5EALA

Crystal structure of human wdr5 in complex with compound 9h
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/transcription inhibitor
molecule keywords WD repeat-containing protein 5
publication title Crystal structure of human WDR5 in complex with compound 9h
rcsb
source organism Homo sapiens
total genus 102
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5ealA00
1GXRA 3CFSB 4J87A 4XYIA 5AJAA 4D0KA 3RFHA 4J79A 2MTAH 1Q47A 4X3EA 3E0CA 3NVXA 1TBGA 2HESX 2I3SA 3SLED 3IIYA 5C2WB 2AH0A 2IUPA 2XL2A 2BCJB 5TEEA 2XU7A 3OKTA 3VGZA 3EG6A 3SXTD 4ZOYA 4K3ID 2H9LA 4Y5RD 4ZN4A 3GREA 1A0RB 4A0AB 2H6QA 4E54A 3SHFA 3JB9L 5HE1B 4CZXA 3P4FA 4GQBB 4E5ZB 3KRXB 4R7AB 1JOFA 5FXYA 4L1QD 3PVWB 4NSXA 3DXKC 4A08A 4GM9A 1GG2B 4JSPC 2HJ4A 4OWRA 1N6FA 2J57G 3K27A 4J0XA 3EWEA 2B5LA 3EMHA 3MXXA 3SVWD 2W18A 4GGCA 4J8BA 4ES0A 5B4WA 4G56B 2PM9A 3C75H 3SBRA 3PXSD 3BWSA 2I3TA 2IAAA 4A0AA 2P9LC 5IC7A 4E5ZA 3JROA 2TRCB 1QNIA 4FA4D 3IJ1A 4JSVC 2I0TA 5CXBA 3L4OD 3JZGA 4QL1A 2HYEA 4CZYA 4X63B 4AEZA 4A2MA 4J81A 3UVNA 3N0DA 3RN0D 2B5NA 4BUJC 3SMRA 4GGDA 3RFGA 3JZNA 4L3GD 2OK4A 3JRPA 1PI6A 3PSLA 5HE3B 3MKSB 4ESGA 4FWWA 3C99A 4OZUA 4A0BA 5GSAA 4CI3A 4J82A 2H14A 3EI3B 1PBYB 5HE2B 2IUVA 4H5JA 3PVUB 4O9DA 5FLXg 2H6KA 3J81g 2YNOA 4GQ2P 4LG8A 5IGOA 3GFCA 4Z8LA 2B4EA 2YNPA 4A08B 3UVKA 3UVMA 3SCYA 5A2Qg 4N14A 4I79A 3U4YA 3DWLC 3RSEC 3A0FA 4A11B 2AGXA 1OMWB 3N0EA 3RRMC 5IJ7E 3NVNA 1NEXB 1K32A 4FAND 3C9CA 4FA9D 2GC7A 3CFVA 3HFQA 5IGQA 2XYIA 5H1MA 2PM9B 1PEVA 1NR0A 5FKQA 4XYHA 5AFU3 2OVRB 4ZOXA 2OVQB 4J84A 3EI3A 1MG2A 5TF2A 3B7FA 3SWSD 2OIZA 5CXBB 3IJ0A 4CY5A 4GM8A 4A7JA 2P9PC 3OKYA 4BH6A 3UKUC 4CZVA 3IKOA 1S4UX 5I5MA 1RI6A 1SQ9A 5GXIA 5EARA 3MZLA 3ODTA 3JAMg 2H9NA 3NVQA 2J55H 4PSWB 4D6VA 1U4CA 4PNKB 4CY1A 3OTTA 3EI2B 4CY2A 5EALA 3IIWA 5EMLB 5AMSA 2HKRA 4GZ8A 2BBKH 3K26A 2H47A 1JMXB 4JT6C 4A11A 4GQ1A 2QC5A 2XL3A 4QT8A 2H9PA 4U7AA 4QQEA 5EAPA 4A0BB 5K1CC 1L0QA 3ZWLB 2IURA 4A09B 3I7KA 1TYQC 2CE9A 2PM6B 5TEFA 2PBIB 4JT5C 4QRJA 3OW8A 1XHMA 3UVLA 4ZOVA 5EMMB 5KDOB 4PBYA 5EAMA 5IJ8E 4L9OA 4X60B 3DM0A 1JMZB 3PE7A 4K3JB 2HXCA 3OKWA 2J56H 1N6EA 5C9ZB 1GP2B 3DXMC 3UR4A 4MK0B 3EI2A 2O9KA 2CNXA 2IWKA 2UZYB 1PGUA 5FA5B 3IJCA 1MDAH 2P9NC 2AGYA 1MG3A 2Z2OA 4JSNC 5K19A 4A09A 2H68A 2AGZA 1OLZA 3OL2B 3SBQA 2P9KC 4J8GA 2Q7QA 2P9SC 5CXCB 2YBAA 4PBZA 3W15A 3OKYB 3V9FA 3FRXA 1XKSA 2PM7B 2CO0A 5C2VB 1JJUB 3I7HA 3KRWB 4FAVD 4O3UB 3UKRC 2QXVA 3I8EA 1U2VC 1GOTB 1ERJA 2I0SA 2H13A 4IMMA 4LGNA 4A2LA 5THAA 5EM2A 4FHLA 4FA5D 1K8KC 2I0RA 5EMKB 2G9AA 3VA6A 4XEIC 5FQDA 4ERYA 3V5WB 3I2NA 5H14A 3EI1B 2OVPB 3I89A 4Y7RA 3SJLD 3RMZD 3OL2A 3PXTD 3UVOA 5CXCA 4PSXB 1VYHC 3I7NA 3DSMA 4GMBA 4GM3A 5GXHA 3MKQA 4CI2A 5FKTA 4YVDA 4BL0A 2IUQA 4J77A 5GMKn 3ULEC 2HJBA 2EBSA 5I5JA 3V7DB 2AGWA 2GNQA 3VH0A 1B9XA 5HQGA 4CC9A 3MZKA 3EI4B 2Z2PA 4O3TB 5SXMA 3BG1A 4ERQA 1SQJA 4J86A 1P22A 4PC0A 3PXWD 5FKSA 4HDJA 5I5IA 3EI1A 2CN3A 5HYNB 2H9MA 3RLMD 3F3GA 5CYKB 2AGLA 4JD2C 2H3XA 3AH8B 3L4MD 4O1QD 4O45A 3I7PA 2P9IC 2Z2NA 2AQ5A 3F3PA 3I7LA 4CI1A 3EU7A 5IT9g 1XIPA 2YNNA 3I7OA 4X61B 4JSXC 5HE0B 2HKMA 3AL8B 5EM2B 5JWZA 2UZXB 4IA9A 5H17A 4ZOZA 3EI4A 3PSCB 4KFMB 3J80g 1FWXA 4FA1D 2OK6A 2B5MA 4PXWA 4L3HD 2GC4A 3AFCA 2YB8B 2H6NA 3RN1D 1B9YA 5CYKA 2CE8A 3JZHA 1R5MA 3ORVD 4U1EI 4J78A 2CN2A 4H5IA 4GGAA 4TZ4A 3SN6B 3BG0A 2CO0C 3JPXA 5FKRA 4E54B 1YFQA 2G99A 2P9UC 3AL9A 3SFZA 3C5MA 4ERZA 4CI8A 5EMJB 3CIKB 4CY3A 4EWRA 3F3FA 3SBPA 3MMYA 1SHYB 3AL8A 4J73A 4JXMA 4J0WA 5TDHB 2OJYA 2YMUA 4FB1D 4LG9A 2AH1A 3I8CA 3FM0A 4UI9R 1N6DA 3FGBA 2IWFA 4AOWA
