5GMKn

Cryo-em structure of the catalytic step i spliceosome (c complex) at 3.4 angstrom resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
405
structure length
299
Chain Sequence
FTKSELKRRRKTRKGDGPWGSWSPKKVIRNYPGHPEGTTALKFLPKTGHLILSGGNDHTIKIWDFECLRDFQGHNKPIKALRFTEDCQSFLSSSFDRSVKIWDTETGKVKTRLHLNSTPADVESRPTNPHEFIVGLSNSKILHYDDVQTYDHHLSSILALKYFPDGSKFISSSEDKTVRIWENQINVPIKQISDTASMPFLNVHPNYFCAQSMDNRIYSFSKYKRHPKKIHSSAGYGISLAFSGDGRYICSGDSKSRLFTWDWNTSRLLIPGNKPITQVDWHPSKVICSGAAGKIYVCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
pubmed doi rcsb
molecule tags Rna binding protein/rna
molecule keywords Pre-mRNA-splicing factor 8
total genus 36
structure length 299
sequence length 405
ec nomenclature
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
n PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5gmkn00
1U2VC 1PGUA 3OW8A 4L3HD 3C5MA 1B9YA 1U4CA 4Z8LA 5GXIA 4BL0A 5THAA 2AH0A 3PVUB 2I3TA 3JZNA 3SVWD 3F3GA 4U1EI 1ERJA 4JSPC 4N14A 4O3TB 2YBAA 2BBKH 4FA4D 4E5ZA 3PVWB 3CFSB 5HYNB 3RLMD 2HXCA 2YMUA 5I5JA 1MG2A 3K27A 1TYQC 3DWLC 1K8KC 2H9NA 4FWWA 1TBGA 4A7JA 2UZXB 2YNOA 4U7AA 1R5MA 4FA5D 3VA6A 5IC7A 2QXVA 2P9UC 4CY5A 4H5IA 2O9KA 5TDHB 2PM9B 4J8BA 3J81g 4FA1D 5CXBA 2UZYB 3DXKC 3F3PA 3N0DA 3B7FA 3UKRC 1Q47A 3GREA 4AOWA 5EAPA 3ORVD 3UVLA 3SXTD 4CZVA 5EMLB 2IAAA 4GM9A 4ERZA 5AMSA 2PM7B 4CI8A 4QL1A 1GOTB 4D0KA 4PXWA 4A0BB 3RMZD 5CXBB 5EAMA 3CIKB 4ESGA 2H6QA 2I3SA 2OVQB 5GSAA 3SLED 4ERYA 4UI9R 3EWEA 5SXMA 3EI2A 4J84A 2I0RA 3BG0A 5H14A 3SBQA 4H5JA 3I7HA 2P9PC 4A0AB 2XYIA 4CI2A 2YB8B 3P4FA 4CZYA 3C9CA 4O45A 3I8EA 3AFCA 4O3UB 2CE8A 2HYEA 2H68A 2OJYA 4E54A 4BUJC 4ZN4A 3IJCA 3FM0A 4CY1A 3EMHA 5GMKn 5FKTA 4PSWB 3UVKA 4JXMA 4Y7RA 5I5IA 4J81A 2IWKA 3PSCB 4PNKB 4XEIC 3IIYA 5IGQA 3OKWA 2GC4A 5TEFA 1OLZA 3I7PA 3IJ1A 2J55H 3SMRA 4E54B 2OK6A 4EWRA 4CI3A 5CXCB 5H17A 3EI1B 3FRXA 4AEZA 3I7KA 2H6NA 4O9DA 4BH6A 3U4YA 4CY2A 2AGYA 3V7DB 5EMKB 4X63B 1SHYB 3JB9L 1B9XA 4G56B 4QQEA 2XL2A 3EI3A 3SFZA 5IGOA 3ODTA 5EM2A 4ES0A 4ZOYA 4J86A 5TF2A 4ERQA 4CZXA 5C2VB 4HDJA 5IJ8E 3L4OD 3C75H 3SCYA 2B4EA 4GGCA 4JSXC 4GZ8A 3DM0A 4GGAA 5IT9g 5AFU3 4L9OA 3AL9A 2CE9A 2H14A 3EI4B 3SWSD 4LGNA 2OVPB 5H1MA 3RRMC 4GM3A 2TRCB 3J80g 5EM2B 4GQ2P 5C2WB 2IUVA 4K3ID 4X60B 3UR4A 4GMBA 2B5NA 3JROA 2YNNA 2GNQA 4J73A 3IKOA 3SHFA 4J0XA 5HE1B 1JMZB 3EI4A 2P9IC 4GGDA 4OWRA 1JOFA 4IA9A 3V9FA 2H9LA 1GP2B 2OK4A 3JZHA 2CO0C 4A09B 3JPXA 4X3EA 4R7AB 4A0AA 2MTAH 1XKSA 2CN2A 4QT8A 3NVNA 2BCJB 2OIZA 3JRPA 5K19A 3IIWA 3I8CA 3MKSB 3AH8B 2H6KA 1JJUB 5EMMB 2B5LA 4MK0B 4A08B 4Y5RD 2G9AA 5FKSA 3L4MD 3NVXA 4J77A 4L1QD 1PI6A 1N6FA 5HE2B 5CYKA 2Q7QA 1OMWB 1P22A 1QNIA 2I0SA 5JWZA 4KFMB 3KRWB 3OTTA 4I79A 2H9PA 3ZWLB 4K3JB 2OVRB 3RN0D 3MZKA 2P9LC 2EBSA 3RSEC 3EU7A 3RFHA 3VGZA 2H3XA 2I0TA 1N6DA 2J57G 3ULEC 4A2LA 4J87A 1SQ9A 3MMYA 5EALA 4YVDA 4CY3A 3NVQA 3MZLA 2J56H 2AGWA 5CYKB 3OL2B 1XIPA 1N6EA 3MXXA 5AJAA 2Z2OA 4L3GD 3E0CA 2P9NC 1S4UX 4J78A 5K1CC 5HE0B 4FAVD 2B5MA 3SBRA 4J79A 3SN6B 1JMXB 4J0WA 1PEVA 2H9MA 4FA9D 2HESX 3UVNA 2IWFA 3BG1A 3AL8A 3IJ0A 1GXRA 2PM6B 4A11A 2PBIB 4JSNC 3W15A 4FHLA 4A11B 3I7OA 1SQJA 2HKMA 3FGBA 1FWXA 2G99A 2PM9A 3OL2A 4FB1D 5C9ZB 4A09A 5FXYA 4NSXA 5A2Qg 3JZGA 4JSVC 5FLXg 2IUQA 4CI1A 3PXTD 3PXSD 4IMMA 5B4WA 2IURA 4JT5C 1YFQA 2P9KC 3N0EA 3OKYA 4J82A 3OKYB 1XHMA 5FQDA 4J8GA 3I7NA 5TEEA 4GQBB 3PE7A 4ZOZA 5FKQA 1PBYB 3AL8B 2YNPA 4CC9A 4A2MA 2AGZA 2IUPA 3RN1D 5FA5B 4PBZA 