5GMKn

Cryo-em structure of the catalytic step i spliceosome (c complex) at 3.4 angstrom resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
405
structure length
299
Chain Sequence
FTKSELKRRRKTRKGDGPWGSWSPKKVIRNYPGHPEGTTALKFLPKTGHLILSGGNDHTIKIWDFECLRDFQGHNKPIKALRFTEDCQSFLSSSFDRSVKIWDTETGKVKTRLHLNSTPADVESRPTNPHEFIVGLSNSKILHYDDVQTYDHHLSSILALKYFPDGSKFISSSEDKTVRIWENQINVPIKQISDTASMPFLNVHPNYFCAQSMDNRIYSFSKYKRHPKKIHSSAGYGISLAFSGDGRYICSGDSKSRLFTWDWNTSRLLIPGNKPITQVDWHPSKVICSGAAGKIYVCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor 8
publication title Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
pubmed doi rcsb
molecule tags Rna binding protein/rna
total genus 36
structure length 299
sequence length 405
ec nomenclature
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
n PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5gmkn00
3PSCB 4CI3A 3UKRC 5B4WA 3ULEC 2XU7A 5EALA 3BG1A 4A09A 2J57G 4J73A 4YVDA 5EM2A 2H3XA 3EG6A 4A11A 3RLMD 1PEVA 3AH8B 3EI4B 4J0WA 4JSPC 4CY3A 4O3UB 1PGUA 3PVUB 5GXIA 3I8EA 1SHYB 3EI3A 1K8KC 2OIZA 4CY5A 5HYNB 4A0BA 5EAMA 5HE1B 2HKRA 2CE8A 3OKTA 4I79A 3DXKC 1N6DA 4BL0A 2IUVA 4GGAA 3VH0A 2TRCB 5AFU3 5IGOA 4Y7RA 2CN3A 2OK4A 3V5WB 4Z8LA 4CZYA 3PXWD 4FAVD 1B9YA 2G99A 4GM3A 2OK6A 4ERQA 3JAMg 3VA6A 3SJLD 2AQ5A 3N0DA 3UVNA 3FM0A 4OZUA 5H17A 4K3ID 4CY2A 1YFQA 2OJYA 4X61B 3AL8B 4CC9A 3J81g 5H14A 1B9XA 5HQGA 3N0EA 5I5IA 3FRXA 2GNQA 4CY1A 4D0KA 2Q7QA 3I2NA 5FKQA 2P9KC 4GM8A 3SHFA 2H47A 5IGQA 2PM6B 2I0TA 4J77A 3C75H 1XIPA 4GGCA 3JRPA 5HE2B 3I8CA 4O3TB 2QC5A 5EMKB 4GMBA 2Z2PA 3PXSD 4BUJC 4UI9R 4A0AA 4J81A 1JMXB 2GC7A 3SBRA 3L4MD 2H6NA 4GGDA 2O9KA 2H13A 4LG9A 4FAND 4G56B 1JOFA 2XL3A 3OL2A 4J78A 2AGYA 5K19A 4E54A 1K32A 3CFVA 3IJ0A 3V7DB 1Q47A 1RI6A 3EWEA 4E5ZA 5CXBB 4N14A 3HFQA 3GFCA 2IWFA 5IT9g 3W15A 3OTTA 2I0SA 3RFHA 4A2MA 5I5JA 2H9PA 3PXTD 3SFZA 4L3HD 1VYHC 3ORVD 1SQ9A 2P9SC 4QL1A 4PSWB 4GZ8A 3I7HA 3MZKA 3UVLA 4ZOZA 1GXRA 3RRMC 3SBPA 2IAAA 1MG3A 2IWKA 3PE7A 5A2Qg 3SBQA 4U1EI 4PXWA 5H1MA 3EI1A 3NVXA 2B5NA 2AGWA 3JZHA 3VGZA 3J80g 5FQDA 3IIYA 4J79A 4IA9A 4MK0B 3A0FA 3JB9L 4LGNA 3KRWB 2EBSA 4J87A 2P9IC 4X63B 3RMZD 5IJ8E 5GMKn 2CN2A 1TYQC 1QNIA 2Z2OA 5C2VB 2G9AA 5EAPA 5HE3B 3OW8A 4O1QD 3IKOA 2IUPA 2YNNA 3MKQA 3EI4A 5GXHA 4ZOVA 2B5MA 3SCYA 3JPXA 2HJ4A 4JSVC 4XEIC 4ERYA 2H14A 3CIKB 3I89A 3SLED 3F3PA 2P9NC 4L9OA 4GQBB 5CYKB 3ODTA 5TEEA 2P9LC 4TZ4A 5IC7A 3SWSD 4O45A 5AMSA 2PBIB 1U2VC 3EMHA 4ZOYA 1OMWB 3NVNA 2OVPB 2AGLA 3RN1D 2AH0A 1GG2B 4A7JA 3KRXB 3U4YA 2BCJB 2AH1A 3I7OA 2PM9B 4L3GD 3OKYB 2B5LA 3I7KA 5FKSA 2MTAH 2QXVA 3AL8A 3DWLC 5TF2A 3DM0A 2I0RA 4AOWA 4O9DA 2UZYB 4A08B 1FWXA 1JJUB 3MXXA 4JSXC 5CXCB 2CE9A 1NEXB 5FKTA 1A0RB 3SXTD 2H9NA 4J82A 3EI2B 4FHLA 3SVWD 4J86A 1OLZA 2HJBA 2GC4A 1MG2A 3RN0D 4A09B 2CO0A 5C9ZB 1N6EA 4GM9A 5GSAA 2HYEA 5AJAA 2H6QA 5EM2B 3UVKA 4A11B 2P9PC 4OWRA 4QT8A 5HE0B 5FKRA 5I5MA 4J8BA 1S4UX 3OKWA 5THAA 4IMMA 4CI8A 4GQ2P 5CXBA 1N6FA 3EI3B 3IJ1A 2I3TA 4A0BB 3FGBA 2XYIA 3BG0A 3MKSB 1MDAH 4FB1D 3V9FA 1SQJA 2IURA 3AFCA 2H9MA 3SN6B 3JZNA 2P9UC 3BWSA 2YNOA 4J84A 4EWRA 2AGXA 2UZXB 2YBAA 3I7PA 4BH6A 5KDOB 2J56H 5K1CC 5EMMB 3IJCA 3AL9A 4H5JA 5C2WB 3E0CA 1GP2B 1XHMA 3PVWB 3P4FA 2BBKH 3UVOA 4PBZA 3UR4A 2YMUA 2OVQB 5TEFA 4FA9D 3I7LA 4QRJA 4KFMB 4HDJA 1NR0A 4R7AB 5FXYA 5SXMA 4JSNC 3RSEC 4AEZA 3DXMC 4ES0A 5TDHB 1ERJA 1PBYB 3K26A 4A2LA 3C9CA 4A0AB 3C99A 3IIWA 2YNPA 4XYIA 4D6VA 2XL2A 2H9LA 