5GMKn

Cryo-em structure of the catalytic step i spliceosome (c complex) at 3.4 angstrom resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
405
structure length
299
Chain Sequence
FTKSELKRRRKTRKGDGPWGSWSPKKVIRNYPGHPEGTTALKFLPKTGHLILSGGNDHTIKIWDFECLRDFQGHNKPIKALRFTEDCQSFLSSSFDRSVKIWDTETGKVKTRLHLNSTPADVESRPTNPHEFIVGLSNSKILHYDDVQTYDHHLSSILALKYFPDGSKFISSSEDKTVRIWENQINVPIKQISDTASMPFLNVHPNYFCAQSMDNRIYSFSKYKRHPKKIHSSAGYGISLAFSGDGRYICSGDSKSRLFTWDWNTSRLLIPGNKPITQVDWHPSKVICSGAAGKIYVCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords Pre-mRNA-splicing factor 8
publication title Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
pubmed doi rcsb
total genus 36
structure length 299
sequence length 405
ec nomenclature
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
n PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5gmkn00
4ERYA 2I0RA 2O9KA 5C2WB 4O3TB 3C5MA 4NSXA 3JRPA 4ZOZA 1U4CA 1TBGA 1NEXB 2W18A 4OZUA 4GQ1A 4U1EI 3V7DB 3SBPA 3V9FA 5EMLB 5KDOB 2UZYB 3UKRC 2PBIB 3BG0A 1B9YA 3AL8A 3RN0D 4FAVD 5IGOA 5FXYA 3MKSB 2IUQA 5EMJB 5IJ8E 5EMKB 3OW8A 5H17A 3RMZD 2OVPB 2P9UC 3RFHA 3IIYA 3IIWA 3OL2B 4PBYA 3DM0A 5HE1B 2OVQB 4CZXA 3JB9L 2HJBA 1SQ9A 2PM9B 4GQ2P 4ZOVA 4O9DA 5EALA 4CY5A 5IT9g 3SN6B 2IUPA 4GMBA 2P9IC 3U4YA 2IWKA 1JMZB 2YB8B 5AMSA 3OKWA 5IC7A 3J81g 3A0FA 1MG3A 2IAAA 4X3EA 4D6VA 3I7OA 4FA9D 3SMRA 3C99A 3IKOA 4JD2C 4KFMB 4A0AA 4G56B 1U2VC 1K32A 4CI1A 2CO0A 2BBKH 5CXCA 2HYEA 5C9ZB 5FA5B 3VGZA 2AH0A 1R5MA 3ORVD 4BH6A 3RFGA 1S4UX 2B5MA 5K1CC 2H9PA 3L4OD 5GXIA 2XL2A 5HE0B 4PC0A 3DXKC 4CZYA 4CY1A 4OWRA 2MTAH 2HKRA 3EI3B 2HESX 3BWSA 1Q47A 2Z2NA 5EM2A 4ZN4A 3NVXA 4H5JA 4J73A 3E0CA 3MXXA 3ZWLB 4ERQA 3B7FA 4O45A 3SLED 3AL8B 2YNOA 3PSCB 4O3UB 5TEFA 3N0EA 3J80g 4MK0B 2YMUA 2OIZA 4E5ZA 4JXMA 3PXWD 3UVNA 3VH0A 4XYIA 3DXMC 2GC4A 1TYQC 2Q7QA 3EMHA 2B4EA 2EBSA 4A08B 3C9CA 1NR0A 3JZNA 2IUVA 2P9PC 5CYKA 4R7AB 3SWSD 4E54A 1XKSA 2CN2A 4YVDA 4A0BA 3PXSD 4L1QD 3RSEC 5FQDA 2XYIA 3I8EA 4X63B 2QXVA 4L3HD 4A09A 4Y5RD 4CC9A 4J82A 5GSAA 3AH8B 2IURA 3MZLA 2P9SC 5SXMA 3UR4A 5FLXg 3UVMA 2AH1A 5CXBA 3KRWB 3IJ0A 2AGXA 4LG9A 4FWWA 4JSPC 2QC5A 4GM3A 1A0RB 4FA1D 4K3ID 1JMXB 1ERJA 3SBQA 5CXCB 2H68A 5EARA 4J8BA 3I7KA 5HE2B 3F3FA 3EI1A 1PI6A 5I5IA 3EI2A 4ERZA 1XHMA 1GXRA 1GP2B 3BG1A 3C75H 3N0DA 4J8GA 3PE7A 4FAND 3ODTA 3MMYA 5JWZA 3I89A 3I7NA 2CE9A 4PXWA 2CNXA 4J87A 1PEVA 2OJYA 3GFCA 4GM8A 2H9MA 2I0SA 2H9NA 4IA9A 4BL0A 2CN3A 4CI2A 3ULEC 4J0WA 3SCYA 2H6QA 1N6EA 3OKYB 1XIPA 5K19A 5HQGA 4J78A 2P9NC 1PBYB 3IJCA 4ZOYA 2H13A 3AL9A 4HDJA 1GOTB 3DSMA 1L0QA 3I7HA 3P4FA 4E54B 1PGUA 2XU7A 3IJ1A 1FWXA 1N6FA 4BUJC 3PVUB 5AJAA 2PM7B 2TRCB 4J81A 3DWLC 3K26A 4A09B 1JOFA 3I7LA 3JZGA 5THAA 3OL2A 2PM6B 4LGNA 3SFZA 5IGQA 2H3XA 2B5NA 4LG8A 1OLZA 1RI6A 2PM9A 2XL3A 2H9LA 3CIKB 3RLMD 4JT5C 1VYHC 2G99A 3NVQA 4QT8A 4A7JA 2YBAA 5IJ7E 3W15A 3SXTD 4GZ8A 4EWRA 4QRJA 5TF2A 4PNKB 5I5JA 3RN1D 2CE8A 4TZ4A 2OK6A 4L3GD 4IMMA 2GC7A 3K27A 3FGBA 4U7AA 4X61B 1MDAH 3UVOA 2G9AA 4ESGA 4Y7RA 2P9KC 4FA5D 4CY2A 4GGDA 2AGWA 2P9LC 3FRXA 2H6NA 5EAPA 2OK4A 2H6KA 5TEEA 1K8KC 2Z2OA 3CFVA 2J55H 4GM9A 3HFQA 1QNIA 4FA4D 3MKQA 3L4MD 2AQ5A 4JT6C 4A0AB 5C2VB 3EI3A 4ES0A 4J77A 4PSXB 3SHFA 3MZKA 4GGCA 4PSWB 2Z2PA 2AGLA 4J86A 1OMWB 2AGYA 2YNNA 1YFQA 4CI8A 1N6DA 3KRXB 3I7PA 3UVLA 2HJ4A 2IWFA 4CZVA 4AOWA 1GG2B 3PXTD 4GGAA 3EI4A 4A11A 3F3GA 5HE3B 5EM2B 2J56H 3OTTA 4AEZA 4O1QD 4FB1D 4A08A 5EMMB 3JZHA 2OVRB 