chains in the Genus database with same CATH superfamily
1GXRA 3CFSB 3QI0A 4J87A 1O6GA 4XYIA 5AJAA 3RFHA 4D0KA 4J79A 2MTAH 1Q47A 4RE6A 4X3EA 3E0CA 3NVXA 1TBGA 2HESX 2I3SA 2HU8A 3K71A 3SLED 3IIYA 5C2WB 3IURA 2AH0A 2IUPA 2XL2A 2BCJB 5TEEA 2XU7A 2QZPA 3OKTA 3VGZA 3EG6A 3SXTD 4ZOYA 4K3ID 4NAAA 1UOPA 2EICA 2H9LA 4WJKA 4Y5RD 4ZN4A 3GREA 1A0RB 3K72A 4A0AB 2H6QA 4E54A 3SHFA 3JB9L 5HE1B 4CZXA 3P4FA 4GQBB 4E5ZB 3KRXB 4R7AB 2WQ8A 1K3IA 1JOFA 5FXYA 3FCUA 4L1QD 3PVWB 4NSXA 3DXKC 4A08A 4NBMA 4GM9A 1UOOA 1GG2B 4JSPC 1GOFA 2HJ4A 1UOQA 4OWRA 1N6FA 2J57G 3K27A 4J0XA 2XE4A 3EWEA 2B5LA 3EMHA 3MXXA 3SVWD 3NIDA 4AN0A 2W18A 4GGCA 4J8BA 3O4HA 4ES0A 5B4WA 4G56B 2VDOA 2PM9A 3C75H 5M5VA 3SBRA 3PXSD 3BWSA 2HU7A 2I3TA 2IAAA 3GD1I 4A0AA 2P9LC 5IC7A 4E5ZA 3JROA 2TRCB 1QNIA 2BKLA 4FA4D 3IJ1A 4JSVC 2I0TA 5CXBA 3L4OD 3JZGA 4QL1A 4AN1A 4CZYA 2HYEA 4X63B 4AEZA 4NENA 4A2MA 4UM8A 4J81A 3O4JA 5E6RA 4BCCA 3UVNA 3N0DA 3RN0D 2B5NA 4BUJC 3SMRA 4GGDA 3RFGA 3JZNA 4L3GD 5M5TA 5C92A 4WK2A 2OK4A 4G1EA 3JRPA 1PI6A 3NIFA 3PSLA 5HE3B 4BCBA 3MKSB 4ESGA 4FWWA 3C99A 4OZUA 4A0BA 5GSAA 4CI3A 4J82A 2H14A 3EI3B 1PBYB 5HE2B 2VDQA 3IUJA 2IUVA 4H5JA 1GOGA 3PVUB 4O9DA 5FLXg 1M1XA 2H6KA 3J81g 2YNOA 4GQ2P 4LG8A 5IGOA 3GFCA 4Z8LA 3ZDZA 2B4EA 2YNPA 4A08B 3UVKA 3UVMA 1I2MB 3SCYA 5A2Qg 4N14A 4I79A 3MUOA 1JV2A 1BPOA 3U4YA 3DWLC 3EQ8A 4BP9A 3ZDYA 3RSEC 3GC3B 3A0FA 4NC4A 4A11B 2AGXA 1U8CA 1OMWB 3N0EA 3RRMC 5IJ7E 3NVNA 1NEXB 1K32A 3IULA 4FAND 4Z7QA 3C9CA 4FA9D 2GC7A 3CFVA 1H2XA 5M5SA 3HFQA 5IGQA 2XYIA 4AX4A 5H1MA 5M5UA 2PM9B 1H2WA 1PEVA 1NR0A 5FKQA 4XYHA 5AFU3 2OVRB 4ZOXA 2OVQB 1VZ3A 3MUNA 4J84A 3EI3A 1MG2A 5TF2A 3B7FA 5FFGA 4G1MA 3SWSD 2OIZA 5CXBB 3IJ0A 4CY5A 4GM8A 4A7JA 2P9PC 3OKYA 2VDPA 4BH6A 3UKUC 3T3PA 4CZVA 3IKOA 1S4UX 5I5MA 1RI6A 1SQ9A 3VI4A 5EARA 5GXIA 3MZLA 3ODTA 3JAMg 2H9NA 3NVQA 2J55H 4D9SA 4PSWB 4D6VA 1U4CA 4PNKB 4CY1A 1O6FA 3OTTA 3EI2B 4CY2A 5EALA 3IIWA 5EMLB 4DNWA 5AMSA 2HKRA 4GZ8A 2BBKH 3K26A 2H47A 1JMXB 4JT6C 4A11A 4GQ1A 2QC5A 2XL3A 4QT8A 2H9PA 4U7AA 1QFSA 4QQEA 5EAPA 4A0BB 4RE5A 5K1CC 1L0QA 3ZWLB 2IURA 4A09B 3I7KA 1TYQC 2CE9A 5M61A 2PM6B 3EQ9A 2PBIB 1E8NA 4JT5C 3OW8A 4QRJA 4JHNA 5TEFA 1XHMA 3UVLA 4ZOVA 5EMMB 5KDOB 4PBYA 5EAMA 5IJ8E 2VDLA 4MMXA 1YR2A 4L9OA 3DDUA 4X60B 3DM0A 1JMZB 3PE7A 5HDBA 4K3JB 2HXCA 3OKWA 1T2XA 2XZGA 2J56H 1QFMA 1N6EA 4JHPC 5C9ZB 1GP2B 3DXMC 3UR4A 4MK0B 3EI2A 2O9KA 5E6SA 2CNXA 2IWKA 2UZYB 1PGUA 4L1MA 5FA5B 3IJCA 1MDAH 2P9NC 2AGYA 1MG3A 3IUNA 2Z2OA 4JSNC 5K19A 4A09A 2H68A 2AGZA 1OLZA 3OL2B 2QR5A 4Z7NA 3SBQA 2P9KC 4J8GA 5C86A 2Q7QA 2VDMA 2P9SC 5CXCB 2YBAA 4PBZA 3W15A 1A12A 3OKYB 3V9FA 3FRXA 1XKSA 2PM7B 2CO0A 4DNUA 5C2VB 1JJUB 3I7HA 3KRWB 3NIGA 4FAVD 4O3UB 4G55A 3UKRC 1E8MA 2QXVA 3I8EA 3ZDXA 1U2VC 4IRZA 3V4VA 1GOTB 1ERJA 2JKXA 2I0SA 2H13A 4IMMA 4LGNA 4A2LA 5THAA 5EM2A 3ZE1A 4FHLA 1TYEA 4FA5D 3ZE0A 1K8KC 2I0RA 5EMKB 2VZ1A 2G9AA 3VA6A 4XEIC 5FQDA 1E5TA 4ERYA 3V5WB 3I2NA 5H14A 3EI1B 2OVPB 1VE7A 3I89A 4Y7RA 3SJLD 3RMZD 3OL2A 4BCDA 3PXTD 4BP8A 3FCSA 1UTCA 3UVOA 5CXCA 1H2ZA 4AMZA 4PSXB 2VC2A 1VYHC 3I7NA 3DSMA 4GMBA 4GM3A 5GXHA 3MKQA 4CI2A 5FKTA 4YVDA 3IUQA 4BL0A 2IUQA 4J77A 5GMKn 3O4IA 3ULEC 2HJBA 2EBSA 5E6UA 5I5JA 3V7DB 