5EALA

Crystal structure of human wdr5 in complex with compound 9h
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title Crystal structure of human WDR5 in complex with compound 9h
rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
total genus 102
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5ealA00
2P9LC 3DXKC 4BUJC 4CZXA 4J0XA 3OKYB 4QL1A 4G56B 4Y5RD 4L3GD 5K1CC 4ZOZA 4O3TB 2O9KA 2XL3A 2HYEA 3OL2A 5FKQA 5AJAA 5EMJB 5HYNB 4D6VA 5HE3B 1P22A 3EI4A 2QC5A 2GC4A 5H17A 4AEZA 4FA4D 4J73A 3SFZA 3SBQA 1PGUA 2P9UC 2MTAH 2AGLA 4GMBA 4OZUA 4CI1A 2IUPA 3PXTD 4JXMA 4A2MA 2H9LA 2I0SA 1RI6A 3N0EA 4CZVA 4GGDA 1B9XA 5FA5B 2CN2A 2H6NA 3RN1D 3GREA 3B7FA 3UR4A 2CNXA 3V7DB 3SMRA 2P9PC 3JROA 4LGNA 4ZN4A 4FA5D 4O9DA 5I5JA 3SWSD 4Y7RA 4QQEA 3JZNA 3EG6A 3OW8A 3MKSB 3KRXB 4ERZA 4X60B 1U2VC 2H3XA 2OVQB 4N14A 5HE2B 3PSCB 5CXBA 3AL9A 2IURA 2QXVA 1GP2B 5HQGA 4ERQA 3SCYA 5GSAA 3ORVD 4H5IA 3W15A 2P9SC 4XYIA 3I7HA 3VH0A 5TEFA 4O1QD 2AGYA 4FB1D 4QRJA 3J81g 4ZOYA 4O3UB 4J79A 4I79A 2AQ5A 4L1QD 1TYQC 3JRPA 2J56H 4X63B 5IJ7E 2H6QA 2H9NA 4FAVD 3EWEA 4UI9R 1QNIA 3IJCA 2I0RA 4KFMB 4NSXA 4PC0A 1XKSA 2H9PA 4A0BA 1MDAH 4GQBB 2BCJB 3OL2B 3EU7A 1S4UX 4EWRA 3SN6B 1JOFA 3EI3A 1VYHC 2YBAA 3EI4B 2YNOA 5HE1B 3UVLA 4Z8LA 4JSNC 3U4YA 3JZHA 3I7PA 3ODTA 5A2Qg 4IMMA 3FRXA 4O45A 2YMUA 3V9FA 2YNNA 5C2VB 2J57G 4GZ8A 5FKSA 1A0RB 3C9CA 4ES0A 4ZOVA 3UKUC 1XHMA 4IA9A 4E54A 4R7AB 3AL8A 3HFQA 3VGZA 3DM0A 3JAMg 4CY5A 2IUQA 3I89A 2PM6B 2H14A 3PVUB 4K3ID 4GGAA 5CXBB 3I7OA 5CYKA 3I8EA 3MMYA 4H5JA 4MK0B 4CZYA 1TBGA 5GXHA 4YVDA 3J80g 3N0DA 5HE0B 1U4CA 3AFCA 3UVKA 1PEVA 4HDJA 4A0AA 4LG9A 1YFQA 1N6DA 3UVNA 2Z2NA 2Q7QA 4A7JA 2YNPA 3PXWD 4J8BA 1GXRA 3SJLD 3SLED 3IIWA 3ULEC 3EI2A 2HKMA 5CXCA 4GM3A 4A0BB 1PI6A 2H6KA 2P9NC 2H68A 3RN0D 4BL0A 4PBYA 2OVPB 3L4OD 5EARA 5FLXg 3EI3B 3BG0A 4A2LA 3OTTA 4XEIC 3K27A 2CO0C 3SBPA 2J55H 3AH8B 1N6FA 4TZ4A 1JJUB 5IGQA 4JSPC 2AGWA 4FA1D 4E5ZA 2AGXA 3OKWA 1L0QA 3K26A 5GXIA 2OJYA 4GM9A 3DWLC 5FXYA 4A08A 2P9IC 3FGBA 5EMLB 3SHFA 3EI1A 1SHYB 4J8GA 3I7LA 2Z2PA 3NVXA 4A09A 3DSMA 2Z2OA 4E54B 3IKOA 2OIZA 5EAPA 2H47A 1OMWB 2CE8A 4JT5C 1K8KC 2PBIB 3AL8B 3JPXA 3F3GA 3RLMD 3NVQA 4J82A 1MG3A 3MZLA 5CYKB 3L4MD 2AH0A 4FHLA 2IWKA 1K32A 3RMZD 3RRMC 3I7KA 4BH6A 4GQ1A 4L9OA 4CY1A 2OK6A 4CI2A 4OWRA 4A0AB 5C9ZB 4GQ2P 1SQ9A 3RSEC 3ZWLB 4CI8A 1Q47A 2PM9A 4FAND 3SXTD 2XYIA 4A11A 4J86A 3SVWD 5IC7A 3EI2B 5FKTA 4J87A 5IT9g 3MXXA 5CXCB 4CI3A 4LG8A 2HXCA 2OK4A 5EM2A 1NEXB 3JB9L 5I5IA 3MKQA 3UVMA 1JMZB 2I3SA 5FKRA 4U7AA 2EBSA 2W18A 4FWWA 3F3PA 5TF2A 3OKTA 4JD2C 5IGOA 1NR0A 1SQJA 5THAA 4CY2A 1N6EA 3MZKA 4E5ZB 2CN3A 3EMHA 3C99A 1B9YA 2I0TA 1GG2B 5TEEA 5C2WB 4A08B 3I2NA 3EI1B 2B5LA 4JSVC 4ESGA 2IWFA 5IJ8E 3OKYA 4A09B 2OVRB 4ZOXA 2B5MA 3NVNA 4JT6C 3FM0A 4GGCA 1XIPA 4J0WA 4GM8A 5SXMA 2XU7A 3UKRC 2IAAA 5TDHB 3CFVA 3PVWB 3I8CA 2GC7A 1PBYB 1GOTB 3GFCA 2H9MA 3C5MA 2G99A 2HKRA 3PE7A 5EMMB 4PBZA 3RFGA 2H13A 2B4EA 3V5WB 1ERJA 2GNQA 2G9AA 3BG1A 1OLZA 2TRCB 4JSXC 3IJ1A 2CE9A 5GMKn 3CFSB 3CIKB 2YB8B 4D0KA 2PM9B 4J84A 3UVOA 2IUVA 3JZGA 3VA6A 4X3EA 4QT8A 4PSWB 4A11B 4FA9D 3E0CA 3IIYA 1R5MA 2XL2A 5K19A 5H14A 4XYHA 3P4FA 5I5MA 3C75H 4ERYA 4J78A 3I7NA 5EM2B 4CC9A 5B4WA 2CO0A 4K3JB 3KRWB 3PSLA 3SBRA 2BBKH 2HJ4A 5KDOB 5EALA 2P9KC 2B5NA 3IJ0A 4PSXB 4U1EI 3BWSA 2UZYB 3PXSD 4J77A 5AMSA 4J81A 2HJBA 3RFHA 2AH1A 4X61B 1FWXA 5H1MA 3DXMC 2AGZA 2I3TA 2PM7B 5FQDA 5JWZA 4PNKB 5EAMA 1JMXB 2UZXB 3F3FA 4CY3A 2HESX 4L3HD 5EMKB 5AFU3 3A0FA 1MG2A 4PXWA 4AOWA