4O1QD 3DXMC 3EI3B 2Z2PA 5HQGA 3RFGA 5EARA 5FKRA 4FAND 2CO0A 3I89A 3F3FA 3JAMg 3I7LA 4ZOXA 1VYHC 5IJ7E 5I5MA 5HE3B 4OZUA 3GFCA 3UKUC 3PSLA 1K32A 2AGXA 1NR0A 3MKQA 4LG8A 2XU7A 2AGLA 3EI2B 5GXHA 1GG2B 3K26A 2XL3A 1NEXB 1MDAH 3C99A 3UVOA 3DSMA 3VH0A 3SBPA 4QRJA 2CN3A 3SJLD 4JD2C 1A0RB 2HJ4A 2AH1A 4XYIA 4LG9A 3PXWD 2P9SC 5KDOB 4A08A 3UVMA 1MG3A 5CXCA 3BWSA 3V5WB 1RI6A 4A0BA 4D6VA 2HJBA 4TZ4A 4PC0A 3KRXB 4GQ1A 2Z2NA 2CNXA 2W18A 5EMJB 4JT6C 2GC7A 3CFVA 3OKTA 4X61B 3A0FA 2AQ5A 1L0QA 3I2NA 2QC5A 4PSXB 4XYHA 4GM8A 4ZOVA 4E5ZB 2H47A 3EG6A 3HFQA 2H13A 4PBYA 2HKRA 3EI1A
chains in the Genus database with same CATH superfamily
1U2VC 1PGUA 3OW8A 4L3HD 3ZDXA 3C5MA 1B9YA 5HDBA 1U4CA 4Z8LA 5GXIA 4BL0A 5THAA 2AH0A 3PVUB 2I3TA 3JZNA 3SVWD 3F3GA 3OF7A 4U1EI 4BCDA 1ERJA 1H2ZA 4JSPC 4N14A 4O3TB 2YBAA 2BBKH 2XZGA 4FA4D 4E5ZA 1QFSA 2EICA 3CFSB 3PVWB 5HYNB 3RLMD 2HXCA 1M1XA 2YMUA 5I5JA 3IUJA 1UOOA 3K27A 1MG2A 1TYQC 3DWLC 1K8KC 2H9NA 4FWWA 1TBGA 2HU5A 4A7JA 2UZXB 2YNOA 4U7AA 1R5MA 4FA5D 2EIBA 3VA6A 1H2YA 5IC7A 1A12A 2QXVA 2P9UC 4CY5A 4H5IA 2O9KA 5TDHB 2PM9B 4J8BA 3J81g 4FA1D 5CXBA 4RE5A 2UZYB 3DXKC 3F3PA 3N0DA 3B7FA 3UKRC 1Q47A 1E5TA 3ZE1A 3GREA 4AOWA 5EAPA 3ORVD 3UVLA 3SXTD 4CZVA 3V4PA 3NIGA 2IAAA 4GM9A 5EMLB 4ERZA 1L5GA 5AMSA 2PM7B 4CI8A 2VC2A 3NIDA 1C9IA 2EIDA 4QL1A 1GOTB 4D0KA 4PXWA 4A0BB 4NAAA 3RMZD 5CXBB 5EAMA 3CIKB 4ESGA 2H6QA 2I3SA 2OVQB 5GSAA 3SLED 4ERYA 3IURA 3IUQA 3EWEA 4UI9R 5SXMA 3EI2A 5M5TA 4J84A 2I0RA 3BG0A 5H14A 4BP9A 2QR5A 3SBQA 4H5JA 3I7HA 2P9PC 4A0AB 4AN0A 2XYIA 4CI2A 2YB8B 3P4FA 4CZYA 3ZE2A 2WQ8A 3C9CA 4O45A 3I8EA 3AFCA 5C86A 4O3UB 2CE8A 3ZE0A 2HYEA 5E6SA 5FFOA 2H68A 2OJYA 4E54A 4BUJC 4ZN4A 3IJCA 3FM0A 4CY1A 3K6SA 2XDWA 1I2MB 3VI3A 3EMHA 5GMKn 5FKTA 1JTDB 4PSWB 4JHPC 3UVKA 4JXMA 4Y7RA 5I5IA 4J81A 2IWKA 4UM8A 3PSCB 4PNKB 4XEIC 2VZ1A 3IUNA 3IIYA 5IGQA 3OKWA 2GC4A 5TEFA 1OLZA 3I7PA 3IJ1A 2J55H 3SMRA 5FFGA 4E54B 2OK6A 4DNUA 4EWRA 4CI3A 5CXCB 5H17A 3NIFA 5M61A 2VDRA 3EI1B 3O4IA 3FRXA 4AEZA 1UOPA 3I7KA 2H6NA 4O9DA 4BH6A 3U4YA 4CY2A 2AGYA 3V7DB 5EMKB 4X63B 1SHYB 3DDUA 3JB9L 1B9XA 4G56B 4QQEA 2XL2A 3EI3A 4WK4A 3SFZA 5IGOA 2HU8A 1E8NA 2QZPA 3ODTA 5EM2A 4J86A 5TF2A 4DNWA 4ERQA 4ES0A 4ZOYA 4CZXA 4O02A 5C2VB 4Z7QA 1VZ2A 4HDJA 3MUNA 5IJ8E 3L4OD 3C75H 3T3MA 3SCYA 2B4EA 4GGCA 4JSXC 4GZ8A 4AX4A 3DM0A 2VDKA 4GGAA 4NBMA 4G55A 5IT9g 5AFU3 4L9OA 4DNVA 3AL9A 2CE9A 2H14A 3EI4B 3SWSD 4LGNA 2OVPB 5H1MA 3RRMC 4GM3A 2TRCB 4Z7OA 3J80g 5EM2B 4GQ2P 5C2WB 2IUVA 4K3ID 3O4JA 4X60B 3UR4A 3K71A 4GMBA 2B5NA 3JROA 3FCSA 4BP8A 2YNNA 2GNQA 4J73A 3IKOA 3SHFA 5E6UA 1GOGA 4MMYA 3ZDYA 4J0XA 5HE1B 1JMZB 1VZ3A 2HU7A 3EI4A 3MUOA 1U8CA 2P9IC 4GGDA 5E6RA 4OWRA 4MMXA 1JOFA 4IA9A 3V9FA 2H9LA 1GP2B 2OK4A 3JZHA 2CO0C 4A09B 3JPXA 4X3EA 4R7AB 3IUMA 4A0AA 2MTAH 1XKSA 2CN2A 4QT8A 2VDLA 4RE6A 3NVNA 2BCJB 1O6FA 2OIZA 3JRPA 3EQ8A 5K19A 4WJKA 3IIWA 3I8CA 3MKSB 3AH8B 2H6KA 4QAMA 1JJUB 5EMMB 2B5LA 4MK0B 4A08B 5M5RA 4Y5RD 2G9AA 5FKSA 3L4MD 5M5SA 3NVXA 4J77A 4L1QD 1PI6A 1VE7A 1N6FA 5HE2B 5CYKA 2Q7QA 1OMWB 1P22A 1VE6A 1QNIA 2I0SA 5JWZA 4KFMB 3KRWB 4AN1A 3OTTA 4I79A 2VZ3A 2H9PA 3FCUA 3ZWLB 4K3JB 2OVRB 3RN0D 3MZKA 2P9LC 2EBSA 3RSEC 3EU7A 2VDOA 3RFHA 3VGZA 2H3XA 2I0TA 1N6DA 2J57G 3ULEC 4A2LA 2VDQA 4J87A 1SQ9A 1YR2A 3MMYA 5EALA 1JV2A 4YVDA 4CY3A 3NVQA 3MZLA 2J56H 2AGWA 5CYKB 1K3IA 3OL2B 1XIPA 1N6EA 5M5VA 3MXXA 5AJAA 2Z2OA 2VDNA 4L3GD 3E0CA 4JHNA 2P9NC 1S4UX 4J78A 3O4GA 5K1CC 1BPOA 