2AGWA 2GNQA 3VH0A 2VZ3A 1B9XA 5HQGA 4CC9A 2VDKA 4WK0A 3MZKA 3EI4B 4WK4A 2Z2PA 4O3TB 5SXMA 3BG1A 4ERQA 1SQJA 4J86A 1P22A 4PC0A 2VDNA 4DNVA 3PXWD 3T3MA 5FKSA 4AMYA 4HDJA 5I5IA 3IJEA 3EI1A 2CN3A 5HYNB 1VZ2A 2H9MA 3RLMD 3F3GA 2EIBA 3O4GA 5CYKB 2HU5A 4QAMA 2AGLA 4JD2C 2H3XA 3AH8B 3L4MD 3V4PA 4O1QD 4O45A 3I7PA 2P9IC 2Z2NA 2AQ5A 3F3PA 3I7LA 4CI1A 3EU7A 5IT9g 1JTDB 1XIPA 2YNNA 3I7OA 4X61B 4MMYA 3K6SA 4JSXC 5HE0B 1L5GA 2HKMA 3AL8B 5EM2B 3OF7A 3IVMA 5JWZA 3VI3A 2UZXB 4IA9A 5H17A 4ZOZA 3EI4A 3PSCB 4KFMB 3KCIA 3J80g 4O2WA 1FWXA 5M5RA 1H2YA 4FA1D 2OK6A 2B5MA 4PXWA 4L3HD 3MVDK 2GC4A 3AFCA 4Z7OA 2YB8B 2H6NA 3IUMA 3RN1D 5FFOA 1B9YA 5CYKA 3ZE2A 1VE6A 2CE8A 3JZHA 1R5MA 3ORVD 4U1EI 4J78A 2CN2A 2EIDA 4H5IA 4GGAA 4TZ4A 3SN6B 1C9IA 3BG0A 2CO0C 3JPXA 5FKRA 4E54B 1YFQA 2EIEA 2G99A 2P9UC 1GOHA 2XDWA 3AL9A 3QHYB 3SFZA 3C5MA 4ERZA 4CI8A 5EMJB 3CIKB 4CY3A 3EQ7A 4EWRA 3F3FA 3SBPA 3MMYA 1SHYB 1C9LA 3AL8A 4J73A 4MMZA 4JXMA 2VDRA 4O02A 4J0WA 5TDHB 2OJYA 2YMUA 4FB1D 2AH1A 4LG9A 3I8CA 3FM0A 4UI9R 1N6DA 3FGBA 2IWFA 4AOWA 4UM9A
chains in the Genus database with same CATH topology
1GXRA 3CFSB 4J87A 4XYIA 5AJAA 4D0KA 3RFHA 4J79A 2MTAH 1Q47A 4X3EA 3E0CA 3NVXA 1TBGA 2HESX 2I3SA 3SLED 3IIYA 5C2WB 2AH0A 2IUPA 2XL2A 2BCJB 5TEEA 2XU7A 3OKTA 3VGZA 3EG6A 3SXTD 4ZOYA 4K3ID 2H9LA 4Y5RD 4ZN4A 3GREA 1A0RB 4A0AB 2H6QA 4E54A 3SHFA 3JB9L 5HE1B 4CZXA 3P4FA 4GQBB 4E5ZB 3KRXB 4R7AB 1JOFA 5FXYA 4L1QD 3PVWB 4NSXA 3DXKC 4A08A 4GM9A 1GG2B 4JSPC 2HJ4A 4OWRA 1N6FA 2J57G 3K27A 4J0XA 3EWEA 2B5LA 3EMHA 3MXXA 3SVWD 2W18A 4GGCA 4J8BA 4ES0A 5B4WA 4G56B 2PM9A 3C75H 3SBRA 3PXSD 3BWSA 2I3TA 2IAAA 4A0AA 2P9LC 5IC7A 4E5ZA 3JROA 2TRCB 1QNIA 4FA4D 3IJ1A 4JSVC 2I0TA 5CXBA 3L4OD 3JZGA 4QL1A 2HYEA 4CZYA 4X63B 4AEZA 4A2MA 4J81A 3UVNA 3N0DA 3RN0D 2B5NA 4BUJC 3SMRA 4GGDA 3RFGA 3JZNA 4L3GD 2OK4A 3JRPA 1PI6A 3PSLA 5HE3B 3MKSB 4ESGA 4FWWA 3C99A 4OZUA 4A0BA 5GSAA 4CI3A 4J82A 2H14A 3EI3B 1PBYB 5HE2B 2IUVA 4H5JA 3PVUB 4O9DA 5FLXg 2H6KA 3J81g 2YNOA 4GQ2P 4LG8A 5IGOA 3GFCA 4Z8LA 2B4EA 2YNPA 4A08B 3UVKA 3UVMA 3SCYA 5A2Qg 4N14A 4I79A 3U4YA 3DWLC 3RSEC 3A0FA 4A11B 2AGXA 1OMWB 3N0EA 3RRMC 5IJ7E 3NVNA 1NEXB 1K32A 4FAND 3C9CA 4FA9D 2GC7A 3CFVA 3HFQA 5IGQA 2XYIA 5H1MA 2PM9B 1PEVA 1NR0A 5FKQA 4XYHA 5AFU3 2OVRB 4ZOXA 2OVQB 4J84A 3EI3A 1MG2A 5TF2A 3B7FA 3SWSD 2OIZA 5CXBB 3IJ0A 4CY5A 4GM8A 4A7JA 2P9PC 3OKYA 4BH6A 3UKUC 4CZVA 3IKOA 1S4UX 5I5MA 1RI6A 1SQ9A 5GXIA 5EARA 3MZLA 3ODTA 3JAMg 2H9NA 3NVQA 2J55H 4PSWB 4D6VA 1U4CA 4PNKB 4CY1A 3OTTA 3EI2B 4CY2A 5EALA 3IIWA 5EMLB 5AMSA 2HKRA 4GZ8A 2BBKH 3K26A 2H47A 1JMXB 4JT6C 4A11A 4GQ1A 2QC5A 2XL3A 4QT8A 2H9PA 4U7AA 4QQEA 5EAPA 4A0BB 5K1CC 1L0QA 3ZWLB 2IURA 4A09B 3I7KA 1TYQC 2CE9A 2PM6B 5TEFA 2PBIB 4JT5C 4QRJA 3OW8A 1XHMA 3UVLA 4ZOVA 5EMMB 5KDOB 4PBYA 5EAMA 5IJ8E 4L9OA 4X60B 3DM0A 1JMZB 3PE7A 4K3JB 2HXCA 3OKWA 2J56H 1N6EA 5C9ZB 1GP2B 3DXMC 3UR4A 4MK0B 3EI2A 2O9KA 2CNXA 2IWKA 2UZYB 1PGUA 5FA5B 3IJCA 1MDAH 2P9NC 2AGYA 1MG3A 2Z2OA 4JSNC 5K19A 4A09A 2H68A 2AGZA 1OLZA 3OL2B 3SBQA 2P9KC 4J8GA 2Q7QA 2P9SC 5CXCB 2YBAA 4PBZA 3W15A 3OKYB 3V9FA 3FRXA 1XKSA 2PM7B 2CO0A 5C2VB 1JJUB 3I7HA 3KRWB 4FAVD 4O3UB 3UKRC 2QXVA 3I8EA 1U2VC 1GOTB 1ERJA 2I0SA 2H13A 4IMMA 4LGNA 4A2LA 5THAA 5EM2A 4FHLA 4FA5D 1K8KC 2I0RA 5EMKB 2G9AA 3VA6A 4XEIC 5FQDA 4ERYA 3V5WB 3I2NA 5H14A 3EI1B 2OVPB 3I89A 4Y7RA 3SJLD 3RMZD 3OL2A 3PXTD 3UVOA 5CXCA 4PSXB 1VYHC 