4ZN4A 2PM7B 3NVQA 1R5MA 4ESGA 2IUQA 2B4EA 3EU7A 3OL2B 3B7FA 2HESX 1GOTB 4FA1D 3F3GA 2YB8B 4PBYA 4CI1A 5FLXg 4E54B 2H6KA 5CYKA 2HKMA 4PC0A 3K27A 2HXCA 4E5ZB 4GQ1A 2AGZA 4FWWA 4LG8A 2OVRB 4Y5RD 3RFGA 3L4OD 4PSXB 3UKUC 4H5IA 4JXMA 4FA5D 3JZGA 3MZLA 5JWZA 4ZOXA 4J8GA 4NSXA 5FA5B 2H68A 4JD2C 1U4CA 2CNXA 2PM9A 3OKYA 1L0QA 1PI6A 3I7NA 3PSLA 4K3JB 3GREA 1JMZB 4JT6C 2Z2NA 3MMYA 5EMLB 5IJ7E 3EI1B 4X3EA 3UVMA 3CFSB 4U7AA 3F3FA 4JT5C 4CZXA 4A08A 5EARA 2I3SA 3JROA 4CI2A 4L1QD 3C5MA 4PNKB 5CXCA 1TBGA 3DSMA 1XKSA 3EI2A 3SMRA 2W18A 4FA4D 4XYHA 1P22A 4CZVA 4ERZA 4X60B 5EMJB 2CO0C 3ZWLB 4QQEA 2J55H 4J0XA
chains in the Genus database with same CATH superfamily
3PSCB 4CI3A 3UKRC 1L5GA 5B4WA 1VE7A 3IJEA 3ULEC 2XU7A 5EALA 3BG1A 4A09A 2J57G 4AN0A 4J73A 4YVDA 5EM2A 2H3XA 3EG6A 4A11A 1M1XA 4Z7QA 3RLMD 1PEVA 3AH8B 3EI4B 1UOPA 4J0WA 4JSPC 4CY3A 4O3UB 1E8NA 1PGUA 3PVUB 3ZE2A 3I8EA 1SHYB 5GXIA 3EI3A 1K8KC 2BKLA 2OIZA 4CY5A 5HYNB 4A0BA 5EAMA 5HE1B 2HKRA 2CE8A 3OKTA 4I79A 3DXKC 3NIGA 1N6DA 4BL0A 2IUVA 4GGAA 3VH0A 2TRCB 5AFU3 5IGOA 4Y7RA 2CN3A 2OK4A 3V5WB 1E5TA 3IUNA 4Z8LA 3IULA 4CZYA 3PXWD 4FAVD 1B9YA 3VI4A 2VDQA 3DDUA 2G99A 3FCSA 4GM3A 2OK6A 4ERQA 3JAMg 1I2MB 3V4VA 3VA6A 3SJLD 2AQ5A 3N0DA 3UVNA 4BCDA 3FM0A 4OZUA 1O6FA 5H17A 4K3ID 4CY2A 1YFQA 2OJYA 4X61B 3AL8B 5FFGA 4CC9A 3J81g 3ZDZA 5M5SA 5H14A 5M5UA 1B9XA 5HQGA 3N0EA 5I5IA 3FRXA 2GNQA 3QI0A 4CY1A 4D0KA 2Q7QA 3I2NA 5FKQA 2P9KC 4GM8A 3SHFA 3GD1I 4WK0A 3IUMA 2H47A 5IGQA 2PM6B 2I0TA 4J77A 3C75H 1XIPA 4GGCA 3JRPA 5HE2B 3I8CA 4O3TB 2QC5A 5EMKB 4GMBA 2Z2PA 3PXSD 4RE6A 3K6SA 3EQ7A 4BUJC 4UI9R 4A0AA 4J81A 1JMXB 2GC7A 3SBRA 3L4MD 2EICA 2H6NA 4GGDA 2O9KA 2H13A 4LG9A 2EIEA 4FAND 4G56B 5M5TA 1JOFA 5M5RA 2XL3A 3OL2A 1UTCA 4J78A 5HDBA 3GC3B 2VDRA 2AGYA 5K19A 4E54A 1K32A 2VDKA 3CFVA 1U8CA 3IJ0A 3V7DB 1Q47A 1RI6A 3EWEA 4E5ZA 1VE6A 5CXBB 4N14A 3HFQA 3GFCA 2IWFA 5IT9g 3W15A 3OTTA 2I0SA 3RFHA 3EQ8A 4A2MA 3IUQA 5I5JA 2XZGA 2H9PA 3PXTD 3SFZA 4L3HD 1C9LA 4AMYA 1VYHC 3ORVD 1SQ9A 2P9SC 4QL1A 4PSWB 4GZ8A 5E6UA 1QFSA 3I7HA 3MZKA 3UVLA 4O2WA 4ZOZA 1GXRA 3RRMC 3SBPA 2IAAA 3IVMA 1MG3A 2IWKA 3PE7A 5A2Qg 3SBQA 4U1EI 4PXWA 5H1MA 4G1EA 1K3IA 5M61A 3O4HA 3EI1A 2EIBA 3NVXA 4Z7OA 2B5NA 2AGWA 3JZHA 3VGZA 3J80g 5FQDA 1H2ZA 3IIYA 3IUJA 4J79A 4IA9A 4MK0B 3A0FA 3JB9L 3MUNA 4LGNA 1VZ3A 3KRWB 2VDNA 2EIDA 2EBSA 4J87A 1JTDB 2P9IC 3QHYB 4X63B 3RMZD 5IJ8E 5GMKn 2CN2A 1TYQC 1QNIA 2Z2OA 5C2VB 3IURA 5E6RA 4NENA 4WK2A 2G9AA 4AMZA 5EAPA 5HE3B 3OW8A 4O1QD 3IKOA 2IUPA 2YNNA 4IRZA 3MKQA 3EI4A 5GXHA 4BP9A 4ZOVA 1H2XA 2B5MA 4BCBA 3SCYA 3JPXA 2HJ4A 4JSVC 4JHNA 4XEIC 4D9SA 4ERYA 2H14A 3CIKB 3I89A 3SLED 3F3PA 2P9NC 4L9OA 4DNVA 4GQBB 5CYKB 3ODTA 2JKXA 5TEEA 3ZE0A 1GOGA 2P9LC 4DNWA 4TZ4A 1UOOA 5IC7A 3SWSD 4O45A 5AMSA 1TYEA 2PBIB 1U2VC 3EMHA 4ZOYA 3FCUA 1OMWB 3NVNA 2OVPB 2AGLA 2VDPA 3RN1D 2AH0A 1GG2B 3ZDXA 4A7JA 3KRXB 4AX4A 3O4JA 4MMXA 3U4YA 2BCJB 2AH1A 3I7OA 2PM9B 3KCIA 4L3GD 3OKYB 2B5LA 3I7KA 5FKSA 2MTAH 2QXVA 4Z7NA 4MMYA 3AL8A 3DWLC 3ZE1A 3O4IA 3DM0A 5TF2A 2I0RA 4AOWA 2HU7A 3K71A 4O9DA 2UZYB 4A08B 1FWXA 1JJUB 3MXXA 5FFOA 2XDWA 2VDMA 2VZ1A 4JSXC 1QFMA 5CXCB 2CE9A 1NEXB 5FKTA 1A0RB 1C9IA 3SXTD 2H9NA 2QR5A 4J82A 3EI2B 4FHLA 1H2WA 2VC2A 3SVWD 4BCCA 4WK4A 4J86A 1OLZA 3OF7A 4NC4A 2HJBA 1H2YA 2GC4A 1MG2A 3RN0D 4A09B 2CO0A 5C9ZB 1N6EA 4GM9A 5GSAA 2HYEA 5AJAA 2H6QA 5EM2B 3UVKA 4A11B 2P9PC 4OWRA 4QT8A 5HE0B 5FKRA 5I5MA 4J8BA 1S4UX 1GOFA 3OKWA 5THAA 4IMMA 1VZ2A 