC3 B;  2EBS A;  3NIF A;  3O4H A;  5CXC B;  5K1C C;  3C75 H;  3K72 A;  2J57 G;  3SBR A;  4JXM A;  3RN1 D;  1JOF A;  4X60 B;  5H17 A;  3IUN A;  3NVN A;  3V7D B;  3DWL C;  3AL8 B;  4GM8 A;  3V9F A;  5EM2 A;  3J81 g;  4MMZ A;  3ZDZ A;  1C9I A;  3SVW D;  4IA9 A;  4QAM A;  2G99 A;  2IWK A;  2PBI B;  4CC9 A;  1MG3 A;  4J87 A;  3EQ7 A;  4PNK B;  4PBY A;  3IJE A;  4NSX A;  1PEV A;  4ZOY A;  2HJ4 A;  1BPO A;  4R7A B;  2H6K A;  1XIP A;  3V4V A;  3BG1 A;  4AN1 A;  3I7O A;  4J0X A;  3P4F A;  2OIZ A;  4WJK A;  3FM0 A;  4L1Q D;  4Z7O A;  3EU7 A;  1E8N A;  2XE4 A;  4NEN A;  3JPX A;  5AMS A;  2GC7 A;  3EI4 B;  2H68 A;  5EMM B;  4CI3 A;  3UVM A;  2Z2N A;  3V5W B;  2OK4 A;  3AFC A;  1C9L A;  1UOO A;  4GZ8 A;  3UVO A;  4JHN A;  1U4C A;  3MZL A;  3OL2 B;  4A08 B;  4YVD A;  2OJY A;  4K3J B;  3W15 A;  1SQ9 A;  1K3I A;  4O3U B;  3E0C A;  5CYK B;  4E5Z A;  1GOG A;  1S4U X;  2PM9 A;  2XL2 A;  2H47 A;  4BCD A;  4H5J A;  2VDP A;  4GGC A;  5FKT A;  4LG8 A;  1N6E A;  3EI2 B;  1GOT B;  3KCI A;  1JTD B;  2I0T A;  3IIW A;  2P9U C;  4J73 A;  4NC4 A;  3F3F A;  3PXT D;  1MG2 A;  4FA1 D;  4ES0 A;  3UVN A;  2CN2 A;  2IUQ A;  3DXM C;  3T3P A;  3VH0 A;  3PSC B;  3MUN A;  5THA A;  3SN6 B;  1TBG A;  4GQB B;  3OW8 A;  4D0K A;  4A0B B;  4GQ1 A;  4O3T B;  2H9L A;  3K71 A;  4A0A B;  5IJ7 E;  3SMR A;  2OVQ B;  1VE7 A;  3VI4 A;  2YMU A;  1GXR A;  3SWS D;  5HE2 B;  4CZY A;  2BBK H;  3IUL A;  3B7F A;  3VA6 A;  2P9L C;  4J78 A;  2YNP A;  4WK2 A;  3NVQ A;  3DM0 A;  3N0E A;  2HES X;  3MZK A;  1JV2 A;  2EID A;  3FGB A;  4GQ2 P;  2H3X A;  2Q7Q A;  1OMW B;  1K8K C;  4N14 A;  5E6S A;  2JKX A;  2WQ8 A;  4A2L A;  1RI6 A;  1XKS A;  3CFV A;  3SFZ A;  2BKL A;  3MMY A;  4JT5 C;  5H14 A;  3ZE2 A;  4AOW A;  3I89 A;  1NR0 A;  5I5I A;  3SXT D;  4H5I A;  3EI1 B;  1U8C A;  5FQD A;  4ZN4 A;  4E54 A;  5AJA A;  1ERJ A;  5HE3 B;  5FA5 B;  3UR4 A;  4NAA A;  3PXS D;  5HQG A;  5E6R A;  4FB1 D;  3MVD K;  1SHY B;  4ZOV A;  3PE7 A;  4OWR A;  4MMY A;  4A11 B;  5C2V B;  3JB9 L;  5C9Z B;  4Z7Q A;  3I7P A;  3PVW B;  4GGA A;  4CI1 A;  4QRJ A;  3HFQ A;  2VZ1 A;  1A12 A;  5EAL A;  1R5M A;  3IIY A;  4A7J A;  4J82 A;  5CXB A;  4GGD A;  3F3P