4GQBB 2BCJB 2YNPA 2UZXB 4J79A 3NVNA 2CO0C 1SQJA 3JAMg 5I5MA 2H47A 4E5ZB 2GNQA 5GXHA 4FHLA 4N14A 4I79A 3UKUC 2AGZA 3RRMC 2HXCA 3SBRA 5AFU3 3GREA 5CYKB 5H1MA 3AFCA 3EG6A 4XYHA 3PSLA 4CY3A 4A0BB 4JSXC 1SHYB 5EAMA 3SJLD 3UVKA 4ZOXA 1MG2A 3I2NA 2H14A 5H14A 5FKRA 1JJUB 4JSVC 3V5WB 5CXBB 5GMKn 4PBZA 3EU7A 3F3PA 3EWEA 3FM0A 4K3JB 4JSNC 5HYNB 5FKSA 3I8CA 3OKTA 4Z8LA 4J0XA 4L9OA 5FKTA 3PVWB 4QL1A 3EI1B 2I3SA 4J84A 3EI2B 4A2MA 5A2Qg 4QQEA 2B5LA 2I3TA 3VA6A 2J57G 3CFSB 5TDHB 4A2LA 4X60B 4D0KA 2HKMA 1P22A 3EI4B 5B4WA 4A11B 3OKYA 2I0TA 4H5IA 3JROA 4CI3A 5FKQA 4UI9R 4XEIC 3JPXA 3SVWD 1B9XA
chains in the Genus database with same CATH superfamily
4IRZA 4ERYA 2I0RA 2O9KA 5C2WB 4O3TB 3C5MA 4NSXA 3JRPA 4WK2A 4ZOZA 1U4CA 1TBGA 1NEXB 1UOOA 2W18A 3MUNA 4OZUA 4GQ1A 4U1EI 4WK0A 3V7DB 3SBPA 3V9FA 4DNUA 5EMLB 5KDOB 3IUJA 2UZYB 3UKRC 2PBIB 3BG0A 2VDMA 4NC4A 1B9YA 1M1XA 3AL8A 3RN0D 4FAVD 3K6SA 5IGOA 5FXYA 3MKSB 3T3MA 2IUQA 1C9IA 5EMJB 5IJ8E 5EMKB 1VE6A 3OW8A 4UM9A 5H17A 3RMZD 2XE4A 2OVPB 2P9UC 1O6GA 4WJKA 3RFHA 3ZDYA 3IIYA 4QAMA 3IIWA 3EQ9A 3OL2B 3OF7A 1U8CA 3DM0A 4PBYA 5HE1B 1UTCA 2OVQB 4CZXA 3JB9L 2HJBA 1SQ9A 2PM9B 5M5SA 4GQ2P 4ZOVA 4O9DA 5E6RA 5EALA 4CY5A 5IT9g 3SN6B 1TYEA 2IUPA 3QI0A 4GMBA 2VDQA 2P9IC 3U4YA 2VDPA 2IWKA 1H2ZA 3NIDA 1JMZB 2YB8B 2QZPA 5AMSA 1VZ2A 3OKWA 5IC7A 3J81g 3A0FA 1MG3A 2IAAA 4X3EA 4D6VA 3I7OA 4FA9D 3SMRA 1QFMA 3C99A 3IKOA 2VDKA 3IVMA 4JD2C 1L5GA 4KFMB 4A0AA 4G56B 1U2VC 3VI4A 4AMZA 1K32A 4CI1A 1H2WA 3FCUA 2CO0A 2BBKH 4BCDA 5CXCA 5M5TA 5C9ZB 2HYEA 5FA5B 3VGZA 2AH0A 1R5MA 3ORVD 5FFOA 4BH6A 3RFGA 1S4UX 2QR5A 2B5MA 3EQ8A 4BP9A 4Z7NA 5K1CC 2H9PA 3L4OD 5GXIA 2XL2A 3K72A 5HE0B 4PC0A 3DXKC 4CZYA 4CY1A 4OWRA 1VZ3A 2MTAH 2HKRA 4RE6A 3EI3B 1K3IA 2HESX 3ZE2A 3BWSA 1Q47A 2Z2NA 5EM2A 4ZN4A 4RE5A 3NVXA 4H5JA 4J73A 3FCSA 3E0CA 3MXXA 3ZWLB 5E6UA 1VE7A 3IULA 4ERQA 3B7FA 4O45A 2XZGA 3O4JA 3SLED 3AL8B 4AMYA 2YNOA 1E5TA 3PSCB 4O3UB 4NENA 3N0EA 5TEFA 3J80g 4MK0B 2YMUA 2OIZA 4E5ZA 4JXMA 3PXWD 3UVNA 4O02A 3VH0A 4XYIA 3DXMC 2GC4A 1TYQC 2Q7QA 3EMHA 2B4EA 2EBSA 4A08B 3IUQA 3ZDXA 5E6SA 3DDUA 3C9CA 4O2WA 1NR0A 3JZNA 4L1MA 2IUVA 2P9PC 5CYKA 4R7AB 5C92A 2VZ1A 3SWSD 4E54A 1XKSA 2CN2A 4YVDA 4AX4A 4A0BA 3PXSD 4L1QD 3RSEC 5FQDA 2XYIA 3I8EA 4X63B 2QXVA 4L3HD 4A09A 4Y5RD 4CC9A 4J82A 3ZDZA 5GSAA 3AH8B 2IURA 3MZLA 2P9SC 5SXMA 3UR4A 5FLXg 4JHPC 3UVMA 2AH1A 5CXBA 3KRWB 3IJ0A 2AGXA 4LG9A 4MMYA 4FWWA 2JKXA 4JSPC 2QC5A 4MMZA 1I2MB 1A0RB 4GM3A 4FA1D 5C86A 4K3ID 5M5UA 1JMXB 1ERJA 1JTDB 3EQ7A 4JHNA 5CXCB 2H68A 3SBQA 5EARA 3IURA 4J8BA 3I7KA 5HE2B 3F3FA 3EI1A 1PI6A 5I5IA 3EI2A 4ERZA 1XHMA 1GXRA 5M61A 1GP2B 5HDBA 3BG1A 3C75H 3N0DA 4J8GA 3PE7A 4Z7OA 4FAND 2HU8A 3ODTA 3MMYA 5JWZA 3I89A 3I7NA 1H2XA 2CE9A 3GC3B 4PXWA 2CNXA 4J87A 2XDWA 1PEVA 1UOQA 2EIDA 4Z7QA 2OJYA 3GFCA 4GM8A 2H9MA 3QHYB 2I0SA 2H9NA 4IA9A 4BL0A 4BCCA 2CN3A 4CI2A 3ULEC 3O4GA 4J0WA 3SCYA 2H6QA 3O4IA 1YR2A 1N6EA 3OKYB 1XIPA 5K19A 5HQGA 4J78A 2P9NC 1PBYB 3IJCA 4ZOYA 4G55A 2H13A 3AL9A 4HDJA 3MVDK 1GOTB 3DSMA 1L0QA 3I7HA 3P4FA 4E54B 1PGUA 2XU7A 4DNWA 3IJ1A 4NAAA 2VDOA 1FWXA 1N6FA 3ZE0A 4BUJC 4NBMA 3PVUB 5AJAA 2PM7B 2TRCB 3V4VA 4J81A 3DWLC 3K26A 4A09B 1JOFA 3I7LA 2WQ8A 3JZGA 5THAA 2EIEA 3OL2A 2PM6B 4LGNA 3SFZA 3VI3A 5IGQA 2H3XA 2B5NA 4LG8A 2BKLA 1OLZA 1RI6A 2PM9A 2XL3A 2H9LA 3NIGA 3CIKB 3RLMD 4JT5C 1VYHC 2G99A 1GOHA 2EICA 3NVQA 3ZE1A 4QT8A 4A7JA 2YBAA 5IJ7E 3W15A 3SXTD 4GZ8A 5M5RA 4EWRA 4QRJA 5M5VA 5TF2A 