chains in the Genus database with same CATH superfamily
2P9LC 3DXKC 4BUJC 4CZXA 2EIDA 3OKYB 4J0XA 4QL1A 4G56B 4Y5RD 3NIFA 1UOQA 4L3GD 5K1CC 4ZOZA 4BP8A 4O3TB 3K71A 1H2XA 2O9KA 2XL3A 5M5RA 2HYEA 3OL2A 5FKQA 5AJAA 5EMJB 5HYNB 1L5GA 4D6VA 2VDMA 5HE3B 1P22A 3EI4A 2QC5A 2GC4A 5H17A 1C9LA 4AEZA 4FA4D 4J73A 3SFZA 3SBQA 1PGUA 2P9UC 2MTAH 1H2ZA 2AGLA 4GMBA 4OZUA 4CI1A 2IUPA 3PXTD 4JXMA 4A2MA 3EQ7A 2H9LA 2I0SA 1I2MB 1RI6A 3N0EA 4CZVA 5FFOA 4GGDA 1B9XA 4AMYA 4AN1A 5FA5B 2CN2A 2H6NA 3GD1I 3RN1D 3GREA 3B7FA 5M5VA 3UR4A 2CNXA 4MMYA 1GOFA 3V7DB 3SMRA 2P9PC 3JROA 4LGNA 4ZN4A 1UOOA 4G1MA 1K3IA 4FA5D 4O9DA 5I5JA 1E8MA 3SWSD 4Y7RA 5HDBA 4NAAA 4QQEA 3JZNA 3EG6A 3OW8A 3MKSB 3KRXB 4ERZA 4X60B 1U2VC 2H3XA 2OVQB 4N14A 2VZ3A 5HE2B 4BCCA 3PSCB 5CXBA 3AL9A 2IURA 2QXVA 1GP2B 5HQGA 4ERQA 3IULA 3SCYA 5GSAA 3ORVD 1E5TA 4H5IA 3W15A 2P9SC 4XYIA 5M5UA 3I7HA 3VH0A 5TEFA 4O1QD 2AGYA 4FB1D 3DDUA 4QRJA 4QAMA 3J81g 4ZOYA 4O3UB 4J79A 2EIEA 4I79A 2HU5A 3O4GA 2AQ5A 4L1QD 1TYQC 3JRPA 2J56H 4X63B 3NIDA 1VZ2A 5IJ7E 4WJKA 2H6QA 2H9NA 4FAVD 3EWEA 4UI9R 1QNIA 3IJCA 2I0RA 4KFMB 4NSXA 4PC0A 1XKSA 2JKXA 2H9PA 5FFGA 4A0BA 1UOPA 1MDAH 4GQBB 2BCJB 4DNWA 3OL2B 4NBMA 3ZDZA 3EU7A 1S4UX 4MMXA 4EWRA 3SN6B 1JOFA 3EI3A 1VYHC 2YBAA 3EI4B 2YNOA 2XE4A 5HE1B 3UVLA 4Z8LA 4JSNC 3U4YA 3JZHA 3I7PA 4WK0A 3ODTA 5A2Qg 2HU8A 4IMMA 3FRXA 4O45A 4BCBA 2YMUA 3V9FA 2YNNA 5C2VB 2J57G 4GZ8A 5FKSA 1UTCA 1A0RB 3C9CA 4ES0A 4ZOVA 1QFSA 3UKUC 4AX4A 3O4IA 1XHMA 3IVMA 4IA9A 4E54A 4R7AB 5M5SA 1QFMA 3AL8A 3HFQA 1VE6A 3VGZA 3DM0A 3JAMg 3V4VA 4CY5A 3IUQA 2IUQA 3I89A 2PM6B 2H14A 3PVUB 4K3ID 4GGAA 5CXBB 2EIBA 5E6UA 2HU7A 3I7OA 5CYKA 3I8EA 3MMYA 4H5JA 4MK0B 4CZYA 2VDPA 1TBGA 5GXHA 4YVDA 3J80g 3N0DA 5HE0B 1U4CA 3O4JA 3AFCA 3UVKA 1PEVA 4HDJA 4A0AA 4LG9A 1YFQA 3EQ9A 1N6DA 3UVNA 2Z2NA 2Q7QA 4A7JA 2VDLA 2YNPA 4IRZA 3PXWD 4J8BA 1GXRA 1M1XA 3SJLD 4Z7OA 3SLED 3IIWA 4G55A 3ULEC 5C86A 3EI2A 2HKMA 5CXCA 4O02A 4GM3A 4A0BB 1PI6A 2H6KA 2P9NC 2H68A 3RN0D 3VI4A 4MMZA 4BL0A 4PBYA 2OVPB 3L4OD 5EARA 5FLXg 2QR5A 3EI3B 3EQ8A 2VDQA 1JV2A 3BG0A 4A2LA 3OTTA 4XEIC 4AN0A 3K27A 2CO0C 3SBPA 2J55H 4NC4A 3AH8B 1N6FA 4TZ4A 4RE6A 5E6SA 1JJUB 5IGQA 4JSPC 2AGWA 4FA1D 4E5ZA 2AGXA 3OKWA 1L0QA 3K26A 5GXIA 2OJYA 4GM9A 3DWLC 5FXYA 5M61A 4A08A 2P9IC 3FGBA 5EMLB 3SHFA 3EI1A 1SHYB 2VC2A 4J8GA 3GC3B 1VE7A 3I7LA 2Z2PA 5C92A 3NVXA 4A09A 3DSMA 2Z2OA 4E54B 3IKOA 2OIZA 3T3MA 1A12A 2H47A 5EAPA 1OMWB 2CE8A 4JT5C 1K8KC 1C9IA 2PBIB 3AL8B 1H2YA 3QHYB 3JPXA 3F3GA 3RLMD 3IJEA 3FCUA 3MUNA 3NVQA 4J82A 1MG3A 3MZLA 5CYKB 3L4MD 2AH0A 4FHLA 2IWKA 1K32A 3RMZD 2VDRA 3I7KA 3RRMC 4BH6A 1U8CA 5E6RA 1TYEA 4WK4A 4GQ1A 4L9OA 4CY1A 2OK6A 4CI2A 4OWRA 4A0AB 3FCSA 4UM8A 1O6GA 5C9ZB 4GQ2P 1SQ9A 3RSEC 3ZWLB 4CI8A 1Q47A 1O6FA 2PM9A 4FAND 2XZGA 3SXTD 3MVDK 2XYIA 3V4PA 4A11A 3IUMA 4J86A 3SVWD 5IC7A 3EI2B 5FKTA 4J87A 2VDOA 5IT9g 4DNUA 3VI3A 3MXXA 5CXCB 4CI3A 1H2WA 3IUNA 4LG8A 2HXCA 4NENA 2OK4A 5EM2A 1NEXB 4WK2A 4Z7NA 3JB9L 5I5IA 3MKQA 2VZ1A 3UVMA 1JMZB 2I3SA 5FKRA 4U7AA 4Z7QA 2EBSA 2W18A 4FWWA 3F3PA 5TF2A 3K6SA 3OKTA 4JD2C 3IURA 5IGOA 1NR0A 5M5TA 1SQJA 5THAA 4JHNA 4CY2A 1N6EA 3MZKA 4E5ZB 2CN3A 3EMHA 3C99A 1B9YA 2I0TA 1GG2B 5TEEA 5C2WB 4A08B 3ZE0A 3I2NA 4L1MA 1GOHA 3EI1B 2B5LA 2EICA 4UM9A 4JSVC 