A;  3PXW D;  3ULE C;  2QZP A;  1YFQ A;  2Z2P A;  5HDB A;  4O2W A;  2VDQ A;  5EAR A;  4X63 B;  3EI3 B;  3JZG A;  1TYQ C;  4L1M A;  2CE9 A;  5IGO A;  4ERY A;  3RRM C;  4TZ4 A;  3IJ1 A;  3J80 g;  4BP8 A;  4G55 A;  4GM9 A;  3I7L A;  3SLE D;  3L4O D;  3O4J A;  3CIK B;  2H6Q A;  4CY5 A;  1E5T A;  2XZG A;  1H2Z A;  1FWX A;  2HU7 A;  2O9K A;  3RMZ D;  1L5G A;  3IUM A;  5H1M A;  3IVM A;  2B5L A;  2H13 A;  3K6S A;  5AFU 3;  3L4M D;  3VGZ A;  3MXX A;  4IRZ A;  3OKY B;  4G1E A;  3DSM A;  2W18 A;  2Z2O A;  2H9P A;  2EIC A;  4NBM A;  3EI1 A;  4J79 A;  2UZY B;  4L9O A;  2IWF A;  1PBY B;  5C92 A;  2YB8 B;  1O6G A;  4QL1 A;  3UKU C;  1VYH C;  3SBP A;  4PSW B;  4J77 A;  3MKQ A;  3JAM g;  2VDK A;  5EMK B;  5CXC A;  2G9A A;  3EMH A;  4LGN A;  4PC0 A;  3AL9 A;  1QFS A;  5GXI A;  4Z8L A;  4JSP C;  2AH0 A;  3ODT A;  5I5M A;  1SQJ A;  5M5U A;  2HU5 A;  2XDW A;  3AL8 A;  3ZE0 A;  4EWR A;  2BCJ B;  4AX4 A;  4A2M A;  1NEX B;  2HKR A;  4D9S A;  3O4G A;  4UI9 R;  4Y7R A;  4PXW A;  4CZV A;  4CI8 A;  4A09 B;  5I5J A;  2AGY A;  1A0R B;  3IUR A;  1E8M A;  4G56 B;  5JWZ A;  2H9M A;  2VDM A;  4JSX C;  5FXY A;  4MK0 B;  1JMZ B;  4CY1 A;  4AMZ A;  3QHY B;  1N6F A;  5FLX g;  1UOQ A;  2OVR B;  4CY3 A;  1B9Y A;  3EI4 A;  1N6D A;  2HJB A;  2UZX B;  3OF7 A;  2AGW A;  4BL0 A;  1B9X A;  4JT6 C;  5IC7 A;  5SXM A;  5EM2 B;  3ZE1 A;  1JMX B;  3DXK C;  2VC2 A;  3A0F A;  1UOP A;  3NVX A;  3OL2 A;  4A08 A;  2QXV A;  2J55 H;  3DDU A;  3JZN A;  5EAM A;  2CE8 A;  5CYK A;  1K32 A;  3T3M A;  3EWE A;  4WK0 A;  5TDH B;  4XYI A;  4U7A A;  4O45 A;  4Z7N A;  5KDO B;  4Y5R D;  3QI0 A;  3UKR C;  3I7N A;  4KFM B;  3EI2 A;  5M5R A;  1GOF A;  1VE6 A;  1TYE A;  4J0W A;  3U4Y A;  2OVP B;  3GRE A;  5C86 A;  3SBQ A;  2P9S C;  4JSN C;  2HXC A;  2YBA A;  1UTC A;  3BG0 A;  4ESG A;  2IAA A;  4A0B A;  4A09 A;  1M1X A;  4A0A A;  4XYH A;  3EQ8 A;  2AH1 A;  4J8B A;  4UM8 A;  5FFO A;  3UVK A;  4ERQ A;  3FCU A;  4K3I D;  3ZDY A;  3NID A;  4HDJ A;  5GMK n;  5EML B;  5A2Q g;  3IJ0 A;  1MDA H;  2YNN A;  2IUR A;  3EG6 A;  3JZH A;  5E6U A;  3RN0 D;  4J81 A;  4E5Z B;  3OTT A;  1GG2 B;  2PM9 B;  4IMM A;  3JRP A;  4ERZ A;  4X61 B;  3ORV D;  