4CI8A 4GQ2P 5CXBA 4MMZA 1N6FA 3EI3B 3IJ1A 2I3TA 5C86A 4A0BB 3FGBA 2XYIA 3BG0A 4O02A 3MKSB 1MDAH 1YR2A 4FB1D 3V9FA 1SQJA 2IURA 3AFCA 2H9MA 3SN6B 3JZNA 2P9UC 3BWSA 2YNOA 3EQ9A 4J84A 4EWRA 2AGXA 2UZXB 2YBAA 3I7PA 4BH6A 5KDOB 2J56H 5K1CC 2WQ8A 5EMMB 3IJCA 3AL9A 4H5JA 5C2WB 3E0CA 1GP2B 1XHMA 3PVWB 3P4FA 2BBKH 3UVOA 4PBZA 3VI3A 2HU5A 2YMUA 2OVQB 3UR4A 5TEFA 4FA9D 3I7LA 4QRJA 4KFMB 1GOHA 4HDJA 1NR0A 4R7AB 5FXYA 4NAAA 4WJKA 3MVDK 5SXMA 4JSNC 3RSEC 4AEZA 4BP8A 3DXMC 4ES0A 5TDHB 1ERJA 1PBYB 2VZ3A 3K26A 4A2LA 3C9CA 4A0AB 3C99A 1O6GA 3IIWA 2YNPA 4L1MA 4XYIA 4D6VA 2XL2A 2H9LA 4ZN4A 2PM7B 3NVQA 1R5MA 4ESGA 2IUQA 4QAMA 5E6SA 2B4EA 3EU7A 3OL2B 3B7FA 2HESX 1GOTB 4FA1D 3F3GA 2YB8B 4PBYA 1BPOA 4CI1A 5FLXg 4E54B 2H6KA 5CYKA 3O4GA 2HKMA 3V4PA 4PC0A 3K27A 2HXCA 3MUOA 4E5ZB 4G1MA 4GQ1A 4JHPC 1JV2A 2AGZA 4FWWA 2HU8A 4LG8A 2OVRB 4UM9A 4Y5RD 3RFGA 5M5VA 3L4OD 4PSXB 3UKUC 4DNUA 4H5IA 4JXMA 3T3PA 4FA5D 3ZDYA 3JZGA 3MZLA 5JWZA 4RE5A 4ZOXA 4J8GA 5C92A 4NSXA 5FA5B 2H68A 4JD2C 1U4CA 3K72A 2CNXA 2PM9A 2VDLA 3OKYA 1L0QA 4AN1A 4NBMA 1PI6A 3I7NA 3PSLA 4K3JB 3GREA 1JMZB 4JT6C 2Z2NA 3MMYA 5EMLB 5IJ7E 1A12A 4X3EA 3UVMA 3EI1B 4UM8A 3CFSB 4U7AA 3F3FA 1UOQA 4JT5C 4CZXA 4A08A 5EARA 3NIDA 3T3MA 2I3SA 3JROA 4CI2A 2QZPA 4L1QD 3C5MA 2XE4A 4PNKB 5CXCA 2VDOA 1TBGA 3DSMA 1XKSA 3EI2A 3SMRA 2W18A 4FA4D 1E8MA 4XYHA 1P22A 1T2XA 4CZVA 4ERZA 4X60B 4G55A 3NIFA 5EMJB 2CO0C 3ZWLB 4QQEA 2J55H 4J0XA
chains in the Genus database with same CATH topology
3PSCB 4CI3A 3UKRC 5B4WA 3ULEC 2XU7A 5EALA 3BG1A 4A09A 2J57G 4J73A 4YVDA 5EM2A 2H3XA 3EG6A 4A11A 3RLMD 1PEVA 3AH8B 3EI4B 4J0WA 4JSPC 4CY3A 4O3UB 1PGUA 3PVUB 5GXIA 3I8EA 1SHYB 3EI3A 1K8KC 2OIZA 4CY5A 5HYNB 4A0BA 5EAMA 5HE1B 2HKRA 2CE8A 3OKTA 4I79A 3DXKC 1N6DA 4BL0A 2IUVA 4GGAA 3VH0A 2TRCB 5AFU3 5IGOA 4Y7RA 2CN3A 2OK4A 3V5WB 4Z8LA 4CZYA 3PXWD 4FAVD 1B9YA 2G99A 4GM3A 2OK6A 4ERQA 3JAMg 3VA6A 3SJLD 2AQ5A 3N0DA 3UVNA 3FM0A 4OZUA 5H17A 4K3ID 4CY2A 1YFQA 2OJYA 4X61B 3AL8B 4CC9A 3J81g 5H14A 1B9XA 5HQGA 3N0EA 5I5IA 3FRXA 2GNQA 4CY1A 4D0KA 2Q7QA 3I2NA 5FKQA 2P9KC 4GM8A 3SHFA 2H47A 5IGQA 2PM6B 2I0TA 4J77A 3C75H 1XIPA 4GGCA 3JRPA 5HE2B 3I8CA 4O3TB 2QC5A 5EMKB 4GMBA 2Z2PA 3PXSD 4BUJC 4UI9R 4A0AA 4J81A 1JMXB 2GC7A 3SBRA 3L4MD 2H6NA 4GGDA 2O9KA 2H13A 4LG9A 4FAND 4G56B 1JOFA 2XL3A 3OL2A 4J78A 2AGYA 5K19A 4E54A 1K32A 3CFVA 3IJ0A 3V7DB 1Q47A 1RI6A 3EWEA 4E5ZA 5CXBB 4N14A 3HFQA 3GFCA 2IWFA 5IT9g 3W15A 3OTTA 2I0SA 3RFHA 4A2MA 5I5JA 2H9PA 3PXTD 3SFZA 4L3HD 1VYHC 3ORVD 1SQ9A 2P9SC 4QL1A 4PSWB 4GZ8A 3I7HA 3MZKA 3UVLA 4ZOZA 1GXRA 3RRMC 3SBPA 2IAAA 1MG3A 2IWKA 3PE7A 5A2Qg 3SBQA 4U1EI 4PXWA 5H1MA 3EI1A 3NVXA 2B5NA 2AGWA 3JZHA 3VGZA 3J80g 5FQDA 3IIYA 4J79A 4IA9A 4MK0B 3A0FA 3JB9L 4LGNA 3KRWB 2EBSA 4J87A 2P9IC 4X63B 3RMZD 5IJ8E 5GMKn 2CN2A 1TYQC 1QNIA 2Z2OA 5C2VB 2G9AA 5EAPA 5HE3B 3OW8A 4O1QD 3IKOA 2IUPA 2YNNA 3MKQA 3EI4A 5GXHA 4ZOVA 2B5MA 3SCYA 3JPXA 2HJ4A 4JSVC 4XEIC 4ERYA 2H14A 3CIKB 3I89A 3SLED 3F3PA 2P9NC 4L9OA 4GQBB 5CYKB 3ODTA 5TEEA 2P9LC 4TZ4A 5IC7A 3SWSD 4O45A 5AMSA 2PBIB 1U2VC 3EMHA 4ZOYA 1OMWB 3NVNA 2OVPB 2AGLA 3RN1D 2AH0A 1GG2B 4A7JA 3KRXB 3U4YA 2BCJB 2AH1A 3I7OA 2PM9B 4L3GD 3OKYB 2B5LA 3I7KA 5FKSA 2MTAH 2QXVA 3AL8A 3DWLC 5TF2A 3DM0A 2I0RA 4AOWA 4O9DA 2UZYB 4A08B 1FWXA 1JJUB 3MXXA 4JSXC 5CXCB 2CE9A 1NEXB 5FKTA 1A0RB 3SXTD 2H9NA 4J82A 3EI2B 4FHLA 3SVWD 4J86A 1OLZA 2HJBA 2GC4A 1MG2A 3RN0D 4A09B 2CO0A 5C9ZB 1N6EA 4GM9A 5GSAA 2HYEA 5AJAA 2H6QA 