4PNKB 5I5JA 3RN1D 1UOPA 2CE8A 4TZ4A 3K71A 2OK6A 4L3GD 4IMMA 2GC7A 3K27A 3FGBA 3KCIA 4U7AA 4X61B 1MDAH 3UVOA 2G9AA 4ESGA 4Y7RA 1H2YA 2P9KC 4FA5D 4CY2A 4GGDA 2AGWA 2EIBA 2P9LC 3FRXA 2H6NA 5EAPA 2OK4A 2H6KA 5TEEA 1K8KC 2Z2OA 3CFVA 2J55H 4GM9A 3HFQA 4MMXA 1QNIA 4FA4D 3MKQA 3L4MD 2AQ5A 4JT6C 4A0AB 5C2VB 3EI3A 4ES0A 2HU7A 4J77A 4PSXB 4AN1A 3SHFA 3MZKA 4GGCA 4PSWB 2Z2PA 2AGLA 1GOFA 4D9SA 4J86A 1OMWB 2AGYA 2VDLA 4G1MA 2YNNA 1E8NA 3MUOA 1YFQA 4CI8A 1N6DA 3KRXB 2VDRA 3I7PA 3UVLA 2HJ4A 2IWFA 4CZVA 4AOWA 1GG2B 3PXTD 1GOGA 4GGAA 3EI4A 4A11A 3F3GA 5HE3B 5EM2B 2J56H 3OTTA 5FFGA 4AEZA 4O1QD 4FB1D 4A08A 5EMMB 3JZHA 4UM8A 2OVRB 4GQBB 2BCJB 3SVWD 2YNPA 2UZXB 4J79A 3NVNA 2CO0C 1SQJA 3JAMg 5I5MA 2H47A 4E5ZB 3V4PA 2GNQA 5GXHA 4FHLA 4N14A 4I79A 3UKUC 2AGZA 3RRMC 2HXCA 3SBRA 5AFU3 3GREA 5CYKB 3IUNA 5H1MA 3AFCA 3EG6A 1C9LA 4XYHA 3PSLA 4CY3A 4A0BB 1O6FA 4JSXC 4AN0A 1SHYB 2VDNA 5EAMA 3SJLD 3O4HA 3UVKA 2HU5A 1A12A 4ZOXA 1MG2A 3I2NA 2H14A 5H14A 5FKRA 1JJUB 4JSVC 3V5WB 5CXBB 5GMKn 4PBZA 3EU7A 3IJEA 3F3PA 3EWEA 3FM0A 4K3JB 4JSNC 5HYNB 5FKSA 3I8CA 3OKTA 4BCBA 4Z8LA 4J0XA 4L9OA 5FKTA 3PVWB 4QL1A 1QFSA 3EI1B 4G1EA 3GD1I 1BPOA 2I3SA 4J84A 3IUMA 4A2MA 5A2Qg 3EI2B 4QQEA 3NIFA 2B5LA 2I3TA 1JV2A 3VA6A 2J57G 3CFSB 5TDHB 4A2LA 4X60B 4D0KA 1T2XA 2HKMA 1P22A 2VC2A 3EI4B 5B4WA 4A11B 3OKYA 2I0TA 1E8MA 4BP8A 4H5IA 3JROA 4CI3A 4DNVA 5FKQA 3T3PA 4UI9R 4WK4A 3JPXA 4XEIC 2VZ3A 1B9XA
chains in the Genus database with same CATH topology
4ERYA 2I0RA 2O9KA 5C2WB 4O3TB 3C5MA 4NSXA 3JRPA 4ZOZA 1U4CA 1TBGA 1NEXB 2W18A 4OZUA 4GQ1A 4U1EI 3V7DB 3SBPA 3V9FA 5EMLB 5KDOB 2UZYB 3UKRC 2PBIB 3BG0A 1B9YA 3AL8A 3RN0D 4FAVD 5IGOA 5FXYA 3MKSB 2IUQA 5EMJB 5IJ8E 5EMKB 3OW8A 5H17A 3RMZD 2OVPB 2P9UC 3RFHA 3IIYA 3IIWA 3OL2B 4PBYA 3DM0A 5HE1B 2OVQB 4CZXA 3JB9L 2HJBA 1SQ9A 2PM9B 4GQ2P 4ZOVA 4O9DA 5EALA 4CY5A 5IT9g 3SN6B 2IUPA 4GMBA 2P9IC 3U4YA 2IWKA 1JMZB 2YB8B 5AMSA 3OKWA 5IC7A 3J81g 3A0FA 1MG3A 2IAAA 4X3EA 4D6VA 3I7OA 4FA9D 3SMRA 3C99A 3IKOA 4JD2C 4KFMB 4A0AA 4G56B 1U2VC 1K32A 4CI1A 2CO0A 2BBKH 5CXCA 2HYEA 5C9ZB 5FA5B 3VGZA 2AH0A 1R5MA 3ORVD 4BH6A 3RFGA 1S4UX 2B5MA 5K1CC 2H9PA 3L4OD 5GXIA 2XL2A 5HE0B 4PC0A 3DXKC 4CZYA 4CY1A 4OWRA 2MTAH 2HKRA 3EI3B 2HESX 3BWSA 1Q47A 2Z2NA 5EM2A 4ZN4A 3NVXA 4H5JA 4J73A 3E0CA 3MXXA 3ZWLB 4ERQA 3B7FA 4O45A 3SLED 3AL8B 2YNOA 3PSCB 4O3UB 5TEFA 3N0EA 3J80g 4MK0B 2YMUA 2OIZA 4E5ZA 4JXMA 3PXWD 3UVNA 3VH0A 4XYIA 3DXMC 2GC4A 1TYQC 2Q7QA 3EMHA 2B4EA 2EBSA 4A08B 3C9CA 1NR0A 3JZNA 2IUVA 2P9PC 5CYKA 4R7AB 3SWSD 4E54A 1XKSA 2CN2A 4YVDA 4A0BA 3PXSD 4L1QD 3RSEC 5FQDA 2XYIA 3I8EA 4X63B 2QXVA 4L3HD 4A09A 4Y5RD 4CC9A 4J82A 5GSAA 3AH8B 2IURA 3MZLA 2P9SC 5SXMA 3UR4A 5FLXg 3UVMA 2AH1A 5CXBA 3KRWB 3IJ0A 2AGXA 4LG9A 4FWWA 4JSPC 2QC5A 4GM3A 1A0RB 4FA1D 4K3ID 1JMXB 1ERJA 3SBQA 5CXCB 2H68A 5EARA 4J8BA 3I7KA 5HE2B 3F3FA 3EI1A 1PI6A 5I5IA 3EI2A 4ERZA 1XHMA 1GXRA 1GP2B 3BG1A 3C75H 3N0DA 4J8GA 3PE7A 4FAND 3ODTA 3MMYA 5JWZA 3I89A 3I7NA 2CE9A 4PXWA 2CNXA 4J87A 1PEVA 2OJYA 3GFCA 4GM8A 2H9MA 2I0SA 2H9NA 4IA9A 4BL0A 2CN3A 4CI2A 3ULEC 4J0WA 3SCYA 2H6QA 1N6EA 3OKYB 1XIPA 5K19A 5HQGA 4J78A 2P9NC 1PBYB 3IJCA 4ZOYA 2H13A 3AL9A 4HDJA 1GOTB 3DSMA 1L0QA 3I7HA 3P4FA 4E54B 1PGUA 2XU7A 3IJ1A 1FWXA 1N6FA 4BUJC 3PVUB 5AJAA 2PM7B 2TRCB 4J81A 3DWLC 3K26A 4A09B 1JOFA 3I7LA 3JZGA 5THAA 3OL2A 2PM6B 4LGNA 3SFZA 5IGQA 2H3XA 2B5NA 4LG8A 1OLZA 1RI6A 2PM9A 2XL3A 2H9LA 3CIKB 3RLMD 4JT5C 1VYHC 2G99A 3NVQA 4QT8A 