4ESGA 2IWFA 5IJ8E 3OKYA 4A09B 2OVRB 4ZOXA 3T3PA 2B5MA 3NVNA 4JT6C 3FM0A 4GGCA 1XIPA 3O4HA 4J0WA 4GM8A 5SXMA 2XDWA 2XU7A 3UKRC 2IAAA 5TDHB 3CFVA 4JHPC 3PVWB 3I8CA 2GC7A 1PBYB 1GOTB 3GFCA 3OF7A 2H9MA 3C5MA 2G99A 2HKRA 1BPOA 3PE7A 5EMMB 4PBZA 3RFGA 2H13A 1GOGA 2B4EA 3MUOA 3V5WB 1ERJA 1VZ3A 3KCIA 4BCDA 2GNQA 1YR2A 2G9AA 1OLZA 2TRCB 3BG1A 4JSXC 3IJ1A 2CE9A 5GMKn 3NIGA 3ZDXA 2QZPA 3CFSB 2YB8B 3CIKB 4D0KA 2PM9B 4J84A 3UVOA 3ZE1A 2IUVA 3JZGA 3VA6A 4X3EA 4QT8A 4PSWB 4A11B 4FA9D 3E0CA 3IIYA 1R5MA 2XL2A 5K19A 3QI0A 5H14A 4XYHA 1JTDB 4D9SA 3P4FA 5I5MA 3C75H 4ERYA 4J78A 3I7NA 3IUJA 3ZDYA 2WQ8A 5EM2B 4RE5A 4CC9A 5B4WA 2CO0A 4K3JB 3KRWB 3PSLA 3SBRA 2BBKH 2HJ4A 3ZE2A 5KDOB 1T2XA 5EALA 2P9KC 2B5NA 3IJ0A 4PSXB 4U1EI 3BWSA 4DNVA 2UZYB 3PXSD 4J77A 5AMSA 4J81A 2HJBA 3RFHA 2AH1A 4X61B 4AMZA 1FWXA 2VDKA 5H1MA 3DXMC 2AGZA 2I3TA 2PM7B 5FQDA 2BKLA 5JWZA 4PNKB 5EAMA 1JMXB 2UZXB 3F3FA 3K72A 2HESX 4L3HD 5EMKB 4CY3A 4G1EA 5AFU3 3A0FA 2VDNA 1MG2A 4PXWA 4AOWA 4O2WA 1E8NA 4BP9A
chains in the Genus database with same CATH topology
2P9LC 3DXKC 4BUJC 4CZXA 4J0XA 3OKYB 4QL1A 4G56B 4Y5RD 4L3GD 5K1CC 4ZOZA 4O3TB 2O9KA 2XL3A 2HYEA 3OL2A 5FKQA 5AJAA 5EMJB 5HYNB 4D6VA 5HE3B 1P22A 3EI4A 2QC5A 2GC4A 5H17A 4AEZA 4FA4D 4J73A 3SFZA 3SBQA 1PGUA 2P9UC 2MTAH 2AGLA 4GMBA 4OZUA 4CI1A 2IUPA 3PXTD 4JXMA 4A2MA 2H9LA 2I0SA 1RI6A 3N0EA 4CZVA 4GGDA 1B9XA 5FA5B 2CN2A 2H6NA 3RN1D 3GREA 3B7FA 3UR4A 2CNXA 3V7DB 3SMRA 2P9PC 3JROA 4LGNA 4ZN4A 4FA5D 4O9DA 5I5JA 3SWSD 4Y7RA 4QQEA 3JZNA 3EG6A 3OW8A 3MKSB 3KRXB 4ERZA 4X60B 1U2VC 2H3XA 2OVQB 4N14A 5HE2B 3PSCB 5CXBA 3AL9A 2IURA 2QXVA 1GP2B 5HQGA 4ERQA 3SCYA 5GSAA 3ORVD 4H5IA 3W15A 2P9SC 4XYIA 3I7HA 3VH0A 5TEFA 4O1QD 2AGYA 4FB1D 4QRJA 3J81g 4ZOYA 4O3UB 4J79A 4I79A 2AQ5A 4L1QD 1TYQC 3JRPA 2J56H 4X63B 5IJ7E 2H6QA 2H9NA 4FAVD 3EWEA 4UI9R 1QNIA 3IJCA 2I0RA 4KFMB 4NSXA 4PC0A 1XKSA 2H9PA 4A0BA 1MDAH 4GQBB 2BCJB 3OL2B 3EU7A 1S4UX 4EWRA 3SN6B 1JOFA 3EI3A 1VYHC 2YBAA 3EI4B 2YNOA 5HE1B 3UVLA 4Z8LA 4JSNC 3U4YA 3JZHA 3I7PA 3ODTA 5A2Qg 4IMMA 3FRXA 4O45A 2YMUA 3V9FA 2YNNA 5C2VB 2J57G 4GZ8A 5FKSA 1A0RB 3C9CA 4ES0A 4ZOVA 3UKUC 1XHMA 4IA9A 4E54A 4R7AB 3AL8A 3HFQA 3VGZA 3DM0A 3JAMg 4CY5A 2IUQA 3I89A 2PM6B 2H14A 3PVUB 4K3ID 4GGAA 5CXBB 3I7OA 5CYKA 3I8EA 3MMYA 4H5JA 4MK0B 4CZYA 1TBGA 5GXHA 4YVDA 3J80g 3N0DA 5HE0B 1U4CA 3AFCA 3UVKA 1PEVA 4HDJA 4A0AA 4LG9A 1YFQA 1N6DA 3UVNA 2Z2NA 2Q7QA 4A7JA 2YNPA 3PXWD 4J8BA 1GXRA 3SJLD 3SLED 3IIWA 3ULEC 3EI2A 2HKMA 5CXCA 4GM3A 4A0BB 1PI6A 2H6KA 2P9NC 2H68A 3RN0D 4BL0A 4PBYA 2OVPB 3L4OD 5EARA 5FLXg 3EI3B 3BG0A 4A2LA 3OTTA 4XEIC 3K27A 2CO0C 3SBPA 2J55H 3AH8B 1N6FA 4TZ4A 1JJUB 5IGQA 4JSPC 2AGWA 4FA1D 4E5ZA 2AGXA 3OKWA 1L0QA 3K26A 5GXIA 2OJYA 4GM9A 3DWLC 5FXYA 4A08A 2P9IC 3FGBA 5EMLB 3SHFA 3EI1A 1SHYB 4J8GA 3I7LA 2Z2PA 3NVXA 4A09A 3DSMA 2Z2OA 4E54B 3IKOA 2OIZA 5EAPA 2H47A 1OMWB 2CE8A 4JT5C 1K8KC 2PBIB 3AL8B 3JPXA 3F3GA 3RLMD 3NVQA 4J82A 1MG3A 3MZLA 5CYKB 3L4MD 2AH0A 4FHLA 2IWKA 1K32A 3RMZD 3RRMC 3I7KA 4BH6A 4GQ1A 4L9OA 4CY1A 2OK6A 4CI2A 4OWRA 4A0AB 5C9ZB 4GQ2P 1SQ9A 3RSEC 3ZWLB 4CI8A 1Q47A 2PM9A 4FAND 3SXTD 2XYIA 4A11A 4J86A 3SVWD 5IC7A 3EI2B 5FKTA 4J87A 5IT9g 3MXXA 5CXCB 4CI3A 4LG8A 2HXCA 2OK4A 5EM2A 1NEXB 3JB9L 5I5IA 3MKQA 3UVMA 1JMZB 2I3SA 5FKRA 4U7AA 2EBSA 2W18A 4FWWA 3F3PA 5TF2A 3OKTA 4JD2C 5IGOA 1NR0A 1SQJA 5THAA 4CY2A 1N6EA 3MZKA 4E5ZB 2CN3A 3EMHA 