5EM2B 3UVKA 4A11B 2P9PC 4OWRA 4QT8A 5HE0B 5FKRA 5I5MA 4J8BA 1S4UX 3OKWA 5THAA 4IMMA 4CI8A 4GQ2P 5CXBA 1N6FA 3EI3B 3IJ1A 2I3TA 4A0BB 3FGBA 2XYIA 3BG0A 3MKSB 1MDAH 4FB1D 3V9FA 1SQJA 2IURA 3AFCA 2H9MA 3SN6B 3JZNA 2P9UC 3BWSA 2YNOA 4J84A 4EWRA 2AGXA 2UZXB 2YBAA 3I7PA 4BH6A 5KDOB 2J56H 5K1CC 5EMMB 3IJCA 3AL9A 4H5JA 5C2WB 3E0CA 1GP2B 1XHMA 3PVWB 3P4FA 2BBKH 3UVOA 4PBZA 3UR4A 2YMUA 2OVQB 5TEFA 4FA9D 3I7LA 4QRJA 4KFMB 4HDJA 1NR0A 4R7AB 5FXYA 5SXMA 4JSNC 3RSEC 4AEZA 3DXMC 4ES0A 5TDHB 1ERJA 1PBYB 3K26A 4A2LA 3C9CA 4A0AB 3C99A 3IIWA 2YNPA 4XYIA 4D6VA 2XL2A 2H9LA 4ZN4A 2PM7B 3NVQA 1R5MA 4ESGA 2IUQA 2B4EA 3EU7A 3OL2B 3B7FA 2HESX 1GOTB 4FA1D 3F3GA 2YB8B 4PBYA 4CI1A 5FLXg 4E54B 2H6KA 5CYKA 2HKMA 4PC0A 3K27A 2HXCA 4E5ZB 4GQ1A 2AGZA 4FWWA 4LG8A 2OVRB 4Y5RD 3RFGA 3L4OD 4PSXB 3UKUC 4H5IA 4JXMA 4FA5D 3JZGA 3MZLA 5JWZA 4ZOXA 4J8GA 4NSXA 5FA5B 2H68A 4JD2C 1U4CA 2CNXA 2PM9A 3OKYA 1L0QA 1PI6A 3I7NA 3PSLA 4K3JB 3GREA 1JMZB 4JT6C 2Z2NA 3MMYA 5EMLB 5IJ7E 3EI1B 4X3EA 3UVMA 3CFSB 4U7AA 3F3FA 4JT5C 4CZXA 4A08A 5EARA 2I3SA 3JROA 4CI2A 4L1QD 3C5MA 4PNKB 5CXCA 1TBGA 3DSMA 1XKSA 3EI2A 3SMRA 2W18A 4FA4D 4XYHA 1P22A 4CZVA 4ERZA 4X60B 5EMJB 2CO0C 3ZWLB 4QQEA 2J55H 4J0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PSC B;  4CI3 A;  3UKR C;  5B4W A;  3ULE C;  2XU7 A;  5EAL A;  3BG1 A;  4A09 A;  2J57 G;  4J73 A;  4YVD A;  5EM2 A;  2H3X A;  3EG6 A;  4A11 A;  3RLM D;  1PEV A;  3AH8 B;  3EI4 B;  4J0W A;  4JSP C;  4CY3 A;  4O3U B;  1PGU A;  3PVU B;  5GXI A;  3I8E A;  1SHY B;  3EI3 A;  1K8K C;  2OIZ A;  4CY5 A;  5HYN B;  4A0B A;  5EAM A;  5HE1 B;  2HKR A;  2CE8 A;  3OKT A;  4I79 A;  3DXK C;  1N6D A;  4BL0 A;  2IUV A;  4GGA A;  3VH0 A;  2TRC B;  5AFU 3;  5IGO A;  4Y7R A;  2CN3 A;  2OK4 A;  3V5W B;  4Z8L A;  4CZY A;  3PXW D;  4FAV D;  1B9Y A;  2G99 A;  4GM3 A;  2OK6 A;  4ERQ A;  3JAM g;  3VA6 A;  3SJL D;  2AQ5 A;  3N0D A;  3UVN A;  3FM0 A;  4OZU A;  5H17 A;  4K3I D;  4CY2 A;  1YFQ A;  2OJY A;  4X61 B;  3AL8 B;  4CC9 A;  3J81 g;  5H14 A;  1B9X A;  5HQG A;  3N0E A;  5I5I A;  3FRX A;  2GNQ A;  4CY1 A;  4D0K A;  2Q7Q A;  3I2N A;  5FKQ A;  2P9K C;  4GM8 A;  3SHF A;  2H47 A;  5IGQ A;  2PM6 B;  2I0T A;  4J77 A;  3C75 H;  1XIP A;  4GGC A;  3JRP A;  5HE2 B;  3I8C A;  4O3T B;  2QC5 A;  5EMK B;  4GMB A;  2Z2P A;  3PXS D;  4BUJ C;  4UI9 R;  4A0A A;  4J81 A;  1JMX B;  2GC7 A;  3SBR A;  3L4M D;  2H6N A;  4GGD A;  2O9K A;  2H13 A;  4LG9 A;  4FAN D;  4G56 B;  1JOF A;  2XL3 A;  3OL2 A;  4J78 A;  2AGY A;  5K19 A;  4E54 A;  1K32 A;  3CFV A;  3IJ0 A;  3V7D B;  1Q47 A;  1RI6 A;  3EWE A;  4E5Z A;  5CXB B;  4N14 A;  3HFQ A;  3GFC A;  2IWF A;  5IT9 g;  3W15 A;  3OTT A;  2I0S A;  3RFH A;  4A2M A;  5I5J A;  2H9P A;  3PXT D;  3SFZ A;  4L3H D;  1VYH C;  3ORV D;  1SQ9 A;  2P9S C;  4QL1 A;  4PSW B;  4GZ8 A;  3I7H A;  3MZK A;  3UVL A;  4ZOZ A;  1GXR A;  3RRM C;  3SBP A;  2IAA A;  1MG3 A;  2IWK A;  3PE7 A;  5A2Q g;  3SBQ A;  4U1E I;  4PXW A;  5H1M A;  3EI1 A;  3NVX A;  2B5N A;  2AGW A;  3JZH A;  3VGZ A;  3J80 g;  5FQD A;  3IIY A;  4J79 A;  4IA9 A;  4MK0 B;  3A0F A;  3JB9 L;  4LGN A;  3KRW B;  2EBS A;  4J87 A;  2P9I C;  4X63 B;  3RMZ D;  5IJ8 E;  5GMK n;  2CN2 A;  1TYQ C;  1QNI A;  2Z2O A;  5C2V B;  2G9A A;  5EAP A;  5HE3 B;  3OW8 A;  4O1Q D;  3IKO A;  2IUP A;  2YNN A;  3MKQ A;  3EI4 A;  5GXH A;  4ZOV A;  2B5M A;  3SCY A;  3JPX A;  2HJ4 A;  4JSV C;  4XEI C;  4ERY A;  2H14 A;  3CIK B;  