1P22 A;  2AGL A;  3PVU B;  4ZOZ A;  5HE1 B;  2AGX A;  3UVL A;  4FA4 D;  2AGZ A;  5K19 A;  5IGQ A;  5TEF A;  4FHL A;  5IT9 g;  2YNO A;  4JD2 C;  4PBZ A;  2QC5 A;  4JHP C;  2HYE A;  2B5N A;  3K27 A;  4BH6 A;  1OLZ A;  4FAV D;  5B4W A;  2AQ5 A;  3I7H A;  4D6V A;  3MKS B;  3K26 A;  4AMY A;  1H2X A;  4A11 A;  3KRX B;  2P9N C;  5C2W B;  1PGU A;  4FA5 D;  2CO0 C;  3RSE C;  3IKO A;  4OZU A;  4AN0 A;  2CN3 A;  2VDL A;  4XEI C;  3IUQ A;  3V4P A;  2PM6 B;  4I79 A;  4L3H D;  3PSL A;  4J86 A;  4O02 A;  4O1Q D;  2TRC B;  3F3G A;  2EIB A;  3O4I A;  4G1M A;  3RLM D;  2PM7 B;  4CZX A;  3RFG A;  2CNX A;  3VI3 A;  3EI3 A;  4JSV C;  4BCC A;  2HKM A;  2MTA H;  3FRX A;  4FAN D;  3I8E A;  4X3E A;  3ZDX A;  4J84 A;  5TEE A;  5M61 A;  4RE5 A;  2CO0 A;  5IJ8 E;  1XHM A;  1T2X A;  3AH8 B;  5EMJ B;  5M5V A;  4J8G A;  4E54 B;  3C99 A;  3N0D A;  5FFG A;  2B4E A;  1Q47 A;  2EIE A;  2H9N A;  2P9K C;  4U1E I;  3RFH A;  2H6N A;  3ZWL B;  2I0S A;  1VZ3 A;  5GSA A;  3OKY A;  3CFS B;  3KRW B;  3I8C A;  3OKT A;  2VDR A;  4BCB A;  2I3S A;  4UM9 A;  2B5M A;  3IUJ A;  2VDN A;  2QR5 A;  5CXB B;  3I2N A;  3EQ9 A;  4BP9 A;  2H14 A;  4LG9 A;  4WK4 A;  5FKR A;  2XYI A;  4RE6 A;  4DNV A;  2IUV A;  2GC4 A;  4GM3 A;  3JRO A;  4BUJ C;  3BWS A;  5GXH A;  4CI2 A;  2VDO A;  3IJC A;  5M5S A;  2I0R A;  4ZOX A;  5EAP A;  1PI6 A;  3FCS A;  5HYN B;  5M5T A;  2GNQ A;  4O9D A;  2XU7 A;  4QT8 A;  1VZ2 A;  5HE0 B;  3C5M A;  4DNU A;  2P9P C;  4FA9 D;  1QFM A;  2HU8 A;  2IUP A;  4DNW A;  1JJU B;  5FKQ A;  2OK6 A;  5TF2 A;  1H2W A;  3SHF A;  5FKS A;  1U2V C;  1I2M B;  2I3T A;  2P9I C;  1YR2 A;  3I7K A;  1GOH A;  1L0Q A;  4FWW A;  1QNI A;  4AEZ A;  3MUO A;  2J56 H;  4GMB A;  1GP2 B;  4MMX A; 
#chains in the Genus database with same CATH homology
 4QQE A;  3GFC A;  3SCY A;  4PSX B;  2XL3 A;  4L3G D;  3OKW A;  3C9C A;  3SJL D;  4CY2 A;  2EBS A;  5CXC B;  5K1C C;  3C75 H;  2J57 G;  3SBR A;  4JXM A;  3RN1 D;  1JOF A;  4X60 B;  5H17 A;  3NVN A;  3V7D B;  3DWL C;  3AL8 B;  4GM8 A;  3V9F A;  5EM2 A;  3J81 g;  3SVW D;  4IA9 A;  2G99 A;  2IWK A;  2PBI B;  4CC9 A;  1MG3 A;  4J87 A;  4PNK B;  4PBY A;  4NSX A;  1PEV A;  4ZOY A;  