5EALA

Crystal structure of human wdr5 in complex with compound 9h
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human WDR5 in complex with compound 9h
rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
molecule keywords WD repeat-containing protein 5
total genus 102
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5ealA00
4JSVC 4CY5A 5IGOA 3KRXB 3MZKA 3UR4A 2AGLA 4K3ID 4BL0A 2HESX 4JT5C 3JRPA 2IUVA 3EI1A 1K32A 4E54B 4D6VA 4A0AB 1PBYB 5AJAA 3SLED 1NR0A 1N6DA 3SN6B 2OK6A 2YMUA 3BG1A 2AGXA 3MMYA 3SXTD 5EALA 5CXBA 4E5ZB 3N0DA 4ZOVA 1K8KC 5EM2A 2YNOA 5CYKA 5IGQA 4H5IA 4ZN4A 4U7AA 4PNKB 4QRJA 5TEEA 1SQ9A 5AMSA 3PXTD 2TRCB 5FA5B 3SFZA 4EWRA 3AH8B 4PBZA 2AGYA 4OZUA 4E54A 3IIWA 3UVMA 1XHMA 5AFU3 3PXSD 1B9YA 3EI2B 3F3GA 5EAPA 2UZYB 3DXMC 2O9KA 3ODTA 5CXBB 4E5ZA 2AH0A 3GREA 2IWFA 2J57G 4A08A 3RMZD 2BCJB 4ZOZA 2YNNA 4J0XA 4HDJA 4L3GD 2QC5A 4D0KA 4FA9D 5GMKn 4A0AA 4CY2A 2QXVA 2G9AA 2GC7A 2IAAA 4OWRA 2PM7B 5JWZA 4J81A 4JSPC 3SBQA 2H6QA 4O9DA 1PGUA 2GC4A 4X63B 4CI8A 3DSMA 5I5JA 5TF2A 4CI3A 1GG2B 2CNXA 2B5LA 4J78A 4CI1A 5GXHA 2XYIA 3JZNA 1U2VC 2CN3A 5IT9g 3DXKC 3OKYB 3NVNA 3UKRC 4ESGA 3J80g 4GGDA 5FQDA 2I0TA 1XKSA 2J55H 2HJBA 2GNQA 4I79A 4ZOXA 4A09A 4AEZA 2CN2A 3AL9A 3RSEC 4FWWA 4H5JA 3OW8A 3V9FA 2CE9A 3AL8B 3I8CA 2I0RA 2P9KC 2HJ4A 3SBRA 3UVLA 2H6KA 3EG6A 3OKTA 2H14A 4L3HD 2P9IC 4L1QD 5FLXg 1SQJA 1QNIA 1PEVA 3V7DB 4LGNA 4A0BB 3ZWLB 5EMLB 4FAND 3EMHA 3SWSD 3OL2B 2AGZA 4A2MA 1SHYB 3PE7A 3BG0A 5I5IA 4GQ1A 3SVWD 3I8EA 5K1CC 2H9MA 4GM9A 3VGZA 2H47A 3E0CA 4O45A 3J81g 2IUQA 4J84A 4PC0A 4J8BA 4XEIC 3OKYA 4ES0A 3IJ0A 5EM2B 2XU7A 3AL8A 2I3SA 4O3UB 1XIPA 1TYQC 3I7HA 4QT8A 2W18A 3MZLA 2PM6B 3F3PA 5C2VB 4J0WA 3MXXA 1NEXB 5H14A 3EI2A 2XL2A 2YB8B 4PBYA 3W15A 4ERZA 2HKRA 3MKSB 4BH6A 1GXRA 5HE3B 4XYHA 3ULEC 3KRWB 3JZGA 4QL1A 3JAMg 5IC7A 4L9OA 3AFCA 3C99A 3PXWD 4CZVA 1U4CA 4G56B 3RN1D 3B7FA 5SXMA 5FKQA 4A11A 3FM0A 5HE2B 3N0EA 2G99A 5CYKB 4PSXB 2I0SA 3MKQA 1JJUB 4A2LA 3VA6A 4CC9A 1N6FA 5CXCB 3RFHA 3NVQA 3I7PA 4ERYA 5EMJB 5HYNB 5HQGA 4Y7RA 4KFMB 4J87A 2OJYA 5FKRA 5TEFA 2IURA 3U4YA 4J8GA 3JROA 3CFVA 2HYEA 2AQ5A 4CY3A 3FRXA 3HFQA 3GFCA 3P4FA 4R7AB 3I7OA 3PSLA 3RN0D 4GZ8A 5GSAA 2Q7QA 4J77A 2H13A 1JMZB 1JMXB 3PVWB 5HE1B 3RRMC 4GQBB 5FKSA 1GP2B 2OK4A 4U1EI 5IJ7E 2BBKH 2J56H 4NSXA 2H9PA 4ERQA 4K3JB 3K27A 4FA5D 3L4OD 3I2NA 3OTTA 2CO0C 2XL3A 2B4EA 2AGWA 5FXYA 1A0RB 2I3TA 4GGAA 3JPXA 1B9XA 3PVUB 1JOFA 2Z2OA 5H17A 3C75H 2Z2NA 1L0QA 2OVRB 4JSXC 2HKMA 1N6EA 2OIZA 4GGCA 4J73A 3PSCB 1R5MA 3C5MA 4CZYA 1RI6A 2CE8A 5B4WA 1MG2A 2HXCA 4JSNC 3SBPA 3I89A 4A08B 3K26A 3SJLD 3V5WB 5CXCA 5C9ZB 2UZXB 2H3XA 4CI2A 4A7JA 5A2Qg 2YBAA 5K19A 5FKTA 3EI4B 4PXWA 1GOTB 3ORVD 3I7LA 4A11B 3EU7A 2EBSA 2PM9B 1ERJA 3OKWA 5IJ8E 2P9UC 2AH1A 4JT6C 2P9PC 5EARA 1S4UX 3VH0A 5HE0B 4CZXA 4GMBA 1OMWB 2H9LA 4O1QD 4Y5RD 3JB9L 5TDHB 2Z2PA 1PI6A 4IMMA 4FHLA 4XYIA 4YVDA 1FWXA 4FA1D 2YNPA 4X61B 3EI3B 3RFGA 4ZOYA 2P9SC 4PSWB 3EI3A 3L4MD 5KDOB 3IJ1A 4GM3A 3IKOA 2CO0A 1MDAH 4J86A 3UVNA 3I7NA 3EWEA 4O3TB 5GXIA 4IA9A 4FAVD 4TZ4A 4X60B 4A09B 1YFQA 4AOWA 3OL2A 4BUJC 3IJCA 4CY1A 3IIYA 1Q47A 4GM8A 4A0BA 4Z8LA 2MTAH 3UKUC 3CIKB 4UI9R 4LG9A 3UVOA 3SHFA 5EAMA 3CFSB 5EMMB 2IUPA 4FB1D 3UVKA 3EI4A 4GQ2P 1P22A 3FGBA 5H1MA 3BWSA 3SCYA 5I5MA 5EMKB 1TBGA 2H9NA 2OVPB 5C2WB 1OLZA 3A0FA 4LG8A 3DM0A 3I7KA 3SMRA 3RLMD 2OVQB 3NVXA 3F3FA 4X3EA 3EI1B 5THAA 1VYHC 1MG3A 2P9NC 4J79A 4JXMA 2P9LC 2B5NA 4N14A 2PM9A 2B5MA 3JZHA 4FA4D 3C9CA 3DWLC 4J82A 2H6NA 2H68A 2PBIB 2IWKA 4QQEA 4MK0B 4JD2C
