5GMKn

Cryo-em structure of the catalytic step i spliceosome (c complex) at 3.4 angstrom resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
405
structure length
299
Chain Sequence
FTKSELKRRRKTRKGDGPWGSWSPKKVIRNYPGHPEGTTALKFLPKTGHLILSGGNDHTIKIWDFECLRDFQGHNKPIKALRFTEDCQSFLSSSFDRSVKIWDTETGKVKTRLHLNSTPADVESRPTNPHEFIVGLSNSKILHYDDVQTYDHHLSSILALKYFPDGSKFISSSEDKTVRIWENQINVPIKQISDTASMPFLNVHPNYFCAQSMDNRIYSFSKYKRHPKKIHSSAGYGISLAFSGDGRYICSGDSKSRLFTWDWNTSRLLIPGNKPITQVDWHPSKVICSGAAGKIYVCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor 8
publication title Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
pubmed doi rcsb
molecule tags Rna binding protein/rna
total genus 36
structure length 299
sequence length 405
ec nomenclature
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
n PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5gmkn00
1XHMA 4NSXA 2HJ4A 3FM0A 3SVWD 3I89A 2EBSA 3SBQA 2AGYA 4O3TB 4JSNC 2P9NC 2CE9A 1GOTB 5HYNB 3NVQA 3SHFA 2CO0A 4ZOZA 5FLXg 3CFSB 5H17A 4J0XA 3EI1A 4G56B 3NVXA 2J56H 2IAAA 3K27A 5TF2A 1VYHC 2H68A 3UKRC 3DSMA 2BCJB 5EARA 1SQJA 2IUQA 5GSAA 3I8EA 4QL1A 4BUJC 3EG6A 3EI3B 4CI8A 2B4EA 2P9IC 3EU7A 5JWZA 3SBRA 3PE7A 2CE8A 4CZVA 5K19A 3OKYB 3PXTD 2Q7QA 3VA6A 3RRMC 2H14A 5IGOA 5CXCB 3UVLA 4FAND 3MKSB 4ESGA 1JMXB 4FWWA 3EI3A 3U4YA 5FXYA 4CY3A 4MK0B 4FA9D 3PSLA 1QNIA 4FAVD 4XEIC 4A2MA 5SXMA 2Z2OA 3OKWA 4JSVC 2XU7A 4L9OA 5C2WB 2I3SA 2OK4A 4JSPC 3C5MA 4E54B 4X3EA 5CXCA 1A0RB 1Q47A 2QXVA 4PSXB 4J81A 2OVRB 3RLMD 2B5NA 5EAPA 2I0RA 4JT6C 5B4WA 5IJ7E 4PBZA 2IWFA 3IJCA 4A09A 4IA9A 2H6KA 4GM3A 3C75H 4E54A 4GQBB 2I0TA 4A08B 1XKSA 4J82A 1OLZA 4CZXA 3DM0A 3I7HA 2CNXA 2YMUA 3ZWLB 4A2LA 4JXMA 3J81g 4H5JA 3VGZA 1SQ9A 3I7NA 1K8KC 3MKQA 4JT5C 3SXTD 4AEZA 2P9KC 3JZHA 1N6EA 4ZOXA 4N14A 4OWRA 5EM2B 2YNNA 4QRJA 3PXSD 3I2NA 3I7KA 2J55H 4A08A 5IGQA 2PM6B 4L3HD 4AOWA 5FQDA 4GQ2P 3GREA 3PXWD 4L1QD 4FHLA 4PXWA 2H9MA 4GQ1A 3FRXA 2Z2NA 2HXCA 4PBYA 2IUPA 4EWRA 3PVWB 2IURA 4O3UB 5TDHB 3J80g 2UZXB 4CI3A 5EM2A 3OKTA 1GG2B 2CN2A 3UVNA 4GM9A 4GZ8A 3CFVA 1PBYB 5HE0B 3SJLD 3SCYA 2XL3A 4HDJA 3SMRA 5EALA 5EMJB 4ZOYA 2AGXA 3OTTA 5IJ8E 3BG1A 2G99A 2H47A 1ERJA 3V5WB 4QT8A 2P9PC 2HKMA 3UVKA 2H9LA 3DWLC 4K3JB 3UR4A 3RFGA 3EI4A 2OK6A 5I5IA 5GMKn 1NEXB 3RSEC 4J86A 2Z2PA 5CXBA 3SLED 4TZ4A 3UVOA 1PGUA 2HESX 1U4CA 2J57G 3RN1D 3I7LA 5TEEA 4CZYA 2B5LA 2YNOA 4XYHA 3AL8B 5H14A 3ORVD 5EAMA 4X61B 3IJ1A 4U1EI 4A09B 4K3ID 5EMLB 1RI6A 4ZN4A 5FA5B 4X60B 2OVQB 3IKOA 1XIPA 4Y7RA 3KRWB 4PSWB 5FKQA 2HKRA 1GP2B 4FA1D 3AL8A 3I8CA 2BBKH 4D0KA 2GNQA 3SWSD 2PM9A 4GM8A 2AH1A 2AGWA 2CN3A 4O1QD 4PNKB 4A0AB 3NVNA 5AFU3 3N0DA 5KDOB 2HJBA 2XL2A 4BL0A 5AMSA 2YNPA 3RFHA 3MZKA 5HE2B 3AL9A 4JSXC 2H13A 3A0FA 3F3GA 1MDAH 2UZYB 3PVUB 3EI2B 5EMKB 1B9YA 3MMYA 3JROA 2YB8B 4XYIA 3F3PA 4JD2C 2OVPB 5GXIA 3C99A 5GXHA 4A0AA 5A2Qg 1JOFA 5I5MA 3PSCB 3SBPA 3OW8A 5K1CC 1JMZB 4LG8A 4E5ZB 3L4OD 1P22A 3SFZA 4U7AA 4LG9A 3EI2A 4CY5A 1B9XA 4UI9R 5AJAA 3JZNA 4O9DA 2P9SC 3FGBA 4R7AB 5HE3B 1SHYB 4GMBA 3L4MD 3HFQA 3EMHA 5FKSA 1U2VC 2H3XA 3C9CA 1K32A 3RMZD 4J78A 2GC4A 3AH8B 4FA5D 3JPXA 4E5ZA 3K26A 4FB1D 3UVMA 2IWKA 4CC9A 4BH6A 3EI4B 2B5MA 3KRXB 4ES0A 1TBGA 5FKTA 4J84A 5IT9g 5CXBB 3ODTA 3UKUC 1L0QA 3JRPA 4J8BA 2AQ5A 4CI2A 5CYKB 1JJUB 2XYIA 4J0WA 2AH0A 3DXMC 1OMWB 4J77A 3GFCA 3W15A 4A7JA 3F3FA 1FWXA 3CIKB 1MG3A 3B7FA 4LGNA 1R5MA 5HE1B 4YVDA 4IMMA 4CY1A 5CYKA 5TEFA 4ERQA 4GGDA 4D6VA 4FA4D 