5HE0B 2B5MA 1UTCA 3SBRA 4FAVD 1GOFA 4J79A 3EQ9A 3SN6B 1JMXB 4WK2A 4J0WA 1PEVA 2H9MA 4FA9D 2HESX 3UVNA 2IWFA 3BG1A 4D9SA 2VDMA 3AL8A 3IJ0A 1GXRA 2PM6B 3QI0A 4A11A 2PBIB 4JSNC 3W15A 3MVDK 4FHLA 4A11B 3I7OA 1SQJA 2HKMA 3OL2A 1FWXA 2G99A 2PM9A 3EQ7A 3FGBA 4FB1D 5C9ZB 4NENA 4A09A 5FXYA 4G1MA 4BCBA 4NSXA 5A2Qg 3JZGA 4JSVC 5FLXg 2IUQA 3ZDZA 5C92A 4CI1A 3GD1I 3PXTD 2XE4A 3PXSD 4IMMA 5B4WA 2IURA 4JT5C 1YFQA 4WK0A 2P9KC 3N0EA 3OKYA 4J82A 4AMZA 3OKYB 1XHMA 5FQDA 4J8GA 3I7NA 5TEEA 2VDPA 4GQBB 3PE7A 4ZOZA 3KCIA 5FKQA 1PBYB 3AL8B 2YNPA 4CC9A 4A2MA 2AGZA 2IUPA 3RN1D 5FA5B 4PBZA 3IULA 4O1QD 3DXMC 3EI3B 2Z2PA 5HQGA 3RFGA 5EARA 5FKRA 2EIEA 4FAND 2CO0A 3I89A 3F3FA 3JAMg 1H2WA 4BCCA 3I7LA 4ZOXA 1VYHC 5IJ7E 5I5MA 5HE3B 1O6GA 3IVMA 4OZUA 3GFCA 3UKUC 3K72A 3PSLA 1K32A 2AGXA 1NR0A 3MKQA 4LG8A 2XU7A 2AGLA 3EI2B 3T3PA 5GXHA 1GG2B 3K26A 4L1MA 4IRZA 2JKXA 2XL3A 4O2WA 4AMYA 1UOQA 1NEXB 1MDAH 3C99A 3UVOA 3DSMA 3VH0A 3SBPA 4QRJA 2CN3A 3SJLD 3V4VA 4JD2C 1A0RB 2HJ4A 2AH1A 4XYIA 4LG9A 3PXWD 2P9SC 5KDOB 4A08A 3GC3B 1C9LA 3UVMA 1MG3A 4G1EA 4UM9A 5CXCA 3BWSA 3V5WB 1RI6A 1T2XA 4D6VA 4A0BA 2HJBA 4TZ4A 4PC0A 3KRXB 4GQ1A 2Z2NA 1E8MA 5M5UA 4Z7NA 3O4HA 2CNXA 2W18A 5EMJB 3IJEA 4JT6C 2GC7A 3CFVA 3OKTA 4X61B 3A0FA 2AQ5A 1GOHA 4MMZA 1L0QA 3I2NA 2QC5A 4PSXB 4XYHA 4NC4A 4GM8A 4ZOVA 4E5ZB 2H47A 3EG6A 3HFQA 1TYEA 3VI4A 2BKLA 2H13A 4PBYA 1QFMA 2HKRA 3EI1A 3QHYB 1H2XA
chains in the Genus database with same CATH topology
1U2VC 1PGUA 3OW8A 4L3HD 3C5MA 1B9YA 1U4CA 4Z8LA 5GXIA 4BL0A 5THAA 2AH0A 3PVUB 2I3TA 3JZNA 3SVWD 3F3GA 4U1EI 1ERJA 4JSPC 4N14A 4O3TB 2YBAA 2BBKH 4FA4D 4E5ZA 3PVWB 3CFSB 5HYNB 3RLMD 2HXCA 2YMUA 5I5JA 1MG2A 3K27A 1TYQC 3DWLC 1K8KC 2H9NA 4FWWA 1TBGA 4A7JA 2UZXB 2YNOA 4U7AA 1R5MA 4FA5D 3VA6A 5IC7A 2QXVA 2P9UC 4CY5A 4H5IA 2O9KA 5TDHB 2PM9B 4J8BA 3J81g 4FA1D 5CXBA 2UZYB 3DXKC 3F3PA 3N0DA 3B7FA 3UKRC 1Q47A 3GREA 4AOWA 5EAPA 3ORVD 3UVLA 3SXTD 4CZVA 5EMLB 2IAAA 4GM9A 4ERZA 5AMSA 2PM7B 4CI8A 4QL1A 1GOTB 4D0KA 4PXWA 4A0BB 3RMZD 5CXBB 5EAMA 3CIKB 4ESGA 2H6QA 2I3SA 2OVQB 5GSAA 3SLED 4ERYA 4UI9R 3EWEA 5SXMA 3EI2A 4J84A 2I0RA 3BG0A 5H14A 3SBQA 4H5JA 3I7HA 2P9PC 4A0AB 2XYIA 4CI2A 2YB8B 3P4FA 4CZYA 3C9CA 4O45A 3I8EA 3AFCA 4O3UB 2CE8A 2HYEA 2H68A 2OJYA 4E54A 4BUJC 4ZN4A 3IJCA 3FM0A 4CY1A 3EMHA 5GMKn 5FKTA 4PSWB 3UVKA 4JXMA 4Y7RA 5I5IA 4J81A 2IWKA 3PSCB 4PNKB 4XEIC 3IIYA 5IGQA 3OKWA 2GC4A 5TEFA 1OLZA 3I7PA 3IJ1A 2J55H 3SMRA 4E54B 2OK6A 4EWRA 4CI3A 5CXCB 5H17A 3EI1B 3FRXA 4AEZA 3I7KA 2H6NA 4O9DA 4BH6A 3U4YA 4CY2A 2AGYA 3V7DB 5EMKB 4X63B 1SHYB 3JB9L 1B9XA 4G56B 4QQEA 2XL2A 3EI3A 3SFZA 5IGOA 3ODTA 5EM2A 4ES0A 4ZOYA 4J86A 5TF2A 4ERQA 4CZXA 5C2VB 4HDJA 5IJ8E 3L4OD 3C75H 3SCYA 2B4EA 4GGCA 4JSXC 4GZ8A 3DM0A 4GGAA 5IT9g 5AFU3 4L9OA 3AL9A 2CE9A 2H14A 3EI4B 3SWSD 4LGNA 2OVPB 5H1MA 3RRMC 4GM3A 2TRCB 3J80g 5EM2B 4GQ2P 5C2WB 2IUVA 4K3ID 4X60B 3UR4A 4GMBA 2B5NA 3JROA 2YNNA 2GNQA 4J73A 3IKOA 3SHFA 4J0XA 5HE1B 1JMZB 3EI4A 2P9IC 4GGDA 4OWRA 1JOFA 4IA9A 3V9FA 2H9LA 1GP2B 2OK4A 3JZHA 2CO0C 4A09B 3JPXA 4X3EA 4R7AB 4A0AA 2MTAH 1XKSA 2CN2A 4QT8A 3NVNA 2BCJB 2OIZA 3JRPA 5K19A 3IIWA 3I8CA 3MKSB 3AH8B 2H6KA 1JJUB 5EMMB 2B5LA 4MK0B 4A08B 4Y5RD 2G9AA 5FKSA 3L4MD 3NVXA 4J77A 4L1QD 1PI6A 1N6FA 5HE2B 5CYKA 2Q7QA 1OMWB 1P22A 1QNIA 2I0SA 5JWZA 4KFMB 3KRWB 3OTTA 4I79A 2H9PA 3ZWLB 4K3JB 2OVRB 3RN0D 3MZKA 2P9LC 2EBSA 3RSEC 3EU7A 3RFHA 3VGZA 2H3XA 2I0TA 1N6DA 2J57G 3ULEC 4A2LA 4J87A 1SQ9A 3MMYA 