3I89 A;  3SLE D;  3F3P A;  2P9N C;  4L9O A;  4GQB B;  5CYK B;  3ODT A;  5TEE A;  2P9L C;  4TZ4 A;  5IC7 A;  3SWS D;  4O45 A;  5AMS A;  2PBI B;  1U2V C;  3EMH A;  4ZOY A;  1OMW B;  3NVN A;  2OVP B;  2AGL A;  3RN1 D;  2AH0 A;  1GG2 B;  4A7J A;  3KRX B;  3U4Y A;  2BCJ B;  2AH1 A;  3I7O A;  2PM9 B;  4L3G D;  3OKY B;  2B5L A;  3I7K A;  5FKS A;  2MTA H;  2QXV A;  3AL8 A;  3DWL C;  5TF2 A;  3DM0 A;  2I0R A;  4AOW A;  4O9D A;  2UZY B;  4A08 B;  1FWX A;  1JJU B;  3MXX A;  4JSX C;  5CXC B;  2CE9 A;  1NEX B;  5FKT A;  1A0R B;  3SXT D;  2H9N A;  4J82 A;  3EI2 B;  4FHL A;  3SVW D;  4J86 A;  1OLZ A;  2HJB A;  2GC4 A;  1MG2 A;  3RN0 D;  4A09 B;  2CO0 A;  5C9Z B;  1N6E A;  4GM9 A;  5GSA A;  2HYE A;  5AJA A;  2H6Q A;  5EM2 B;  3UVK A;  4A11 B;  2P9P C;  4OWR A;  4QT8 A;  5HE0 B;  5FKR A;  5I5M A;  4J8B A;  1S4U X;  3OKW A;  5THA A;  4IMM A;  4CI8 A;  4GQ2 P;  5CXB A;  1N6F A;  3EI3 B;  3IJ1 A;  2I3T A;  4A0B B;  3FGB A;  2XYI A;  3BG0 A;  3MKS B;  1MDA H;  4FB1 D;  3V9F A;  1SQJ A;  2IUR A;  3AFC A;  2H9M A;  3SN6 B;  3JZN A;  2P9U C;  3BWS A;  2YNO A;  4J84 A;  4EWR A;  2AGX A;  2UZX B;  2YBA A;  3I7P A;  4BH6 A;  5KDO B;  2J56 H;  5K1C C;  5EMM B;  3IJC A;  3AL9 A;  4H5J A;  5C2W B;  3E0C A;  1GP2 B;  1XHM A;  3PVW B;  3P4F A;  2BBK H;  3UVO A;  4PBZ A;  3UR4 A;  2YMU A;  2OVQ B;  5TEF A;  4FA9 D;  3I7L A;  4QRJ A;  4KFM B;  4HDJ A;  1NR0 A;  4R7A B;  5FXY A;  5SXM A;  4JSN C;  3RSE C;  4AEZ A;  3DXM C;  4ES0 A;  5TDH B;  1ERJ A;  1PBY B;  3K26 A;  4A2L A;  3C9C A;  4A0A B;  3C99 A;  3IIW A;  2YNP A;  4XYI A;  4D6V A;  2XL2 A;  2H9L A;  4ZN4 A;  2PM7 B;  3NVQ A;  1R5M A;  4ESG A;  2IUQ A;  2B4E A;  3EU7 A;  3OL2 B;  3B7F A;  2HES X;  1GOT B;  4FA1 D;  3F3G A;  2YB8 B;  4PBY A;  4CI1 A;  5FLX g;  4E54 B;  2H6K A;  5CYK A;  2HKM A;  4PC0 A;  3K27 A;  2HXC A;  4E5Z B;  4GQ1 A;  2AGZ A;  4FWW A;  4LG8 A;  2OVR B;  4Y5R D;  3RFG A;  3L4O D;  4PSX B;  3UKU C;  4H5I A;  4JXM A;  4FA5 D;  3JZG A;  3MZL A;  5JWZ A;  4ZOX A;  4J8G A;  4NSX A;  5FA5 B;  2H68 A;  4JD2 C;  1U4C A;  2CNX A;  2PM9 A;  3OKY A;  1L0Q A;  1PI6 A;  3I7N A;  3PSL A;  4K3J B;  3GRE A;  1JMZ B;  4JT6 C;  2Z2N A;  3MMY A;  5EML B;  5IJ7 E;  3EI1 B;  4X3E A;  3UVM A;  3CFS B;  4U7A A;  3F3F A;  4JT5 C;  4CZX A;  4A08 A;  5EAR A;  2I3S A;  3JRO A;  4CI2 A;  4L1Q D;  3C5M A;  4PNK B;  5CXC A;  1TBG A;  3DSM A;  1XKS A;  3EI2 A;  3SMR A;  2W18 A;  4FA4 D;  4XYH A;  1P22 A;  4CZV A;  4ERZ A;  4X60 B;  5EMJ B;  2CO0 C;  3ZWL B;  4QQE A;  2J55 H;  4J0X A; 
#chains in the Genus database with same CATH topology
 3PSC B;  4CI3 A;  3UKR C;  1L5G A;  5B4W A;  1VE7 A;  3IJE A;  3ULE C;  2XU7 A;  5EAL A;  3BG1 A;  4A09 A;  2J57 G;  4AN0 A;  4J73 A;  4YVD A;  5EM2 A;  2H3X A;  3EG6 A;  4A11 A;  1M1X A;  4Z7Q A;  3RLM D;  1PEV A;  3AH8 B;  3EI4 B;  1UOP A;  4J0W A;  4JSP C;  4CY3 A;  4O3U B;  1E8N A;  1PGU A;  3PVU B;  3ZE2 A;  3I8E A;  1SHY B;  5GXI A;  3EI3 A;  1K8K C;  2BKL A;  2OIZ A;  4CY5 A;  5HYN B;  4A0B A;  5EAM A;  5HE1 B;  2HKR A;  2CE8 A;  3OKT A;  4I79 A;  3DXK C;  3NIG A;  1N6D A;  4BL0 A;  2IUV A;  4GGA A;  3VH0 A;  2TRC B;  5AFU 3;  5IGO A;  4Y7R A;  2CN3 A;  2OK4 A;  3V5W B;  1E5T A;  3IUN A;  4Z8L A;  3IUL A;  4CZY A;  3PXW D;  4FAV D;  1B9Y A;  3VI4 A;  2VDQ A;  3DDU A;  2G99 A;  3FCS A;  4GM3 A;  2OK6 A;  4ERQ A;  3JAM g;  1I2M B;  3V4V A;  3VA6 A;  3SJL D;  2AQ5 