2AGLA 3JZGA 1YFQA 2PM9B 4A0BB 3AFCA 5THAA 2TRCB 2HYEA 5IC7A 4X63B 4H5IA 2O9KA 5H1MA 4J8GA 2H6NA 4Z8LA 3IJ0A 3DXKC 1NR0A 5C2VB 4OZUA 4O45A 4GGAA 5C9ZB 3V7DB 1N6DA 4KFMB 2OIZA 3OL2B 3OKYA 3I7OA 4A0BA 1GXRA 3MZLA 2H6QA 2YBAA 4QQEA 4CY2A 2OJYA 1PEVA 2W18A 4ERZA 1N6FA 2P9UC 5EMMB 2PBIB 3SN6B 5FKRA 2I3TA 2IUVA 4ERYA 3IIWA 2MTAH 1TYQC 3MXXA 3I7PA 4Y5RD 1MG2A 2I0SA 2AGZA 3OL2A 4A11B 3BG0A 3P4FA 3RN0D 3V9FA 4PC0A 3IIYA 4J87A 1PI6A 2P9LC 4J73A 4I79A 4L3GD 2H9PA 5HQGA 4ZOVA 5I5JA 3ULEC 2G9AA 2QC5A 2H9NA 4GGCA 3E0CA 3EWEA 4A11A 2GC7A 3JB9L 4CI1A 3N0EA 2PM7B 3VH0A 2CO0C 4J79A 3JAMg 3BWSA 3EI1B 1S4UX
chains in the Genus database with same CATH superfamily
3K71A 1XHMA 4NSXA 2HJ4A 3FM0A 3NIGA 3SVWD 1E8MA 3I89A 2EBSA 3SBQA 2AGYA 4AMZA 4O3TB 2BKLA 4JSNC 5E6SA 1QFMA 2P9NC 2CE9A 1GOTB 5HYNB 3NVQA 3SHFA 2CO0A 4WK4A 4ZOZA 5FLXg 3CFSB 5H17A 2VC2A 4J0XA 3EI1A 4G56B 1JV2A 3NVXA 2J56H 2IAAA 3K27A 5TF2A 1VYHC 2H68A 3UKRC 3DSMA 1UOOA 2BCJB 5EARA 1VE7A 1SQJA 2IUQA 2XDWA 3EQ7A 5GSAA 3I8EA 4QL1A 4BUJC 3EG6A 3EI3B 4CI8A 2B4EA 2P9IC 3EU7A 4O02A 5JWZA 3SBRA 5C92A 3PE7A 2CE8A 4CZVA 1TYEA 5K19A 3OKYB 3FCUA 3V4VA 3PXTD 3ZDZA 2Q7QA 3VA6A 5C86A 3K6SA 4DNWA 3RRMC 2H14A 2VDQA 5IGOA 5CXCB 3UVLA 4FAND 3IUQA 3MKSB 4ESGA 1K3IA 3IVMA 1JMXB 3MUNA 4FWWA 3EI3A 3U4YA 3IUNA 5FXYA 4CY3A 2EIBA 4MK0B 4FA9D 4G55A 3PSLA 3T3PA 1QNIA 4JHNA 4FAVD 4Z7NA 4XEIC 4A2MA 5SXMA 2Z2OA 1T2XA 3OKWA 4JSVC 2XU7A 4L9OA 5C2WB 2I3SA 2OK4A 4JSPC 4G1MA 3C5MA 4DNUA 4E54B 4X3EA 1UOPA 5CXCA 4RE5A 1A0RB 1Q47A 2QXVA 4PSXB 4J81A 4JHPC 3IURA 2OVRB 3GC3B 1H2XA 3KCIA 3RLMD 5E6RA 2B5NA 5EAPA 1E8NA 2I0RA 1H2YA 4JT6C 5B4WA 5IJ7E 4PBZA 2IWFA 4AX4A 3IJCA 4A09A 4IA9A 2H6KA 4GM3A 3C75H 4MMXA 4E54A 2I0TA 4GQBB 4A08B 1XKSA 4G1EA 4J82A 1OLZA 3IUJA 4CZXA 3DM0A 3I7HA 2CNXA 2YMUA 3ZWLB 4A2LA 1O6GA 4JXMA 3J81g 4H5JA 3VGZA 1SQ9A 3I7NA 1K8KC 3MKQA 4JT5C 4BCCA 3SXTD 4AEZA 5M5VA 2P9KC 3JZHA 1N6EA 4ZOXA 4N14A 4OWRA 5EM2B 1U8CA 2YNNA 4QRJA 3PXSD 3I2NA 3I7KA 3QI0A 2J55H 4A08A 3DDUA 5IGQA 2PM6B 4L3HD 4AOWA 5FQDA 1VE6A 4GQ2P 4IRZA 3GREA 1E5TA 3PXWD 2QR5A 4NC4A 4L1QD 3IUMA 4FHLA 4PXWA 2H9MA 4GQ1A 2VDRA 3FRXA 5M5UA 2Z2NA 2HXCA 4PBYA 2IUPA 4EWRA 3PVWB 2IURA 4O3UB 5TDHB 3J80g 1VZ3A 2UZXB 4NBMA 4CI3A 5EM2A 3QHYB 3OKTA 1GG2B 2CN2A 3UVNA 4GM9A 5FFGA 3NIFA 4GZ8A 4BP8A 3CFVA 3ZE2A 1PBYB 5HE0B 3SJLD 5M61A 2XL3A 4HDJA 3SCYA 3SMRA 5EALA 5EMJB 4ZOYA 2AGXA 3OTTA 2VDPA 5IJ8E 3BG1A 4BP9A 2G99A 2H47A 3ZE0A 1ERJA 3V5WB 4QT8A 2P9PC 1O6FA 2HKMA 3UVKA 2H9LA 3MUOA 3DWLC 3EQ9A 4K3JB 3UR4A 3RFGA 1H2ZA 3EI4A 2OK6A 5I5IA 5GMKn 1NEXB 3RSEC 4J86A 2Z2PA 5CXBA 2HU7A 4TZ4A 3SLED 3UVOA 1PGUA 1C9LA 1GOFA 2HESX 1U4CA 3ZDYA 4UM9A 4NAAA 3FCSA 2EICA 2J57G 4WK2A 3RN1D 3I7LA 5TEEA 4CZYA 2B5LA 2YNOA 4XYHA 3AL8B 5H14A 2VDOA 3ORVD 4Z7OA 5EAMA 4X61B 3IJ1A 4U1EI 4A09B 4K3ID 5EMLB 3EQ8A 1RI6A 4ZN4A 5FA5B 4X60B 3K72A 2XZGA 2OVQB 3IKOA 1XIPA 1JTDB 4Y7RA 3KRWB 4PSWB 5FKQA 2HKRA 5E6UA 4AN1A 1GP2B 4FA1D 3AL8A 3I8CA 2BBKH 4D0KA 2GNQA 3SWSD 2PM9A 4GM8A 4WJKA 2AH1A 1GOHA 2AGWA 2CN3A 4O1QD 4PNKB 4A0AB 3NVNA 5AFU3 3N0DA 4MMYA 5KDOB 2HJBA 2XL2A 3IULA 3O4HA 4BL0A 5AMSA 2YNPA 3RFHA 3MZKA 5HE2B 3AL9A 4JSXC 2H13A 3A0FA 3O4GA 3F3GA 1MDAH 2UZYB 4AN0A 3PVUB 3EI2B 5EMKB 3VI3A 4WK0A 1B9YA 3MMYA 3JROA 2HU5A 2YB8B 4XYIA 3F3PA 4JD2C 2OVPB 5GXIA 5M5RA 3C99A 5GXHA 4A0AA 3O4IA 5A2Qg 1JOFA 5I5MA 3PSCB 3SBPA 2VDLA 3OW8A 5M5SA 5K1CC 1JMZB 4LG8A 4E5ZB 3L4OD 1P22A 3SFZA 4U7AA 4LG9A 3EI2A 3VI4A 