4A7JA 2YBAA 5IJ7E 3W15A 3SXTD 4GZ8A 4EWRA 4QRJA 5TF2A 4PNKB 5I5JA 3RN1D 2CE8A 4TZ4A 2OK6A 4L3GD 4IMMA 2GC7A 3K27A 3FGBA 4U7AA 4X61B 1MDAH 3UVOA 2G9AA 4ESGA 4Y7RA 2P9KC 4FA5D 4CY2A 4GGDA 2AGWA 2P9LC 3FRXA 2H6NA 5EAPA 2OK4A 2H6KA 5TEEA 1K8KC 2Z2OA 3CFVA 2J55H 4GM9A 3HFQA 1QNIA 4FA4D 3MKQA 3L4MD 2AQ5A 4JT6C 4A0AB 5C2VB 3EI3A 4ES0A 4J77A 4PSXB 3SHFA 3MZKA 4GGCA 4PSWB 2Z2PA 2AGLA 4J86A 1OMWB 2AGYA 2YNNA 1YFQA 4CI8A 1N6DA 3KRXB 3I7PA 3UVLA 2HJ4A 2IWFA 4CZVA 4AOWA 1GG2B 3PXTD 4GGAA 3EI4A 4A11A 3F3GA 5HE3B 5EM2B 2J56H 3OTTA 4AEZA 4O1QD 4FB1D 4A08A 5EMMB 3JZHA 2OVRB 4GQBB 2BCJB 2YNPA 2UZXB 4J79A 3NVNA 2CO0C 1SQJA 3JAMg 5I5MA 2H47A 4E5ZB 2GNQA 5GXHA 4FHLA 4N14A 4I79A 3UKUC 2AGZA 3RRMC 2HXCA 3SBRA 5AFU3 3GREA 5CYKB 5H1MA 3AFCA 3EG6A 4XYHA 3PSLA 4CY3A 4A0BB 4JSXC 1SHYB 5EAMA 3SJLD 3UVKA 4ZOXA 1MG2A 3I2NA 2H14A 5H14A 5FKRA 1JJUB 4JSVC 3V5WB 5CXBB 5GMKn 4PBZA 3EU7A 3F3PA 3EWEA 3FM0A 4K3JB 4JSNC 5HYNB 5FKSA 3I8CA 3OKTA 4Z8LA 4J0XA 4L9OA 5FKTA 3PVWB 4QL1A 3EI1B 2I3SA 4J84A 3EI2B 4A2MA 5A2Qg 4QQEA 2B5LA 2I3TA 3VA6A 2J57G 3CFSB 5TDHB 4A2LA 4X60B 4D0KA 2HKMA 1P22A 3EI4B 5B4WA 4A11B 3OKYA 2I0TA 4H5IA 3JROA 4CI3A 5FKQA 4UI9R 4XEIC 3JPXA 3SVWD 1B9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ERY A;  2I0R A;  2O9K A;  5C2W B;  4O3T B;  3C5M A;  4NSX A;  3JRP A;  4ZOZ A;  1U4C A;  1TBG A;  1NEX B;  2W18 A;  4OZU A;  4GQ1 A;  4U1E I;  3V7D B;  3SBP A;  3V9F A;  5EML B;  5KDO B;  2UZY B;  3UKR C;  2PBI B;  3BG0 A;  1B9Y A;  3AL8 A;  3RN0 D;  4FAV D;  5IGO A;  5FXY A;  3MKS B;  2IUQ A;  5EMJ B;  5IJ8 E;  5EMK B;  3OW8 A;  5H17 A;  3RMZ D;  2OVP B;  2P9U C;  3RFH A;  3IIY A;  3IIW A;  3OL2 B;  4PBY A;  3DM0 A;  5HE1 B;  2OVQ B;  4CZX A;  3JB9 L;  2HJB A;  1SQ9 A;  2PM9 B;  4GQ2 P;  4ZOV A;  4O9D A;  5EAL A;  4CY5 A;  5IT9 g;  3SN6 B;  2IUP A;  4GMB A;  2P9I C;  3U4Y A;  2IWK A;  1JMZ B;  2YB8 B;  5AMS A;  3OKW A;  5IC7 A;  3J81 g;  3A0F A;  1MG3 A;  2IAA A;  4X3E A;  4D6V A;  3I7O A;  4FA9 D;  3SMR A;  3C99 A;  3IKO A;  4JD2 C;  4KFM B;  4A0A A;  4G56 B;  1U2V C;  1K32 A;  4CI1 A;  2CO0 A;  2BBK H;  5CXC A;  2HYE A;  5C9Z B;  5FA5 B;  3VGZ A;  2AH0 A;  1R5M A;  3ORV D;  4BH6 A;  3RFG A;  1S4U X;  2B5M A;  5K1C C;  2H9P A;  3L4O D;  5GXI A;  2XL2 A;  5HE0 B;  4PC0 A;  3DXK C;  4CZY A;  4CY1 A;  4OWR A;  2MTA H;  2HKR A;  3EI3 B;  2HES X;  3BWS A;  1Q47 A;  2Z2N A;  5EM2 A;  4ZN4 A;  3NVX A;  4H5J A;  4J73 A;  3E0C A;  3MXX A;  3ZWL B;  4ERQ A;  3B7F A;  4O45 A;  3SLE D;  3AL8 B;  2YNO A;  3PSC B;  4O3U B;  5TEF A;  3N0E A;  3J80 g;  4MK0 B;  2YMU A;  2OIZ A;  4E5Z A;  4JXM A;  3PXW D;  3UVN A;  3VH0 A;  4XYI A;  3DXM C;  2GC4 A;  1TYQ C;  2Q7Q A;  3EMH A;  2B4E A;  2EBS A;  4A08 B;  3C9C A;  1NR0 A;  3JZN A;  2IUV A;  2P9P C;  5CYK A;  4R7A B;  3SWS D;  4E54 A;  1XKS A;  2CN2 A;  4YVD A;  4A0B A;  3PXS D;  4L1Q D;  3RSE C;  5FQD A;  2XYI A;  3I8E A;  4X63 B;  2QXV A;  4L3H D;  4A09 A;  4Y5R D;  4CC9 A;  4J82 A;  5GSA A;  3AH8 B;  2IUR A;  3MZL A;  2P9S C;  5SXM A;  3UR4 A;  5FLX g;  3UVM A;  2AH1 A;  5CXB A;  3KRW B;  3IJ0 A;  2AGX A;  4LG9 A;  4FWW A;  4JSP C;  2QC5 A;  4GM3 A;  1A0R B;  4FA1 D;  4K3I D;  1JMX B;  1ERJ A;  3SBQ A;  5CXC B;  2H68 A;  5EAR A;  4J8B A;  3I7K A;  5HE2 B;  3F3F A;  3EI1 A;  1PI6 A;  5I5I A;  3EI2 A;  4ERZ A;  1XHM A;  1GXR A;  1GP2 B;  3BG1 A;  3C75 H;  3N0D A;  4J8G A;  3PE7 A;  4FAN D;  3ODT A;  3MMY