chains in the Genus database with same CATH superfamily
4JSVC 4CY5A 5IGOA 3KRXB 3GC3B 3MZKA 3UR4A 3ZE2A 2AGLA 4K3ID 4BL0A 2HESX 4JT5C 3JRPA 2IUVA 3EI1A 1K32A 4E54B 4D6VA 4A0AB 1PBYB 2XDWA 4MMYA 5AJAA 3SLED 4Z7NA 1NR0A 2QR5A 1N6DA 3SN6B 1H2XA 2OK6A 2YMUA 4G1MA 3BG1A 2AGXA 3MMYA 3SXTD 5EALA 5CXBA 4E5ZB 3N0DA 3EQ7A 4ZOVA 1K8KC 5EM2A 2YNOA 5CYKA 5IGQA 5FFOA 4H5IA 4ZN4A 4U7AA 4PNKB 4QRJA 5TEEA 1SQ9A 5AMSA 3PXTD 2TRCB 5FA5B 3SFZA 4EWRA 3AH8B 4PBZA 5E6RA 2AGYA 4OZUA 4E54A 3O4HA 3IIWA 3UVMA 1XHMA 5AFU3 3PXSD 1B9YA 3EI2B 3F3GA 4O2WA 1C9IA 5EAPA 2UZYB 3DXMC 2O9KA 1JTDB 3ODTA 5CXBB 5FFGA 4E5ZA 2AH0A 3GREA 2IWFA 2J57G 4A08A 3RMZD 1VE7A 2BCJB 4MMZA 4ZOZA 2YNNA 4J0XA 4HDJA 3DDUA 5M5VA 4L3GD 2QC5A 4D0KA 4FA9D 5GMKn 4A0AA 4CY2A 2QXVA 3K6SA 2G9AA 3EQ8A 3T3PA 2GC7A 2IAAA 2BKLA 4G55A 4OWRA 2VZ3A 2PM7B 5JWZA 4MMXA 4J81A 4JSPC 1UOQA 1GOGA 3SBQA 2H6QA 4O9DA 1PGUA 2GC4A 4X63B 4CI8A 3DSMA 5I5JA 5TF2A 1UOOA 4CI3A 3MVDK 1GG2B 2CNXA 2B5LA 4J78A 4CI1A 5GXHA 2XYIA 3JZNA 4QAMA 1U2VC 2CN3A 4WK2A 5IT9g 2VDMA 2VDKA 3DXKC 3OKYB 3NVNA 3UKRC 4ESGA 3J80g 4GGDA 5FQDA 2I0TA 1XKSA 2J55H 4Z7QA 2HJBA 4UM8A 2GNQA 4I79A 4ZOXA 4A09A 4AEZA 4NC4A 2CN2A 3AL9A 3RSEC 3V4VA 4FWWA 1K3IA 4H5JA 3OW8A 3V9FA 2CE9A 4Z7OA 3AL8B 3I8CA 2I0RA 2P9KC 2HU5A 2HJ4A 3SBRA 3UVLA 5M5UA 2QZPA 2H6KA 3FCSA 3EG6A 5M5TA 1L5GA 3OKTA 2H14A 4O02A 4L3HD 2P9IC 4L1QD 3ZE1A 5FLXg 4BCCA 1SQJA 1QNIA 1PEVA 3V7DB 1A12A 2JKXA 4LGNA 4WK0A 2VDQA 4A0BB 3ZWLB 1QFSA 3IUMA 1E8MA 5HDBA 3O4GA 5EMLB 4FAND 3EMHA 3SWSD 3OL2B 2AGZA 4A2MA 1SHYB 5M5SA 3PE7A 3BG0A 5I5IA 4GQ1A 3SVWD 3I8EA 5K1CC 3ZE0A 2H9MA 4GM9A 3VGZA 2H47A 3KCIA 3E0CA 4O45A 3J81g 2IUQA 4J84A 3VI4A 4PC0A 4J8BA 4XEIC 3OKYA 4ES0A 3IJ0A 5EM2B 2XU7A 3AL8A 2I3SA 4O3UB 1XIPA 1TYQC 1YR2A 4NAAA 3I7HA 4QT8A 2W18A 4NENA 3MZLA 2PM6B 3F3PA 1UTCA 5C2VB 4J0WA 3MXXA 1NEXB 5H14A 4AN1A 3EI2A 3K72A 2XL2A 2YB8B 1BPOA 4UM9A 4PBYA 1E5TA 3W15A 4ERZA 2HKRA 2VDRA 1T2XA 1VZ2A 3MKSB 4BH6A 1GXRA 5HE3B 4XYHA 3ULEC 3KRWB 3JZGA 4QL1A 3JAMg 5IC7A 4L9OA 2WQ8A 3AFCA 3C99A 3PXWD 3VI3A 4CZVA 1U4CA 4G56B 3RN1D 3O4IA 3B7FA 1H2WA 5SXMA 2VZ1A 4BP8A 1GOFA 3IURA 5FKQA 4A11A 3FM0A 5HE2B 3N0EA 2G99A 1VZ3A 5CYKB 4RE5A 4IRZA 4PSXB 2I0SA 3MKQA 3K71A 3OF7A 1JJUB 4A2LA 3VA6A 4CC9A 1N6FA 5CXCB 3RFHA 1C9LA 2VDPA 4BCBA 3NVQA 3I7PA 4ERYA 5EMJB 5HYNB 2EIDA 2EIEA 5HQGA 4Y7RA 1QFMA 4KFMB 4J87A 2OJYA 5FKRA 5TEFA 1U8CA 2IURA 3U4YA 4J8GA 4JHPC 3JROA 3CFVA 2HYEA 2AQ5A 2XZGA 3FRXA 4CY3A 3HFQA 3GFCA 3P4FA 2EICA 4R7AB 3I7OA 3PSLA 3RN0D 4GZ8A 5GSAA 2Q7QA 4J77A 2H13A 1JMZB 1JMXB 3PVWB 5HE1B 3RRMC 4GQBB 5FKSA 1GP2B 2OK4A 4JHNA 4U1EI 5IJ7E 2BBKH 2J56H 4AMYA 4NSXA 2H9PA 4ERQA 4K3JB 3K27A 4FA5D 3L4OD 1O6FA 5E6SA 3I2NA 3OTTA 2CO0C 2XL3A 2B4EA 2AGWA 5FXYA 1A0RB 2I3TA 4GGAA 3JPXA 1B9XA 3PVUB 1JOFA 2Z2OA 5H17A 3C75H 2Z2NA 1L0QA 4DNVA 2OVRB 4JSXC 2HKMA 1N6EA 2OIZA 3NIDA 4GGCA 4J73A 3PSCB 1R5MA 3C5MA 4CZYA 1RI6A 2CE8A 5B4WA 1MG2A 1H2ZA 2HXCA 4JSNC 3SBPA 3I89A 1E8NA 4A08B 3K26A 3SJLD 3V5WB 5CXCA 5C9ZB 2UZXB 4RE6A 1O6GA 2H3XA 4A7JA 4CI2A 5A2Qg 2HU8A 4AMZA 3V4PA 2YBAA 3QI0A 5FKTA 5K19A 3EI4B 3FCUA 4PXWA 5M5RA 1GOTB 3ORVD 3I7LA 4A11B 3EU7A 4WJKA 2EBSA 4DNUA 2PM9B 1ERJA 3OKWA 3IJEA 5IJ8E 2P9UC 2AH1A 4JT6C 2P9PC 5EARA 1JV2A 