4CY5A 1B9XA 4UI9R 5AJAA 1UTCA 4DNVA 3JZNA 4O9DA 2P9SC 3FGBA 4R7AB 5HE3B 1SHYB 4BCBA 4GMBA 3L4MD 3HFQA 3EMHA 5FKSA 2VZ1A 1U2VC 2H3XA 3C9CA 1K32A 3GD1I 3RMZD 4J78A 4QAMA 2GC4A 3AH8B 4FA5D 3JPXA 4E5ZA 3K26A 4FB1D 3UVMA 2IWKA 4CC9A 4BH6A 1L5GA 2B5MA 3EI4B 3KRXB 4ES0A 1TBGA 5FKTA 4J84A 5IT9g 5CXBB 1UOQA 3ODTA 3UKUC 1L0QA 2EIEA 4AMYA 4NENA 1I2MB 3JRPA 3IJEA 4J8BA 2AQ5A 4CI2A 5CYKB 2WQ8A 5M5TA 1JJUB 2XYIA 4J0WA 2AH0A 3DXMC 1OMWB 3O4JA 4J77A 3V4PA 3MVDK 3GFCA 3W15A 4A7JA 3F3FA 1FWXA 3CIKB 1MG3A 3B7FA 4LGNA 1R5MA 5HE1B 4YVDA 1QFSA 1C9IA 4IMMA 4CY1A 5CYKA 5TEFA 1GOGA 4ERQA 4GGDA 4D6VA 4FA4D 2AGLA 3JZGA 1YFQA 2PM9B 4A0BB 3AFCA 1M1XA 2EIDA 5THAA 2TRCB 2HYEA 1A12A 1H2WA 2VZ3A 5IC7A 4X63B 4H5IA 2O9KA 5H1MA 4D9SA 4J8GA 2H6NA 4Z8LA 3IJ0A 2VDMA 4Z7QA 3DXKC 1NR0A 3T3MA 5C2VB 4OZUA 4O45A 4GGAA 5C9ZB 3V7DB 1N6DA 4KFMB 2OIZA 2VDNA 3OL2B 2HU8A 3OKYA 3I7OA 4A0BA 1GXRA 3MZLA 2H6QA 2XE4A 3ZDXA 2YBAA 4QQEA 4CY2A 2OJYA 1PEVA 2W18A 4ERZA 1N6FA 5HDBA 2P9UC 5EMMB 5FFOA 2PBIB 3SN6B 5FKRA 2I3TA 2IUVA 4MMZA 4ERYA 3IIWA 2MTAH 1TYQC 3MXXA 3I7PA 4Y5RD 1MG2A 2I0SA 3OF7A 2AGZA 3OL2A 4A11B 3BG0A 3P4FA 3RN0D 3V9FA 4PC0A 3ZE1A 3IIYA 4J87A 1PI6A 4L1MA 1BPOA 2P9LC 4J73A 4I79A 4L3GD 2H9PA 5HQGA 4ZOVA 5I5JA 3ULEC 2G9AA 2QC5A 1VZ2A 4UM8A 2H9NA 4GGCA 3E0CA 2JKXA 2VDKA 3EWEA 4A11A 4BCDA 1YR2A 2GC7A 2QZPA 3NIDA 3JB9L 4O2WA 4CI1A 3N0EA 2PM7B 3VH0A 2CO0C 4RE6A 4J79A 3JAMg 3BWSA 3EI1B 1S4UX
chains in the Genus database with same CATH topology
1XHMA 4NSXA 2HJ4A 3FM0A 3SVWD 3I89A 2EBSA 3SBQA 2AGYA 4O3TB 4JSNC 2P9NC 2CE9A 1GOTB 5HYNB 3NVQA 3SHFA 2CO0A 4ZOZA 5FLXg 3CFSB 5H17A 4J0XA 3EI1A 4G56B 3NVXA 2J56H 2IAAA 3K27A 5TF2A 1VYHC 2H68A 3UKRC 3DSMA 2BCJB 5EARA 1SQJA 2IUQA 5GSAA 3I8EA 4QL1A 4BUJC 3EG6A 3EI3B 4CI8A 2B4EA 2P9IC 3EU7A 5JWZA 3SBRA 3PE7A 2CE8A 4CZVA 5K19A 3OKYB 3PXTD 2Q7QA 3VA6A 3RRMC 2H14A 5IGOA 5CXCB 3UVLA 4FAND 3MKSB 4ESGA 1JMXB 4FWWA 3EI3A 3U4YA 5FXYA 4CY3A 4MK0B 4FA9D 3PSLA 1QNIA 4FAVD 4XEIC 4A2MA 5SXMA 2Z2OA 3OKWA 4JSVC 2XU7A 4L9OA 5C2WB 2I3SA 2OK4A 4JSPC 3C5MA 4E54B 4X3EA 5CXCA 1A0RB 1Q47A 2QXVA 4PSXB 4J81A 2OVRB 3RLMD 2B5NA 5EAPA 2I0RA 4JT6C 5B4WA 5IJ7E 4PBZA 2IWFA 3IJCA 4A09A 4IA9A 2H6KA 4GM3A 3C75H 4E54A 4GQBB 2I0TA 4A08B 1XKSA 4J82A 1OLZA 4CZXA 3DM0A 3I7HA 2CNXA 2YMUA 3ZWLB 4A2LA 4JXMA 3J81g 4H5JA 3VGZA 1SQ9A 3I7NA 1K8KC 3MKQA 4JT5C 3SXTD 4AEZA 2P9KC 3JZHA 1N6EA 4ZOXA 4N14A 4OWRA 5EM2B 2YNNA 4QRJA 3PXSD 3I2NA 3I7KA 2J55H 4A08A 5IGQA 2PM6B 4L3HD 4AOWA 5FQDA 4GQ2P 3GREA 3PXWD 4L1QD 4FHLA 4PXWA 2H9MA 4GQ1A 3FRXA 2Z2NA 2HXCA 4PBYA 2IUPA 4EWRA 3PVWB 2IURA 4O3UB 5TDHB 3J80g 2UZXB 4CI3A 5EM2A 3OKTA 1GG2B 2CN2A 3UVNA 4GM9A 4GZ8A 3CFVA 1PBYB 5HE0B 3SJLD 3SCYA 2XL3A 4HDJA 3SMRA 5EALA 5EMJB 4ZOYA 2AGXA 3OTTA 5IJ8E 3BG1A 2G99A 2H47A 1ERJA 3V5WB 4QT8A 2P9PC 2HKMA 3UVKA 2H9LA 3DWLC 4K3JB 3UR4A 3RFGA 3EI4A 2OK6A 5I5IA 5GMKn 1NEXB 3RSEC 4J86A 2Z2PA 5CXBA 3SLED 4TZ4A 3UVOA 1PGUA 2HESX 1U4CA 2J57G 3RN1D 3I7LA 5TEEA 4CZYA 2B5LA 2YNOA 4XYHA 3AL8B 5H14A 3ORVD 5EAMA 4X61B 3IJ1A 4U1EI 4A09B 4K3ID 5EMLB 1RI6A 4ZN4A 5FA5B 4X60B 2OVQB 3IKOA 1XIPA 4Y7RA 3KRWB 4PSWB 5FKQA 2HKRA 1GP2B 4FA1D 3AL8A 3I8CA 2BBKH 4D0KA 2GNQA 3SWSD 2PM9A 4GM8A 2AH1A 2AGWA 2CN3A 4O1QD 4PNKB 4A0AB 3NVNA 5AFU3 3N0DA 5KDOB 2HJBA 2XL2A 4BL0A 5AMSA 2YNPA 3RFHA 3MZKA 5HE2B 3AL9A 4JSXC 2H13A 3A0FA 3F3GA 1MDAH 2UZYB 3PVUB 3EI2B 5EMKB 1B9YA 3MMYA 3JROA 2YB8B 4XYIA 3F3PA 4JD2C 2OVPB 5GXIA 3C99A 5GXHA 4A0AA 5A2Qg 