5EALA 4YVDA 4CY3A 3NVQA 3MZLA 2J56H 2AGWA 5CYKB 3OL2B 1XIPA 1N6EA 3MXXA 5AJAA 2Z2OA 4L3GD 3E0CA 2P9NC 1S4UX 4J78A 5K1CC 5HE0B 4FAVD 2B5MA 3SBRA 4J79A 3SN6B 1JMXB 4J0WA 1PEVA 2H9MA 4FA9D 2HESX 3UVNA 2IWFA 3BG1A 3AL8A 3IJ0A 1GXRA 2PM6B 4A11A 2PBIB 4JSNC 3W15A 4FHLA 4A11B 3I7OA 1SQJA 2HKMA 3FGBA 1FWXA 2G99A 2PM9A 3OL2A 4FB1D 5C9ZB 4A09A 5FXYA 4NSXA 5A2Qg 3JZGA 4JSVC 5FLXg 2IUQA 4CI1A 3PXTD 3PXSD 4IMMA 5B4WA 2IURA 4JT5C 1YFQA 2P9KC 3N0EA 3OKYA 4J82A 3OKYB 1XHMA 5FQDA 4J8GA 3I7NA 5TEEA 4GQBB 3PE7A 4ZOZA 5FKQA 1PBYB 3AL8B 2YNPA 4CC9A 4A2MA 2AGZA 2IUPA 3RN1D 5FA5B 4PBZA 4O1QD 3DXMC 3EI3B 2Z2PA 5HQGA 3RFGA 5EARA 5FKRA 4FAND 2CO0A 3I89A 3F3FA 3JAMg 3I7LA 4ZOXA 1VYHC 5IJ7E 5I5MA 5HE3B 4OZUA 3GFCA 3UKUC 3PSLA 1K32A 2AGXA 1NR0A 3MKQA 4LG8A 2XU7A 2AGLA 3EI2B 5GXHA 1GG2B 3K26A 2XL3A 1NEXB 1MDAH 3C99A 3UVOA 3DSMA 3VH0A 3SBPA 4QRJA 2CN3A 3SJLD 4JD2C 1A0RB 2HJ4A 2AH1A 4XYIA 4LG9A 3PXWD 2P9SC 5KDOB 4A08A 3UVMA 1MG3A 5CXCA 3BWSA 3V5WB 1RI6A 4A0BA 4D6VA 2HJBA 4TZ4A 4PC0A 3KRXB 4GQ1A 2Z2NA 2CNXA 2W18A 5EMJB 4JT6C 2GC7A 3CFVA 3OKTA 4X61B 3A0FA 2AQ5A 1L0QA 3I2NA 2QC5A 4PSXB 4XYHA 4GM8A 4ZOVA 4E5ZB 2H47A 3EG6A 3HFQA 2H13A 4PBYA 2HKRA 3EI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U2V C;  1PGU A;  3OW8 A;  4L3H D;  3C5M A;  1B9Y A;  1U4C A;  4Z8L A;  5GXI A;  4BL0 A;  5THA A;  2AH0 A;  3PVU B;  2I3T A;  3JZN A;  3SVW D;  3F3G A;  4U1E I;  1ERJ A;  4JSP C;  4N14 A;  4O3T B;  2YBA A;  2BBK H;  4FA4 D;  4E5Z A;  3PVW B;  3CFS B;  5HYN B;  3RLM D;  2HXC A;  2YMU A;  5I5J A;  1MG2 A;  3K27 A;  1TYQ C;  3DWL C;  1K8K C;  2H9N A;  4FWW A;  1TBG A;  4A7J A;  2UZX B;  2YNO A;  4U7A A;  1R5M A;  4FA5 D;  3VA6 A;  5IC7 A;  2QXV A;  2P9U C;  4CY5 A;  4H5I A;  2O9K A;  5TDH B;  2PM9 B;  4J8B A;  3J81 g;  4FA1 D;  5CXB A;  2UZY B;  3DXK C;  3F3P A;  3N0D A;  3B7F A;  3UKR C;  1Q47 A;  3GRE A;  4AOW A;  5EAP A;  3ORV D;  3UVL A;  3SXT D;  4CZV A;  5EML B;  2IAA A;  4GM9 A;  4ERZ A;  5AMS A;  2PM7 B;  4CI8 A;  4QL1 A;  1GOT B;  4D0K A;  4PXW A;  4A0B B;  3RMZ D;  5CXB B;  5EAM A;  3CIK B;  4ESG A;  2H6Q A;  2I3S A;  2OVQ B;  5GSA A;  3SLE D;  4ERY A;  4UI9 R;  3EWE A;  5SXM A;  3EI2 A;  4J84 A;  2I0R A;  3BG0 A;  5H14 A;  3SBQ A;  4H5J A;  3I7H A;  2P9P C;  4A0A B;  2XYI A;  4CI2 A;  2YB8 B;  3P4F A;  4CZY A;  3C9C A;  4O45 A;  3I8E A;  3AFC A;  4O3U B;  2CE8 A;  2HYE A;  2H68 A;  2OJY A;  4E54 A;  4BUJ C;  4ZN4 A;  3IJC A;  3FM0 A;  4CY1 A;  3EMH A;  5GMK n;  5FKT A;  4PSW B;  3UVK A;  4JXM A;  4Y7R A;  5I5I A;  4J81 A;  2IWK A;  3PSC B;  4PNK B;  4XEI C;  3IIY A;  5IGQ A;  3OKW A;  2GC4 A;  5TEF A;  1OLZ A;  3I7P A;  3IJ1 A;  2J55 H;  3SMR A;  4E54 B;  2OK6 A;  4EWR A;  4CI3 A;  5CXC B;  5H17 A;  3EI1 B;  3FRX A;  4AEZ A;  3I7K A;  2H6N A;  4O9D A;  4BH6 A;  3U4Y A;  4CY2 A;  2AGY A;  3V7D B;  5EMK B;  4X63 B;  1SHY B;  3JB9 L;  1B9X A;  4G56 B;  4QQE A;  2XL2 A;  3EI3 A;  3SFZ A;  5IGO A;  3ODT A;  5EM2 A;  4ES0 A;  4ZOY A;  4J86 A;  5TF2 A;  4ERQ A;  4CZX A;  5C2V B;  4HDJ A;  5IJ8 E;  3L4O D;  3C75 H;  3SCY A;  2B4E A;  4GGC A;  4JSX C;  4GZ8 A;  3DM0 A;  4GGA A;  5IT9 g;  5AFU 3;  4L9O A;  3AL9 A;  2CE9 A;  2H14 A;  3EI4 B;  3SWS D;  4LGN A;  2OVP B;  5H1M A;  3RRM C;  4GM3 A;  2TRC B;  3J80 g;  5EM2 B;  4GQ2 P;  5C2W B;  2IUV A;  4K3I D;  4X60 B;  3UR4 A;  4GMB A;  2B5N A;  3JRO A;  2YNN A;  2GNQ A;  4J73 A;  3IKO A;  3SHF A;  4J0X A;  