1H2YA 2XE4A 1GOHA 1S4UX 3VH0A 5HE0B 4CZXA 4GMBA 4BP9A 1OMWB 2H9LA 4O1QD 4Y5RD 3JB9L 5TDHB 2Z2PA 1PI6A 3IUQA 4FHLA 4IMMA 4XYIA 5C86A 4YVDA 1FWXA 3T3MA 2VC2A 4FA1D 2YNPA 4X61B 3EI3B 3RFGA 4ZOYA 2P9SC 4PSWB 3ZDZA 3EI3A 4L1MA 3IVMA 3L4MD 5KDOB 3IJ1A 4GM3A 3IKOA 2CO0A 1MDAH 4J86A 3UVNA 3ZDXA 4G1EA 3I7NA 3EWEA 4O3TB 4BCDA 5GXIA 5M61A 4IA9A 4FAVD 4TZ4A 4X60B 1TYEA 1I2MB 4A09B 1YFQA 4AOWA 3OL2A 3NIFA 4BUJC 4NBMA 3MUNA 3EQ9A 3IJCA 4CY1A 4AX4A 4D9SA 3IIYA 3MUOA 1Q47A 3GD1I 4GM8A 4A0BA 4Z8LA 2MTAH 1UOPA 3UKUC 3CIKB 4UI9R 2VDLA 4LG9A 3UVOA 3IUNA 3SHFA 5EAMA 3CFSB 5EMMB 2IUPA 4FB1D 3UVKA 3EI4A 4GQ2P 1P22A 3FGBA 5E6UA 5H1MA 3BWSA 3SCYA 5I5MA 5EMKB 1TBGA 2H9NA 2EIBA 3NIGA 2OVPB 5C2WB 1OLZA 1M1XA 3A0FA 4LG8A 3DM0A 3I7KA 3SMRA 5C92A 3RLMD 2OVQB 3NVXA 3F3FA 3QHYB 3ZDYA 3O4JA 4X3EA 3EI1B 5THAA 4DNWA 3IULA 1VYHC 1MG3A 2P9NC 4J79A 2HU7A 4JXMA 2VDNA 4WK4A 2P9LC 2B5NA 2VDOA 4N14A 4AN0A 2PM9A 2B5MA 3IUJA 3JZHA 4FA4D 3C9CA 3DWLC 4J82A 2H6NA 2H68A 2PBIB 1VE6A 2IWKA 4MK0B 4QQEA 4JD2C
chains in the Genus database with same CATH topology
4JSVC 4CY5A 5IGOA 3KRXB 3MZKA 3UR4A 2AGLA 4K3ID 4BL0A 2HESX 4JT5C 3JRPA 2IUVA 3EI1A 1K32A 4E54B 4D6VA 4A0AB 1PBYB 5AJAA 3SLED 1NR0A 1N6DA 3SN6B 2OK6A 2YMUA 3BG1A 2AGXA 3MMYA 3SXTD 5EALA 5CXBA 4E5ZB 3N0DA 4ZOVA 1K8KC 5EM2A 2YNOA 5CYKA 5IGQA 4H5IA 4ZN4A 4U7AA 4PNKB 4QRJA 5TEEA 1SQ9A 5AMSA 3PXTD 2TRCB 5FA5B 3SFZA 4EWRA 3AH8B 4PBZA 2AGYA 4OZUA 4E54A 3IIWA 3UVMA 1XHMA 5AFU3 3PXSD 1B9YA 3EI2B 3F3GA 5EAPA 2UZYB 3DXMC 2O9KA 3ODTA 5CXBB 4E5ZA 2AH0A 3GREA 2IWFA 2J57G 4A08A 3RMZD 2BCJB 4ZOZA 2YNNA 4J0XA 4HDJA 4L3GD 2QC5A 4D0KA 4FA9D 5GMKn 4A0AA 4CY2A 2QXVA 2G9AA 2GC7A 2IAAA 4OWRA 2PM7B 5JWZA 4J81A 4JSPC 3SBQA 2H6QA 4O9DA 1PGUA 2GC4A 4X63B 4CI8A 3DSMA 5I5JA 5TF2A 4CI3A 1GG2B 2CNXA 2B5LA 4J78A 4CI1A 5GXHA 2XYIA 3JZNA 1U2VC 2CN3A 5IT9g 3DXKC 3OKYB 3NVNA 3UKRC 4ESGA 3J80g 4GGDA 5FQDA 2I0TA 1XKSA 2J55H 2HJBA 2GNQA 4I79A 4ZOXA 4A09A 4AEZA 2CN2A 3AL9A 3RSEC 4FWWA 4H5JA 3OW8A 3V9FA 2CE9A 3AL8B 3I8CA 2I0RA 2P9KC 2HJ4A 3SBRA 3UVLA 2H6KA 3EG6A 3OKTA 2H14A 4L3HD 2P9IC 4L1QD 5FLXg 1SQJA 1QNIA 1PEVA 3V7DB 4LGNA 4A0BB 3ZWLB 5EMLB 4FAND 3EMHA 3SWSD 3OL2B 2AGZA 4A2MA 1SHYB 3PE7A 3BG0A 5I5IA 4GQ1A 3SVWD 3I8EA 5K1CC 2H9MA 4GM9A 3VGZA 2H47A 3E0CA 4O45A 3J81g 2IUQA 4J84A 4PC0A 4J8BA 4XEIC 3OKYA 4ES0A 3IJ0A 5EM2B 2XU7A 3AL8A 2I3SA 4O3UB 1XIPA 1TYQC 3I7HA 4QT8A 2W18A 3MZLA 2PM6B 3F3PA 5C2VB 4J0WA 3MXXA 1NEXB 5H14A 3EI2A 2XL2A 2YB8B 4PBYA 3W15A 4ERZA 2HKRA 3MKSB 4BH6A 1GXRA 5HE3B 4XYHA 3ULEC 3KRWB 3JZGA 4QL1A 3JAMg 5IC7A 4L9OA 3AFCA 3C99A 3PXWD 4CZVA 1U4CA 4G56B 3RN1D 3B7FA 5SXMA 5FKQA 4A11A 3FM0A 5HE2B 3N0EA 2G99A 5CYKB 4PSXB 2I0SA 3MKQA 1JJUB 4A2LA 3VA6A 4CC9A 1N6FA 5CXCB 3RFHA 3NVQA 3I7PA 4ERYA 5EMJB 5HYNB 5HQGA 4Y7RA 4KFMB 4J87A 2OJYA 5FKRA 5TEFA 2IURA 3U4YA 4J8GA 3JROA 3CFVA 2HYEA 2AQ5A 4CY3A 3FRXA 3HFQA 3GFCA 3P4FA 4R7AB 3I7OA 3PSLA 3RN0D 4GZ8A 5GSAA 2Q7QA 4J77A 2H13A 1JMZB 1JMXB 3PVWB 5HE1B 3RRMC 4GQBB 5FKSA 1GP2B 2OK4A 4U1EI 5IJ7E 2BBKH 2J56H 4NSXA 2H9PA 4ERQA 4K3JB 3K27A 4FA5D 3L4OD 3I2NA 3OTTA 2CO0C 2XL3A 2B4EA 2AGWA 5FXYA 1A0RB 2I3TA 4GGAA 3JPXA 1B9XA 3PVUB 1JOFA 2Z2OA 5H17A 3C75H 2Z2NA 1L0QA 2OVRB 4JSXC 2HKMA 1N6EA 2OIZA 4GGCA 4J73A 3PSCB 1R5MA 3C5MA 4CZYA 1RI6A 2CE8A 5B4WA 1MG2A 2HXCA 4JSNC 3SBPA 3I89A 4A08B 3K26A 3SJLD 3V5WB 5CXCA 5C9ZB 2UZXB 2H3XA 4CI2A 4A7JA 