3C99A 1B9YA 2I0TA 1GG2B 5TEEA 5C2WB 4A08B 3I2NA 3EI1B 2B5LA 4JSVC 4ESGA 2IWFA 5IJ8E 3OKYA 4A09B 2OVRB 4ZOXA 2B5MA 3NVNA 4JT6C 3FM0A 4GGCA 1XIPA 4J0WA 4GM8A 5SXMA 2XU7A 3UKRC 2IAAA 5TDHB 3CFVA 3PVWB 3I8CA 2GC7A 1PBYB 1GOTB 3GFCA 2H9MA 3C5MA 2G99A 2HKRA 3PE7A 5EMMB 4PBZA 3RFGA 2H13A 2B4EA 3V5WB 1ERJA 2GNQA 2G9AA 3BG1A 1OLZA 2TRCB 4JSXC 3IJ1A 2CE9A 5GMKn 3CFSB 3CIKB 2YB8B 4D0KA 2PM9B 4J84A 3UVOA 2IUVA 3JZGA 3VA6A 4X3EA 4QT8A 4PSWB 4A11B 4FA9D 3E0CA 3IIYA 1R5MA 2XL2A 5K19A 5H14A 4XYHA 3P4FA 5I5MA 3C75H 4ERYA 4J78A 3I7NA 5EM2B 4CC9A 5B4WA 2CO0A 4K3JB 3KRWB 3PSLA 3SBRA 2BBKH 2HJ4A 5KDOB 5EALA 2P9KC 2B5NA 3IJ0A 4PSXB 4U1EI 3BWSA 2UZYB 3PXSD 4J77A 5AMSA 4J81A 2HJBA 3RFHA 2AH1A 4X61B 1FWXA 5H1MA 3DXMC 2AGZA 2I3TA 2PM7B 5FQDA 5JWZA 4PNKB 5EAMA 1JMXB 2UZXB 3F3FA 4CY3A 2HESX 4L3HD 5EMKB 5AFU3 3A0FA 1MG2A 4PXWA 4AOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9L C;  3DXK C;  4BUJ C;  4CZX A;  4J0X A;  3OKY B;  4QL1 A;  4G56 B;  4Y5R D;  4L3G D;  5K1C C;  4ZOZ A;  4O3T B;  2O9K A;  2XL3 A;  2HYE A;  3OL2 A;  5FKQ A;  5AJA A;  5EMJ B;  5HYN B;  4D6V A;  5HE3 B;  1P22 A;  3EI4 A;  2QC5 A;  2GC4 A;  5H17 A;  4AEZ A;  4FA4 D;  4J73 A;  3SFZ A;  3SBQ A;  1PGU A;  2P9U C;  2MTA H;  2AGL A;  4GMB A;  4OZU A;  4CI1 A;  2IUP A;  3PXT D;  4JXM A;  4A2M A;  2H9L A;  2I0S A;  1RI6 A;  3N0E A;  4CZV A;  4GGD A;  1B9X A;  5FA5 B;  2CN2 A;  2H6N A;  3RN1 D;  3GRE A;  3B7F A;  3UR4 A;  2CNX A;  3V7D B;  3SMR A;  2P9P C;  3JRO A;  4LGN A;  4ZN4 A;  4FA5 D;  4O9D A;  5I5J A;  3SWS D;  4Y7R A;  4QQE A;  3JZN A;  3EG6 A;  3OW8 A;  3MKS B;  3KRX B;  4ERZ A;  4X60 B;  1U2V C;  2H3X A;  2OVQ B;  4N14 A;  5HE2 B;  3PSC B;  5CXB A;  3AL9 A;  2IUR A;  2QXV A;  1GP2 B;  5HQG A;  4ERQ A;  3SCY A;  5GSA A;  3ORV D;  4H5I A;  3W15 A;  2P9S C;  4XYI A;  3I7H A;  3VH0 A;  5TEF A;  4O1Q D;  2AGY A;  4FB1 D;  4QRJ A;  3J81 g;  4ZOY A;  4O3U B;  4J79 A;  4I79 A;  2AQ5 A;  4L1Q D;  1TYQ C;  3JRP A;  2J56 H;  4X63 B;  5IJ7 E;  2H6Q A;  2H9N A;  4FAV D;  3EWE A;  4UI9 R;  1QNI A;  3IJC A;  2I0R A;  4KFM B;  4NSX A;  4PC0 A;  1XKS A;  2H9P A;  4A0B A;  1MDA H;  4GQB B;  2BCJ B;  3OL2 B;  3EU7 A;  1S4U X;  4EWR A;  3SN6 B;  1JOF A;  3EI3 A;  1VYH C;  2YBA A;  3EI4 B;  2YNO A;  5HE1 B;  3UVL A;  4Z8L A;  4JSN C;  3U4Y A;  3JZH A;  3I7P A;  3ODT A;  5A2Q g;  4IMM A;  3FRX A;  4O45 A;  2YMU A;  3V9F A;  2YNN A;  5C2V B;  2J57 G;  4GZ8 A;  5FKS A;  1A0R B;  3C9C A;  4ES0 A;  4ZOV A;  3UKU C;  1XHM A;  4IA9 A;  4E54 A;  4R7A B;  3AL8 A;  3HFQ A;  3VGZ A;  3DM0 A;  3JAM g;  4CY5 A;  2IUQ A;  3I89 A;  2PM6 B;  2H14 A;  3PVU B;  4K3I D;  4GGA A;  5CXB B;  3I7O A;  5CYK A;  3I8E A;  3MMY A;  4H5J A;  4MK0 B;  4CZY A;  1TBG A;  5GXH A;  4YVD A;  3J80 g;  3N0D A;  5HE0 B;  1U4C A;  3AFC A;  3UVK A;  1PEV A;  4HDJ A;  4A0A A;  4LG9 A;  1YFQ A;  1N6D A;  3UVN A;  2Z2N A;  2Q7Q A;  4A7J A;  2YNP A;  3PXW D;  4J8B A;  1GXR A;  3SJL D;  3SLE D;  3IIW A;  3ULE C;  3EI2 A;  2HKM A;  5CXC A;  4GM3 A;  4A0B B;  1PI6 A;  2H6K A;  2P9N C;  2H68 A;  3RN0 D;  4BL0 A;  4PBY A;  2OVP B;  3L4O D;  5EAR A;  5FLX g;  3EI3 B;  3BG0 A;  4A2L A;  3OTT A;  4XEI C;  3K27 A;  2CO0 C;  3SBP A;  2J55 H;  3AH8 B;  1N6F A;  4TZ4 A;  1JJU B;  5IGQ A;  4JSP C;  2AGW A;  4FA1 D;  4E5Z A;  2AGX A;  3OKW A;  1L0Q A;  3K26 A;  5GXI A;  