3I7NA 3DSMA 4GMBA 4GM3A 5GXHA 3MKQA 4CI2A 5FKTA 4YVDA 4BL0A 2IUQA 4J77A 5GMKn 3ULEC 2HJBA 2EBSA 5I5JA 3V7DB 2AGWA 2GNQA 3VH0A 1B9XA 5HQGA 4CC9A 3MZKA 3EI4B 2Z2PA 4O3TB 5SXMA 3BG1A 4ERQA 1SQJA 4J86A 1P22A 4PC0A 3PXWD 5FKSA 4HDJA 5I5IA 3EI1A 2CN3A 5HYNB 2H9MA 3RLMD 3F3GA 5CYKB 2AGLA 4JD2C 2H3XA 3AH8B 3L4MD 4O1QD 4O45A 3I7PA 2P9IC 2Z2NA 2AQ5A 3F3PA 3I7LA 4CI1A 3EU7A 5IT9g 1XIPA 2YNNA 3I7OA 4X61B 4JSXC 5HE0B 2HKMA 3AL8B 5EM2B 5JWZA 2UZXB 4IA9A 5H17A 4ZOZA 3EI4A 3PSCB 4KFMB 3J80g 1FWXA 4FA1D 2OK6A 2B5MA 4PXWA 4L3HD 2GC4A 3AFCA 2YB8B 2H6NA 3RN1D 1B9YA 5CYKA 2CE8A 3JZHA 1R5MA 3ORVD 4U1EI 4J78A 2CN2A 4H5IA 4GGAA 4TZ4A 3SN6B 3BG0A 2CO0C 3JPXA 5FKRA 4E54B 1YFQA 2G99A 2P9UC 3AL9A 3SFZA 3C5MA 4ERZA 4CI8A 5EMJB 3CIKB 4CY3A 4EWRA 3F3FA 3SBPA 3MMYA 1SHYB 3AL8A 4J73A 4JXMA 4J0WA 5TDHB 2OJYA 2YMUA 4FB1D 4LG9A 2AH1A 3I8CA 3FM0A 4UI9R 1N6DA 3FGBA 2IWFA 4AOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GXR A;  3CFS B;  4J87 A;  4XYI A;  5AJA A;  4D0K A;  3RFH A;  4J79 A;  2MTA H;  1Q47 A;  4X3E A;  3E0C A;  3NVX A;  1TBG A;  2HES X;  2I3S A;  3SLE D;  3IIY A;  5C2W B;  2AH0 A;  2IUP A;  2XL2 A;  2BCJ B;  5TEE A;  2XU7 A;  3OKT A;  3VGZ A;  3EG6 A;  3SXT D;  4ZOY A;  4K3I D;  2H9L A;  4Y5R D;  4ZN4 A;  3GRE A;  1A0R B;  4A0A B;  2H6Q A;  4E54 A;  3SHF A;  3JB9 L;  5HE1 B;  4CZX A;  3P4F A;  4GQB B;  4E5Z B;  3KRX B;  4R7A B;  1JOF A;  5FXY A;  4L1Q D;  3PVW B;  4NSX A;  3DXK C;  4A08 A;  4GM9 A;  1GG2 B;  4JSP C;  2HJ4 A;  4OWR A;  1N6F A;  2J57 G;  3K27 A;  4J0X A;  3EWE A;  2B5L A;  3EMH A;  3MXX A;  3SVW D;  2W18 A;  4GGC A;  4J8B A;  4ES0 A;  5B4W A;  4G56 B;  2PM9 A;  3C75 H;  3SBR A;  3PXS D;  3BWS A;  2I3T A;  2IAA A;  4A0A A;  2P9L C;  5IC7 A;  4E5Z A;  3JRO A;  2TRC B;  1QNI A;  4FA4 D;  3IJ1 A;  4JSV C;  2I0T A;  5CXB A;  3L4O D;  3JZG A;  4QL1 A;  2HYE A;  4CZY A;  4X63 B;  4AEZ A;  4A2M A;  4J81 A;  3UVN A;  3N0D A;  3RN0 D;  2B5N A;  4BUJ C;  3SMR A;  4GGD A;  3RFG A;  3JZN A;  4L3G D;  2OK4 A;  3JRP A;  1PI6 A;  3PSL A;  5HE3 B;  3MKS B;  4ESG A;  4FWW A;  3C99 A;  4OZU A;  4A0B A;  5GSA A;  4CI3 A;  4J82 A;  2H14 A;  3EI3 B;  1PBY B;  5HE2 B;  2IUV A;  4H5J A;  3PVU B;  4O9D A;  5FLX g;  2H6K A;  3J81 g;  2YNO A;  4GQ2 P;  4LG8 A;  5IGO A;  3GFC A;  4Z8L A;  2B4E A;  2YNP A;  4A08 B;  3UVK A;  3UVM A;  3SCY A;  5A2Q g;  4N14 A;  4I79 A;  3U4Y A;  3DWL C;  3RSE C;  3A0F A;  4A11 B;  2AGX A;  1OMW B;  3N0E A;  3RRM C;  5IJ7 E;  3NVN A;  1NEX B;  1K32 A;  4FAN D;  3C9C A;  4FA9 D;  2GC7 A;  3CFV A;  3HFQ A;  5IGQ A;  2XYI A;  5H1M A;  2PM9 B;  1PEV A;  1NR0 A;  5FKQ A;  4XYH A;  5AFU 3;  2OVR B;  4ZOX A;  2OVQ B;  4J84 A;  3EI3 A;  1MG2 A;  5TF2 A;  3B7F A;  3SWS D;  2OIZ A;  5CXB B;  3IJ0 A;  4CY5 A;  4GM8 A;  4A7J A;  2P9P C;  3OKY A;  4BH6 A;  3UKU C;  4CZV A;  3IKO A;  1S4U X;  5I5M A;  1RI6 A;  1SQ9 A;  5GXI A;  5EAR A;  3MZL A;  3ODT A;  3JAM g;  2H9N A;  3NVQ A;  2J55 H;  4PSW B;  4D6V A;  1U4C A;  4PNK B;  4CY1 A;  3OTT A;  3EI2 B;  4CY2 A;  5EAL A;  3IIW A;  5EML B;  5AMS A;  2HKR A;  4GZ8 A;  2BBK H;  3K26 A;  2H47 A;  1JMX B;  4JT6 C;  4A11 A;  4GQ1 A;  2QC5 A;  2XL3 A;  4QT8 A;  2H9P A;  4U7A A;  4QQE A;  5EAP A;  4A0B B;  5K1C C;  1L0Q A;  3ZWL B;  2IUR A;  4A09 B;  3I7K A;  1TYQ C;  2CE9 A;  2PM6 B;  5TEF A;  2PBI B;  4JT5 C;  4QRJ A;  3OW8 