A;  3N0D A;  3UVN A;  4BCD A;  3FM0 A;  4OZU A;  1O6F A;  5H17 A;  4K3I D;  4CY2 A;  1YFQ A;  2OJY A;  4X61 B;  3AL8 B;  5FFG A;  4CC9 A;  3J81 g;  3ZDZ A;  5M5S A;  5H14 A;  5M5U A;  1B9X A;  5HQG A;  3N0E A;  5I5I A;  3FRX A;  2GNQ A;  3QI0 A;  4CY1 A;  4D0K A;  2Q7Q A;  3I2N A;  5FKQ A;  2P9K C;  4GM8 A;  3SHF A;  3GD1 I;  4WK0 A;  3IUM A;  2H47 A;  5IGQ A;  2PM6 B;  2I0T A;  4J77 A;  3C75 H;  1XIP A;  4GGC A;  3JRP A;  5HE2 B;  3I8C A;  4O3T B;  2QC5 A;  5EMK B;  4GMB A;  2Z2P A;  3PXS D;  4RE6 A;  3K6S A;  3EQ7 A;  4BUJ C;  4UI9 R;  4A0A A;  4J81 A;  1JMX B;  2GC7 A;  3SBR A;  3L4M D;  2EIC A;  2H6N A;  4GGD A;  2O9K A;  2H13 A;  4LG9 A;  2EIE A;  4FAN D;  4G56 B;  5M5T A;  1JOF A;  5M5R A;  2XL3 A;  3OL2 A;  1UTC A;  4J78 A;  5HDB A;  3GC3 B;  2VDR A;  2AGY A;  5K19 A;  4E54 A;  1K32 A;  2VDK A;  3CFV A;  1U8C A;  3IJ0 A;  3V7D B;  1Q47 A;  1RI6 A;  3EWE A;  4E5Z A;  1VE6 A;  5CXB B;  4N14 A;  3HFQ A;  3GFC A;  2IWF A;  5IT9 g;  3W15 A;  3OTT A;  2I0S A;  3RFH A;  3EQ8 A;  4A2M A;  3IUQ A;  5I5J A;  2XZG A;  2H9P A;  3PXT D;  3SFZ A;  4L3H D;  1C9L A;  4AMY A;  1VYH C;  3ORV D;  1SQ9 A;  2P9S C;  4QL1 A;  4PSW B;  4GZ8 A;  5E6U A;  1QFS A;  3I7H A;  3MZK A;  3UVL A;  4O2W A;  4ZOZ A;  1GXR A;  3RRM C;  3SBP A;  2IAA A;  3IVM A;  1MG3 A;  2IWK A;  3PE7 A;  5A2Q g;  3SBQ A;  4U1E I;  4PXW A;  5H1M A;  4G1E A;  1K3I A;  5M61 A;  3O4H A;  3EI1 A;  2EIB A;  3NVX A;  4Z7O A;  2B5N A;  2AGW A;  3JZH A;  3VGZ A;  3J80 g;  5FQD A;  1H2Z A;  3IIY A;  3IUJ A;  4J79 A;  4IA9 A;  4MK0 B;  3A0F A;  3JB9 L;  3MUN A;  4LGN A;  1VZ3 A;  3KRW B;  2VDN A;  2EID A;  2EBS A;  4J87 A;  1JTD B;  2P9I C;  3QHY B;  4X63 B;  3RMZ D;  5IJ8 E;  5GMK n;  2CN2 A;  1TYQ C;  1QNI A;  2Z2O A;  5C2V B;  3IUR A;  5E6R A;  4NEN A;  4WK2 A;  2G9A A;  4AMZ A;  5EAP A;  5HE3 B;  3OW8 A;  4O1Q D;  3IKO A;  2IUP A;  2YNN A;  4IRZ A;  3MKQ A;  3EI4 A;  5GXH A;  4BP9 A;  4ZOV A;  1H2X A;  2B5M A;  4BCB A;  3SCY A;  3JPX A;  2HJ4 A;  4JSV C;  4JHN A;  4XEI C;  4D9S A;  4ERY A;  2H14 A;  3CIK B;  3I89 A;  3SLE D;  3F3P A;  2P9N C;  4L9O A;  4DNV A;  4GQB B;  5CYK B;  3ODT A;  2JKX A;  5TEE A;  3ZE0 A;  1GOG A;  2P9L C;  4DNW A;  4TZ4 A;  1UOO A;  5IC7 A;  3SWS D;  4O45 A;  5AMS A;  1TYE A;  2PBI B;  1U2V C;  3EMH A;  4ZOY A;  3FCU A;  1OMW B;  3NVN A;  2OVP B;  2AGL A;  2VDP A;  3RN1 D;  2AH0 A;  1GG2 B;  3ZDX A;  4A7J A;  3KRX B;  4AX4 A;  3O4J A;  4MMX A;  3U4Y A;  2BCJ B;  2AH1 A;  3I7O A;  2PM9 B;  3KCI A;  4L3G D;  3OKY B;  2B5L A;  3I7K A;  5FKS A;  2MTA H;  2QXV A;  4Z7N A;  4MMY A;  3AL8 A;  3DWL C;  3ZE1 A;  3O4I A;  3DM0 A;  5TF2 A;  2I0R A;  4AOW A;  2HU7 A;  3K71 A;  4O9D A;  2UZY B;  4A08 B;  1FWX A;  1JJU B;  3MXX A;  5FFO A;  2XDW A;  2VDM A;  2VZ1 A;  4JSX C;  1QFM A;  5CXC B;  2CE9 A;  1NEX B;  5FKT A;  1A0R B;  1C9I A;  3SXT D;  2H9N A;  2QR5 A;  4J82 A;  3EI2 B;  4FHL A;  1H2W A;  2VC2 A;  3SVW D;  4BCC A;  4WK4 A;  4J86 A;  1OLZ A;  3OF7 A;  4NC4 A;  2HJB A;  1H2Y A;  2GC4 A;  1MG2 A;  3RN0 D;  4A09 B;  2CO0 A;  5C9Z B;  1N6E A;  4GM9 A;  5GSA A;  2HYE A;  5AJA A;  2H6Q A;  5EM2 B;  3UVK A;  4A11 B;  2P9P C;  4OWR A;  4QT8 A;  5HE0 B;  5FKR A;  5I5M A;  4J8B A;  1S4U X;  1GOF A;  3OKW A;  5THA A;  4IMM A;  1VZ2 A;  4CI8 A;  4GQ2 P;  5CXB A;  4MMZ A;  1N6F A;  3EI3 B;  3IJ1 A;  2I3T A;  5C86 A;  4A0B B;  3FGB A;  2XYI A;  3BG0 A;  