2OJY A;  4GM9 A;  3DWL C;  5FXY A;  4A08 A;  2P9I C;  3FGB A;  5EML B;  3SHF A;  3EI1 A;  1SHY B;  4J8G A;  3I7L A;  2Z2P A;  3NVX A;  4A09 A;  3DSM A;  2Z2O A;  4E54 B;  3IKO A;  2OIZ A;  5EAP A;  2H47 A;  1OMW B;  2CE8 A;  4JT5 C;  1K8K C;  2PBI B;  3AL8 B;  3JPX A;  3F3G A;  3RLM D;  3NVQ A;  4J82 A;  1MG3 A;  3MZL A;  5CYK B;  3L4M D;  2AH0 A;  4FHL A;  2IWK A;  1K32 A;  3RMZ D;  3RRM C;  3I7K A;  4BH6 A;  4GQ1 A;  4L9O A;  4CY1 A;  2OK6 A;  4CI2 A;  4OWR A;  4A0A B;  5C9Z B;  4GQ2 P;  1SQ9 A;  3RSE C;  3ZWL B;  4CI8 A;  1Q47 A;  2PM9 A;  4FAN D;  3SXT D;  2XYI A;  4A11 A;  4J86 A;  3SVW D;  5IC7 A;  3EI2 B;  5FKT A;  4J87 A;  5IT9 g;  3MXX A;  5CXC B;  4CI3 A;  4LG8 A;  2HXC A;  2OK4 A;  5EM2 A;  1NEX B;  3JB9 L;  5I5I A;  3MKQ A;  3UVM A;  1JMZ B;  2I3S A;  5FKR A;  4U7A A;  2EBS A;  2W18 A;  4FWW A;  3F3P A;  5TF2 A;  3OKT A;  4JD2 C;  5IGO A;  1NR0 A;  1SQJ A;  5THA A;  4CY2 A;  1N6E A;  3MZK A;  4E5Z B;  2CN3 A;  3EMH A;  3C99 A;  1B9Y A;  2I0T A;  1GG2 B;  5TEE A;  5C2W B;  4A08 B;  3I2N A;  3EI1 B;  2B5L A;  4JSV C;  4ESG A;  2IWF A;  5IJ8 E;  3OKY A;  4A09 B;  2OVR B;  4ZOX A;  2B5M A;  3NVN A;  4JT6 C;  3FM0 A;  4GGC A;  1XIP A;  4J0W A;  4GM8 A;  5SXM A;  2XU7 A;  3UKR C;  2IAA A;  5TDH B;  3CFV A;  3PVW B;  3I8C A;  2GC7 A;  1PBY B;  1GOT B;  3GFC A;  2H9M A;  3C5M A;  2G99 A;  2HKR A;  3PE7 A;  5EMM B;  4PBZ A;  3RFG A;  2H13 A;  2B4E A;  3V5W B;  1ERJ A;  2GNQ A;  2G9A A;  3BG1 A;  1OLZ A;  2TRC B;  4JSX C;  3IJ1 A;  2CE9 A;  5GMK n;  3CFS B;  3CIK B;  2YB8 B;  4D0K A;  2PM9 B;  4J84 A;  3UVO A;  2IUV A;  3JZG A;  3VA6 A;  4X3E A;  4QT8 A;  4PSW B;  4A11 B;  4FA9 D;  3E0C A;  3IIY A;  1R5M A;  2XL2 A;  5K19 A;  5H14 A;  4XYH A;  3P4F A;  5I5M A;  3C75 H;  4ERY A;  4J78 A;  3I7N A;  5EM2 B;  4CC9 A;  5B4W A;  2CO0 A;  4K3J B;  3KRW B;  3PSL A;  3SBR A;  2BBK H;  2HJ4 A;  5KDO B;  5EAL A;  2P9K C;  2B5N A;  3IJ0 A;  4PSX B;  4U1E I;  3BWS A;  2UZY B;  3PXS D;  4J77 A;  5AMS A;  4J81 A;  2HJB A;  3RFH A;  2AH1 A;  4X61 B;  1FWX A;  5H1M A;  3DXM C;  2AGZ A;  2I3T A;  2PM7 B;  5FQD A;  5JWZ A;  4PNK B;  5EAM A;  1JMX B;  2UZX B;  3F3F A;  4CY3 A;  2HES X;  4L3H D;  5EMK B;  5AFU 3;  3A0F A;  1MG2 A;  4PXW A;  4AOW A; 
#chains in the Genus database with same CATH topology
 2P9L C;  3DXK C;  4BUJ C;  4CZX A;  2EID A;  3OKY B;  4J0X A;  4QL1 A;  4G56 B;  4Y5R D;  3NIF A;  1UOQ A;  4L3G D;  5K1C C;  4ZOZ A;  4BP8 A;  4O3T B;  3K71 A;  1H2X A;  2O9K A;  2XL3 A;  5M5R A;  2HYE A;  3OL2 A;  5FKQ A;  5AJA A;  5EMJ B;  5HYN B;  1L5G A;  4D6V A;  2VDM A;  5HE3 B;  1P22 A;  3EI4 A;  2QC5 A;  2GC4 A;  5H17 A;  1C9L A;  4AEZ A;  4FA4 D;  4J73 A;  3SFZ A;  3SBQ A;  1PGU A;  2P9U C;  2MTA H;  1H2Z A;  2AGL A;  4GMB A;  4OZU A;  4CI1 A;  2IUP A;  3PXT D;  4JXM A;  4A2M A;  3EQ7 A;  2H9L A;  2I0S A;  1I2M B;  1RI6 A;  3N0E A;  4CZV A;  5FFO A;  4GGD A;  1B9X A;  4AMY A;  4AN1 A;  5FA5 B;  2CN2 A;  2H6N A;  3GD1 I;  3RN1 D;  3GRE A;  3B7F A;  5M5V A;  3UR4 A;  2CNX A;  4MMY A;  1GOF A;  3V7D B;  3SMR A;  2P9P C;  3JRO A;  4LGN A;  4ZN4 A;  1UOO A;  4G1M A;  1K3I A;  4FA5 D;  4O9D A;  5I5J A;  1E8M A;  3SWS D;  4Y7R A;  5HDB A;  4NAA A;  4QQE A;  3JZN A;  3EG6 A;  3OW8 A;  3MKS B;  3KRX B;  4ERZ A;  4X60 B;  1U2V C;  2H3X A;  2OVQ B;  4N14 A;  2VZ3 A;  