1MG3A

Mutation of alpha phe55 of methylamine dehydrogenase alters the reorganization energy and electronic coupling for its electron transfer reaction with amicyanin
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
382
structure length
382
Chain Sequence
EAETQAQETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHAAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine dehydrogenase, heavy chain
publication title MUTATION OF ALPHA PHE55 OF METHYLAMINE DEHYDROGENASE ALTERS THE REORGANIZATION ENERGY AND ELECTRONIC COUPLING FOR ITS ELECTRON TRANSFER REACTION WITH AMICYANIN
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase
total genus 93
structure length 382
sequence length 382
chains with identical sequence E, I, M
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2002-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1mg3A00
3SJLD 5IJ8E 1B9XA 4QT8A 3I7LA 5C9ZB 2H9NA 5IGQA 4GQ1A 3C75H 3SFZA 3OW8A 2IUVA 1JJUB 2AGXA 4GM8A 5K19A 2P9KC 3JB9L 3GFCA 4QRJA 1L0QA 2I0TA 3DWLC 2HKMA 3UVOA 4H5IA 4ESGA 2OVQB 4JSXC 5EALA 2OIZA 5EARA 4CZXA 4FAVD 3J80g 1TYQC 1MG3A 3SWSD 1XHMA 2B4EA 4J0XA 3ODTA 2YMUA 4L3GD 4L9OA 4E5ZA 4JSNC 2PM9B 3IKOA 4IMMA 4JSPC 4CY3A 4FB1D 4CY1A 4Y5RD 2YNPA 4ZOVA 3IIWA 2Z2PA 4ERYA 2BCJB 4X61B 3RSEC 3EI4B 5C2WB 3I8CA 2HJBA 2QC5A 3JRPA 3PVWB 3VA6A 1OLZA 1GOTB 4PC0A 4L1QD 4ES0A 2P9LC 4JT5C 4PBZA 5IGOA 3NVNA 5IT9g 3I89A 4A0AA 3F3PA 2H68A 4G56B 3DXKC 4A0BA 4FA4D 4GGAA 2AH1A 3F3FA 1K8KC 3EI1A 5FXYA 4J0WA 4GM3A 4PNKB 2B5LA 3N0EA 4ZOZA 4D6VA 5A2Qg 3BWSA 4XEIC 3SBQA 1YFQA 4XYIA 2B5MA 4J87A 3MZKA 4J82A 2AGZA 3KRWB 1JOFA 1FWXA 4O1QD 4JD2C 4AEZA 3PE7A 2J56H 5HE0B 3OKWA 2CE9A 3DXMC 4GMBA 2OVRB 2HYEA 4CI3A 3SBRA 4PBYA 2TRCB 2HESX 3BG1A 4BH6A 2HKRA 2G9AA 3AFCA 2XU7A 3MXXA 5CXCB 3MKSB 5CXBA 4K3ID 3N0DA 2W18A 3UVNA 4A2MA 5KDOB 4J81A 1PEVA 2AGWA 4BUJC 3FM0A 5CYKA 4QQEA 3DSMA 2CE8A 3ULEC 3SN6B 4PSXB 3UVMA 3OL2A 4L3HD 1OMWB 4UI9R 3CFVA 2AGLA 3PSCB 4IA9A 3FGBA 2PBIB 3B7FA 4CI1A 2IWFA 5HE2B 2IAAA 3BG0A 5EMKB 1A0RB 4K3JB 4FA5D 4NSXA 3PXWD 2QXVA 3V9FA 