1JOFA 5I5MA 3PSCB 3SBPA 3OW8A 5K1CC 1JMZB 4LG8A 4E5ZB 3L4OD 1P22A 3SFZA 4U7AA 4LG9A 3EI2A 4CY5A 1B9XA 4UI9R 5AJAA 3JZNA 4O9DA 2P9SC 3FGBA 4R7AB 5HE3B 1SHYB 4GMBA 3L4MD 3HFQA 3EMHA 5FKSA 1U2VC 2H3XA 3C9CA 1K32A 3RMZD 4J78A 2GC4A 3AH8B 4FA5D 3JPXA 4E5ZA 3K26A 4FB1D 3UVMA 2IWKA 4CC9A 4BH6A 3EI4B 2B5MA 3KRXB 4ES0A 1TBGA 5FKTA 4J84A 5IT9g 5CXBB 3ODTA 3UKUC 1L0QA 3JRPA 4J8BA 2AQ5A 4CI2A 5CYKB 1JJUB 2XYIA 4J0WA 2AH0A 3DXMC 1OMWB 4J77A 3GFCA 3W15A 4A7JA 3F3FA 1FWXA 3CIKB 1MG3A 3B7FA 4LGNA 1R5MA 5HE1B 4YVDA 4IMMA 4CY1A 5CYKA 5TEFA 4ERQA 4GGDA 4D6VA 4FA4D 2AGLA 3JZGA 1YFQA 2PM9B 4A0BB 3AFCA 5THAA 2TRCB 2HYEA 5IC7A 4X63B 4H5IA 2O9KA 5H1MA 4J8GA 2H6NA 4Z8LA 3IJ0A 3DXKC 1NR0A 5C2VB 4OZUA 4O45A 4GGAA 5C9ZB 3V7DB 1N6DA 4KFMB 2OIZA 3OL2B 3OKYA 3I7OA 4A0BA 1GXRA 3MZLA 2H6QA 2YBAA 4QQEA 4CY2A 2OJYA 1PEVA 2W18A 4ERZA 1N6FA 2P9UC 5EMMB 2PBIB 3SN6B 5FKRA 2I3TA 2IUVA 4ERYA 3IIWA 2MTAH 1TYQC 3MXXA 3I7PA 4Y5RD 1MG2A 2I0SA 2AGZA 3OL2A 4A11B 3BG0A 3P4FA 3RN0D 3V9FA 4PC0A 3IIYA 4J87A 1PI6A 2P9LC 4J73A 4I79A 4L3GD 2H9PA 5HQGA 4ZOVA 5I5JA 3ULEC 2G9AA 2QC5A 2H9NA 4GGCA 3E0CA 3EWEA 4A11A 2GC7A 3JB9L 4CI1A 3N0EA 2PM7B 3VH0A 2CO0C 4J79A 3JAMg 3BWSA 3EI1B 1S4UX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XHM A;  4NSX A;  2HJ4 A;  3FM0 A;  3SVW D;  3I89 A;  2EBS A;  3SBQ A;  2AGY A;  4O3T B;  4JSN C;  2P9N C;  2CE9 A;  1GOT B;  5HYN B;  3NVQ A;  3SHF A;  2CO0 A;  4ZOZ A;  5FLX g;  3CFS B;  5H17 A;  4J0X A;  3EI1 A;  4G56 B;  3NVX A;  2J56 H;  2IAA A;  3K27 A;  5TF2 A;  1VYH C;  2H68 A;  3UKR C;  3DSM A;  2BCJ B;  5EAR A;  1SQJ A;  2IUQ A;  5GSA A;  3I8E A;  4QL1 A;  4BUJ C;  3EG6 A;  3EI3 B;  4CI8 A;  2B4E A;  2P9I C;  3EU7 A;  5JWZ A;  3SBR A;  3PE7 A;  2CE8 A;  4CZV A;  5K19 A;  3OKY B;  3PXT D;  2Q7Q A;  3VA6 A;  3RRM C;  2H14 A;  5IGO A;  5CXC B;  3UVL A;  4FAN D;  3MKS B;  4ESG A;  1JMX B;  4FWW A;  3EI3 A;  3U4Y A;  5FXY A;  4CY3 A;  4MK0 B;  4FA9 D;  3PSL A;  1QNI A;  4FAV D;  4XEI C;  4A2M A;  5SXM A;  2Z2O A;  3OKW A;  4JSV C;  2XU7 A;  4L9O A;  5C2W B;  2I3S A;  2OK4 A;  4JSP C;  3C5M A;  4E54 B;  4X3E A;  5CXC A;  1A0R B;  1Q47 A;  2QXV A;  4PSX B;  4J81 A;  2OVR B;  3RLM D;  2B5N A;  5EAP A;  2I0R A;  4JT6 C;  5B4W A;  5IJ7 E;  4PBZ A;  2IWF A;  3IJC A;  4A09 A;  4IA9 A;  2H6K A;  4GM3 A;  3C75 H;  4E54 A;  4GQB B;  2I0T A;  4A08 B;  1XKS A;  4J82 A;  1OLZ A;  4CZX A;  3DM0 A;  3I7H A;  2CNX A;  2YMU A;  3ZWL B;  4A2L A;  4JXM A;  3J81 g;  4H5J A;  3VGZ A;  1SQ9 A;  3I7N A;  1K8K C;  3MKQ A;  4JT5 C;  3SXT D;  4AEZ A;  2P9K C;  3JZH A;  1N6E A;  4ZOX A;  4N14 A;  4OWR A;  5EM2 B;  2YNN A;  4QRJ A;  3PXS D;  3I2N A;  3I7K A;  2J55 H;  4A08 A;  5IGQ A;  2PM6 B;  4L3H D;  4AOW A;  5FQD A;  4GQ2 P;  3GRE A;  3PXW D;  4L1Q D;  4FHL A;  4PXW A;  2H9M A;  4GQ1 A;  3FRX A;  2Z2N A;  2HXC A;  4PBY A;  2IUP A;  4EWR A;  3PVW B;  2IUR A;  4O3U B;  5TDH B;  3J80 g;  2UZX B;  4CI3 A;  5EM2 A;  3OKT A;  1GG2 B;  2CN2 A;  3UVN A;  4GM9 A;  4GZ8 A;  3CFV A;  1PBY B;  5HE0 B;  3SJL D;  3SCY A;  2XL3 A;  4HDJ A;  3SMR A;  5EAL A;  5EMJ B;  4ZOY A;  2AGX A;  3OTT A;  5IJ8 E;  3BG1 A;  2G99 A;  2H47 A;  1ERJ A;  3V5W B;  4QT8 A;  2P9P C;  2HKM A;  3UVK A;  2H9L A;  3DWL C;  4K3J B;  3UR4 A;  3RFG A;  3EI4 A;  2OK6 A;  5I5I A;  5GMK n;  1NEX B;  3RSE C;  4J86 A;  2Z2P A;  5CXB A;  3SLE D;  4TZ4 A;  3UVO A;  1PGU A;  2HES X;  1U4C A;  2J57 G;  