4O02 A;  3MKS B;  1MDA H;  1YR2 A;  4FB1 D;  3V9F A;  1SQJ A;  2IUR A;  3AFC A;  2H9M A;  3SN6 B;  3JZN A;  2P9U C;  3BWS A;  2YNO A;  3EQ9 A;  4J84 A;  4EWR A;  2AGX A;  2UZX B;  2YBA A;  3I7P A;  4BH6 A;  5KDO B;  2J56 H;  5K1C C;  2WQ8 A;  5EMM B;  3IJC A;  3AL9 A;  4H5J A;  5C2W B;  3E0C A;  1GP2 B;  1XHM A;  3PVW B;  3P4F A;  2BBK H;  3UVO A;  4PBZ A;  3VI3 A;  2HU5 A;  2YMU A;  2OVQ B;  3UR4 A;  5TEF A;  4FA9 D;  3I7L A;  4QRJ A;  4KFM B;  1GOH A;  4HDJ A;  1NR0 A;  4R7A B;  5FXY A;  4NAA A;  4WJK A;  3MVD K;  5SXM A;  4JSN C;  3RSE C;  4AEZ A;  4BP8 A;  3DXM C;  4ES0 A;  5TDH B;  1ERJ A;  1PBY B;  2VZ3 A;  3K26 A;  4A2L A;  3C9C A;  4A0A B;  3C99 A;  1O6G A;  3IIW A;  2YNP A;  4L1M A;  4XYI A;  4D6V A;  2XL2 A;  2H9L A;  4ZN4 A;  2PM7 B;  3NVQ A;  1R5M A;  4ESG A;  2IUQ A;  4QAM A;  5E6S A;  2B4E A;  3EU7 A;  3OL2 B;  3B7F A;  2HES X;  1GOT B;  4FA1 D;  3F3G A;  2YB8 B;  4PBY A;  1BPO A;  4CI1 A;  5FLX g;  4E54 B;  2H6K A;  5CYK A;  3O4G A;  2HKM A;  3V4P A;  4PC0 A;  3K27 A;  2HXC A;  3MUO A;  4E5Z B;  4G1M A;  4GQ1 A;  4JHP C;  1JV2 A;  2AGZ A;  4FWW A;  2HU8 A;  4LG8 A;  2OVR B;  4UM9 A;  4Y5R D;  3RFG A;  5M5V A;  3L4O D;  4PSX B;  3UKU C;  4DNU A;  4H5I A;  4JXM A;  3T3P A;  4FA5 D;  3ZDY A;  3JZG A;  3MZL A;  5JWZ A;  4RE5 A;  4ZOX A;  4J8G A;  5C92 A;  4NSX A;  5FA5 B;  2H68 A;  4JD2 C;  1U4C A;  3K72 A;  2CNX A;  2PM9 A;  2VDL A;  3OKY A;  1L0Q A;  4AN1 A;  4NBM A;  1PI6 A;  3I7N A;  3PSL A;  4K3J B;  3GRE A;  1JMZ B;  4JT6 C;  2Z2N A;  3MMY A;  5EML B;  5IJ7 E;  1A12 A;  4X3E A;  3UVM A;  3EI1 B;  4UM8 A;  3CFS B;  4U7A A;  3F3F A;  1UOQ A;  4JT5 C;  4CZX A;  4A08 A;  5EAR A;  3NID A;  3T3M A;  2I3S A;  3JRO A;  4CI2 A;  2QZP A;  4L1Q D;  3C5M A;  2XE4 A;  4PNK B;  5CXC A;  2VDO A;  1TBG A;  3DSM A;  1XKS A;  3EI2 A;  3SMR A;  2W18 A;  4FA4 D;  1E8M A;  4XYH A;  1P22 A;  1T2X A;  4CZV A;  4ERZ A;  4X60 B;  4G55 A;  3NIF A;  5EMJ B;  2CO0 C;  3ZWL B;  4QQE A;  2J55 H;  4J0X A; 
#chains in the Genus database with same CATH homology
 3PSC B;  4CI3 A;  3UKR C;  5B4W A;  3ULE C;  2XU7 A;  5EAL A;  3BG1 A;  4A09 A;  2J57 G;  4J73 A;  4YVD A;  5EM2 A;  2H3X A;  3EG6 A;  4A11 A;  3RLM D;  1PEV A;  3AH8 B;  3EI4 B;  4J0W A;  4JSP C;  4CY3 A;  4O3U B;  1PGU A;  3PVU B;  5GXI A;  3I8E A;  1SHY B;  3EI3 A;  1K8K C;  2OIZ A;  4CY5 A;  5HYN B;  4A0B A;  5EAM A;  5HE1 B;  2HKR A;  2CE8 A;  3OKT A;  4I79 A;  3DXK C;  1N6D A;  4BL0 A;  2IUV A;  4GGA A;  3VH0 A;  2TRC B;  5AFU 3;  5IGO A;  4Y7R A;  2CN3 A;  2OK4 A;  3V5W B;  4Z8L A;  4CZY A;  3PXW D;  4FAV D;  1B9Y A;  2G99 A;  4GM3 A;  2OK6 A;  4ERQ A;  3JAM g;  3VA6 A;  3SJL D;  2AQ5 A;  3N0D A;  3UVN A;  3FM0 A;  4OZU A;  5H17 A;  4K3I D;  4CY2 A;  1YFQ A;  2OJY A;  4X61 B;  3AL8 B;  4CC9 A;  3J81 g;  5H14 A;  1B9X A;  5HQG A;  3N0E A;  5I5I A;  3FRX A;  2GNQ A;  4CY1 A;  4D0K A;  2Q7Q A;  3I2N A;  5FKQ A;  2P9K C;  4GM8 A;  3SHF A;  2H47 A;  5IGQ A;  2PM6 B;  2I0T A;  4J77 A;  3C75 H;  1XIP A;  4GGC A;  3JRP A;  5HE2 B;  3I8C A;  4O3T B;  2QC5 A;  5EMK B;  4GMB A;  2Z2P A;  3PXS D;  4BUJ C;  4UI9 R;  4A0A A;  4J81 A;  1JMX B;  2GC7 A;  3SBR A;  3L4M D;  2H6N A;  4GGD A;  2O9K A;  2H13 A;  4LG9 A;  4FAN D;  4G56 B;  1JOF A;  2XL3 A;  3OL2 A;  4J78 A;  2AGY A;  5K19 A;  4E54 A;  1K32 A;  3CFV A;  3IJ0 A;  3V7D B;  1Q47 A;  1RI6 A;  3EWE A;  4E5Z A;  5CXB B;  