A;  5JWZ A;  3I89 A;  3I7N A;  2CE9 A;  4PXW A;  2CNX A;  4J87 A;  1PEV A;  2OJY A;  3GFC A;  4GM8 A;  2H9M A;  2I0S A;  2H9N A;  4IA9 A;  4BL0 A;  2CN3 A;  4CI2 A;  3ULE C;  4J0W A;  3SCY A;  2H6Q A;  1N6E A;  3OKY B;  1XIP A;  5K19 A;  5HQG A;  4J78 A;  2P9N C;  1PBY B;  3IJC A;  4ZOY A;  2H13 A;  3AL9 A;  4HDJ A;  1GOT B;  3DSM A;  1L0Q A;  3I7H A;  3P4F A;  4E54 B;  1PGU A;  2XU7 A;  3IJ1 A;  1FWX A;  1N6F A;  4BUJ C;  3PVU B;  5AJA A;  2PM7 B;  2TRC B;  4J81 A;  3DWL C;  3K26 A;  4A09 B;  1JOF A;  3I7L A;  3JZG A;  5THA A;  3OL2 A;  2PM6 B;  4LGN A;  3SFZ A;  5IGQ A;  2H3X A;  2B5N A;  4LG8 A;  1OLZ A;  1RI6 A;  2PM9 A;  2XL3 A;  2H9L A;  3CIK B;  3RLM D;  4JT5 C;  1VYH C;  2G99 A;  3NVQ A;  4QT8 A;  4A7J A;  2YBA A;  5IJ7 E;  3W15 A;  3SXT D;  4GZ8 A;  4EWR A;  4QRJ A;  5TF2 A;  4PNK B;  5I5J A;  3RN1 D;  2CE8 A;  4TZ4 A;  2OK6 A;  4L3G D;  4IMM A;  2GC7 A;  3K27 A;  3FGB A;  4U7A A;  4X61 B;  1MDA H;  3UVO A;  2G9A A;  4ESG A;  4Y7R A;  2P9K C;  4FA5 D;  4CY2 A;  4GGD A;  2AGW A;  2P9L C;  3FRX A;  2H6N A;  5EAP A;  2OK4 A;  2H6K A;  5TEE A;  1K8K C;  2Z2O A;  3CFV A;  2J55 H;  4GM9 A;  3HFQ A;  1QNI A;  4FA4 D;  3MKQ A;  3L4M D;  2AQ5 A;  4JT6 C;  4A0A B;  5C2V B;  3EI3 A;  4ES0 A;  4J77 A;  4PSX B;  3SHF A;  3MZK A;  4GGC A;  4PSW B;  2Z2P A;  2AGL A;  4J86 A;  1OMW B;  2AGY A;  2YNN A;  1YFQ A;  4CI8 A;  1N6D A;  3KRX B;  3I7P A;  3UVL A;  2HJ4 A;  2IWF A;  4CZV A;  4AOW A;  1GG2 B;  3PXT D;  4GGA A;  3EI4 A;  4A11 A;  3F3G A;  5HE3 B;  5EM2 B;  2J56 H;  3OTT A;  4AEZ A;  4O1Q D;  4FB1 D;  4A08 A;  5EMM B;  3JZH A;  2OVR B;  4GQB B;  2BCJ B;  2YNP A;  2UZX B;  4J79 A;  3NVN A;  2CO0 C;  1SQJ A;  3JAM g;  5I5M A;  2H47 A;  4E5Z B;  2GNQ A;  5GXH A;  4FHL A;  4N14 A;  4I79 A;  3UKU C;  2AGZ A;  3RRM C;  2HXC A;  3SBR A;  5AFU 3;  3GRE A;  5CYK B;  5H1M A;  3AFC A;  3EG6 A;  4XYH A;  3PSL A;  4CY3 A;  4A0B B;  4JSX C;  1SHY B;  5EAM A;  3SJL D;  3UVK A;  4ZOX A;  1MG2 A;  3I2N A;  2H14 A;  5H14 A;  5FKR A;  1JJU B;  4JSV C;  3V5W B;  5CXB B;  5GMK n;  4PBZ A;  3EU7 A;  3F3P A;  3EWE A;  3FM0 A;  4K3J B;  4JSN C;  5HYN B;  5FKS A;  3I8C A;  3OKT A;  4Z8L A;  4J0X A;  4L9O A;  5FKT A;  3PVW B;  4QL1 A;  3EI1 B;  2I3S A;  4J84 A;  3EI2 B;  4A2M A;  5A2Q g;  4QQE A;  2B5L A;  2I3T A;  3VA6 A;  2J57 G;  3CFS B;  5TDH B;  4A2L A;  4X60 B;  4D0K A;  2HKM A;  1P22 A;  3EI4 B;  5B4W A;  4A11 B;  3OKY A;  2I0T A;  4H5I A;  3JRO A;  4CI3 A;  5FKQ A;  4UI9 R;  4XEI C;  3JPX A;  3SVW D;  1B9X A; 
#chains in the Genus database with same CATH topology
 4IRZ A;  4ERY A;  2I0R A;  2O9K A;  5C2W B;  4O3T B;  3C5M A;  4NSX A;  3JRP A;  4WK2 A;  4ZOZ A;  1U4C A;  1TBG A;  1NEX B;  1UOO A;  2W18 A;  3MUN A;  4OZU A;  4GQ1 A;  4U1E I;  4WK0 A;  3V7D B;  3SBP A;  3V9F A;  4DNU A;  5EML B;  5KDO B;  3IUJ A;  2UZY B;  3UKR C;  2PBI B;  3BG0 A;  2VDM A;  4NC4 A;  1B9Y A;  1M1X A;  3AL8 A;  3RN0 D;  4FAV D;  3K6S A;  5IGO A;  5FXY A;  3MKS B;  3T3M A;  2IUQ A;  1C9I A;  5EMJ B;  5IJ8 E;  5EMK B;  1VE6 A;  3OW8 A;  4UM9 A;  5H17 A;  3RMZ D;  2XE4 A;  2OVP B;  2P9U C;  1O6G A;  4WJK A;  3RFH A;  3ZDY A;  3IIY A;  4QAM A;  3IIW A;  3EQ9 A;  3OL2 B;  3OF7 A;  1U8C A;  3DM0 A;  4PBY A;  5HE1 B;  1UTC A;  2OVQ B;  4CZX A;  3JB9 L;  2HJB A;  1SQ9 A;  2PM9 B;  5M5S A;  4GQ2 P;  4ZOV A;  4O9D A;  5E6R A;  5EAL A;  4CY5 A;  5IT9 g;  3SN6 B;  