5HE1 B;  1JMZ B;  3EI4 A;  2P9I C;  4GGD A;  4OWR A;  1JOF A;  4IA9 A;  3V9F A;  2H9L A;  1GP2 B;  2OK4 A;  3JZH A;  2CO0 C;  4A09 B;  3JPX A;  4X3E A;  4R7A B;  4A0A A;  2MTA H;  1XKS A;  2CN2 A;  4QT8 A;  3NVN A;  2BCJ B;  2OIZ A;  3JRP A;  5K19 A;  3IIW A;  3I8C A;  3MKS B;  3AH8 B;  2H6K A;  1JJU B;  5EMM B;  2B5L A;  4MK0 B;  4A08 B;  4Y5R D;  2G9A A;  5FKS A;  3L4M D;  3NVX A;  4J77 A;  4L1Q D;  1PI6 A;  1N6F A;  5HE2 B;  5CYK A;  2Q7Q A;  1OMW B;  1P22 A;  1QNI A;  2I0S A;  5JWZ A;  4KFM B;  3KRW B;  3OTT A;  4I79 A;  2H9P A;  3ZWL B;  4K3J B;  2OVR B;  3RN0 D;  3MZK A;  2P9L C;  2EBS A;  3RSE C;  3EU7 A;  3RFH A;  3VGZ A;  2H3X A;  2I0T A;  1N6D A;  2J57 G;  3ULE C;  4A2L A;  4J87 A;  1SQ9 A;  3MMY A;  5EAL A;  4YVD A;  4CY3 A;  3NVQ A;  3MZL A;  2J56 H;  2AGW A;  5CYK B;  3OL2 B;  1XIP A;  1N6E A;  3MXX A;  5AJA A;  2Z2O A;  4L3G D;  3E0C A;  2P9N C;  1S4U X;  4J78 A;  5K1C C;  5HE0 B;  4FAV D;  2B5M A;  3SBR A;  4J79 A;  3SN6 B;  1JMX B;  4J0W A;  1PEV A;  2H9M A;  4FA9 D;  2HES X;  3UVN A;  2IWF A;  3BG1 A;  3AL8 A;  3IJ0 A;  1GXR A;  2PM6 B;  4A11 A;  2PBI B;  4JSN C;  3W15 A;  4FHL A;  4A11 B;  3I7O A;  1SQJ A;  2HKM A;  3FGB A;  1FWX A;  2G99 A;  2PM9 A;  3OL2 A;  4FB1 D;  5C9Z B;  4A09 A;  5FXY A;  4NSX A;  5A2Q g;  3JZG A;  4JSV C;  5FLX g;  2IUQ A;  4CI1 A;  3PXT D;  3PXS D;  4IMM A;  5B4W A;  2IUR A;  4JT5 C;  1YFQ A;  2P9K C;  3N0E A;  3OKY A;  4J82 A;  3OKY B;  1XHM A;  5FQD A;  4J8G A;  3I7N A;  5TEE A;  4GQB B;  3PE7 A;  4ZOZ A;  5FKQ A;  1PBY B;  3AL8 B;  2YNP A;  4CC9 A;  4A2M A;  2AGZ A;  2IUP A;  3RN1 D;  5FA5 B;  4PBZ A;  4O1Q D;  3DXM C;  3EI3 B;  2Z2P A;  5HQG A;  3RFG A;  5EAR A;  5FKR A;  4FAN D;  2CO0 A;  3I89 A;  3F3F A;  3JAM g;  3I7L A;  4ZOX A;  1VYH C;  5IJ7 E;  5I5M A;  5HE3 B;  4OZU A;  3GFC A;  3UKU C;  3PSL A;  1K32 A;  2AGX A;  1NR0 A;  3MKQ A;  4LG8 A;  2XU7 A;  2AGL A;  3EI2 B;  5GXH A;  1GG2 B;  3K26 A;  2XL3 A;  1NEX B;  1MDA H;  3C99 A;  3UVO A;  3DSM A;  3VH0 A;  3SBP A;  4QRJ A;  2CN3 A;  3SJL D;  4JD2 C;  1A0R B;  2HJ4 A;  2AH1 A;  4XYI A;  4LG9 A;  3PXW D;  2P9S C;  5KDO B;  4A08 A;  3UVM A;  1MG3 A;  5CXC A;  3BWS A;  3V5W B;  1RI6 A;  4A0B A;  4D6V A;  2HJB A;  4TZ4 A;  4PC0 A;  3KRX B;  4GQ1 A;  2Z2N A;  2CNX A;  2W18 A;  5EMJ B;  4JT6 C;  2GC7 A;  3CFV A;  3OKT A;  4X61 B;  3A0F A;  2AQ5 A;  1L0Q A;  3I2N A;  2QC5 A;  4PSX B;  4XYH A;  4GM8 A;  4ZOV A;  4E5Z B;  2H47 A;  3EG6 A;  3HFQ A;  2H13 A;  4PBY A;  2HKR A;  3EI1 A; 
#chains in the Genus database with same CATH topology
 1U2V C;  1PGU A;  3OW8 A;  4L3H D;  3ZDX A;  3C5M A;  1B9Y A;  5HDB A;  1U4C A;  4Z8L A;  5GXI A;  4BL0 A;  5THA A;  2AH0 A;  3PVU B;  2I3T A;  3JZN A;  3SVW D;  3F3G A;  3OF7 A;  4U1E I;  4BCD A;  1ERJ A;  1H2Z A;  4JSP C;  4N14 A;  4O3T B;  2YBA A;  2BBK H;  2XZG A;  4FA4 D;  4E5Z A;  1QFS A;  2EIC A;  3CFS B;  3PVW B;  5HYN B;  3RLM D;  2HXC A;  1M1X A;  2YMU A;  5I5J A;  3IUJ A;  1UOO A;  3K27 A;  1MG2 A;  1TYQ C;  3DWL C;  1K8K C;  2H9N A;  4FWW A;  1TBG A;  2HU5 A;  4A7J A;  2UZX B;  2YNO A;  4U7A A;  1R5M A;  4FA5 D;  2EIB A;  3VA6 A;  1H2Y A;  5IC7 A;  1A12 A;  2QXV A;  2P9U C;  4CY5 A;  4H5I A;  2O9K A;  5TDH B;  2PM9 B;  4J8B A;  3J81 g;  4FA1 D;  5CXB A;  4RE5 A;  2UZY B;  3DXK C;  3F3P A;  3N0D A;  3B7F A;  3UKR C;  1Q47 A;  1E5T A;  3ZE1 A;  3GRE A;  4AOW A;  5EAP