5A2Qg 2YBAA 5K19A 5FKTA 3EI4B 4PXWA 1GOTB 3ORVD 3I7LA 4A11B 3EU7A 2EBSA 2PM9B 1ERJA 3OKWA 5IJ8E 2P9UC 2AH1A 4JT6C 2P9PC 5EARA 1S4UX 3VH0A 5HE0B 4CZXA 4GMBA 1OMWB 2H9LA 4O1QD 4Y5RD 3JB9L 5TDHB 2Z2PA 1PI6A 4IMMA 4FHLA 4XYIA 4YVDA 1FWXA 4FA1D 2YNPA 4X61B 3EI3B 3RFGA 4ZOYA 2P9SC 4PSWB 3EI3A 3L4MD 5KDOB 3IJ1A 4GM3A 3IKOA 2CO0A 1MDAH 4J86A 3UVNA 3I7NA 3EWEA 4O3TB 5GXIA 4IA9A 4FAVD 4TZ4A 4X60B 4A09B 1YFQA 4AOWA 3OL2A 4BUJC 3IJCA 4CY1A 3IIYA 1Q47A 4GM8A 4A0BA 4Z8LA 2MTAH 3UKUC 3CIKB 4UI9R 4LG9A 3UVOA 3SHFA 5EAMA 3CFSB 5EMMB 2IUPA 4FB1D 3UVKA 3EI4A 4GQ2P 1P22A 3FGBA 5H1MA 3BWSA 3SCYA 5I5MA 5EMKB 1TBGA 2H9NA 2OVPB 5C2WB 1OLZA 3A0FA 4LG8A 3DM0A 3I7KA 3SMRA 3RLMD 2OVQB 3NVXA 3F3FA 4X3EA 3EI1B 5THAA 1VYHC 1MG3A 2P9NC 4J79A 4JXMA 2P9LC 2B5NA 4N14A 2PM9A 2B5MA 3JZHA 4FA4D 3C9CA 3DWLC 4J82A 2H6NA 2H68A 2PBIB 2IWKA 4QQEA 4MK0B 4JD2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JSV C;  4CY5 A;  5IGO A;  3KRX B;  3MZK A;  3UR4 A;  2AGL A;  4K3I D;  4BL0 A;  2HES X;  4JT5 C;  3JRP A;  2IUV A;  3EI1 A;  1K32 A;  4E54 B;  4D6V A;  4A0A B;  1PBY B;  5AJA A;  3SLE D;  1NR0 A;  1N6D A;  3SN6 B;  2OK6 A;  2YMU A;  3BG1 A;  2AGX A;  3MMY A;  3SXT D;  5EAL A;  5CXB A;  4E5Z B;  3N0D A;  4ZOV A;  1K8K C;  5EM2 A;  2YNO A;  5CYK A;  5IGQ A;  4H5I A;  4ZN4 A;  4U7A A;  4PNK B;  4QRJ A;  5TEE A;  1SQ9 A;  5AMS A;  3PXT D;  2TRC B;  5FA5 B;  3SFZ A;  4EWR A;  3AH8 B;  4PBZ A;  2AGY A;  4OZU A;  4E54 A;  3IIW A;  3UVM A;  1XHM A;  5AFU 3;  3PXS D;  1B9Y A;  3EI2 B;  3F3G A;  5EAP A;  2UZY B;  3DXM C;  2O9K A;  3ODT A;  5CXB B;  4E5Z A;  2AH0 A;  3GRE A;  2IWF A;  2J57 G;  4A08 A;  3RMZ D;  2BCJ B;  4ZOZ A;  2YNN A;  4J0X A;  4HDJ A;  4L3G D;  2QC5 A;  4D0K A;  4FA9 D;  5GMK n;  4A0A A;  4CY2 A;  2QXV A;  2G9A A;  2GC7 A;  2IAA A;  4OWR A;  2PM7 B;  5JWZ A;  4J81 A;  4JSP C;  3SBQ A;  2H6Q A;  4O9D A;  1PGU A;  2GC4 A;  4X63 B;  4CI8 A;  3DSM A;  5I5J A;  5TF2 A;  4CI3 A;  1GG2 B;  2CNX A;  2B5L A;  4J78 A;  4CI1 A;  5GXH A;  2XYI A;  3JZN A;  1U2V C;  2CN3 A;  5IT9 g;  3DXK C;  3OKY B;  3NVN A;  3UKR C;  4ESG A;  3J80 g;  4GGD A;  5FQD A;  2I0T A;  1XKS A;  2J55 H;  2HJB A;  2GNQ A;  4I79 A;  4ZOX A;  4A09 A;  4AEZ A;  2CN2 A;  3AL9 A;  3RSE C;  4FWW A;  4H5J A;  3OW8 A;  3V9F A;  2CE9 A;  3AL8 B;  3I8C A;  2I0R A;  2P9K C;  2HJ4 A;  3SBR A;  3UVL A;  2H6K A;  3EG6 A;  3OKT A;  2H14 A;  4L3H D;  2P9I C;  4L1Q D;  5FLX g;  1SQJ A;  1QNI A;  1PEV A;  3V7D B;  4LGN A;  4A0B B;  3ZWL B;  5EML B;  4FAN D;  3EMH A;  3SWS D;  3OL2 B;  2AGZ A;  4A2M A;  1SHY B;  3PE7 A;  3BG0 A;  5I5I A;  4GQ1 A;  3SVW D;  3I8E A;  5K1C C;  2H9M A;  4GM9 A;  3VGZ A;  2H47 A;  3E0C A;  4O45 A;  3J81 g;  2IUQ A;  4J84 A;  4PC0 A;  4J8B A;  4XEI C;  3OKY A;  4ES0 A;  3IJ0 A;  5EM2 B;  2XU7 A;  3AL8 A;  2I3S A;  4O3U B;  1XIP A;  1TYQ C;  3I7H A;  4QT8 A;  2W18 A;  3MZL A;  2PM6 B;  3F3P A;  5C2V B;  4J0W A;  3MXX A;  1NEX B;  5H14 A;  3EI2 A;  2XL2 A;  2YB8 B;  4PBY A;  3W15 A;  4ERZ A;  2HKR A;  3MKS B;  4BH6 A;  1GXR A;  5HE3 B;  4XYH A;  3ULE C;  3KRW B;  3JZG A;  4QL1 A;  3JAM g;  5IC7 A;  4L9O A;  3AFC A;  3C99 A;  3PXW D;  4CZV A;  1U4C A;  4G56 B;  3RN1 D;  3B7F A;  5SXM A;  5FKQ A;  4A11 A;  3FM0 A;  5HE2 B;  3N0E A;  2G99 A;  5CYK B;  4PSX B;  2I0S A;  3MKQ A;  1JJU B;  4A2L A;  3VA6 A;  4CC9 A;  