1TYE A;  2IUP A;  3QI0 A;  4GMB A;  2VDQ A;  2P9I C;  3U4Y A;  2VDP A;  2IWK A;  1H2Z A;  3NID A;  1JMZ B;  2YB8 B;  2QZP A;  5AMS A;  1VZ2 A;  3OKW A;  5IC7 A;  3J81 g;  3A0F A;  1MG3 A;  2IAA A;  4X3E A;  4D6V A;  3I7O A;  4FA9 D;  3SMR A;  1QFM A;  3C99 A;  3IKO A;  2VDK A;  3IVM A;  4JD2 C;  1L5G A;  4KFM B;  4A0A A;  4G56 B;  1U2V C;  3VI4 A;  4AMZ A;  1K32 A;  4CI1 A;  1H2W A;  3FCU A;  2CO0 A;  2BBK H;  4BCD A;  5CXC A;  5M5T A;  5C9Z B;  2HYE A;  5FA5 B;  3VGZ A;  2AH0 A;  1R5M A;  3ORV D;  5FFO A;  4BH6 A;  3RFG A;  1S4U X;  2QR5 A;  2B5M A;  3EQ8 A;  4BP9 A;  4Z7N A;  5K1C C;  2H9P A;  3L4O D;  5GXI A;  2XL2 A;  3K72 A;  5HE0 B;  4PC0 A;  3DXK C;  4CZY A;  4CY1 A;  4OWR A;  1VZ3 A;  2MTA H;  2HKR A;  4RE6 A;  3EI3 B;  1K3I A;  2HES X;  3ZE2 A;  3BWS A;  1Q47 A;  2Z2N A;  5EM2 A;  4ZN4 A;  4RE5 A;  3NVX A;  4H5J A;  4J73 A;  3FCS A;  3E0C A;  3MXX A;  3ZWL B;  5E6U A;  1VE7 A;  3IUL A;  4ERQ A;  3B7F A;  4O45 A;  2XZG A;  3O4J A;  3SLE D;  3AL8 B;  4AMY A;  2YNO A;  1E5T A;  3PSC B;  4O3U B;  4NEN A;  3N0E A;  5TEF A;  3J80 g;  4MK0 B;  2YMU A;  2OIZ A;  4E5Z A;  4JXM A;  3PXW D;  3UVN A;  4O02 A;  3VH0 A;  4XYI A;  3DXM C;  2GC4 A;  1TYQ C;  2Q7Q A;  3EMH A;  2B4E A;  2EBS A;  4A08 B;  3IUQ A;  3ZDX A;  5E6S A;  3DDU A;  3C9C A;  4O2W A;  1NR0 A;  3JZN A;  4L1M A;  2IUV A;  2P9P C;  5CYK A;  4R7A B;  5C92 A;  2VZ1 A;  3SWS D;  4E54 A;  1XKS A;  2CN2 A;  4YVD A;  4AX4 A;  4A0B A;  3PXS D;  4L1Q D;  3RSE C;  5FQD A;  2XYI A;  3I8E A;  4X63 B;  2QXV A;  4L3H D;  4A09 A;  4Y5R D;  4CC9 A;  4J82 A;  3ZDZ A;  5GSA A;  3AH8 B;  2IUR A;  3MZL A;  2P9S C;  5SXM A;  3UR4 A;  5FLX g;  4JHP C;  3UVM A;  2AH1 A;  5CXB A;  3KRW B;  3IJ0 A;  2AGX A;  4LG9 A;  4MMY A;  4FWW A;  2JKX A;  4JSP C;  2QC5 A;  4MMZ A;  1I2M B;  1A0R B;  4GM3 A;  4FA1 D;  5C86 A;  4K3I D;  5M5U A;  1JMX B;  1ERJ A;  1JTD B;  3EQ7 A;  4JHN A;  5CXC B;  2H68 A;  3SBQ A;  5EAR A;  3IUR A;  4J8B A;  3I7K A;  5HE2 B;  3F3F A;  3EI1 A;  1PI6 A;  5I5I A;  3EI2 A;  4ERZ A;  1XHM A;  1GXR A;  5M61 A;  1GP2 B;  5HDB A;  3BG1 A;  3C75 H;  3N0D A;  4J8G A;  3PE7 A;  4Z7O A;  4FAN D;  2HU8 A;  3ODT A;  3MMY A;  5JWZ A;  3I89 A;  3I7N A;  1H2X A;  2CE9 A;  3GC3 B;  4PXW A;  2CNX A;  4J87 A;  2XDW A;  1PEV A;  1UOQ A;  2EID A;  4Z7Q A;  2OJY A;  3GFC A;  4GM8 A;  2H9M A;  3QHY B;  2I0S A;  2H9N A;  4IA9 A;  4BL0 A;  4BCC A;  2CN3 A;  4CI2 A;  3ULE C;  3O4G A;  4J0W A;  3SCY A;  2H6Q A;  3O4I A;  1YR2 A;  1N6E A;  3OKY B;  1XIP A;  5K19 A;  5HQG A;  4J78 A;  2P9N C;  1PBY B;  3IJC A;  4ZOY A;  4G55 A;  2H13 A;  3AL9 A;  4HDJ A;  3MVD K;  1GOT B;  3DSM A;  1L0Q A;  3I7H A;  3P4F A;  4E54 B;  1PGU A;  2XU7 A;  4DNW A;  3IJ1 A;  4NAA A;  2VDO A;  1FWX A;  1N6F A;  3ZE0 A;  4BUJ C;  4NBM A;  3PVU B;  5AJA A;  2PM7 B;  2TRC B;  3V4V A;  4J81 A;  3DWL C;  3K26 A;  4A09 B;  1JOF A;  3I7L A;  2WQ8 A;  3JZG A;  5THA A;  2EIE A;  3OL2 A;  2PM6 B;  4LGN A;  3SFZ A;  3VI3 A;  5IGQ A;  2H3X A;  2B5N A;  4LG8 A;  2BKL A;  1OLZ A;  1RI6 A;  2PM9 A;  2XL3 A;  2H9L A;  3NIG A;  3CIK B;  3RLM D;  4JT5 C;  1VYH C;  2G99 A;  1GOH A;  2EIC A;  3NVQ A;  3ZE1 A;  4QT8 A;  4A7J A;  2YBA A;  5IJ7 E;  3W15 A;  3SXT D;  4GZ8 A;  5M5R A;  4EWR A;  4QRJ A;  5M5V A;  5TF2 A;  4PNK B;  5I5J A;  3RN1 D;  1UOP A;  2CE8 A;  4TZ4 A;  3K71 A;  2OK6 A;  4L3G D;  4IMM A;  2GC7 A;  3K27 A;  