A;  1XHM A;  3UVL A;  4ZOV A;  5EMM B;  5KDO B;  4PBY A;  5EAM A;  5IJ8 E;  4L9O A;  4X60 B;  3DM0 A;  1JMZ B;  3PE7 A;  4K3J B;  2HXC A;  3OKW A;  2J56 H;  1N6E A;  5C9Z B;  1GP2 B;  3DXM C;  3UR4 A;  4MK0 B;  3EI2 A;  2O9K A;  2CNX A;  2IWK A;  2UZY B;  1PGU A;  5FA5 B;  3IJC A;  1MDA H;  2P9N C;  2AGY A;  1MG3 A;  2Z2O A;  4JSN C;  5K19 A;  4A09 A;  2H68 A;  2AGZ A;  1OLZ A;  3OL2 B;  3SBQ A;  2P9K C;  4J8G A;  2Q7Q A;  2P9S C;  5CXC B;  2YBA A;  4PBZ A;  3W15 A;  3OKY B;  3V9F A;  3FRX A;  1XKS A;  2PM7 B;  2CO0 A;  5C2V B;  1JJU B;  3I7H A;  3KRW B;  4FAV D;  4O3U B;  3UKR C;  2QXV A;  3I8E A;  1U2V C;  1GOT B;  1ERJ A;  2I0S A;  2H13 A;  4IMM A;  4LGN A;  4A2L A;  5THA A;  5EM2 A;  4FHL A;  4FA5 D;  1K8K C;  2I0R A;  5EMK B;  2G9A A;  3VA6 A;  4XEI C;  5FQD A;  4ERY A;  3V5W B;  3I2N A;  5H14 A;  3EI1 B;  2OVP B;  3I89 A;  4Y7R A;  3SJL D;  3RMZ D;  3OL2 A;  3PXT D;  3UVO A;  5CXC A;  4PSX B;  1VYH C;  3I7N A;  3DSM A;  4GMB A;  4GM3 A;  5GXH A;  3MKQ A;  4CI2 A;  5FKT A;  4YVD A;  4BL0 A;  2IUQ A;  4J77 A;  5GMK n;  3ULE C;  2HJB A;  2EBS A;  5I5J A;  3V7D B;  2AGW A;  2GNQ A;  3VH0 A;  1B9X A;  5HQG A;  4CC9 A;  3MZK A;  3EI4 B;  2Z2P A;  4O3T B;  5SXM A;  3BG1 A;  4ERQ A;  1SQJ A;  4J86 A;  1P22 A;  4PC0 A;  3PXW D;  5FKS A;  4HDJ A;  5I5I A;  3EI1 A;  2CN3 A;  5HYN B;  2H9M A;  3RLM D;  3F3G A;  5CYK B;  2AGL A;  4JD2 C;  2H3X A;  3AH8 B;  3L4M D;  4O1Q D;  4O45 A;  3I7P A;  2P9I C;  2Z2N A;  2AQ5 A;  3F3P A;  3I7L A;  4CI1 A;  3EU7 A;  5IT9 g;  1XIP A;  2YNN A;  3I7O A;  4X61 B;  4JSX C;  5HE0 B;  2HKM A;  3AL8 B;  5EM2 B;  5JWZ A;  2UZX B;  4IA9 A;  5H17 A;  4ZOZ A;  3EI4 A;  3PSC B;  4KFM B;  3J80 g;  1FWX A;  4FA1 D;  2OK6 A;  2B5M A;  4PXW A;  4L3H D;  2GC4 A;  3AFC A;  2YB8 B;  2H6N A;  3RN1 D;  1B9Y A;  5CYK A;  2CE8 A;  3JZH A;  1R5M A;  3ORV D;  4U1E I;  4J78 A;  2CN2 A;  4H5I A;  4GGA A;  4TZ4 A;  3SN6 B;  3BG0 A;  2CO0 C;  3JPX A;  5FKR A;  4E54 B;  1YFQ A;  2G99 A;  2P9U C;  3AL9 A;  3SFZ A;  3C5M A;  4ERZ A;  4CI8 A;  5EMJ B;  3CIK B;  4CY3 A;  4EWR A;  3F3F A;  3SBP A;  3MMY A;  1SHY B;  3AL8 A;  4J73 A;  4JXM A;  4J0W A;  5TDH B;  2OJY A;  2YMU A;  4FB1 D;  4LG9 A;  2AH1 A;  3I8C A;  3FM0 A;  4UI9 R;  1N6D A;  3FGB A;  2IWF A;  4AOW A; 
#chains in the Genus database with same CATH topology
 1GXR A;  3CFS B;  3QI0 A;  4J87 A;  1O6G A;  4XYI A;  5AJA A;  3RFH A;  4D0K A;  4J79 A;  2MTA H;  1Q47 A;  4RE6 A;  4X3E A;  3E0C A;  3NVX A;  1TBG A;  2HES X;  2I3S A;  2HU8 A;  3K71 A;  3SLE D;  3IIY A;  5C2W B;  3IUR A;  2AH0 A;  2IUP A;  2XL2 A;  2BCJ B;  5TEE A;  2XU7 A;  2QZP A;  3OKT A;  3VGZ A;  3EG6 A;  3SXT D;  4ZOY A;  4K3I D;  4NAA A;  1UOP A;  2EIC A;  2H9L A;  4WJK A;  4Y5R D;  4ZN4 A;  3GRE A;  1A0R B;  3K72 A;  4A0A B;  2H6Q A;  4E54 A;  3SHF A;  3JB9 L;  5HE1 B;  4CZX A;  3P4F A;  4GQB B;  4E5Z B;  3KRX B;  4R7A B;  2WQ8 A;  1K3I A;  1JOF A;  5FXY A;  3FCU A;  4L1Q D;  3PVW B;  4NSX A;  3DXK C;  4A08 A;  4NBM A;  4GM9 A;  1UOO A;  1GG2 B;  4JSP C;  1GOF A;  2HJ4 A;  1UOQ A;  4OWR A;  1N6F A;  2J57 G;  3K27 A;  4J0X A;  2XE4 A;  3EWE A;  2B5L A;  3EMH A;  3MXX A;  3SVW D;  3NID A;  4AN0 A;  2W18 A;  4GGC A;  4J8B A;  3O4H A;  4ES0 A;  5B4W A;  4G56 B;  2VDO A;  2PM9 A;  3C75 H;  5M5V A;  3SBR A;  3PXS D;  3BWS A;  2HU7 A;  