2HJ4 A;  4R7A B;  2H6K A;  1XIP A;  3BG1 A;  3I7O A;  4J0X A;  3P4F A;  2OIZ A;  3FM0 A;  4L1Q D;  3EU7 A;  3JPX A;  5AMS A;  2GC7 A;  3EI4 B;  2H68 A;  5EMM B;  4CI3 A;  3UVM A;  2Z2N A;  3V5W B;  2OK4 A;  3AFC A;  3UVO A;  4GZ8 A;  1U4C A;  3MZL A;  3OL2 B;  4A08 B;  4YVD A;  2OJY A;  4K3J B;  3W15 A;  1SQ9 A;  4O3U B;  3E0C A;  5CYK B;  4E5Z A;  2PM9 A;  1S4U X;  2XL2 A;  2H47 A;  4H5J A;  4GGC A;  5FKT A;  4LG8 A;  1N6E A;  3EI2 B;  1GOT B;  2I0T A;  3IIW A;  2P9U C;  4J73 A;  3F3F A;  3PXT D;  1MG2 A;  4FA1 D;  4ES0 A;  3UVN A;  2CN2 A;  2IUQ A;  3DXM C;  3VH0 A;  3PSC B;  5THA A;  3SN6 B;  1TBG A;  4GQB B;  3OW8 A;  4D0K A;  4A0B B;  4GQ1 A;  4O3T B;  2H9L A;  4A0A B;  5IJ7 E;  3SMR A;  2OVQ B;  2YMU A;  1GXR A;  3SWS D;  5HE2 B;  4CZY A;  2BBK H;  3B7F A;  3VA6 A;  4J78 A;  2P9L C;  2YNP A;  3NVQ A;  3DM0 A;  3N0E A;  2HES X;  3MZK A;  3FGB A;  4GQ2 P;  2H3X A;  2Q7Q A;  1OMW B;  1K8K C;  4N14 A;  4A2L A;  1RI6 A;  1XKS A;  3CFV A;  3SFZ A;  3MMY A;  4JT5 C;  5H14 A;  4AOW A;  3I89 A;  1NR0 A;  5I5I A;  3SXT D;  4H5I A;  3EI1 B;  5FQD A;  4ZN4 A;  4E54 A;  5AJA A;  1ERJ A;  5HE3 B;  5FA5 B;  3UR4 A;  3PXS D;  5HQG A;  4FB1 D;  1SHY B;  4ZOV A;  3PE7 A;  4OWR A;  4A11 B;  5C2V B;  3JB9 L;  5C9Z B;  3I7P A;  3PVW B;  4GGA A;  4CI1 A;  4QRJ A;  3HFQ A;  5EAL A;  1R5M A;  3IIY A;  4A7J A;  4J82 A;  5CXB A;  4GGD A;  3F3P A;  3PXW D;  3ULE C;  1YFQ A;  2Z2P A;  5EAR A;  4X63 B;  3EI3 B;  3JZG A;  1TYQ C;  2CE9 A;  5IGO A;  4ERY A;  3RRM C;  4TZ4 A;  3IJ1 A;  3J80 g;  4GM9 A;  3I7L A;  3SLE D;  3L4O D;  3CIK B;  2H6Q A;  4CY5 A;  1FWX A;  2O9K A;  3RMZ D;  5H1M A;  2B5L A;  2H13 A;  5AFU 3;  3L4M D;  3VGZ A;  3MXX A;  3OKY B;  3DSM A;  2W18 A;  2Z2O A;  2H9P A;  3EI1 A;  4J79 A;  2UZY B;  4L9O A;  2IWF A;  1PBY B;  2YB8 B;  4QL1 A;  3UKU C;  1VYH C;  3SBP A;  4PSW B;  4J77 A;  3MKQ A;  3JAM g;  5EMK B;  5CXC A;  2G9A A;  3EMH A;  4LGN A;  4PC0 A;  3AL9 A;  5GXI A;  4Z8L A;  4JSP C;  2AH0 A;  3ODT A;  5I5M A;  1SQJ A;  3AL8 A;  4EWR A;  2BCJ B;  4A2M A;  1NEX B;  2HKR A;  4UI9 R;  4Y7R A;  4PXW A;  4CZV A;  4CI8 A;  4A09 B;  5I5J A;  2AGY A;  1A0R B;  4G56 