3PXSD 3SMRA 3JZGA 1SQJA 4KFMB 4GQBB 5SXMA 2CO0A 4U1EI 4J73A 1XIPA 4QL1A 3AL8B 4J86A 2IURA 1P22A 3OKYB 3I8EA 2PM6B 4EWRA 5C2VB 4CC9A 2CN3A 2H14A 2XYIA 3I2NA 4A08A 3E0CA 3UVKA 5H17A 3I7KA 3L4MD 2HXCA 4J84A 1N6DA 4GGCA 3EI2A 2YBAA 3KRXB 1R5MA 1NR0A 2H6KA 2YNNA 3VGZA 5I5MA 4LGNA 3CIKB 1ERJA 4ERQA 5EMMB 5TDHB 4E54A 4R7AB 2Z2NA 4O3UB 3MMYA 4CY2A 3K26A 3P4FA 3EU7A 5FA5B 4J78A 2BBKH 3EG6A 2AQ5A 3C5MA 5THAA 2GC7A 3C99A 5IC7A 4E5ZB 3UVLA 4TZ4A 3PVUB 4JT6C 3UR4A 3RMZD 2XL2A 3RRMC 3EI3A 3HFQA 4A09A 3SHFA 3SVWD 5EM2A 4LG8A 1VYHC 3RN1D 3I7OA 5I5IA 1MG2A 3JAMg 3SBPA 3W15A 3MZLA 1Q47A 3RLMD 3RFHA 1K32A 3ZWLB 4J8GA 2XL3A 1XKSA 4A0AB 3UKUC 4A0BB 1GXRA 1PI6A 2H9PA 4Z8LA 4FA1D 4O45A 5GXIA 5HYNB 1GP2B 3IJ0A 5HQGA 4ZOYA 2EBSA 4A11A 4Y7RA 4J8BA 3F3GA 3JPXA 5IJ7E 2P9PC 2PM7B 5GXHA 3V7DB 3EWEA 2MTAH 4YVDA 5TF2A 2B5NA 5GMKn 4GQ2P 3JROA 2H6NA 3FRXA 3JZHA 3C9CA 4CY5A 2I0RA 2GC4A 4O3TB 5FKTA 3UKRC 3K27A 3J81g 3NVXA 3EMHA 3VH0A 4D0KA 2Q7QA 4FA9D 4FAND 3DM0A 4JSVC 2YB8B 1JMXB 2UZYB 3V5WB 4CZYA 4U7AA 1QNIA 4GGDA 3RN0D 1S4UX 4BL0A 1N6EA 4PXWA 5CYKB 4HDJA 5FQDA 2PM9A 2CO0C 4OWRA 2H3XA 4A7JA 5FKSA 3U4YA 3OL2B 2YNOA 3EI4A 3SXTD 4AOWA 5H1MA 2G99A 3PSLA 4FWWA 2OK4A 5FKQA 5HE3B 2IUPA 3CFSB 3IIYA 5EAPA 3SLED 3SCYA 3I7NA 4CI8A 4LG9A 5JWZA 2GNQA 1TBGA 2Z2OA 2I0SA 1B9YA 4OZUA 5EMJB 2O9KA 4XYHA 1MDAH 1RI6A 4FHLA 2AH0A 4A08B 2I3TA 3NVQA 5I5JA 3OKTA 4X63B 3I7PA 4A2LA 3EI2B 2H9MA 3OTTA 1GG2B 4GM9A 5EMLB 4X3EA 4CZVA 2H13A 2OJYA 4ERZA 2HJ4A 5B4WA 3I7HA 4PSWB 4H5JA 3IJCA 4J79A 4E54B 2AGYA 2H9LA 3MKQA 1N6FA 2H47A 2P9SC 5CXCA 3AH8B 2J57G 3RFGA 4CI2A 5K1CC 3A0FA 5H14A 1PGUA 2CNXA 3EI1B 5TEEA 4GZ8A 3EI3B 3AL9A 3IJ1A 4ZN4A 4I79A 2OVPB 3GREA 4A09B 5EM2B 2H6QA 2IWKA 2P9NC 5EAMA 4J77A 5HE1B 2IUQA 2CN2A 4X60B 2P9UC 2I3SA 5FLXg 1NEXB 2OK6A 4O9DA 4JXMA 5FKRA 1PBYB 4MK0B 1SHYB 3ORVD 5AMSA 2J55H 5GSAA 4N14A 5AJAA 2UZXB 5AFU3 3PXTD 1U4CA 4A11B 3AL8A 1U2VC 5CXBB 1JMZB 3JZNA 1SQ9A 2P9IC 5TEFA 3OKYA 3L4OD 4ZOXA
chains in the Genus database with same CATH superfamily