3RN1 D;  3I7L A;  5TEE A;  4CZY A;  2B5L A;  2YNO A;  4XYH A;  3AL8 B;  5H14 A;  3ORV D;  5EAM A;  4X61 B;  3IJ1 A;  4U1E I;  4A09 B;  4K3I D;  5EML B;  1RI6 A;  4ZN4 A;  5FA5 B;  4X60 B;  2OVQ B;  3IKO A;  1XIP A;  4Y7R A;  3KRW B;  4PSW B;  5FKQ A;  2HKR A;  1GP2 B;  4FA1 D;  3AL8 A;  3I8C A;  2BBK H;  4D0K A;  2GNQ A;  3SWS D;  2PM9 A;  4GM8 A;  2AH1 A;  2AGW A;  2CN3 A;  4O1Q D;  4PNK B;  4A0A B;  3NVN A;  5AFU 3;  3N0D A;  5KDO B;  2HJB A;  2XL2 A;  4BL0 A;  5AMS A;  2YNP A;  3RFH A;  3MZK A;  5HE2 B;  3AL9 A;  4JSX C;  2H13 A;  3A0F A;  3F3G A;  1MDA H;  2UZY B;  3PVU B;  3EI2 B;  5EMK B;  1B9Y A;  3MMY A;  3JRO A;  2YB8 B;  4XYI A;  3F3P A;  4JD2 C;  2OVP B;  5GXI A;  3C99 A;  5GXH A;  4A0A A;  5A2Q g;  1JOF A;  5I5M A;  3PSC B;  3SBP A;  3OW8 A;  5K1C C;  1JMZ B;  4LG8 A;  4E5Z B;  3L4O D;  1P22 A;  3SFZ A;  4U7A A;  4LG9 A;  3EI2 A;  4CY5 A;  1B9X A;  4UI9 R;  5AJA A;  3JZN A;  4O9D A;  2P9S C;  3FGB A;  4R7A B;  5HE3 B;  1SHY B;  4GMB A;  3L4M D;  3HFQ A;  3EMH A;  5FKS A;  1U2V C;  2H3X A;  3C9C A;  1K32 A;  3RMZ D;  4J78 A;  2GC4 A;  3AH8 B;  4FA5 D;  3JPX A;  4E5Z A;  3K26 A;  4FB1 D;  3UVM A;  2IWK A;  4CC9 A;  4BH6 A;  3EI4 B;  2B5M A;  3KRX B;  4ES0 A;  1TBG A;  5FKT A;  4J84 A;  5IT9 g;  5CXB B;  3ODT A;  3UKU C;  1L0Q A;  3JRP A;  4J8B A;  2AQ5 A;  4CI2 A;  5CYK B;  1JJU B;  2XYI A;  4J0W A;  2AH0 A;  3DXM C;  1OMW B;  4J77 A;  3GFC A;  3W15 A;  4A7J A;  3F3F A;  1FWX A;  3CIK B;  1MG3 A;  3B7F A;  4LGN A;  1R5M A;  5HE1 B;  4YVD A;  4IMM A;  4CY1 A;  5CYK A;  5TEF A;  4ERQ A;  4GGD A;  4D6V A;  4FA4 D;  2AGL A;  3JZG A;  1YFQ A;  2PM9 B;  4A0B B;  3AFC A;  5THA A;  2TRC B;  2HYE A;  5IC7 A;  4X63 B;  4H5I A;  2O9K A;  5H1M A;  4J8G A;  2H6N A;  4Z8L A;  3IJ0 A;  3DXK C;  1NR0 A;  5C2V B;  4OZU A;  4O45 A;  4GGA A;  5C9Z B;  3V7D B;  1N6D A;  4KFM B;  2OIZ A;  3OL2 B;  3OKY A;  3I7O A;  4A0B A;  1GXR A;  3MZL A;  2H6Q A;  2YBA A;  4QQE A;  4CY2 A;  2OJY A;  1PEV A;  2W18 A;  4ERZ A;  1N6F A;  2P9U C;  5EMM B;  2PBI B;  3SN6 B;  5FKR A;  2I3T A;  2IUV A;  4ERY A;  3IIW A;  2MTA H;  1TYQ C;  3MXX A;  3I7P A;  4Y5R D;  1MG2 A;  2I0S A;  2AGZ A;  3OL2 A;  4A11 B;  3BG0 A;  3P4F A;  3RN0 D;  3V9F A;  4PC0 A;  3IIY A;  4J87 A;  1PI6 A;  2P9L C;  4J73 A;  4I79 A;  4L3G D;  2H9P A;  5HQG A;  4ZOV A;  5I5J A;  3ULE C;  2G9A A;  2QC5 A;  2H9N A;  4GGC A;  3E0C A;  3EWE A;  4A11 A;  2GC7 A;  3JB9 L;  4CI1 A;  3N0E A;  2PM7 B;  3VH0 A;  2CO0 C;  4J79 A;  3JAM g;  3BWS A;  3EI1 B;  1S4U X; 
#chains in the Genus database with same CATH topology
 3K71 A;  1XHM A;  4NSX A;  2HJ4 A;  3FM0 A;  3NIG A;  3SVW D;  1E8M A;  3I89 A;  2EBS A;  3SBQ A;  2AGY A;  4AMZ A;  4O3T B;  2BKL A;  4JSN C;  5E6S A;  1QFM A;  2P9N C;  2CE9 A;  1GOT B;  5HYN B;  3NVQ A;  3SHF A;  2CO0 A;  4WK4 A;  4ZOZ A;  5FLX g;  3CFS B;  5H17 A;  2VC2 A;  4J0X A;  3EI1 A;  4G56 B;  1JV2 A;  3NVX A;  2J56 H;  2IAA A;  3K27 A;  5TF2 A;  1VYH C;  2H68 A;  3UKR C;  3DSM A;  1UOO A;  2BCJ B;  5EAR A;  1VE7 A;  1SQJ A;  2IUQ A;  2XDW A;  3EQ7 A;  5GSA A;  3I8E A;  4QL1 A;  4BUJ C;  3EG6 A;  3EI3 B;  4CI8 A;  2B4E A;  2P9I C;  3EU7 A;  4O02 A;  5JWZ A;  3SBR A;  5C92 A;  3PE7 A;  2CE8 A;  4CZV A;  1TYE A;  5K19 A;  3OKY B;  3FCU A;  3V4V A;  3PXT D;  3ZDZ A;  2Q7Q A;  3VA6 A;  5C86 A;  3K6S A;  4DNW A;  3RRM C;  2H14 A;  2VDQ A;  5IGO A;  5CXC B;  3UVL