2I3T A;  2IAA A;  3GD1 I;  4A0A A;  2P9L C;  5IC7 A;  4E5Z A;  3JRO A;  2TRC B;  1QNI A;  2BKL A;  4FA4 D;  3IJ1 A;  4JSV C;  2I0T A;  5CXB A;  3L4O D;  3JZG A;  4QL1 A;  4AN1 A;  4CZY A;  2HYE A;  4X63 B;  4AEZ A;  4NEN A;  4A2M A;  4UM8 A;  4J81 A;  3O4J A;  5E6R A;  4BCC A;  3UVN A;  3N0D A;  3RN0 D;  2B5N A;  4BUJ C;  3SMR A;  4GGD A;  3RFG A;  3JZN A;  4L3G D;  5M5T A;  5C92 A;  4WK2 A;  2OK4 A;  4G1E A;  3JRP A;  1PI6 A;  3NIF A;  3PSL A;  5HE3 B;  4BCB A;  3MKS B;  4ESG A;  4FWW A;  3C99 A;  4OZU A;  4A0B A;  5GSA A;  4CI3 A;  4J82 A;  2H14 A;  3EI3 B;  1PBY B;  5HE2 B;  2VDQ A;  3IUJ A;  2IUV A;  4H5J A;  1GOG A;  3PVU B;  4O9D A;  5FLX g;  1M1X A;  2H6K A;  3J81 g;  2YNO A;  4GQ2 P;  4LG8 A;  5IGO A;  3GFC A;  4Z8L A;  3ZDZ A;  2B4E A;  2YNP A;  4A08 B;  3UVK A;  3UVM A;  1I2M B;  3SCY A;  5A2Q g;  4N14 A;  4I79 A;  3MUO A;  1JV2 A;  1BPO A;  3U4Y A;  3DWL C;  3EQ8 A;  4BP9 A;  3ZDY A;  3RSE C;  3GC3 B;  3A0F A;  4NC4 A;  4A11 B;  2AGX A;  1U8C A;  1OMW B;  3N0E A;  3RRM C;  5IJ7 E;  3NVN A;  1NEX B;  1K32 A;  3IUL A;  4FAN D;  4Z7Q A;  3C9C A;  4FA9 D;  2GC7 A;  3CFV A;  1H2X A;  5M5S A;  3HFQ A;  5IGQ A;  2XYI A;  4AX4 A;  5H1M A;  5M5U A;  2PM9 B;  1H2W A;  1PEV A;  1NR0 A;  5FKQ A;  4XYH A;  5AFU 3;  2OVR B;  4ZOX A;  2OVQ B;  1VZ3 A;  3MUN A;  4J84 A;  3EI3 A;  1MG2 A;  5TF2 A;  3B7F A;  5FFG A;  4G1M A;  3SWS D;  2OIZ A;  5CXB B;  3IJ0 A;  4CY5 A;  4GM8 A;  4A7J A;  2P9P C;  3OKY A;  2VDP A;  4BH6 A;  3UKU C;  3T3P A;  4CZV A;  3IKO A;  1S4U X;  5I5M A;  1RI6 A;  1SQ9 A;  3VI4 A;  5EAR A;  5GXI A;  3MZL A;  3ODT A;  3JAM g;  2H9N A;  3NVQ A;  2J55 H;  4D9S A;  4PSW B;  4D6V A;  1U4C A;  4PNK B;  4CY1 A;  1O6F A;  3OTT A;  3EI2 B;  4CY2 A;  5EAL A;  3IIW A;  5EML B;  4DNW A;  5AMS A;  2HKR A;  4GZ8 A;  2BBK H;  3K26 A;  2H47 A;  1JMX B;  4JT6 C;  4A11 A;  4GQ1 A;  2QC5 A;  2XL3 A;  4QT8 A;  2H9P A;  4U7A A;  1QFS A;  4QQE A;  5EAP A;  4A0B B;  4RE5 A;  5K1C C;  1L0Q A;  3ZWL B;  2IUR A;  4A09 B;  3I7K A;  1TYQ C;  2CE9 A;  5M61 A;  2PM6 B;  3EQ9 A;  2PBI B;  1E8N A;  4JT5 C;  3OW8 A;  4QRJ A;  4JHN A;  5TEF A;  1XHM A;  3UVL A;  4ZOV A;  5EMM B;  5KDO B;  4PBY A;  5EAM A;  5IJ8 E;  2VDL A;  4MMX A;  1YR2 A;  4L9O A;  3DDU A;  4X60 B;  3DM0 A;  1JMZ B;  3PE7 A;  5HDB A;  4K3J B;  2HXC A;  3OKW A;  1T2X A;  2XZG A;  2J56 H;  1QFM A;  1N6E A;  4JHP C;  5C9Z B;  1GP2 B;  3DXM C;  3UR4 A;  4MK0 B;  3EI2 A;  2O9K A;  5E6S A;  2CNX A;  2IWK A;  2UZY B;  1PGU A;  4L1M A;  5FA5 B;  3IJC A;  1MDA H;  2P9N C;  2AGY A;  1MG3 A;  3IUN A;  2Z2O A;  4JSN C;  5K19 A;  4A09 A;  2H68 A;  2AGZ A;  1OLZ A;  3OL2 B;  2QR5 A;  4Z7N A;  3SBQ A;  2P9K C;  4J8G A;  5C86 A;  2Q7Q A;  2VDM A;  2P9S C;  5CXC B;  2YBA A;  4PBZ A;  3W15 A;  1A12 A;  3OKY B;  3V9F A;  3FRX A;  1XKS A;  2PM7 B;  2CO0 A;  4DNU A;  5C2V B;  1JJU B;  3I7H A;  3KRW B;  3NIG A;  4FAV D;  4O3U B;  4G55 A;  3UKR C;  1E8M A;  2QXV A;  3I8E A;  3ZDX A;  1U2V C;  4IRZ A;  3V4V A;  1GOT B;  1ERJ A;  2JKX A;  2I0S A;  2H13 A;  4IMM A;  4LGN A;  4A2L A;  5THA A;  5EM2 A;  3ZE1 A;  4FHL A;  1TYE A;  4FA5 D;  3ZE0 A;  1K8K C;  2I0R A;  5EMK B;  2VZ1 A;  2G9A A;  3VA6 A;  4XEI C;  5FQD A;  1E5T A;  4ERY A;  3V5W B;  3I2N A;  5H14 A;  3EI1 B;  2OVP B;  1VE7 A;  3I89 A;  4Y7R A;  3SJL D;  3RMZ D;  3OL2 A;  