A;  3ORV D;  3UVL A;  3SXT D;  4CZV A;  3V4P A;  3NIG A;  2IAA A;  4GM9 A;  5EML B;  4ERZ A;  1L5G A;  5AMS A;  2PM7 B;  4CI8 A;  2VC2 A;  3NID A;  1C9I A;  2EID A;  4QL1 A;  1GOT B;  4D0K A;  4PXW A;  4A0B B;  4NAA A;  3RMZ D;  5CXB B;  5EAM A;  3CIK B;  4ESG A;  2H6Q A;  2I3S A;  2OVQ B;  5GSA A;  3SLE D;  4ERY A;  3IUR A;  3IUQ A;  3EWE A;  4UI9 R;  5SXM A;  3EI2 A;  5M5T A;  4J84 A;  2I0R A;  3BG0 A;  5H14 A;  4BP9 A;  2QR5 A;  3SBQ A;  4H5J A;  3I7H A;  2P9P C;  4A0A B;  4AN0 A;  2XYI A;  4CI2 A;  2YB8 B;  3P4F A;  4CZY A;  3ZE2 A;  2WQ8 A;  3C9C A;  4O45 A;  3I8E A;  3AFC A;  5C86 A;  4O3U B;  2CE8 A;  3ZE0 A;  2HYE A;  5E6S A;  5FFO A;  2H68 A;  2OJY A;  4E54 A;  4BUJ C;  4ZN4 A;  3IJC A;  3FM0 A;  4CY1 A;  3K6S A;  2XDW A;  1I2M B;  3VI3 A;  3EMH A;  5GMK n;  5FKT A;  1JTD B;  4PSW B;  4JHP C;  3UVK A;  4JXM A;  4Y7R A;  5I5I A;  4J81 A;  2IWK A;  4UM8 A;  3PSC B;  4PNK B;  4XEI C;  2VZ1 A;  3IUN A;  3IIY A;  5IGQ A;  3OKW A;  2GC4 A;  5TEF A;  1OLZ A;  3I7P A;  3IJ1 A;  2J55 H;  3SMR A;  5FFG A;  4E54 B;  2OK6 A;  4DNU A;  4EWR A;  4CI3 A;  5CXC B;  5H17 A;  3NIF A;  5M61 A;  2VDR A;  3EI1 B;  3O4I A;  3FRX A;  4AEZ A;  1UOP A;  3I7K A;  2H6N A;  4O9D A;  4BH6 A;  3U4Y A;  4CY2 A;  2AGY A;  3V7D B;  5EMK B;  4X63 B;  1SHY B;  3DDU A;  3JB9 L;  1B9X A;  4G56 B;  4QQE A;  2XL2 A;  3EI3 A;  4WK4 A;  3SFZ A;  5IGO A;  2HU8 A;  1E8N A;  2QZP A;  3ODT A;  5EM2 A;  4J86 A;  5TF2 A;  4DNW A;  4ERQ A;  4ES0 A;  4ZOY A;  4CZX A;  4O02 A;  5C2V B;  4Z7Q A;  1VZ2 A;  4HDJ A;  3MUN A;  5IJ8 E;  3L4O D;  3C75 H;  3T3M A;  3SCY A;  2B4E A;  4GGC A;  4JSX C;  4GZ8 A;  4AX4 A;  3DM0 A;  2VDK A;  4GGA A;  4NBM A;  4G55 A;  5IT9 g;  5AFU 3;  4L9O A;  4DNV A;  3AL9 A;  2CE9 A;  2H14 A;  3EI4 B;  3SWS D;  4LGN A;  2OVP B;  5H1M A;  3RRM C;  4GM3 A;  2TRC B;  4Z7O A;  3J80 g;  5EM2 B;  4GQ2 P;  5C2W B;  2IUV A;  4K3I D;  3O4J A;  4X60 B;  3UR4 A;  3K71 A;  4GMB A;  2B5N A;  3JRO A;  3FCS A;  4BP8 A;  2YNN A;  2GNQ A;  4J73 A;  3IKO A;  3SHF A;  5E6U A;  1GOG A;  4MMY A;  3ZDY A;  4J0X A;  5HE1 B;  1JMZ B;  1VZ3 A;  2HU7 A;  3EI4 A;  3MUO A;  1U8C A;  2P9I C;  4GGD A;  5E6R A;  4OWR A;  4MMX A;  1JOF A;  4IA9 A;  3V9F A;  2H9L A;  1GP2 B;  2OK4 A;  3JZH A;  2CO0 C;  4A09 B;  3JPX A;  4X3E A;  4R7A B;  3IUM A;  4A0A A;  2MTA H;  1XKS A;  2CN2 A;  4QT8 A;  2VDL A;  4RE6 A;  3NVN A;  2BCJ B;  1O6F A;  2OIZ A;  3JRP A;  3EQ8 A;  5K19 A;  4WJK A;  3IIW A;  3I8C A;  3MKS B;  3AH8 B;  2H6K A;  4QAM A;  1JJU B;  5EMM B;  2B5L A;  4MK0 B;  4A08 B;  5M5R A;  4Y5R D;  2G9A A;  5FKS A;  3L4M D;  5M5S A;  3NVX A;  4J77 A;  4L1Q D;  1PI6 A;  1VE7 A;  1N6F A;  5HE2 B;  5CYK A;  2Q7Q A;  1OMW B;  1P22 A;  1VE6 A;  1QNI A;  2I0S A;  5JWZ A;  4KFM B;  3KRW B;  4AN1 A;  3OTT A;  4I79 A;  2VZ3 A;  2H9P A;  3FCU A;  3ZWL B;  4K3J B;  2OVR B;  3RN0 D;  3MZK A;  2P9L C;  2EBS A;  3RSE C;  3EU7 A;  2VDO A;  3RFH A;  3VGZ A;  2H3X A;  2I0T A;  1N6D A;  2J57 G;  3ULE C;  4A2L A;  2VDQ A;  4J87 A;  1SQ9 A;  1YR2 A;  3MMY A;  5EAL A;  1JV2 A;  4YVD A;  4CY3 A;  3NVQ A;  3MZL A;  2J56 H;  2AGW A;  5CYK B;  1K3I A;  3OL2 B;  1XIP A;  1N6E A;  5M5V A;  3MXX A;  5AJA A;  2Z2O A;  2VDN A;  4L3G D;  3E0C A;  4JHN A;  2P9N C;  1S4U X;  4J78 A;  3O4G A;  5K1C C;  1BPO A;  5HE0 B;  2B5M A;  1UTC A;  3SBR A;  4FAV D;  1GOF A;  4J79 A;  3EQ9 A;  3SN6 B;  1JMX