A;  4FAN D;  3IUQ A;  3MKS B;  4ESG A;  1K3I A;  3IVM A;  1JMX B;  3MUN A;  4FWW A;  3EI3 A;  3U4Y A;  3IUN A;  5FXY A;  4CY3 A;  2EIB A;  4MK0 B;  4FA9 D;  4G55 A;  3PSL A;  3T3P A;  1QNI A;  4JHN A;  4FAV D;  4Z7N A;  4XEI C;  4A2M A;  5SXM A;  2Z2O A;  1T2X A;  3OKW A;  4JSV C;  2XU7 A;  4L9O A;  5C2W B;  2I3S A;  2OK4 A;  4JSP C;  4G1M A;  3C5M A;  4DNU A;  4E54 B;  4X3E A;  1UOP A;  5CXC A;  4RE5 A;  1A0R B;  1Q47 A;  2QXV A;  4PSX B;  4J81 A;  4JHP C;  3IUR A;  2OVR B;  3GC3 B;  1H2X A;  3KCI A;  3RLM D;  5E6R A;  2B5N A;  5EAP A;  1E8N A;  2I0R A;  1H2Y A;  4JT6 C;  5B4W A;  5IJ7 E;  4PBZ A;  2IWF A;  4AX4 A;  3IJC A;  4A09 A;  4IA9 A;  2H6K A;  4GM3 A;  3C75 H;  4MMX A;  4E54 A;  2I0T A;  4GQB B;  4A08 B;  1XKS A;  4G1E A;  4J82 A;  1OLZ A;  3IUJ A;  4CZX A;  3DM0 A;  3I7H A;  2CNX A;  2YMU A;  3ZWL B;  4A2L A;  1O6G A;  4JXM A;  3J81 g;  4H5J A;  3VGZ A;  1SQ9 A;  3I7N A;  1K8K C;  3MKQ A;  4JT5 C;  4BCC A;  3SXT D;  4AEZ A;  5M5V A;  2P9K C;  3JZH A;  1N6E A;  4ZOX A;  4N14 A;  4OWR A;  5EM2 B;  1U8C A;  2YNN A;  4QRJ A;  3PXS D;  3I2N A;  3I7K A;  3QI0 A;  2J55 H;  4A08 A;  3DDU A;  5IGQ A;  2PM6 B;  4L3H D;  4AOW A;  5FQD A;  1VE6 A;  4GQ2 P;  4IRZ A;  3GRE A;  1E5T A;  3PXW D;  2QR5 A;  4NC4 A;  4L1Q D;  3IUM A;  4FHL A;  4PXW A;  2H9M A;  4GQ1 A;  2VDR A;  3FRX A;  5M5U A;  2Z2N A;  2HXC A;  4PBY A;  2IUP A;  4EWR A;  3PVW B;  2IUR A;  4O3U B;  5TDH B;  3J80 g;  1VZ3 A;  2UZX B;  4NBM A;  4CI3 A;  5EM2 A;  3QHY B;  3OKT A;  1GG2 B;  2CN2 A;  3UVN A;  4GM9 A;  5FFG A;  3NIF A;  4GZ8 A;  4BP8 A;  3CFV A;  3ZE2 A;  1PBY B;  5HE0 B;  3SJL D;  5M61 A;  2XL3 A;  4HDJ A;  3SCY A;  3SMR A;  5EAL A;  5EMJ B;  4ZOY A;  2AGX A;  3OTT A;  2VDP A;  5IJ8 E;  3BG1 A;  4BP9 A;  2G99 A;  2H47 A;  3ZE0 A;  1ERJ A;  3V5W B;  4QT8 A;  2P9P C;  1O6F A;  2HKM A;  3UVK A;  2H9L A;  3MUO A;  3DWL C;  3EQ9 A;  4K3J B;  3UR4 A;  3RFG A;  1H2Z A;  3EI4 A;  2OK6 A;  5I5I A;  5GMK n;  1NEX B;  3RSE C;  4J86 A;  2Z2P A;  5CXB A;  2HU7 A;  4TZ4 A;  3SLE D;  3UVO A;  1PGU A;  1C9L A;  1GOF A;  2HES X;  1U4C A;  3ZDY A;  4UM9 A;  4NAA A;  3FCS A;  2EIC A;  2J57 G;  4WK2 A;  3RN1 D;  3I7L A;  5TEE A;  4CZY A;  2B5L A;  2YNO A;  4XYH A;  3AL8 B;  5H14 A;  2VDO A;  3ORV D;  4Z7O A;  5EAM A;  4X61 B;  3IJ1 A;  4U1E I;  4A09 B;  4K3I D;  5EML B;  3EQ8 A;  1RI6 A;  4ZN4 A;  5FA5 B;  4X60 B;  3K72 A;  2XZG A;  2OVQ B;  3IKO A;  1XIP A;  1JTD B;  4Y7R A;  3KRW B;  4PSW B;  5FKQ A;  2HKR A;  5E6U A;  4AN1 A;  1GP2 B;  4FA1 D;  3AL8 A;  3I8C A;  2BBK H;  4D0K A;  2GNQ A;  3SWS D;  2PM9 A;  4GM8 A;  4WJK A;  2AH1 A;  1GOH A;  2AGW A;  2CN3 A;  4O1Q D;  4PNK B;  4A0A B;  3NVN A;  5AFU 3;  3N0D A;  4MMY A;  5KDO B;  2HJB A;  2XL2 A;  3IUL A;  3O4H A;  4BL0 A;  5AMS A;  2YNP A;  3RFH A;  3MZK A;  5HE2 B;  3AL9 A;  4JSX C;  2H13 A;  3A0F A;  3O4G A;  3F3G A;  1MDA H;  2UZY B;  4AN0 A;  3PVU B;  3EI2 B;  5EMK B;  3VI3 A;  4WK0 A;  1B9Y A;  3MMY A;  3JRO A;  2HU5 A;  2YB8 B;  4XYI A;  3F3P A;  4JD2 C;  2OVP B;  5GXI A;  5M5R A;  3C99 A;  5GXH A;  4A0A A;  3O4I A;  5A2Q g;  1JOF A;  5I5M A;  3PSC B;  3SBP A;  2VDL A;  3OW8 A;  5M5S A;  5K1C C;  1JMZ B;  4LG8 A;  4E5Z B;  3L4O D;  1P22 A;  3SFZ A;  4U7A A;  4LG9 A;  3EI2 A;  3VI4 A;  4CY5 A;  1B9X A;  4UI9 R;  5AJA A;  1UTC A;  4DNV A;  3JZN A;  4O9D A;  2P9S C;  3FGB A;  4R7A B;  5HE3 B;  1SHY B;  