5HE2 B;  4BCC A;  3PSC B;  5CXB A;  3AL9 A;  2IUR A;  2QXV A;  1GP2 B;  5HQG A;  4ERQ A;  3IUL A;  3SCY A;  5GSA A;  3ORV D;  1E5T A;  4H5I A;  3W15 A;  2P9S C;  4XYI A;  5M5U A;  3I7H A;  3VH0 A;  5TEF A;  4O1Q D;  2AGY A;  4FB1 D;  3DDU A;  4QRJ A;  4QAM A;  3J81 g;  4ZOY A;  4O3U B;  4J79 A;  2EIE A;  4I79 A;  2HU5 A;  3O4G A;  2AQ5 A;  4L1Q D;  1TYQ C;  3JRP A;  2J56 H;  4X63 B;  3NID A;  1VZ2 A;  5IJ7 E;  4WJK A;  2H6Q A;  2H9N A;  4FAV D;  3EWE A;  4UI9 R;  1QNI A;  3IJC A;  2I0R A;  4KFM B;  4NSX A;  4PC0 A;  1XKS A;  2JKX A;  2H9P A;  5FFG A;  4A0B A;  1UOP A;  1MDA H;  4GQB B;  2BCJ B;  4DNW A;  3OL2 B;  4NBM A;  3ZDZ A;  3EU7 A;  1S4U X;  4MMX A;  4EWR A;  3SN6 B;  1JOF A;  3EI3 A;  1VYH C;  2YBA A;  3EI4 B;  2YNO A;  2XE4 A;  5HE1 B;  3UVL A;  4Z8L A;  4JSN C;  3U4Y A;  3JZH A;  3I7P A;  4WK0 A;  3ODT A;  5A2Q g;  2HU8 A;  4IMM A;  3FRX A;  4O45 A;  4BCB A;  2YMU A;  3V9F A;  2YNN A;  5C2V B;  2J57 G;  4GZ8 A;  5FKS A;  1UTC A;  1A0R B;  3C9C A;  4ES0 A;  4ZOV A;  1QFS A;  3UKU C;  4AX4 A;  3O4I A;  1XHM A;  3IVM A;  4IA9 A;  4E54 A;  4R7A B;  5M5S A;  1QFM A;  3AL8 A;  3HFQ A;  1VE6 A;  3VGZ A;  3DM0 A;  3JAM g;  3V4V A;  4CY5 A;  3IUQ A;  2IUQ A;  3I89 A;  2PM6 B;  2H14 A;  3PVU B;  4K3I D;  4GGA A;  5CXB B;  2EIB A;  5E6U A;  2HU7 A;  3I7O A;  5CYK A;  3I8E A;  3MMY A;  4H5J A;  4MK0 B;  4CZY A;  2VDP A;  1TBG A;  5GXH A;  4YVD A;  3J80 g;  3N0D A;  5HE0 B;  1U4C A;  3O4J A;  3AFC A;  3UVK A;  1PEV A;  4HDJ A;  4A0A A;  4LG9 A;  1YFQ A;  3EQ9 A;  1N6D A;  3UVN A;  2Z2N A;  2Q7Q A;  4A7J A;  2VDL A;  2YNP A;  4IRZ A;  3PXW D;  4J8B A;  1GXR A;  1M1X A;  3SJL D;  4Z7O A;  3SLE D;  3IIW A;  4G55 A;  3ULE C;  5C86 A;  3EI2 A;  2HKM A;  5CXC A;  4O02 A;  4GM3 A;  4A0B B;  1PI6 A;  2H6K A;  2P9N C;  2H68 A;  3RN0 D;  3VI4 A;  4MMZ A;  4BL0 A;  4PBY A;  2OVP B;  3L4O D;  5EAR A;  5FLX g;  2QR5 A;  3EI3 B;  3EQ8 A;  2VDQ A;  1JV2 A;  3BG0 A;  4A2L A;  3OTT A;  4XEI C;  4AN0 A;  3K27 A;  2CO0 C;  3SBP A;  2J55 H;  4NC4 A;  3AH8 B;  1N6F A;  4TZ4 A;  4RE6 A;  5E6S A;  1JJU B;  5IGQ A;  4JSP C;  2AGW A;  4FA1 D;  4E5Z A;  2AGX A;  3OKW A;  1L0Q A;  3K26 A;  5GXI A;  2OJY A;  4GM9 A;  3DWL C;  5FXY A;  5M61 A;  4A08 A;  2P9I C;  3FGB A;  5EML B;  3SHF A;  3EI1 A;  1SHY B;  2VC2 A;  4J8G A;  3GC3 B;  1VE7 A;  3I7L A;  2Z2P A;  5C92 A;  3NVX A;  4A09 A;  3DSM A;  2Z2O A;  4E54 B;  3IKO A;  2OIZ A;  3T3M A;  1A12 A;  2H47 A;  5EAP A;  1OMW B;  2CE8 A;  4JT5 C;  1K8K C;  1C9I A;  2PBI B;  3AL8 B;  1H2Y A;  3QHY B;  3JPX A;  3F3G A;  3RLM D;  3IJE A;  3FCU A;  3MUN A;  3NVQ A;  4J82 A;  1MG3 A;  3MZL A;  5CYK B;  3L4M D;  2AH0 A;  4FHL A;  2IWK A;  1K32 A;  3RMZ D;  2VDR A;  3I7K A;  3RRM C;  4BH6 A;  1U8C A;  5E6R A;  1TYE A;  4WK4 A;  4GQ1 A;  4L9O A;  4CY1 A;  2OK6 A;  4CI2 A;  4OWR A;  4A0A B;  3FCS A;  4UM8 A;  1O6G A;  5C9Z B;  4GQ2 P;  1SQ9 A;  3RSE C;  3ZWL B;  4CI8 A;  1Q47 A;  1O6F A;  2PM9 A;  4FAN D;  2XZG A;  3SXT D;  3MVD K;  2XYI A;  3V4P A;  4A11 A;  3IUM A;  4J86 A;  3SVW D;  5IC7 A;  3EI2 B;  5FKT A;  4J87 A;  2VDO A;  5IT9 g;  4DNU A;  3VI3 A;  3MXX A;  5CXC B;  4CI3 A;  1H2W A;  3IUN A;  4LG8 A;  2HXC A;  4NEN A;  2OK4 A;  5EM2 A;  1NEX B;  4WK2 A;  4Z7N A;  3JB9 L;  5I5I A;  3MKQ A;  2VZ1 A;  3UVM A;  1JMZ B;  2I3S A;  5FKR A;  