B;  4WK2 A;  4J0W A;  1PEV A;  2H9M A;  4FA9 D;  2HES X;  3UVN A;  2IWF A;  3BG1 A;  4D9S A;  2VDM A;  3AL8 A;  3IJ0 A;  1GXR A;  2PM6 B;  3QI0 A;  4A11 A;  2PBI B;  4JSN C;  3W15 A;  3MVD K;  4FHL A;  4A11 B;  3I7O A;  1SQJ A;  2HKM A;  3OL2 A;  1FWX A;  2G99 A;  2PM9 A;  3EQ7 A;  3FGB A;  4FB1 D;  5C9Z B;  4NEN A;  4A09 A;  5FXY A;  4G1M A;  4BCB A;  4NSX A;  5A2Q g;  3JZG A;  4JSV C;  5FLX g;  2IUQ A;  3ZDZ A;  5C92 A;  4CI1 A;  3GD1 I;  3PXT D;  2XE4 A;  3PXS D;  4IMM A;  5B4W A;  2IUR A;  4JT5 C;  1YFQ A;  4WK0 A;  2P9K C;  3N0E A;  3OKY A;  4J82 A;  4AMZ A;  3OKY B;  1XHM A;  5FQD A;  4J8G A;  3I7N A;  5TEE A;  2VDP A;  4GQB B;  3PE7 A;  4ZOZ A;  3KCI A;  5FKQ A;  1PBY B;  3AL8 B;  2YNP A;  4CC9 A;  4A2M A;  2AGZ A;  2IUP A;  3RN1 D;  5FA5 B;  4PBZ A;  3IUL A;  4O1Q D;  3DXM C;  3EI3 B;  2Z2P A;  5HQG A;  3RFG A;  5EAR A;  5FKR A;  2EIE A;  4FAN D;  2CO0 A;  3I89 A;  3F3F A;  3JAM g;  1H2W A;  4BCC A;  3I7L A;  4ZOX A;  1VYH C;  5IJ7 E;  5I5M A;  5HE3 B;  1O6G A;  3IVM A;  4OZU A;  3GFC A;  3UKU C;  3K72 A;  3PSL A;  1K32 A;  2AGX A;  1NR0 A;  3MKQ A;  4LG8 A;  2XU7 A;  2AGL A;  3EI2 B;  3T3P A;  5GXH A;  1GG2 B;  3K26 A;  4L1M A;  4IRZ A;  2JKX A;  2XL3 A;  4O2W A;  4AMY A;  1UOQ A;  1NEX B;  1MDA H;  3C99 A;  3UVO A;  3DSM A;  3VH0 A;  3SBP A;  4QRJ A;  2CN3 A;  3SJL D;  3V4V A;  4JD2 C;  1A0R B;  2HJ4 A;  2AH1 A;  4XYI A;  4LG9 A;  3PXW D;  2P9S C;  5KDO B;  4A08 A;  3GC3 B;  1C9L A;  3UVM A;  1MG3 A;  4G1E A;  4UM9 A;  5CXC A;  3BWS A;  3V5W B;  1RI6 A;  1T2X A;  4D6V A;  4A0B A;  2HJB A;  4TZ4 A;  4PC0 A;  3KRX B;  4GQ1 A;  2Z2N A;  1E8M A;  5M5U A;  4Z7N A;  3O4H A;  2CNX A;  2W18 A;  5EMJ B;  3IJE A;  4JT6 C;  2GC7 A;  3CFV A;  3OKT A;  4X61 B;  3A0F A;  2AQ5 A;  1GOH A;  4MMZ A;  1L0Q A;  3I2N A;  2QC5 A;  4PSX B;  4XYH A;  4NC4 A;  4GM8 A;  4ZOV A;  4E5Z B;  2H47 A;  3EG6 A;  3HFQ A;  1TYE A;  3VI4 A;  2BKL A;  2H13 A;  4PBY A;  1QFM A;  2HKR A;  3EI1 A;  3QHY B;  1H2X A; 
#chains in the Genus database with same CATH homology
 1U2V C;  1PGU A;  3OW8 A;  4L3H D;  3C5M A;  1B9Y A;  1U4C A;  4Z8L A;  5GXI A;  4BL0 A;  5THA A;  2AH0 A;  3PVU B;  2I3T A;  3JZN A;  3SVW D;  3F3G A;  4U1E I;  1ERJ A;  4JSP C;  4N14 A;  4O3T B;  2YBA A;  2BBK H;  4FA4 D;  4E5Z A;  3PVW B;  3CFS B;  5HYN B;  3RLM D;  2HXC A;  2YMU A;  5I5J A;  1MG2 A;  3K27 A;  1TYQ C;  3DWL C;  1K8K C;  2H9N A;  4FWW A;  1TBG A;  4A7J A;  2UZX B;  2YNO A;  4U7A A;  1R5M A;  4FA5 D;  3VA6 A;  5IC7 A;  2QXV A;  2P9U C;  4CY5 A;  4H5I A;  2O9K A;  5TDH B;  2PM9 B;  4J8B A;  3J81 g;  4FA1 D;  5CXB A;  2UZY B;  3DXK C;  3F3P A;  3N0D A;  3B7F A;  3UKR C;  1Q47 A;  3GRE A;  4AOW A;  5EAP A;  3ORV D;  3UVL A;  3SXT D;  4CZV A;  5EML B;  2IAA A;  4GM9 A;  4ERZ A;  5AMS A;  2PM7 B;  4CI8 A;  4QL1 A;  1GOT B;  4D0K A;  4PXW A;  4A0B B;  3RMZ D;  5CXB B;  5EAM A;  3CIK B;  4ESG A;  2H6Q A;  2I3S A;  2OVQ B;  5GSA A;  3SLE D;  4ERY A;  4UI9 R;  3EWE A;  5SXM A;  3EI2 A;  4J84 A;  2I0R A;  3BG0 A;  5H14 A;  3SBQ A;  4H5J A;  3I7H A;  2P9P C;  4A0A B;  2XYI A;  4CI2 A;  2YB8 B;  3P4F A;  4CZY A;  3C9C A;  4O45 A;  3I8E A;  3AFC A;  4O3U B;  2CE8 A;  2HYE A;  2H68 A;  2OJY A;  4E54 A;  4BUJ C;  4ZN4 A;  3IJC A;  3FM0 A;  4CY1 A;  3EMH A;  5GMK n;  5FKT A;  4PSW B;  3UVK A;  4JXM A;  4Y7R A;  5I5I A;  4J81 A;  2IWK A;  3PSC B;  4PNK B;  4XEI C;  3IIY