4BCB A;  4GMB A;  3L4M D;  3HFQ A;  3EMH A;  5FKS A;  2VZ1 A;  1U2V C;  2H3X A;  3C9C A;  1K32 A;  3GD1 I;  3RMZ D;  4J78 A;  4QAM A;  2GC4 A;  3AH8 B;  4FA5 D;  3JPX A;  4E5Z A;  3K26 A;  4FB1 D;  3UVM A;  2IWK A;  4CC9 A;  4BH6 A;  1L5G A;  2B5M A;  3EI4 B;  3KRX B;  4ES0 A;  1TBG A;  5FKT A;  4J84 A;  5IT9 g;  5CXB B;  1UOQ A;  3ODT A;  3UKU C;  1L0Q A;  2EIE A;  4AMY A;  4NEN A;  1I2M B;  3JRP A;  3IJE A;  4J8B A;  2AQ5 A;  4CI2 A;  5CYK B;  2WQ8 A;  5M5T A;  1JJU B;  2XYI A;  4J0W A;  2AH0 A;  3DXM C;  1OMW B;  3O4J A;  4J77 A;  3V4P A;  3MVD K;  3GFC A;  3W15 A;  4A7J A;  3F3F A;  1FWX A;  3CIK B;  1MG3 A;  3B7F A;  4LGN A;  1R5M A;  5HE1 B;  4YVD A;  1QFS A;  1C9I A;  4IMM A;  4CY1 A;  5CYK A;  5TEF A;  1GOG A;  4ERQ A;  4GGD A;  4D6V A;  4FA4 D;  2AGL A;  3JZG A;  1YFQ A;  2PM9 B;  4A0B B;  3AFC A;  1M1X A;  2EID A;  5THA A;  2TRC B;  2HYE A;  1A12 A;  1H2W A;  2VZ3 A;  5IC7 A;  4X63 B;  4H5I A;  2O9K A;  5H1M A;  4D9S A;  4J8G A;  2H6N A;  4Z8L A;  3IJ0 A;  2VDM A;  4Z7Q A;  3DXK C;  1NR0 A;  3T3M A;  5C2V B;  4OZU A;  4O45 A;  4GGA A;  5C9Z B;  3V7D B;  1N6D A;  4KFM B;  2OIZ A;  2VDN A;  3OL2 B;  2HU8 A;  3OKY A;  3I7O A;  4A0B A;  1GXR A;  3MZL A;  2H6Q A;  2XE4 A;  3ZDX A;  2YBA A;  4QQE A;  4CY2 A;  2OJY A;  1PEV A;  2W18 A;  4ERZ A;  1N6F A;  5HDB A;  2P9U C;  5EMM B;  5FFO A;  2PBI B;  3SN6 B;  5FKR A;  2I3T A;  2IUV A;  4MMZ A;  4ERY A;  3IIW A;  2MTA H;  1TYQ C;  3MXX A;  3I7P A;  4Y5R D;  1MG2 A;  2I0S A;  3OF7 A;  2AGZ A;  3OL2 A;  4A11 B;  3BG0 A;  3P4F A;  3RN0 D;  3V9F A;  4PC0 A;  3ZE1 A;  3IIY A;  4J87 A;  1PI6 A;  4L1M A;  1BPO A;  2P9L C;  4J73 A;  4I79 A;  4L3G D;  2H9P A;  5HQG A;  4ZOV A;  5I5J A;  3ULE C;  2G9A A;  2QC5 A;  1VZ2 A;  4UM8 A;  2H9N A;  4GGC A;  3E0C A;  2JKX A;  2VDK A;  3EWE A;  4A11 A;  4BCD A;  1YR2 A;  2GC7 A;  2QZP A;  3NID A;  3JB9 L;  4O2W A;  4CI1 A;  3N0E A;  2PM7 B;  3VH0 A;  2CO0 C;  4RE6 A;  4J79 A;  3JAM g;  3BWS A;  3EI1 B;  1S4U X; 
#chains in the Genus database with same CATH homology
 1XHM A;  4NSX A;  2HJ4 A;  3FM0 A;  3SVW D;  3I89 A;  2EBS A;  3SBQ A;  2AGY A;  4O3T B;  4JSN C;  2P9N C;  2CE9 A;  1GOT B;  5HYN B;  3NVQ A;  3SHF A;  2CO0 A;  4ZOZ A;  5FLX g;  3CFS B;  5H17 A;  4J0X A;  3EI1 A;  4G56 B;  3NVX A;  2J56 H;  2IAA A;  3K27 A;  5TF2 A;  1VYH C;  2H68 A;  3UKR C;  3DSM A;  2BCJ B;  5EAR A;  1SQJ A;  2IUQ A;  5GSA A;  3I8E A;  4QL1 A;  4BUJ C;  3EG6 A;  3EI3 B;  4CI8 A;  2B4E A;  2P9I C;  3EU7 A;  5JWZ A;  3SBR A;  3PE7 A;  2CE8 A;  4CZV A;  5K19 A;  3OKY B;  3PXT D;  2Q7Q A;  3VA6 A;  3RRM C;  2H14 A;  5IGO A;  5CXC B;  3UVL A;  4FAN D;  3MKS B;  4ESG A;  1JMX B;  4FWW A;  3EI3 A;  3U4Y A;  5FXY A;  4CY3 A;  4MK0 B;  4FA9 D;  3PSL A;  1QNI A;  4FAV D;  4XEI C;  4A2M A;  5SXM A;  2Z2O A;  3OKW A;  4JSV C;  2XU7 A;  4L9O A;  5C2W B;  2I3S A;  2OK4 A;  4JSP C;  3C5M A;  4E54 B;  4X3E A;  5CXC A;  1A0R B;  1Q47 A;  2QXV A;  4PSX B;  4J81 A;  2OVR B;  3RLM D;  2B5N A;  5EAP A;  2I0R A;  4JT6 C;  5B4W A;  5IJ7 E;  4PBZ A;  2IWF A;  3IJC A;  4A09 A;  4IA9 A;  2H6K A;  4GM3 A;  3C75 H;  4E54 A;  4GQB B;  2I0T A;  4A08 B;  1XKS A;  4J82 A;  1OLZ A;  4CZX A;  3DM0 A;  3I7H A;  2CNX A;  2YMU A;  3ZWL B;  4A2L A;  4JXM A;  3J81 g;  4H5J A;  3VGZ A;  1SQ9 A;  3I7N A;  1K8K C;  3MKQ A;  4JT5 C;  3SXT D;  4AEZ A;  2P9K C;  3JZH A;  1N6E A;  4ZOX A;  4N14 