4N14 A;  3HFQ A;  3GFC A;  2IWF A;  5IT9 g;  3W15 A;  3OTT A;  2I0S A;  3RFH A;  4A2M A;  5I5J A;  2H9P A;  3PXT D;  3SFZ A;  4L3H D;  1VYH C;  3ORV D;  1SQ9 A;  2P9S C;  4QL1 A;  4PSW B;  4GZ8 A;  3I7H A;  3MZK A;  3UVL A;  4ZOZ A;  1GXR A;  3RRM C;  3SBP A;  2IAA A;  1MG3 A;  2IWK A;  3PE7 A;  5A2Q g;  3SBQ A;  4U1E I;  4PXW A;  5H1M A;  3EI1 A;  3NVX A;  2B5N A;  2AGW A;  3JZH A;  3VGZ A;  3J80 g;  5FQD A;  3IIY A;  4J79 A;  4IA9 A;  4MK0 B;  3A0F A;  3JB9 L;  4LGN A;  3KRW B;  2EBS A;  4J87 A;  2P9I C;  4X63 B;  3RMZ D;  5IJ8 E;  5GMK n;  2CN2 A;  1TYQ C;  1QNI A;  2Z2O A;  5C2V B;  2G9A A;  5EAP A;  5HE3 B;  3OW8 A;  4O1Q D;  3IKO A;  2IUP A;  2YNN A;  3MKQ A;  3EI4 A;  5GXH A;  4ZOV A;  2B5M A;  3SCY A;  3JPX A;  2HJ4 A;  4JSV C;  4XEI C;  4ERY A;  2H14 A;  3CIK B;  3I89 A;  3SLE D;  3F3P A;  2P9N C;  4L9O A;  4GQB B;  5CYK B;  3ODT A;  5TEE A;  2P9L C;  4TZ4 A;  5IC7 A;  3SWS D;  4O45 A;  5AMS A;  2PBI B;  1U2V C;  3EMH A;  4ZOY A;  1OMW B;  3NVN A;  2OVP B;  2AGL A;  3RN1 D;  2AH0 A;  1GG2 B;  4A7J A;  3KRX B;  3U4Y A;  2BCJ B;  2AH1 A;  3I7O A;  2PM9 B;  4L3G D;  3OKY B;  2B5L A;  3I7K A;  5FKS A;  2MTA H;  2QXV A;  3AL8 A;  3DWL C;  5TF2 A;  3DM0 A;  2I0R A;  4AOW A;  4O9D A;  2UZY B;  4A08 B;  1FWX A;  1JJU B;  3MXX A;  4JSX C;  5CXC B;  2CE9 A;  1NEX B;  5FKT A;  1A0R B;  3SXT D;  2H9N A;  4J82 A;  3EI2 B;  4FHL A;  3SVW D;  4J86 A;  1OLZ A;  2HJB A;  2GC4 A;  1MG2 A;  3RN0 D;  4A09 B;  2CO0 A;  5C9Z B;  1N6E A;  4GM9 A;  5GSA A;  2HYE A;  5AJA A;  2H6Q A;  5EM2 B;  3UVK A;  4A11 B;  2P9P C;  4OWR A;  4QT8 A;  5HE0 B;  5FKR A;  5I5M A;  4J8B A;  1S4U X;  3OKW A;  5THA A;  4IMM A;  4CI8 A;  4GQ2 P;  5CXB A;  1N6F A;  3EI3 B;  3IJ1 A;  2I3T A;  4A0B B;  3FGB A;  2XYI A;  3BG0 A;  3MKS B;  1MDA H;  4FB1 D;  3V9F A;  1SQJ A;  2IUR A;  3AFC A;  2H9M A;  3SN6 B;  3JZN A;  2P9U C;  3BWS A;  2YNO A;  4J84 A;  4EWR A;  2AGX A;  2UZX B;  2YBA A;  3I7P A;  4BH6 A;  5KDO B;  2J56 H;  5K1C C;  5EMM B;  3IJC A;  3AL9 A;  4H5J A;  5C2W B;  3E0C A;  1GP2 B;  1XHM A;  3PVW B;  3P4F A;  2BBK H;  3UVO A;  4PBZ A;  3UR4 A;  2YMU A;  2OVQ B;  5TEF A;  4FA9 D;  3I7L A;  4QRJ A;  4KFM B;  4HDJ A;  1NR0 A;  4R7A B;  5FXY A;  5SXM A;  4JSN C;  3RSE C;  4AEZ A;  3DXM C;  4ES0 A;  5TDH B;  1ERJ A;  1PBY B;  3K26 A;  4A2L A;  3C9C A;  4A0A B;  3C99 A;  3IIW A;  2YNP A;  4XYI A;  4D6V A;  2XL2 A;  2H9L A;  4ZN4 A;  2PM7 B;  3NVQ A;  1R5M A;  4ESG A;  2IUQ A;  2B4E A;  3EU7 A;  3OL2 B;  3B7F A;  2HES X;  1GOT B;  4FA1 D;  3F3G A;  2YB8 B;  4PBY A;  4CI1 A;  5FLX g;  4E54 B;  2H6K A;  5CYK A;  2HKM A;  4PC0 A;  3K27 A;  2HXC A;  4E5Z B;  4GQ1 A;  2AGZ A;  4FWW A;  4LG8 A;  2OVR B;  4Y5R D;  3RFG A;  3L4O D;  4PSX B;  3UKU C;  4H5I A;  4JXM A;  4FA5 D;  3JZG A;  3MZL A;  5JWZ A;  4ZOX A;  4J8G A;  4NSX A;  5FA5 B;  2H68 A;  4JD2 C;  1U4C A;  2CNX A;  2PM9 A;  3OKY A;  1L0Q A;  1PI6 A;  3I7N A;  3PSL A;  4K3J B;  3GRE A;  1JMZ B;  4JT6 C;  2Z2N A;  3MMY A;  5EML B;  5IJ7 E;  3EI1 B;  4X3E A;  3UVM A;  3CFS B;  4U7A A;  3F3F A;  4JT5 C;  4CZX A;  4A08 A;  5EAR A;  2I3S A;  3JRO A;  4CI2 A;  4L1Q D;  3C5M A;  4PNK B;  5CXC A;  1TBG A;  3DSM A;  1XKS A;  3EI2 A;  3SMR A;  2W18 A;  4FA4 D;  4XYH A;  1P22 A;  4CZV A;  4ERZ A;  4X60 B;  5EMJ B;  2CO0 C;  3ZWL B;  4QQE A;  2J55 H;  4J0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...