3FGB A;  3KCI A;  4U7A A;  4X61 B;  1MDA H;  3UVO A;  2G9A A;  4ESG A;  4Y7R A;  1H2Y A;  2P9K C;  4FA5 D;  4CY2 A;  4GGD A;  2AGW A;  2EIB A;  2P9L C;  3FRX A;  2H6N A;  5EAP A;  2OK4 A;  2H6K A;  5TEE A;  1K8K C;  2Z2O A;  3CFV A;  2J55 H;  4GM9 A;  3HFQ A;  4MMX A;  1QNI A;  4FA4 D;  3MKQ A;  3L4M D;  2AQ5 A;  4JT6 C;  4A0A B;  5C2V B;  3EI3 A;  4ES0 A;  2HU7 A;  4J77 A;  4PSX B;  4AN1 A;  3SHF A;  3MZK A;  4GGC A;  4PSW B;  2Z2P A;  2AGL A;  1GOF A;  4D9S A;  4J86 A;  1OMW B;  2AGY A;  2VDL A;  4G1M A;  2YNN A;  1E8N A;  3MUO A;  1YFQ A;  4CI8 A;  1N6D A;  3KRX B;  2VDR A;  3I7P A;  3UVL A;  2HJ4 A;  2IWF A;  4CZV A;  4AOW A;  1GG2 B;  3PXT D;  1GOG A;  4GGA A;  3EI4 A;  4A11 A;  3F3G A;  5HE3 B;  5EM2 B;  2J56 H;  3OTT A;  5FFG A;  4AEZ A;  4O1Q D;  4FB1 D;  4A08 A;  5EMM B;  3JZH A;  4UM8 A;  2OVR B;  4GQB B;  2BCJ B;  3SVW D;  2YNP A;  2UZX B;  4J79 A;  3NVN A;  2CO0 C;  1SQJ A;  3JAM g;  5I5M A;  2H47 A;  4E5Z B;  3V4P A;  2GNQ A;  5GXH A;  4FHL A;  4N14 A;  4I79 A;  3UKU C;  2AGZ A;  3RRM C;  2HXC A;  3SBR A;  5AFU 3;  3GRE A;  5CYK B;  3IUN A;  5H1M A;  3AFC A;  3EG6 A;  1C9L A;  4XYH A;  3PSL A;  4CY3 A;  4A0B B;  1O6F A;  4JSX C;  4AN0 A;  1SHY B;  2VDN A;  5EAM A;  3SJL D;  3O4H A;  3UVK A;  2HU5 A;  1A12 A;  4ZOX A;  1MG2 A;  3I2N A;  2H14 A;  5H14 A;  5FKR A;  1JJU B;  4JSV C;  3V5W B;  5CXB B;  5GMK n;  4PBZ A;  3EU7 A;  3IJE A;  3F3P A;  3EWE A;  3FM0 A;  4K3J B;  4JSN C;  5HYN B;  5FKS A;  3I8C A;  3OKT A;  4BCB A;  4Z8L A;  4J0X A;  4L9O A;  5FKT A;  3PVW B;  4QL1 A;  1QFS A;  3EI1 B;  4G1E A;  3GD1 I;  1BPO A;  2I3S A;  4J84 A;  3IUM A;  4A2M A;  5A2Q g;  3EI2 B;  4QQE A;  3NIF A;  2B5L A;  2I3T A;  1JV2 A;  3VA6 A;  2J57 G;  3CFS B;  5TDH B;  4A2L A;  4X60 B;  4D0K A;  1T2X A;  2HKM A;  1P22 A;  2VC2 A;  3EI4 B;  5B4W A;  4A11 B;  3OKY A;  2I0T A;  1E8M A;  4BP8 A;  4H5I A;  3JRO A;  4CI3 A;  4DNV A;  5FKQ A;  3T3P A;  4UI9 R;  4WK4 A;  3JPX A;  4XEI C;  2VZ3 A;  1B9X A; 
#chains in the Genus database with same CATH homology
 4ERY A;  2I0R A;  2O9K A;  5C2W B;  4O3T B;  3C5M A;  4NSX A;  3JRP A;  4ZOZ A;  1U4C A;  1TBG A;  1NEX B;  2W18 A;  4OZU A;  4GQ1 A;  4U1E I;  3V7D B;  3SBP A;  3V9F A;  5EML B;  5KDO B;  2UZY B;  3UKR C;  2PBI B;  3BG0 A;  1B9Y A;  3AL8 A;  3RN0 D;  4FAV D;  5IGO A;  5FXY A;  3MKS B;  2IUQ A;  5EMJ B;  5IJ8 E;  5EMK B;  3OW8 A;  5H17 A;  3RMZ D;  2OVP B;  2P9U C;  3RFH A;  3IIY A;  3IIW A;  3OL2 B;  4PBY A;  3DM0 A;  5HE1 B;  2OVQ B;  4CZX A;  3JB9 L;  2HJB A;  1SQ9 A;  2PM9 B;  4GQ2 P;  4ZOV A;  4O9D A;  5EAL A;  4CY5 A;  5IT9 g;  3SN6 B;  2IUP A;  4GMB A;  2P9I C;  3U4Y A;  2IWK A;  1JMZ B;  2YB8 B;  5AMS A;  3OKW A;  5IC7 A;  3J81 g;  3A0F A;  1MG3 A;  2IAA A;  4X3E A;  4D6V A;  3I7O A;  4FA9 D;  3SMR A;  3C99 A;  3IKO A;  4JD2 C;  4KFM B;  4A0A A;  4G56 B;  1U2V C;  1K32 A;  4CI1 A;  2CO0 A;  2BBK H;  5CXC A;  2HYE A;  5C9Z B;  5FA5 B;  3VGZ A;  2AH0 A;  1R5M A;  3ORV D;  4BH6 A;  3RFG A;  1S4U X;  2B5M A;  5K1C C;  2H9P A;  3L4O D;  5GXI A;  2XL2 A;  5HE0 B;  4PC0 A;  3DXK C;  4CZY A;  4CY1 A;  4OWR A;  2MTA H;  2HKR A;  3EI3 B;  2HES X;  3BWS A;  1Q47 A;  2Z2N A;  5EM2 A;  4ZN4 A;  3NVX A;  4H5J A;  4J73 A;  3E0C A;  3MXX A;  3ZWL B;  4ERQ A;  3B7F A;  4O45 A;  3SLE D;  3AL8 B;  2YNO A;  3PSC B;  4O3U B;  5TEF A;  3N0E A;  3J80 g;  4MK0 B;  2YMU A;  2OIZ A;  4E5Z