4BCD A;  3PXT D;  4BP8 A;  3FCS A;  1UTC A;  3UVO A;  5CXC A;  1H2Z A;  4AMZ A;  4PSX B;  2VC2 A;  1VYH C;  3I7N A;  3DSM A;  4GMB A;  4GM3 A;  5GXH A;  3MKQ A;  4CI2 A;  5FKT A;  4YVD A;  3IUQ A;  4BL0 A;  2IUQ A;  4J77 A;  5GMK n;  3O4I A;  3ULE C;  2HJB A;  2EBS A;  5E6U A;  5I5J A;  3V7D B;  2AGW A;  2GNQ A;  3VH0 A;  2VZ3 A;  1B9X A;  5HQG A;  4CC9 A;  2VDK A;  4WK0 A;  3MZK A;  3EI4 B;  4WK4 A;  2Z2P A;  4O3T B;  5SXM A;  3BG1 A;  4ERQ A;  1SQJ A;  4J86 A;  1P22 A;  4PC0 A;  2VDN A;  4DNV A;  3PXW D;  3T3M A;  5FKS A;  4AMY A;  4HDJ A;  5I5I A;  3IJE A;  3EI1 A;  2CN3 A;  5HYN B;  1VZ2 A;  2H9M A;  3RLM D;  3F3G A;  2EIB A;  3O4G A;  5CYK B;  2HU5 A;  4QAM A;  2AGL A;  4JD2 C;  2H3X A;  3AH8 B;  3L4M D;  3V4P A;  4O1Q D;  4O45 A;  3I7P A;  2P9I C;  2Z2N A;  2AQ5 A;  3F3P A;  3I7L A;  4CI1 A;  3EU7 A;  5IT9 g;  1JTD B;  1XIP A;  2YNN A;  3I7O A;  4X61 B;  4MMY A;  3K6S A;  4JSX C;  5HE0 B;  1L5G A;  2HKM A;  3AL8 B;  5EM2 B;  3OF7 A;  3IVM A;  5JWZ A;  3VI3 A;  2UZX B;  4IA9 A;  5H17 A;  4ZOZ A;  3EI4 A;  3PSC B;  4KFM B;  3KCI A;  3J80 g;  4O2W A;  1FWX A;  5M5R A;  1H2Y A;  4FA1 D;  2OK6 A;  2B5M A;  4PXW A;  4L3H D;  3MVD K;  2GC4 A;  3AFC A;  4Z7O A;  2YB8 B;  2H6N A;  3IUM A;  3RN1 D;  5FFO A;  1B9Y A;  5CYK A;  3ZE2 A;  1VE6 A;  2CE8 A;  3JZH A;  1R5M A;  3ORV D;  4U1E I;  4J78 A;  2CN2 A;  2EID A;  4H5I A;  4GGA A;  4TZ4 A;  3SN6 B;  1C9I A;  3BG0 A;  2CO0 C;  3JPX A;  5FKR A;  4E54 B;  1YFQ A;  2EIE A;  2G99 A;  2P9U C;  1GOH A;  2XDW A;  3AL9 A;  3QHY B;  3SFZ A;  3C5M A;  4ERZ A;  4CI8 A;  5EMJ B;  3CIK B;  4CY3 A;  3EQ7 A;  4EWR A;  3F3F A;  3SBP A;  3MMY A;  1SHY B;  1C9L A;  3AL8 A;  4J73 A;  4MMZ A;  4JXM A;  2VDR A;  4O02 A;  4J0W A;  5TDH B;  2OJY A;  2YMU A;  4FB1 D;  2AH1 A;  4LG9 A;  3I8C A;  3FM0 A;  4UI9 R;  1N6D A;  3FGB A;  2IWF A;  4AOW A;  4UM9 A; 
#chains in the Genus database with same CATH homology
 1GXR A;  3CFS B;  4J87 A;  4XYI A;  5AJA A;  4D0K A;  3RFH A;  4J79 A;  2MTA H;  1Q47 A;  4X3E A;  3E0C A;  3NVX A;  1TBG A;  2HES X;  2I3S A;  3SLE D;  3IIY A;  5C2W B;  2AH0 A;  2IUP A;  2XL2 A;  2BCJ B;  5TEE A;  2XU7 A;  3OKT A;  3VGZ A;  3EG6 A;  3SXT D;  4ZOY A;  4K3I D;  2H9L A;  4Y5R D;  4ZN4 A;  3GRE A;  1A0R B;  4A0A B;  2H6Q A;  4E54 A;  3SHF A;  3JB9 L;  5HE1 B;  4CZX A;  3P4F A;  4GQB B;  4E5Z B;  3KRX B;  4R7A B;  1JOF A;  5FXY A;  4L1Q D;  3PVW B;  4NSX A;  3DXK C;  4A08 A;  4GM9 A;  1GG2 B;  4JSP C;  2HJ4 A;  4OWR A;  1N6F A;  2J57 G;  3K27 A;  4J0X A;  3EWE A;  2B5L A;  3EMH A;  3MXX A;  3SVW D;  2W18 A;  4GGC A;  4J8B A;  4ES0 A;  5B4W A;  4G56 B;  2PM9 A;  3C75 H;  3SBR A;  3PXS D;  3BWS A;  2I3T A;  2IAA A;  4A0A A;  2P9L C;  5IC7 A;  4E5Z A;  3JRO A;  2TRC B;  1QNI A;  4FA4 D;  3IJ1 A;  4JSV C;  2I0T A;  5CXB A;  3L4O D;  3JZG A;  4QL1 A;  2HYE A;  4CZY A;  4X63 B;  4AEZ A;  4A2M A;  4J81 A;  3UVN A;  3N0D A;  3RN0 D;  2B5N A;  4BUJ C;  3SMR A;  4GGD A;  3RFG A;  3JZN A;  4L3G D;  2OK4 A;  3JRP A;  1PI6 A;  3PSL A;  5HE3 B;  3MKS B;  4ESG A;  4FWW A;  3C99 A;  4OZU A;  4A0B A;  5GSA A;  4CI3 A;  4J82 A;  2H14 A;  3EI3 B;  1PBY B;  5HE2 B;  2IUV A;  4H5J A;  3PVU B;  4O9D A;  5FLX g;  2H6K A;  3J81 g;  2YNO A;  4GQ2 P;  4LG8 A;  5IGO A;  3GFC A;  4Z8L A;  2B4E A;  2YNP A;  4A08 B;  3UVK A;  3UVM A;  3SCY