1N6F A;  5CXC B;  3RFH A;  3NVQ A;  3I7P A;  4ERY A;  5EMJ B;  5HYN B;  5HQG A;  4Y7R A;  4KFM B;  4J87 A;  2OJY A;  5FKR A;  5TEF A;  2IUR A;  3U4Y A;  4J8G A;  3JRO A;  3CFV A;  2HYE A;  2AQ5 A;  4CY3 A;  3FRX A;  3HFQ A;  3GFC A;  3P4F A;  4R7A B;  3I7O A;  3PSL A;  3RN0 D;  4GZ8 A;  5GSA A;  2Q7Q A;  4J77 A;  2H13 A;  1JMZ B;  1JMX B;  3PVW B;  5HE1 B;  3RRM C;  4GQB B;  5FKS A;  1GP2 B;  2OK4 A;  4U1E I;  5IJ7 E;  2BBK H;  2J56 H;  4NSX A;  2H9P A;  4ERQ A;  4K3J B;  3K27 A;  4FA5 D;  3L4O D;  3I2N A;  3OTT A;  2CO0 C;  2XL3 A;  2B4E A;  2AGW A;  5FXY A;  1A0R B;  2I3T A;  4GGA A;  3JPX A;  1B9X A;  3PVU B;  1JOF A;  2Z2O A;  5H17 A;  3C75 H;  2Z2N A;  1L0Q A;  2OVR B;  4JSX C;  2HKM A;  1N6E A;  2OIZ A;  4GGC A;  4J73 A;  3PSC B;  1R5M A;  3C5M A;  4CZY A;  1RI6 A;  2CE8 A;  5B4W A;  1MG2 A;  2HXC A;  4JSN C;  3SBP A;  3I89 A;  4A08 B;  3K26 A;  3SJL D;  3V5W B;  5CXC A;  5C9Z B;  2UZX B;  2H3X A;  4CI2 A;  4A7J A;  5A2Q g;  2YBA A;  5K19 A;  5FKT A;  3EI4 B;  4PXW A;  1GOT B;  3ORV D;  3I7L A;  4A11 B;  3EU7 A;  2EBS A;  2PM9 B;  1ERJ A;  3OKW A;  5IJ8 E;  2P9U C;  2AH1 A;  4JT6 C;  2P9P C;  5EAR A;  1S4U X;  3VH0 A;  5HE0 B;  4CZX A;  4GMB A;  1OMW B;  2H9L A;  4O1Q D;  4Y5R D;  3JB9 L;  5TDH B;  2Z2P A;  1PI6 A;  4IMM A;  4FHL A;  4XYI A;  4YVD A;  1FWX A;  4FA1 D;  2YNP A;  4X61 B;  3EI3 B;  3RFG A;  4ZOY A;  2P9S C;  4PSW B;  3EI3 A;  3L4M D;  5KDO B;  3IJ1 A;  4GM3 A;  3IKO A;  2CO0 A;  1MDA H;  4J86 A;  3UVN A;  3I7N A;  3EWE A;  4O3T B;  5GXI A;  4IA9 A;  4FAV D;  4TZ4 A;  4X60 B;  4A09 B;  1YFQ A;  4AOW A;  3OL2 A;  4BUJ C;  3IJC A;  4CY1 A;  3IIY A;  1Q47 A;  4GM8 A;  4A0B A;  4Z8L A;  2MTA H;  3UKU C;  3CIK B;  4UI9 R;  4LG9 A;  3UVO A;  3SHF A;  5EAM A;  3CFS B;  5EMM B;  2IUP A;  4FB1 D;  3UVK A;  3EI4 A;  4GQ2 P;  1P22 A;  3FGB A;  5H1M A;  3BWS A;  3SCY A;  5I5M A;  5EMK B;  1TBG A;  2H9N A;  2OVP B;  5C2W B;  1OLZ A;  3A0F A;  4LG8 A;  3DM0 A;  3I7K A;  3SMR A;  3RLM D;  2OVQ B;  3NVX A;  3F3F A;  4X3E A;  3EI1 B;  5THA A;  1VYH C;  1MG3 A;  2P9N C;  4J79 A;  4JXM A;  2P9L C;  2B5N A;  4N14 A;  2PM9 A;  2B5M A;  3JZH A;  4FA4 D;  3C9C A;  3DWL C;  4J82 A;  2H6N A;  2H68 A;  2PBI B;  2IWK A;  4QQE A;  4MK0 B;  4JD2 C; 
#chains in the Genus database with same CATH topology
 4JSV C;  4CY5 A;  5IGO A;  3KRX B;  3GC3 B;  3MZK A;  3UR4 A;  3ZE2 A;  2AGL A;  4K3I D;  4BL0 A;  2HES X;  4JT5 C;  3JRP A;  2IUV A;  3EI1 A;  1K32 A;  4E54 B;  4D6V A;  4A0A B;  1PBY B;  2XDW A;  4MMY A;  5AJA A;  3SLE D;  4Z7N A;  1NR0 A;  2QR5 A;  1N6D A;  3SN6 B;  1H2X A;  2OK6 A;  2YMU A;  4G1M A;  3BG1 A;  2AGX A;  3MMY A;  3SXT D;  5EAL A;  5CXB A;  4E5Z B;  3N0D A;  3EQ7 A;  4ZOV A;  1K8K C;  5EM2 A;  2YNO A;  5CYK A;  5IGQ A;  5FFO A;  4H5I A;  4ZN4 A;  4U7A A;  4PNK B;  4QRJ A;  5TEE A;  1SQ9 A;  5AMS A;  3PXT D;  2TRC B;  5FA5 B;  3SFZ A;  4EWR A;  3AH8 B;  4PBZ A;  5E6R A;  2AGY A;  4OZU A;  4E54 A;  3O4H A;  3IIW A;  3UVM A;  1XHM A;  5AFU 3;  3PXS D;  1B9Y A;  3EI2 B;  3F3G A;  4O2W A;  1C9I A;  5EAP A;  2UZY B;  3DXM C;  2O9K A;  1JTD B;  3ODT A;  5CXB B;  5FFG A;  4E5Z A;  2AH0 A;  3GRE A;  2IWF A;  2J57 G;  4A08 A;  3RMZ D;  1VE7 A;  2BCJ B;  4MMZ A;  4ZOZ A;  2YNN A;  4J0X A;  4HDJ A;  3DDU A;  5M5V A;  4L3G D;  2QC5 A;  4D0K A;  4FA9 D;  