A;  4JXM A;  3PXW D;  3UVN A;  3VH0 A;  4XYI A;  3DXM C;  2GC4 A;  1TYQ C;  2Q7Q A;  3EMH A;  2B4E A;  2EBS A;  4A08 B;  3C9C A;  1NR0 A;  3JZN A;  2IUV A;  2P9P C;  5CYK A;  4R7A B;  3SWS D;  4E54 A;  1XKS A;  2CN2 A;  4YVD A;  4A0B A;  3PXS D;  4L1Q D;  3RSE C;  5FQD A;  2XYI A;  3I8E A;  4X63 B;  2QXV A;  4L3H D;  4A09 A;  4Y5R D;  4CC9 A;  4J82 A;  5GSA A;  3AH8 B;  2IUR A;  3MZL A;  2P9S C;  5SXM A;  3UR4 A;  5FLX g;  3UVM A;  2AH1 A;  5CXB A;  3KRW B;  3IJ0 A;  2AGX A;  4LG9 A;  4FWW A;  4JSP C;  2QC5 A;  4GM3 A;  1A0R B;  4FA1 D;  4K3I D;  1JMX B;  1ERJ A;  3SBQ A;  5CXC B;  2H68 A;  5EAR A;  4J8B A;  3I7K A;  5HE2 B;  3F3F A;  3EI1 A;  1PI6 A;  5I5I A;  3EI2 A;  4ERZ A;  1XHM A;  1GXR A;  1GP2 B;  3BG1 A;  3C75 H;  3N0D A;  4J8G A;  3PE7 A;  4FAN D;  3ODT A;  3MMY A;  5JWZ A;  3I89 A;  3I7N A;  2CE9 A;  4PXW A;  2CNX A;  4J87 A;  1PEV A;  2OJY A;  3GFC A;  4GM8 A;  2H9M A;  2I0S A;  2H9N A;  4IA9 A;  4BL0 A;  2CN3 A;  4CI2 A;  3ULE C;  4J0W A;  3SCY A;  2H6Q A;  1N6E A;  3OKY B;  1XIP A;  5K19 A;  5HQG A;  4J78 A;  2P9N C;  1PBY B;  3IJC A;  4ZOY A;  2H13 A;  3AL9 A;  4HDJ A;  1GOT B;  3DSM A;  1L0Q A;  3I7H A;  3P4F A;  4E54 B;  1PGU A;  2XU7 A;  3IJ1 A;  1FWX A;  1N6F A;  4BUJ C;  3PVU B;  5AJA A;  2PM7 B;  2TRC B;  4J81 A;  3DWL C;  3K26 A;  4A09 B;  1JOF A;  3I7L A;  3JZG A;  5THA A;  3OL2 A;  2PM6 B;  4LGN A;  3SFZ A;  5IGQ A;  2H3X A;  2B5N A;  4LG8 A;  1OLZ A;  1RI6 A;  2PM9 A;  2XL3 A;  2H9L A;  3CIK B;  3RLM D;  4JT5 C;  1VYH C;  2G99 A;  3NVQ A;  4QT8 A;  4A7J A;  2YBA A;  5IJ7 E;  3W15 A;  3SXT D;  4GZ8 A;  4EWR A;  4QRJ A;  5TF2 A;  4PNK B;  5I5J A;  3RN1 D;  2CE8 A;  4TZ4 A;  2OK6 A;  4L3G D;  4IMM A;  2GC7 A;  3K27 A;  3FGB A;  4U7A A;  4X61 B;  1MDA H;  3UVO A;  2G9A A;  4ESG A;  4Y7R A;  2P9K C;  4FA5 D;  4CY2 A;  4GGD A;  2AGW A;  2P9L C;  3FRX A;  2H6N A;  5EAP A;  2OK4 A;  2H6K A;  5TEE A;  1K8K C;  2Z2O A;  3CFV A;  2J55 H;  4GM9 A;  3HFQ A;  1QNI A;  4FA4 D;  3MKQ A;  3L4M D;  2AQ5 A;  4JT6 C;  4A0A B;  5C2V B;  3EI3 A;  4ES0 A;  4J77 A;  4PSX B;  3SHF A;  3MZK A;  4GGC A;  4PSW B;  2Z2P A;  2AGL A;  4J86 A;  1OMW B;  2AGY A;  2YNN A;  1YFQ A;  4CI8 A;  1N6D A;  3KRX B;  3I7P A;  3UVL A;  2HJ4 A;  2IWF A;  4CZV A;  4AOW A;  1GG2 B;  3PXT D;  4GGA A;  3EI4 A;  4A11 A;  3F3G A;  5HE3 B;  5EM2 B;  2J56 H;  3OTT A;  4AEZ A;  4O1Q D;  4FB1 D;  4A08 A;  5EMM B;  3JZH A;  2OVR B;  4GQB B;  2BCJ B;  2YNP A;  2UZX B;  4J79 A;  3NVN A;  2CO0 C;  1SQJ A;  3JAM g;  5I5M A;  2H47 A;  4E5Z B;  2GNQ A;  5GXH A;  4FHL A;  4N14 A;  4I79 A;  3UKU C;  2AGZ A;  3RRM C;  2HXC A;  3SBR A;  5AFU 3;  3GRE A;  5CYK B;  5H1M A;  3AFC A;  3EG6 A;  4XYH A;  3PSL A;  4CY3 A;  4A0B B;  4JSX C;  1SHY B;  5EAM A;  3SJL D;  3UVK A;  4ZOX A;  1MG2 A;  3I2N A;  2H14 A;  5H14 A;  5FKR A;  1JJU B;  4JSV C;  3V5W B;  5CXB B;  5GMK n;  4PBZ A;  3EU7 A;  3F3P A;  3EWE A;  3FM0 A;  4K3J B;  4JSN C;  5HYN B;  5FKS A;  3I8C A;  3OKT A;  4Z8L A;  4J0X A;  4L9O A;  5FKT A;  3PVW B;  4QL1 A;  3EI1 B;  2I3S A;  4J84 A;  3EI2 B;  4A2M A;  5A2Q g;  4QQE A;  2B5L A;  2I3T A;  3VA6 A;  2J57 G;  3CFS B;  5TDH B;  4A2L A;  4X60 B;  4D0K A;  2HKM A;  1P22 A;  3EI4 B;  5B4W A;  4A11 B;  3OKY A;  2I0T A;  4H5I A;  3JRO A;  4CI3 A;  5FKQ A;  4UI9 R;  4XEI C;  3JPX A;  3SVW D;  1B9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...