A;  4OWR A;  5EM2 B;  2YNN A;  4QRJ A;  3PXS D;  3I2N A;  3I7K A;  2J55 H;  4A08 A;  5IGQ A;  2PM6 B;  4L3H D;  4AOW A;  5FQD A;  4GQ2 P;  3GRE A;  3PXW D;  4L1Q D;  4FHL A;  4PXW A;  2H9M A;  4GQ1 A;  3FRX A;  2Z2N A;  2HXC A;  4PBY A;  2IUP A;  4EWR A;  3PVW B;  2IUR A;  4O3U B;  5TDH B;  3J80 g;  2UZX B;  4CI3 A;  5EM2 A;  3OKT A;  1GG2 B;  2CN2 A;  3UVN A;  4GM9 A;  4GZ8 A;  3CFV A;  1PBY B;  5HE0 B;  3SJL D;  3SCY A;  2XL3 A;  4HDJ A;  3SMR A;  5EAL A;  5EMJ B;  4ZOY A;  2AGX A;  3OTT A;  5IJ8 E;  3BG1 A;  2G99 A;  2H47 A;  1ERJ A;  3V5W B;  4QT8 A;  2P9P C;  2HKM A;  3UVK A;  2H9L A;  3DWL C;  4K3J B;  3UR4 A;  3RFG A;  3EI4 A;  2OK6 A;  5I5I A;  5GMK n;  1NEX B;  3RSE C;  4J86 A;  2Z2P A;  5CXB A;  3SLE D;  4TZ4 A;  3UVO A;  1PGU A;  2HES X;  1U4C A;  2J57 G;  3RN1 D;  3I7L A;  5TEE A;  4CZY A;  2B5L A;  2YNO A;  4XYH A;  3AL8 B;  5H14 A;  3ORV D;  5EAM A;  4X61 B;  3IJ1 A;  4U1E I;  4A09 B;  4K3I D;  5EML B;  1RI6 A;  4ZN4 A;  5FA5 B;  4X60 B;  2OVQ B;  3IKO A;  1XIP A;  4Y7R A;  3KRW B;  4PSW B;  5FKQ A;  2HKR A;  1GP2 B;  4FA1 D;  3AL8 A;  3I8C A;  2BBK H;  4D0K A;  2GNQ A;  3SWS D;  2PM9 A;  4GM8 A;  2AH1 A;  2AGW A;  2CN3 A;  4O1Q D;  4PNK B;  4A0A B;  3NVN A;  5AFU 3;  3N0D A;  5KDO B;  2HJB A;  2XL2 A;  4BL0 A;  5AMS A;  2YNP A;  3RFH A;  3MZK A;  5HE2 B;  3AL9 A;  4JSX C;  2H13 A;  3A0F A;  3F3G A;  1MDA H;  2UZY B;  3PVU B;  3EI2 B;  5EMK B;  1B9Y A;  3MMY A;  3JRO A;  2YB8 B;  4XYI A;  3F3P A;  4JD2 C;  2OVP B;  5GXI A;  3C99 A;  5GXH A;  4A0A A;  5A2Q g;  1JOF A;  5I5M A;  3PSC B;  3SBP A;  3OW8 A;  5K1C C;  1JMZ B;  4LG8 A;  4E5Z B;  3L4O D;  1P22 A;  3SFZ A;  4U7A A;  4LG9 A;  3EI2 A;  4CY5 A;  1B9X A;  4UI9 R;  5AJA A;  3JZN A;  4O9D A;  2P9S C;  3FGB A;  4R7A B;  5HE3 B;  1SHY B;  4GMB A;  3L4M D;  3HFQ A;  3EMH A;  5FKS A;  1U2V C;  2H3X A;  3C9C A;  1K32 A;  3RMZ D;  4J78 A;  2GC4 A;  3AH8 B;  4FA5 D;  3JPX A;  4E5Z A;  3K26 A;  4FB1 D;  3UVM A;  2IWK A;  4CC9 A;  4BH6 A;  3EI4 B;  2B5M A;  3KRX B;  4ES0 A;  1TBG A;  5FKT A;  4J84 A;  5IT9 g;  5CXB B;  3ODT A;  3UKU C;  1L0Q A;  3JRP A;  4J8B A;  2AQ5 A;  4CI2 A;  5CYK B;  1JJU B;  2XYI A;  4J0W A;  2AH0 A;  3DXM C;  1OMW B;  4J77 A;  3GFC A;  3W15 A;  4A7J A;  3F3F A;  1FWX A;  3CIK B;  1MG3 A;  3B7F A;  4LGN A;  1R5M A;  5HE1 B;  4YVD A;  4IMM A;  4CY1 A;  5CYK A;  5TEF A;  4ERQ A;  4GGD A;  4D6V A;  4FA4 D;  2AGL A;  3JZG A;  1YFQ A;  2PM9 B;  4A0B B;  3AFC A;  5THA A;  2TRC B;  2HYE A;  5IC7 A;  4X63 B;  4H5I A;  2O9K A;  5H1M A;  4J8G A;  2H6N A;  4Z8L A;  3IJ0 A;  3DXK C;  1NR0 A;  5C2V B;  4OZU A;  4O45 A;  4GGA A;  5C9Z B;  3V7D B;  1N6D A;  4KFM B;  2OIZ A;  3OL2 B;  3OKY A;  3I7O A;  4A0B A;  1GXR A;  3MZL A;  2H6Q A;  2YBA A;  4QQE A;  4CY2 A;  2OJY A;  1PEV A;  2W18 A;  4ERZ A;  1N6F A;  2P9U C;  5EMM B;  2PBI B;  3SN6 B;  5FKR A;  2I3T A;  2IUV A;  4ERY A;  3IIW A;  2MTA H;  1TYQ C;  3MXX A;  3I7P A;  4Y5R D;  1MG2 A;  2I0S A;  2AGZ A;  3OL2 A;  4A11 B;  3BG0 A;  3P4F A;  3RN0 D;  3V9F A;  4PC0 A;  3IIY A;  4J87 A;  1PI6 A;  2P9L C;  4J73 A;  4I79 A;  4L3G D;  2H9P A;  5HQG A;  4ZOV A;  5I5J A;  3ULE C;  2G9A A;  2QC5 A;  2H9N A;  4GGC A;  3E0C A;  3EWE A;  4A11 A;  2GC7 A;  3JB9 L;  4CI1 A;  3N0E A;  2PM7 B;  3VH0 A;  2CO0 C;  4J79 A;  3JAM g;  3BWS A;  3EI1 B;  1S4U X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...