5GMK n;  4A0A A;  4CY2 A;  2QXV A;  3K6S A;  2G9A A;  3EQ8 A;  3T3P A;  2GC7 A;  2IAA A;  2BKL A;  4G55 A;  4OWR A;  2VZ3 A;  2PM7 B;  5JWZ A;  4MMX A;  4J81 A;  4JSP C;  1UOQ A;  1GOG A;  3SBQ A;  2H6Q A;  4O9D A;  1PGU A;  2GC4 A;  4X63 B;  4CI8 A;  3DSM A;  5I5J A;  5TF2 A;  1UOO A;  4CI3 A;  3MVD K;  1GG2 B;  2CNX A;  2B5L A;  4J78 A;  4CI1 A;  5GXH A;  2XYI A;  3JZN A;  4QAM A;  1U2V C;  2CN3 A;  4WK2 A;  5IT9 g;  2VDM A;  2VDK A;  3DXK C;  3OKY B;  3NVN A;  3UKR C;  4ESG A;  3J80 g;  4GGD A;  5FQD A;  2I0T A;  1XKS A;  2J55 H;  4Z7Q A;  2HJB A;  4UM8 A;  2GNQ A;  4I79 A;  4ZOX A;  4A09 A;  4AEZ A;  4NC4 A;  2CN2 A;  3AL9 A;  3RSE C;  3V4V A;  4FWW A;  1K3I A;  4H5J A;  3OW8 A;  3V9F A;  2CE9 A;  4Z7O A;  3AL8 B;  3I8C A;  2I0R A;  2P9K C;  2HU5 A;  2HJ4 A;  3SBR A;  3UVL A;  5M5U A;  2QZP A;  2H6K A;  3FCS A;  3EG6 A;  5M5T A;  1L5G A;  3OKT A;  2H14 A;  4O02 A;  4L3H D;  2P9I C;  4L1Q D;  3ZE1 A;  5FLX g;  4BCC A;  1SQJ A;  1QNI A;  1PEV A;  3V7D B;  1A12 A;  2JKX A;  4LGN A;  4WK0 A;  2VDQ A;  4A0B B;  3ZWL B;  1QFS A;  3IUM A;  1E8M A;  5HDB A;  3O4G A;  5EML B;  4FAN D;  3EMH A;  3SWS D;  3OL2 B;  2AGZ A;  4A2M A;  1SHY B;  5M5S A;  3PE7 A;  3BG0 A;  5I5I A;  4GQ1 A;  3SVW D;  3I8E A;  5K1C C;  3ZE0 A;  2H9M A;  4GM9 A;  3VGZ A;  2H47 A;  3KCI A;  3E0C A;  4O45 A;  3J81 g;  2IUQ A;  4J84 A;  3VI4 A;  4PC0 A;  4J8B A;  4XEI C;  3OKY A;  4ES0 A;  3IJ0 A;  5EM2 B;  2XU7 A;  3AL8 A;  2I3S A;  4O3U B;  1XIP A;  1TYQ C;  1YR2 A;  4NAA A;  3I7H A;  4QT8 A;  2W18 A;  4NEN A;  3MZL A;  2PM6 B;  3F3P A;  1UTC A;  5C2V B;  4J0W A;  3MXX A;  1NEX B;  5H14 A;  4AN1 A;  3EI2 A;  3K72 A;  2XL2 A;  2YB8 B;  1BPO A;  4UM9 A;  4PBY A;  1E5T A;  3W15 A;  4ERZ A;  2HKR A;  2VDR A;  1T2X A;  1VZ2 A;  3MKS B;  4BH6 A;  1GXR A;  5HE3 B;  4XYH A;  3ULE C;  3KRW B;  3JZG A;  4QL1 A;  3JAM g;  5IC7 A;  4L9O A;  2WQ8 A;  3AFC A;  3C99 A;  3PXW D;  3VI3 A;  4CZV A;  1U4C A;  4G56 B;  3RN1 D;  3O4I A;  3B7F A;  1H2W A;  5SXM A;  2VZ1 A;  4BP8 A;  1GOF A;  3IUR A;  5FKQ A;  4A11 A;  3FM0 A;  5HE2 B;  3N0E A;  2G99 A;  1VZ3 A;  5CYK B;  4RE5 A;  4IRZ A;  4PSX B;  2I0S A;  3MKQ A;  3K71 A;  3OF7 A;  1JJU B;  4A2L A;  3VA6 A;  4CC9 A;  1N6F A;  5CXC B;  3RFH A;  1C9L A;  2VDP A;  4BCB A;  3NVQ A;  3I7P A;  4ERY A;  5EMJ B;  5HYN B;  2EID A;  2EIE A;  5HQG A;  4Y7R A;  1QFM A;  4KFM B;  4J87 A;  2OJY A;  5FKR A;  5TEF A;  1U8C A;  2IUR A;  3U4Y A;  4J8G A;  4JHP C;  3JRO A;  3CFV A;  2HYE A;  2AQ5 A;  2XZG A;  3FRX A;  4CY3 A;  3HFQ A;  3GFC A;  3P4F A;  2EIC A;  4R7A B;  3I7O A;  3PSL A;  3RN0 D;  4GZ8 A;  5GSA A;  2Q7Q A;  4J77 A;  2H13 A;  1JMZ B;  1JMX B;  3PVW B;  5HE1 B;  3RRM C;  4GQB B;  5FKS A;  1GP2 B;  2OK4 A;  4JHN A;  4U1E I;  5IJ7 E;  2BBK H;  2J56 H;  4AMY A;  4NSX A;  2H9P A;  4ERQ A;  4K3J B;  3K27 A;  4FA5 D;  3L4O D;  1O6F A;  5E6S A;  3I2N A;  3OTT A;  2CO0 C;  2XL3 A;  2B4E A;  2AGW A;  5FXY A;  1A0R B;  2I3T A;  4GGA A;  3JPX A;  1B9X A;  3PVU B;  1JOF A;  2Z2O A;  5H17 A;  3C75 H;  2Z2N A;  1L0Q A;  4DNV A;  2OVR B;  4JSX C;  2HKM A;  1N6E A;  2OIZ A;  3NID A;  4GGC A;  4J73 A;  3PSC B;  1R5M A;  3C5M A;  4CZY A;  1RI6 A;  2CE8 A;  5B4W A;  1MG2 A;  1H2Z A;  2HXC A;  4JSN C;  3SBP A;  3I89 A;  1E8N A;  4A08 B;  3K26 A;  3SJL D;  3V5W B;  5CXC A;  