A;  5A2Q g;  4N14 A;  4I79 A;  3U4Y A;  3DWL C;  3RSE C;  3A0F A;  4A11 B;  2AGX A;  1OMW B;  3N0E A;  3RRM C;  5IJ7 E;  3NVN A;  1NEX B;  1K32 A;  4FAN D;  3C9C A;  4FA9 D;  2GC7 A;  3CFV A;  3HFQ A;  5IGQ A;  2XYI A;  5H1M A;  2PM9 B;  1PEV A;  1NR0 A;  5FKQ A;  4XYH A;  5AFU 3;  2OVR B;  4ZOX A;  2OVQ B;  4J84 A;  3EI3 A;  1MG2 A;  5TF2 A;  3B7F A;  3SWS D;  2OIZ A;  5CXB B;  3IJ0 A;  4CY5 A;  4GM8 A;  4A7J A;  2P9P C;  3OKY A;  4BH6 A;  3UKU C;  4CZV A;  3IKO A;  1S4U X;  5I5M A;  1RI6 A;  1SQ9 A;  5GXI A;  5EAR A;  3MZL A;  3ODT A;  3JAM g;  2H9N A;  3NVQ A;  2J55 H;  4PSW B;  4D6V A;  1U4C A;  4PNK B;  4CY1 A;  3OTT A;  3EI2 B;  4CY2 A;  5EAL A;  3IIW A;  5EML B;  5AMS A;  2HKR A;  4GZ8 A;  2BBK H;  3K26 A;  2H47 A;  1JMX B;  4JT6 C;  4A11 A;  4GQ1 A;  2QC5 A;  2XL3 A;  4QT8 A;  2H9P A;  4U7A A;  4QQE A;  5EAP A;  4A0B B;  5K1C C;  1L0Q A;  3ZWL B;  2IUR A;  4A09 B;  3I7K A;  1TYQ C;  2CE9 A;  2PM6 B;  5TEF A;  2PBI B;  4JT5 C;  4QRJ A;  3OW8 A;  1XHM A;  3UVL A;  4ZOV A;  5EMM B;  5KDO B;  4PBY A;  5EAM A;  5IJ8 E;  4L9O A;  4X60 B;  3DM0 A;  1JMZ B;  3PE7 A;  4K3J B;  2HXC A;  3OKW A;  2J56 H;  1N6E A;  5C9Z B;  1GP2 B;  3DXM C;  3UR4 A;  4MK0 B;  3EI2 A;  2O9K A;  2CNX A;  2IWK A;  2UZY B;  1PGU A;  5FA5 B;  3IJC A;  1MDA H;  2P9N C;  2AGY A;  1MG3 A;  2Z2O A;  4JSN C;  5K19 A;  4A09 A;  2H68 A;  2AGZ A;  1OLZ A;  3OL2 B;  3SBQ A;  2P9K C;  4J8G A;  2Q7Q A;  2P9S C;  5CXC B;  2YBA A;  4PBZ A;  3W15 A;  3OKY B;  3V9F A;  3FRX A;  1XKS A;  2PM7 B;  2CO0 A;  5C2V B;  1JJU B;  3I7H A;  3KRW B;  4FAV D;  4O3U B;  3UKR C;  2QXV A;  3I8E A;  1U2V C;  1GOT B;  1ERJ A;  2I0S A;  2H13 A;  4IMM A;  4LGN A;  4A2L A;  5THA A;  5EM2 A;  4FHL A;  4FA5 D;  1K8K C;  2I0R A;  5EMK B;  2G9A A;  3VA6 A;  4XEI C;  5FQD A;  4ERY A;  3V5W B;  3I2N A;  5H14 A;  3EI1 B;  2OVP B;  3I89 A;  4Y7R A;  3SJL D;  3RMZ D;  3OL2 A;  3PXT D;  3UVO A;  5CXC A;  4PSX B;  1VYH C;  3I7N A;  3DSM A;  4GMB A;  4GM3 A;  5GXH A;  3MKQ A;  4CI2 A;  5FKT A;  4YVD A;  4BL0 A;  2IUQ A;  4J77 A;  5GMK n;  3ULE C;  2HJB A;  2EBS A;  5I5J A;  3V7D B;  2AGW A;  2GNQ A;  3VH0 A;  1B9X A;  5HQG A;  4CC9 A;  3MZK A;  3EI4 B;  2Z2P A;  4O3T B;  5SXM A;  3BG1 A;  4ERQ A;  1SQJ A;  4J86 A;  1P22 A;  4PC0 A;  3PXW D;  5FKS A;  4HDJ A;  5I5I A;  3EI1 A;  2CN3 A;  5HYN B;  2H9M A;  3RLM D;  3F3G A;  5CYK B;  2AGL A;  4JD2 C;  2H3X A;  3AH8 B;  3L4M D;  4O1Q D;  4O45 A;  3I7P A;  2P9I C;  2Z2N A;  2AQ5 A;  3F3P A;  3I7L A;  4CI1 A;  3EU7 A;  5IT9 g;  1XIP A;  2YNN A;  3I7O A;  4X61 B;  4JSX C;  5HE0 B;  2HKM A;  3AL8 B;  5EM2 B;  5JWZ A;  2UZX B;  4IA9 A;  5H17 A;  4ZOZ A;  3EI4 A;  3PSC B;  4KFM B;  3J80 g;  1FWX A;  4FA1 D;  2OK6 A;  2B5M A;  4PXW A;  4L3H D;  2GC4 A;  3AFC A;  2YB8 B;  2H6N A;  3RN1 D;  1B9Y A;  5CYK A;  2CE8 A;  3JZH A;  1R5M A;  3ORV D;  4U1E I;  4J78 A;  2CN2 A;  4H5I A;  4GGA A;  4TZ4 A;  3SN6 B;  3BG0 A;  2CO0 C;  3JPX A;  5FKR A;  4E54 B;  1YFQ A;  2G99 A;  2P9U C;  3AL9 A;  3SFZ A;  3C5M A;  4ERZ A;  4CI8 A;  5EMJ B;  3CIK B;  4CY3 A;  4EWR A;  3F3F A;  3SBP A;  3MMY A;  1SHY B;  3AL8 A;  4J73 A;  4JXM A;  4J0W A;  5TDH B;  2OJY A;  2YMU A;  4FB1 D;  4LG9 A;  2AH1 A;  3I8C A;  3FM0 A;  4UI9 R;  1N6D A;  3FGB A;  2IWF A;  4AOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...