B;  5JWZ A;  2H9M A;  4JSX C;  5FXY A;  4MK0 B;  1JMZ B;  4CY1 A;  1N6F A;  5FLX g;  2OVR B;  4CY3 A;  1B9Y A;  3EI4 A;  1N6D A;  2HJB A;  2UZX B;  2AGW A;  4BL0 A;  1B9X A;  4JT6 C;  5IC7 A;  5SXM A;  5EM2 B;  1JMX B;  3DXK C;  3A0F A;  3NVX A;  3OL2 A;  4A08 A;  2QXV A;  2J55 H;  3JZN A;  5EAM A;  2CE8 A;  5CYK A;  1K32 A;  3EWE A;  5TDH B;  4XYI A;  4U7A A;  4O45 A;  5KDO B;  4Y5R D;  3UKR C;  3I7N A;  4KFM B;  3EI2 A;  4J0W A;  3U4Y A;  2OVP B;  3GRE A;  3SBQ A;  2P9S C;  4JSN C;  2HXC A;  2YBA A;  3BG0 A;  4ESG A;  2IAA A;  4A0B A;  4A09 A;  4A0A A;  4XYH A;  2AH1 A;  4J8B A;  3UVK A;  4ERQ A;  4K3I D;  4HDJ A;  5GMK n;  5EML B;  5A2Q g;  3IJ0 A;  1MDA H;  2YNN A;  2IUR A;  3EG6 A;  3JZH A;  3RN0 D;  4J81 A;  4E5Z B;  3OTT A;  1GG2 B;  2PM9 B;  4IMM A;  3JRP A;  4ERZ A;  4X61 B;  3ORV D;  1P22 A;  2AGL A;  3PVU B;  4ZOZ A;  5HE1 B;  2AGX A;  3UVL A;  4FA4 D;  2AGZ A;  5K19 A;  5IGQ A;  5TEF A;  4FHL A;  5IT9 g;  2YNO A;  4JD2 C;  4PBZ A;  2QC5 A;  2HYE A;  2B5N A;  3K27 A;  4BH6 A;  1OLZ A;  4FAV D;  5B4W A;  2AQ5 A;  3I7H A;  4D6V A;  3MKS B;  3K26 A;  4A11 A;  3KRX B;  2P9N C;  5C2W B;  1PGU A;  4FA5 D;  2CO0 C;  3RSE C;  3IKO A;  4OZU A;  2CN3 A;  4XEI C;  2PM6 B;  4I79 A;  4L3H D;  3PSL A;  4J86 A;  4O1Q D;  2TRC B;  3F3G A;  3RLM D;  2PM7 B;  4CZX A;  3RFG A;  2CNX A;  3EI3 A;  4JSV C;  2HKM A;  2MTA H;  3FRX A;  4FAN D;  3I8E A;  4X3E A;  4J84 A;  5TEE A;  5IJ8 E;  2CO0 A;  1XHM A;  3AH8 B;  5EMJ B;  4J8G A;  4E54 B;  3C99 A;  3N0D A;  2B4E A;  1Q47 A;  2H9N A;  2P9K C;  4U1E I;  3RFH A;  2H6N A;  3ZWL B;  2I0S A;  5GSA A;  3OKY A;  3CFS B;  3KRW B;  3I8C A;  3OKT A;  2I3S A;  2B5M A;  5CXB B;  3I2N A;  4LG9 A;  2H14 A;  5FKR A;  2XYI A;  4GM3 A;  2IUV A;  2GC4 A;  3JRO A;  4BUJ C;  3BWS A;  5GXH A;  4CI2 A;  3IJC A;  2I0R A;  4ZOX A;  5EAP A;  1PI6 A;  5HYN B;  2GNQ A;  4O9D A;  2XU7 A;  4QT8 A;  5HE0 B;  3C5M A;  2P9P C;  4FA9 D;  2IUP A;  1JJU B;  5FKQ A;  2OK6 A;  5TF2 A;  3SHF A;  5FKS A;  1U2V C;  2I3T A;  2P9I C;  3I7K A;  1L0Q A;  4FWW A;  1QNI A;  4AEZ A;  2J56 H;  4GMB A;  1GP2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...