5C9Z B;  2UZX B;  4RE6 A;  1O6G A;  2H3X A;  4A7J A;  4CI2 A;  5A2Q g;  2HU8 A;  4AMZ A;  3V4P A;  2YBA A;  3QI0 A;  5FKT A;  5K19 A;  3EI4 B;  3FCU A;  4PXW A;  5M5R A;  1GOT B;  3ORV D;  3I7L A;  4A11 B;  3EU7 A;  4WJK A;  2EBS A;  4DNU A;  2PM9 B;  1ERJ A;  3OKW A;  3IJE A;  5IJ8 E;  2P9U C;  2AH1 A;  4JT6 C;  2P9P C;  5EAR A;  1JV2 A;  1H2Y A;  2XE4 A;  1GOH A;  1S4U X;  3VH0 A;  5HE0 B;  4CZX A;  4GMB A;  4BP9 A;  1OMW B;  2H9L A;  4O1Q D;  4Y5R D;  3JB9 L;  5TDH B;  2Z2P A;  1PI6 A;  3IUQ A;  4FHL A;  4IMM A;  4XYI A;  5C86 A;  4YVD A;  1FWX A;  3T3M A;  2VC2 A;  4FA1 D;  2YNP A;  4X61 B;  3EI3 B;  3RFG A;  4ZOY A;  2P9S C;  4PSW B;  3ZDZ A;  3EI3 A;  4L1M A;  3IVM A;  3L4M D;  5KDO B;  3IJ1 A;  4GM3 A;  3IKO A;  2CO0 A;  1MDA H;  4J86 A;  3UVN A;  3ZDX A;  4G1E A;  3I7N A;  3EWE A;  4O3T B;  4BCD A;  5GXI A;  5M61 A;  4IA9 A;  4FAV D;  4TZ4 A;  4X60 B;  1TYE A;  1I2M B;  4A09 B;  1YFQ A;  4AOW A;  3OL2 A;  3NIF A;  4BUJ C;  4NBM A;  3MUN A;  3EQ9 A;  3IJC A;  4CY1 A;  4AX4 A;  4D9S A;  3IIY A;  3MUO A;  1Q47 A;  3GD1 I;  4GM8 A;  4A0B A;  4Z8L A;  2MTA H;  1UOP A;  3UKU C;  3CIK B;  4UI9 R;  2VDL A;  4LG9 A;  3UVO A;  3IUN A;  3SHF A;  5EAM A;  3CFS B;  5EMM B;  2IUP A;  4FB1 D;  3UVK A;  3EI4 A;  4GQ2 P;  1P22 A;  3FGB A;  5E6U A;  5H1M A;  3BWS A;  3SCY A;  5I5M A;  5EMK B;  1TBG A;  2H9N A;  2EIB A;  3NIG A;  2OVP B;  5C2W B;  1OLZ A;  1M1X A;  3A0F A;  4LG8 A;  3DM0 A;  3I7K A;  3SMR A;  5C92 A;  3RLM D;  2OVQ B;  3NVX A;  3F3F A;  3QHY B;  3ZDY A;  3O4J A;  4X3E A;  3EI1 B;  5THA A;  4DNW A;  3IUL A;  1VYH C;  1MG3 A;  2P9N C;  4J79 A;  2HU7 A;  4JXM A;  2VDN A;  4WK4 A;  2P9L C;  2B5N A;  2VDO A;  4N14 A;  4AN0 A;  2PM9 A;  2B5M A;  3IUJ A;  3JZH A;  4FA4 D;  3C9C A;  3DWL C;  4J82 A;  2H6N A;  2H68 A;  2PBI B;  1VE6 A;  2IWK A;  4MK0 B;  4QQE A;  4JD2 C; 
#chains in the Genus database with same CATH homology
 4JSV C;  4CY5 A;  5IGO A;  3KRX B;  3MZK A;  3UR4 A;  2AGL A;  4K3I D;  4BL0 A;  2HES X;  4JT5 C;  3JRP A;  2IUV A;  3EI1 A;  1K32 A;  4E54 B;  4D6V A;  4A0A B;  1PBY B;  5AJA A;  3SLE D;  1NR0 A;  1N6D A;  3SN6 B;  2OK6 A;  2YMU A;  3BG1 A;  2AGX A;  3MMY A;  3SXT D;  5EAL A;  5CXB A;  4E5Z B;  3N0D A;  4ZOV A;  1K8K C;  5EM2 A;  2YNO A;  5CYK A;  5IGQ A;  4H5I A;  4ZN4 A;  4U7A A;  4PNK B;  4QRJ A;  5TEE A;  1SQ9 A;  5AMS A;  3PXT D;  2TRC B;  5FA5 B;  3SFZ A;  4EWR A;  3AH8 B;  4PBZ A;  2AGY A;  4OZU A;  4E54 A;  3IIW A;  3UVM A;  1XHM A;  5AFU 3;  3PXS D;  1B9Y A;  3EI2 B;  3F3G A;  5EAP A;  2UZY B;  3DXM C;  2O9K A;  3ODT A;  5CXB B;  4E5Z A;  2AH0 A;  3GRE A;  2IWF A;  2J57 G;  4A08 A;  3RMZ D;  2BCJ B;  4ZOZ A;  2YNN A;  4J0X A;  4HDJ A;  4L3G D;  2QC5 A;  4D0K A;  4FA9 D;  5GMK n;  4A0A A;  4CY2 A;  2QXV A;  2G9A A;  2GC7 A;  2IAA A;  4OWR A;  2PM7 B;  5JWZ A;  4J81 A;  4JSP C;  3SBQ A;  2H6Q A;  4O9D A;  1PGU A;  2GC4 A;  4X63 B;  4CI8 A;  3DSM A;  5I5J A;  5TF2 A;  4CI3 A;  1GG2 B;  2CNX A;  2B5L A;  4J78 A;  4CI1 A;  5GXH A;  2XYI A;  3JZN A;  1U2V C;  2CN3 A;  5IT9 g;  3DXK C;  3OKY B;  3NVN A;  3UKR C;  4ESG A;  3J80 g;  4GGD A;  5FQD A;  2I0T A;  1XKS A;  2J55 H;  2HJB A;  2GNQ A;  4I79 A;  4ZOX A;  4A09 A;  4AEZ A;  2CN2 A;  3AL9 A;  3RSE C;  4FWW A;  4H5J A;  3OW8 A;  3V9F A;  2CE9 A;  3AL8 B;  3I8C A;  2I0R A;  2P9K