A;  5IGQ A;  3OKW A;  2GC4 A;  5TEF A;  1OLZ A;  3I7P A;  3IJ1 A;  2J55 H;  3SMR A;  4E54 B;  2OK6 A;  4EWR A;  4CI3 A;  5CXC B;  5H17 A;  3EI1 B;  3FRX A;  4AEZ A;  3I7K A;  2H6N A;  4O9D A;  4BH6 A;  3U4Y A;  4CY2 A;  2AGY A;  3V7D B;  5EMK B;  4X63 B;  1SHY B;  3JB9 L;  1B9X A;  4G56 B;  4QQE A;  2XL2 A;  3EI3 A;  3SFZ A;  5IGO A;  3ODT A;  5EM2 A;  4ES0 A;  4ZOY A;  4J86 A;  5TF2 A;  4ERQ A;  4CZX A;  5C2V B;  4HDJ A;  5IJ8 E;  3L4O D;  3C75 H;  3SCY A;  2B4E A;  4GGC A;  4JSX C;  4GZ8 A;  3DM0 A;  4GGA A;  5IT9 g;  5AFU 3;  4L9O A;  3AL9 A;  2CE9 A;  2H14 A;  3EI4 B;  3SWS D;  4LGN A;  2OVP B;  5H1M A;  3RRM C;  4GM3 A;  2TRC B;  3J80 g;  5EM2 B;  4GQ2 P;  5C2W B;  2IUV A;  4K3I D;  4X60 B;  3UR4 A;  4GMB A;  2B5N A;  3JRO A;  2YNN A;  2GNQ A;  4J73 A;  3IKO A;  3SHF A;  4J0X A;  5HE1 B;  1JMZ B;  3EI4 A;  2P9I C;  4GGD A;  4OWR A;  1JOF A;  4IA9 A;  3V9F A;  2H9L A;  1GP2 B;  2OK4 A;  3JZH A;  2CO0 C;  4A09 B;  3JPX A;  4X3E A;  4R7A B;  4A0A A;  2MTA H;  1XKS A;  2CN2 A;  4QT8 A;  3NVN A;  2BCJ B;  2OIZ A;  3JRP A;  5K19 A;  3IIW A;  3I8C A;  3MKS B;  3AH8 B;  2H6K A;  1JJU B;  5EMM B;  2B5L A;  4MK0 B;  4A08 B;  4Y5R D;  2G9A A;  5FKS A;  3L4M D;  3NVX A;  4J77 A;  4L1Q D;  1PI6 A;  1N6F A;  5HE2 B;  5CYK A;  2Q7Q A;  1OMW B;  1P22 A;  1QNI A;  2I0S A;  5JWZ A;  4KFM B;  3KRW B;  3OTT A;  4I79 A;  2H9P A;  3ZWL B;  4K3J B;  2OVR B;  3RN0 D;  3MZK A;  2P9L C;  2EBS A;  3RSE C;  3EU7 A;  3RFH A;  3VGZ A;  2H3X A;  2I0T A;  1N6D A;  2J57 G;  3ULE C;  4A2L A;  4J87 A;  1SQ9 A;  3MMY A;  5EAL A;  4YVD A;  4CY3 A;  3NVQ A;  3MZL A;  2J56 H;  2AGW A;  5CYK B;  3OL2 B;  1XIP A;  1N6E A;  3MXX A;  5AJA A;  2Z2O A;  4L3G D;  3E0C A;  2P9N C;  1S4U X;  4J78 A;  5K1C C;  5HE0 B;  4FAV D;  2B5M A;  3SBR A;  4J79 A;  3SN6 B;  1JMX B;  4J0W A;  1PEV A;  2H9M A;  4FA9 D;  2HES X;  3UVN A;  2IWF A;  3BG1 A;  3AL8 A;  3IJ0 A;  1GXR A;  2PM6 B;  4A11 A;  2PBI B;  4JSN C;  3W15 A;  4FHL A;  4A11 B;  3I7O A;  1SQJ A;  2HKM A;  3FGB A;  1FWX A;  2G99 A;  2PM9 A;  3OL2 A;  4FB1 D;  5C9Z B;  4A09 A;  5FXY A;  4NSX A;  5A2Q g;  3JZG A;  4JSV C;  5FLX g;  2IUQ A;  4CI1 A;  3PXT D;  3PXS D;  4IMM A;  5B4W A;  2IUR A;  4JT5 C;  1YFQ A;  2P9K C;  3N0E A;  3OKY A;  4J82 A;  3OKY B;  1XHM A;  5FQD A;  4J8G A;  3I7N A;  5TEE A;  4GQB B;  3PE7 A;  4ZOZ A;  5FKQ A;  1PBY B;  3AL8 B;  2YNP A;  4CC9 A;  4A2M A;  2AGZ A;  2IUP A;  3RN1 D;  5FA5 B;  4PBZ A;  4O1Q D;  3DXM C;  3EI3 B;  2Z2P A;  5HQG A;  3RFG A;  5EAR A;  5FKR A;  4FAN D;  2CO0 A;  3I89 A;  3F3F A;  3JAM g;  3I7L A;  4ZOX A;  1VYH C;  5IJ7 E;  5I5M A;  5HE3 B;  4OZU A;  3GFC A;  3UKU C;  3PSL A;  1K32 A;  2AGX A;  1NR0 A;  3MKQ A;  4LG8 A;  2XU7 A;  2AGL A;  3EI2 B;  5GXH A;  1GG2 B;  3K26 A;  2XL3 A;  1NEX B;  1MDA H;  3C99 A;  3UVO A;  3DSM A;  3VH0 A;  3SBP A;  4QRJ A;  2CN3 A;  3SJL D;  4JD2 C;  1A0R B;  2HJ4 A;  2AH1 A;  4XYI A;  4LG9 A;  3PXW D;  2P9S C;  5KDO B;  4A08 A;  3UVM A;  1MG3 A;  5CXC A;  3BWS A;  3V5W B;  1RI6 A;  4A0B A;  4D6V A;  2HJB A;  4TZ4 A;  4PC0 A;  3KRX B;  4GQ1 A;  2Z2N A;  2CNX A;  2W18 A;  5EMJ B;  4JT6 C;  2GC7 A;  3CFV A;  3OKT A;  4X61 B;  3A0F A;  2AQ5 A;  1L0Q A;  3I2N A;  2QC5 A;  4PSX B;  4XYH A;  4GM8 A;  4ZOV A;  4E5Z B;  2H47 A;  3EG6 A;  3HFQ A;  2H13 A;  4PBY A;  2HKR A;  3EI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...