4U7A A;  4Z7Q A;  2EBS A;  2W18 A;  4FWW A;  3F3P A;  5TF2 A;  3K6S A;  3OKT A;  4JD2 C;  3IUR A;  5IGO A;  1NR0 A;  5M5T A;  1SQJ A;  5THA A;  4JHN A;  4CY2 A;  1N6E A;  3MZK A;  4E5Z B;  2CN3 A;  3EMH A;  3C99 A;  1B9Y A;  2I0T A;  1GG2 B;  5TEE A;  5C2W B;  4A08 B;  3ZE0 A;  3I2N A;  4L1M A;  1GOH A;  3EI1 B;  2B5L A;  2EIC A;  4UM9 A;  4JSV C;  4ESG A;  2IWF A;  5IJ8 E;  3OKY A;  4A09 B;  2OVR B;  4ZOX A;  3T3P A;  2B5M A;  3NVN A;  4JT6 C;  3FM0 A;  4GGC A;  1XIP A;  3O4H A;  4J0W A;  4GM8 A;  5SXM A;  2XDW A;  2XU7 A;  3UKR C;  2IAA A;  5TDH B;  3CFV A;  4JHP C;  3PVW B;  3I8C A;  2GC7 A;  1PBY B;  1GOT B;  3GFC A;  3OF7 A;  2H9M A;  3C5M A;  2G99 A;  2HKR A;  1BPO A;  3PE7 A;  5EMM B;  4PBZ A;  3RFG A;  2H13 A;  1GOG A;  2B4E A;  3MUO A;  3V5W B;  1ERJ A;  1VZ3 A;  3KCI A;  4BCD A;  2GNQ A;  1YR2 A;  2G9A A;  1OLZ A;  2TRC B;  3BG1 A;  4JSX C;  3IJ1 A;  2CE9 A;  5GMK n;  3NIG A;  3ZDX A;  2QZP A;  3CFS B;  2YB8 B;  3CIK B;  4D0K A;  2PM9 B;  4J84 A;  3UVO A;  3ZE1 A;  2IUV A;  3JZG A;  3VA6 A;  4X3E A;  4QT8 A;  4PSW B;  4A11 B;  4FA9 D;  3E0C A;  3IIY A;  1R5M A;  2XL2 A;  5K19 A;  3QI0 A;  5H14 A;  4XYH A;  1JTD B;  4D9S A;  3P4F A;  5I5M A;  3C75 H;  4ERY A;  4J78 A;  3I7N A;  3IUJ A;  3ZDY A;  2WQ8 A;  5EM2 B;  4RE5 A;  4CC9 A;  5B4W A;  2CO0 A;  4K3J B;  3KRW B;  3PSL A;  3SBR A;  2BBK H;  2HJ4 A;  3ZE2 A;  5KDO B;  1T2X A;  5EAL A;  2P9K C;  2B5N A;  3IJ0 A;  4PSX B;  4U1E I;  3BWS A;  4DNV A;  2UZY B;  3PXS D;  4J77 A;  5AMS A;  4J81 A;  2HJB A;  3RFH A;  2AH1 A;  4X61 B;  4AMZ A;  1FWX A;  2VDK A;  5H1M A;  3DXM C;  2AGZ A;  2I3T A;  2PM7 B;  5FQD A;  2BKL A;  5JWZ A;  4PNK B;  5EAM A;  1JMX B;  2UZX B;  3F3F A;  3K72 A;  2HES X;  4L3H D;  5EMK B;  4CY3 A;  4G1E A;  5AFU 3;  3A0F A;  2VDN A;  1MG2 A;  4PXW A;  4AOW A;  4O2W A;  1E8N A;  4BP9 A; 
#chains in the Genus database with same CATH homology
 2P9L C;  3DXK C;  4BUJ C;  4CZX A;  4J0X A;  3OKY B;  4QL1 A;  4G56 B;  4Y5R D;  4L3G D;  5K1C C;  4ZOZ A;  4O3T B;  2O9K A;  2XL3 A;  2HYE A;  3OL2 A;  5FKQ A;  5AJA A;  5EMJ B;  5HYN B;  4D6V A;  5HE3 B;  1P22 A;  3EI4 A;  2QC5 A;  2GC4 A;  5H17 A;  4AEZ A;  4FA4 D;  4J73 A;  3SFZ A;  3SBQ A;  1PGU A;  2P9U C;  2MTA H;  2AGL A;  4GMB A;  4OZU A;  4CI1 A;  2IUP A;  3PXT D;  4JXM A;  4A2M A;  2H9L A;  2I0S A;  1RI6 A;  3N0E A;  4CZV A;  4GGD A;  1B9X A;  5FA5 B;  2CN2 A;  2H6N A;  3RN1 D;  3GRE A;  3B7F A;  3UR4 A;  2CNX A;  3V7D B;  3SMR A;  2P9P C;  3JRO A;  4LGN A;  4ZN4 A;  4FA5 D;  4O9D A;  5I5J A;  3SWS D;  4Y7R A;  4QQE A;  3JZN A;  3EG6 A;  3OW8 A;  3MKS B;  3KRX B;  4ERZ A;  4X60 B;  1U2V C;  2H3X A;  2OVQ B;  4N14 A;  5HE2 B;  3PSC B;  5CXB A;  3AL9 A;  2IUR A;  2QXV A;  1GP2 B;  5HQG A;  4ERQ A;  3SCY A;  5GSA A;  3ORV D;  4H5I A;  3W15 A;  2P9S C;  4XYI A;  3I7H A;  3VH0 A;  5TEF A;  4O1Q D;  2AGY A;  4FB1 D;  4QRJ A;  3J81 g;  4ZOY A;  4O3U B;  4J79 A;  4I79 A;  2AQ5 A;  4L1Q D;  1TYQ C;  3JRP A;  2J56 H;  4X63 B;  5IJ7 E;  2H6Q A;  2H9N A;  4FAV D;  3EWE A;  4UI9 R;  1QNI A;  3IJC A;  2I0R A;  4KFM B;  4NSX A;  4PC0 A;  1XKS A;  2H9P A;  4A0B A;  1MDA H;  4GQB B;  2BCJ B;  3OL2 B;  3EU7 A;  1S4U X;  4EWR A;  3SN6 B;  1JOF A;  3EI3 A;  1VYH C;  2YBA A;  3EI4 B;  2YNO A;  5HE1 B;  3UVL A;  4Z8L A;  4JSN C;  3U4Y A;  3JZH