C;  2HJ4 A;  3SBR A;  3UVL A;  2H6K A;  3EG6 A;  3OKT A;  2H14 A;  4L3H D;  2P9I C;  4L1Q D;  5FLX g;  1SQJ A;  1QNI A;  1PEV A;  3V7D B;  4LGN A;  4A0B B;  3ZWL B;  5EML B;  4FAN D;  3EMH A;  3SWS D;  3OL2 B;  2AGZ A;  4A2M A;  1SHY B;  3PE7 A;  3BG0 A;  5I5I A;  4GQ1 A;  3SVW D;  3I8E A;  5K1C C;  2H9M A;  4GM9 A;  3VGZ A;  2H47 A;  3E0C A;  4O45 A;  3J81 g;  2IUQ A;  4J84 A;  4PC0 A;  4J8B A;  4XEI C;  3OKY A;  4ES0 A;  3IJ0 A;  5EM2 B;  2XU7 A;  3AL8 A;  2I3S A;  4O3U B;  1XIP A;  1TYQ C;  3I7H A;  4QT8 A;  2W18 A;  3MZL A;  2PM6 B;  3F3P A;  5C2V B;  4J0W A;  3MXX A;  1NEX B;  5H14 A;  3EI2 A;  2XL2 A;  2YB8 B;  4PBY A;  3W15 A;  4ERZ A;  2HKR A;  3MKS B;  4BH6 A;  1GXR A;  5HE3 B;  4XYH A;  3ULE C;  3KRW B;  3JZG A;  4QL1 A;  3JAM g;  5IC7 A;  4L9O A;  3AFC A;  3C99 A;  3PXW D;  4CZV A;  1U4C A;  4G56 B;  3RN1 D;  3B7F A;  5SXM A;  5FKQ A;  4A11 A;  3FM0 A;  5HE2 B;  3N0E A;  2G99 A;  5CYK B;  4PSX B;  2I0S A;  3MKQ A;  1JJU B;  4A2L A;  3VA6 A;  4CC9 A;  1N6F A;  5CXC B;  3RFH A;  3NVQ A;  3I7P A;  4ERY A;  5EMJ B;  5HYN B;  5HQG A;  4Y7R A;  4KFM B;  4J87 A;  2OJY A;  5FKR A;  5TEF A;  2IUR A;  3U4Y A;  4J8G A;  3JRO A;  3CFV A;  2HYE A;  2AQ5 A;  4CY3 A;  3FRX A;  3HFQ A;  3GFC A;  3P4F A;  4R7A B;  3I7O A;  3PSL A;  3RN0 D;  4GZ8 A;  5GSA A;  2Q7Q A;  4J77 A;  2H13 A;  1JMZ B;  1JMX B;  3PVW B;  5HE1 B;  3RRM C;  4GQB B;  5FKS A;  1GP2 B;  2OK4 A;  4U1E I;  5IJ7 E;  2BBK H;  2J56 H;  4NSX A;  2H9P A;  4ERQ A;  4K3J B;  3K27 A;  4FA5 D;  3L4O D;  3I2N A;  3OTT A;  2CO0 C;  2XL3 A;  2B4E A;  2AGW A;  5FXY A;  1A0R B;  2I3T A;  4GGA A;  3JPX A;  1B9X A;  3PVU B;  1JOF A;  2Z2O A;  5H17 A;  3C75 H;  2Z2N A;  1L0Q A;  2OVR B;  4JSX C;  2HKM A;  1N6E A;  2OIZ A;  4GGC A;  4J73 A;  3PSC B;  1R5M A;  3C5M A;  4CZY A;  1RI6 A;  2CE8 A;  5B4W A;  1MG2 A;  2HXC A;  4JSN C;  3SBP A;  3I89 A;  4A08 B;  3K26 A;  3SJL D;  3V5W B;  5CXC A;  5C9Z B;  2UZX B;  2H3X A;  4CI2 A;  4A7J A;  5A2Q g;  2YBA A;  5K19 A;  5FKT A;  3EI4 B;  4PXW A;  1GOT B;  3ORV D;  3I7L A;  4A11 B;  3EU7 A;  2EBS A;  2PM9 B;  1ERJ A;  3OKW A;  5IJ8 E;  2P9U C;  2AH1 A;  4JT6 C;  2P9P C;  5EAR A;  1S4U X;  3VH0 A;  5HE0 B;  4CZX A;  4GMB A;  1OMW B;  2H9L A;  4O1Q D;  4Y5R D;  3JB9 L;  5TDH B;  2Z2P A;  1PI6 A;  4IMM A;  4FHL A;  4XYI A;  4YVD A;  1FWX A;  4FA1 D;  2YNP A;  4X61 B;  3EI3 B;  3RFG A;  4ZOY A;  2P9S C;  4PSW B;  3EI3 A;  3L4M D;  5KDO B;  3IJ1 A;  4GM3 A;  3IKO A;  2CO0 A;  1MDA H;  4J86 A;  3UVN A;  3I7N A;  3EWE A;  4O3T B;  5GXI A;  4IA9 A;  4FAV D;  4TZ4 A;  4X60 B;  4A09 B;  1YFQ A;  4AOW A;  3OL2 A;  4BUJ C;  3IJC A;  4CY1 A;  3IIY A;  1Q47 A;  4GM8 A;  4A0B A;  4Z8L A;  2MTA H;  3UKU C;  3CIK B;  4UI9 R;  4LG9 A;  3UVO A;  3SHF A;  5EAM A;  3CFS B;  5EMM B;  2IUP A;  4FB1 D;  3UVK A;  3EI4 A;  4GQ2 P;  1P22 A;  3FGB A;  5H1M A;  3BWS A;  3SCY A;  5I5M A;  5EMK B;  1TBG A;  2H9N A;  2OVP B;  5C2W B;  1OLZ A;  3A0F A;  4LG8 A;  3DM0 A;  3I7K A;  3SMR A;  3RLM D;  2OVQ B;  3NVX A;  3F3F A;  4X3E A;  3EI1 B;  5THA A;  1VYH C;  1MG3 A;  2P9N C;  4J79 A;  4JXM A;  2P9L C;  2B5N A;  4N14 A;  2PM9 A;  2B5M A;  3JZH A;  4FA4 D;  3C9C A;  3DWL C;  4J82 A;  2H6N A;  2H68 A;  2PBI B;  2IWK A;  4QQE A;  4MK0 B;  4JD2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...