A;  3I7P A;  3ODT A;  5A2Q g;  4IMM A;  3FRX A;  4O45 A;  2YMU A;  3V9F A;  2YNN A;  5C2V B;  2J57 G;  4GZ8 A;  5FKS A;  1A0R B;  3C9C A;  4ES0 A;  4ZOV A;  3UKU C;  1XHM A;  4IA9 A;  4E54 A;  4R7A B;  3AL8 A;  3HFQ A;  3VGZ A;  3DM0 A;  3JAM g;  4CY5 A;  2IUQ A;  3I89 A;  2PM6 B;  2H14 A;  3PVU B;  4K3I D;  4GGA A;  5CXB B;  3I7O A;  5CYK A;  3I8E A;  3MMY A;  4H5J A;  4MK0 B;  4CZY A;  1TBG A;  5GXH A;  4YVD A;  3J80 g;  3N0D A;  5HE0 B;  1U4C A;  3AFC A;  3UVK A;  1PEV A;  4HDJ A;  4A0A A;  4LG9 A;  1YFQ A;  1N6D A;  3UVN A;  2Z2N A;  2Q7Q A;  4A7J A;  2YNP A;  3PXW D;  4J8B A;  1GXR A;  3SJL D;  3SLE D;  3IIW A;  3ULE C;  3EI2 A;  2HKM A;  5CXC A;  4GM3 A;  4A0B B;  1PI6 A;  2H6K A;  2P9N C;  2H68 A;  3RN0 D;  4BL0 A;  4PBY A;  2OVP B;  3L4O D;  5EAR A;  5FLX g;  3EI3 B;  3BG0 A;  4A2L A;  3OTT A;  4XEI C;  3K27 A;  2CO0 C;  3SBP A;  2J55 H;  3AH8 B;  1N6F A;  4TZ4 A;  1JJU B;  5IGQ A;  4JSP C;  2AGW A;  4FA1 D;  4E5Z A;  2AGX A;  3OKW A;  1L0Q A;  3K26 A;  5GXI A;  2OJY A;  4GM9 A;  3DWL C;  5FXY A;  4A08 A;  2P9I C;  3FGB A;  5EML B;  3SHF A;  3EI1 A;  1SHY B;  4J8G A;  3I7L A;  2Z2P A;  3NVX A;  4A09 A;  3DSM A;  2Z2O A;  4E54 B;  3IKO A;  2OIZ A;  5EAP A;  2H47 A;  1OMW B;  2CE8 A;  4JT5 C;  1K8K C;  2PBI B;  3AL8 B;  3JPX A;  3F3G A;  3RLM D;  3NVQ A;  4J82 A;  1MG3 A;  3MZL A;  5CYK B;  3L4M D;  2AH0 A;  4FHL A;  2IWK A;  1K32 A;  3RMZ D;  3RRM C;  3I7K A;  4BH6 A;  4GQ1 A;  4L9O A;  4CY1 A;  2OK6 A;  4CI2 A;  4OWR A;  4A0A B;  5C9Z B;  4GQ2 P;  1SQ9 A;  3RSE C;  3ZWL B;  4CI8 A;  1Q47 A;  2PM9 A;  4FAN D;  3SXT D;  2XYI A;  4A11 A;  4J86 A;  3SVW D;  5IC7 A;  3EI2 B;  5FKT A;  4J87 A;  5IT9 g;  3MXX A;  5CXC B;  4CI3 A;  4LG8 A;  2HXC A;  2OK4 A;  5EM2 A;  1NEX B;  3JB9 L;  5I5I A;  3MKQ A;  3UVM A;  1JMZ B;  2I3S A;  5FKR A;  4U7A A;  2EBS A;  2W18 A;  4FWW A;  3F3P A;  5TF2 A;  3OKT A;  4JD2 C;  5IGO A;  1NR0 A;  1SQJ A;  5THA A;  4CY2 A;  1N6E A;  3MZK A;  4E5Z B;  2CN3 A;  3EMH A;  3C99 A;  1B9Y A;  2I0T A;  1GG2 B;  5TEE A;  5C2W B;  4A08 B;  3I2N A;  3EI1 B;  2B5L A;  4JSV C;  4ESG A;  2IWF A;  5IJ8 E;  3OKY A;  4A09 B;  2OVR B;  4ZOX A;  2B5M A;  3NVN A;  4JT6 C;  3FM0 A;  4GGC A;  1XIP A;  4J0W A;  4GM8 A;  5SXM A;  2XU7 A;  3UKR C;  2IAA A;  5TDH B;  3CFV A;  3PVW B;  3I8C A;  2GC7 A;  1PBY B;  1GOT B;  3GFC A;  2H9M A;  3C5M A;  2G99 A;  2HKR A;  3PE7 A;  5EMM B;  4PBZ A;  3RFG A;  2H13 A;  2B4E A;  3V5W B;  1ERJ A;  2GNQ A;  2G9A A;  3BG1 A;  1OLZ A;  2TRC B;  4JSX C;  3IJ1 A;  2CE9 A;  5GMK n;  3CFS B;  3CIK B;  2YB8 B;  4D0K A;  2PM9 B;  4J84 A;  3UVO A;  2IUV A;  3JZG A;  3VA6 A;  4X3E A;  4QT8 A;  4PSW B;  4A11 B;  4FA9 D;  3E0C A;  3IIY A;  1R5M A;  2XL2 A;  5K19 A;  5H14 A;  4XYH A;  3P4F A;  5I5M A;  3C75 H;  4ERY A;  4J78 A;  3I7N A;  5EM2 B;  4CC9 A;  5B4W A;  2CO0 A;  4K3J B;  3KRW B;  3PSL A;  3SBR A;  2BBK H;  2HJ4 A;  5KDO B;  5EAL A;  2P9K C;  2B5N A;  3IJ0 A;  4PSX B;  4U1E I;  3BWS A;  2UZY B;  3PXS D;  4J77 A;  5AMS A;  4J81 A;  2HJB A;  3RFH A;  2AH1 A;  4X61 B;  1FWX A;  5H1M A;  3DXM C;  2AGZ A;  2I3T A;  2PM7 B;  5FQD A;  5JWZ A;  4PNK B;  5EAM A;  1JMX B;  2UZX B;  3F3F A;  4CY3 A;  2HES X;  4L3H D;  5EMK B;  5AFU 3;  3A0F A;  1MG2 A;  4PXW A;  4AOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...