3SJLD 5IJ8E 1B9XA 4QT8A 3ZDYA 3I7LA 5C9ZB 2H9NA 4MMYA 5IGQA 4GQ1A 3C75H 3SFZA 3OW8A 2IUVA 1JJUB 2AGXA 4GM8A 5K19A 2P9KC 3JB9L 3GFCA 4QRJA 1L0QA 2I0TA 3DWLC 2HKMA 3GC3B 3NIGA 3UVOA 4H5IA 4ESGA 2OVQB 4JSXC 1C9IA 5EALA 2OIZA 5EARA 4CZXA 4FAVD 3J80g 4Z7OA 2QZPA 1TYQC 2VDOA 2VDLA 1MG3A 3SWSD 1XHMA 2B4EA 4J0XA 3IUQA 3ODTA 2YMUA 3KCIA 2VZ3A 4L3GD 4L9OA 4E5ZA 4JSNC 2PM9B 3IKOA 4IMMA 4JSPC 3QI0A 4CY3A 4FB1D 4CY1A 1BPOA 4Y5RD 2YNPA 4ZOVA 3IIWA 2Z2PA 4ERYA 2BCJB 4X61B 1O6FA 3RSEC 3EI4B 5C2WB 3I8CA 2HJBA 2VDMA 2QC5A 3JRPA 3PVWB 3VA6A 1OLZA 1VE7A 1GOTB 4PC0A 4L1QD 2XDWA 4ES0A 2P9LC 4JT5C 4PBZA 5IGOA 4WJKA 4Z7NA 5C92A 3NVNA 3FCUA 3FCSA 5E6SA 3I89A 5IT9g 4A0AA 3F3PA 2H68A 4G56B 3DXKC 4A0BA 4FA4D 4GGAA 5M5TA 3IURA 2BKLA 2AH1A 3F3FA 1K8KC 3EI1A 5FXYA 1UOQA 4G55A 4J0WA 4GM3A 4PNKB 1UTCA 2B5LA 1H2YA 3N0EA 4ZOZA 4D6VA 3MVDK 5A2Qg 4AN1A 3BWSA 4XEIC 3SBQA 1YFQA 4XYIA 2B5MA 4J87A 3MZKA 5E6RA 4J82A 2AGZA 1GOGA 3KRWB 1JOFA 1FWXA 2VZ1A 4JD2C 4O1QD 1JTDB 5HDBA 2HU5A 3PE7A 4AEZA 2J56H 5HE0B 2WQ8A 3OKWA 2CE9A 3DXMC 4GMBA 2OVRB 2HYEA 4CI3A 3SBRA 4PBYA 2TRCB 2HESX 3BG1A 4BH6A 2VDPA 4Z7QA 2HKRA 2G9AA 3AFCA 2XU7A 3MXXA 3O4HA 5CXCB 3MKSB 5CXBA 4K3ID 4UM8A 3N0DA 2W18A 3UVNA 4A2MA 3EQ9A 2VDRA 5KDOB 4J81A 1M1XA 1PEVA 2AGWA 4BUJC 3FM0A 5CYKA 4AMZA 1H2ZA 4QQEA 3DSMA 4WK0A 2CE8A 3K72A 3ULEC 3SN6B 1K3IA 4PSXB 3UVMA 3OL2A 4L3HD 1OMWB 4UI9R 4MMZA 3CFVA 2AGLA 4NC4A 3PSCB 1VZ2A 5M5RA 4IA9A 3FGBA 2EIEA 2PBIB 3K71A 3B7FA 4CI1A 2IWFA 5HE2B 2IAAA 3BG0A 5EMKB 1A0RB 4K3JB 4FA5D 4NSXA 3PXWD 2QXVA 3QHYB 3V9FA 1QFSA 3PXSD 3SMRA 3JZGA 1SQJA 1YR2A 1E8NA 2XE4A 4KFMB 4GQBB 5SXMA 2CO0A 4U1EI 4J73A 1XIPA 4QL1A 3AL8B 4J86A 2IURA 3T3MA 1P22A 3OKYB 3I8EA 3IUJA 2PM6B 4EWRA 5C2VB 4CC9A 2CN3A 2H14A 2XYIA 3I2NA 4A08A 4JHNA 3E0CA 3UVKA 4AX4A 5H17A 3L4MD 3I7KA 4G1EA 2HXCA 3IVMA 4J84A 1N6DA 3MUOA 4GGCA 3ZDXA 3EI2A 2YBAA 4NENA 3KRXB 1R5MA 1NR0A 2H6KA 4AN0A 2YNNA 4NAAA 3VGZA 5I5MA 4LGNA 3CIKB 1ERJA 4ERQA 5EMMB 5TDHB 4E54A 4R7AB 2Z2NA 4O3UB 3MMYA 4CY2A 3K26A 3P4FA 3EU7A 4IRZA 5FA5B 3T3PA 1E5TA 4J78A 2BBKH 3EG6A 2AQ5A 3C5MA 5THAA 2GC7A 3C99A 5IC7A 4E5ZB 3NIFA 3UVLA 4TZ4A 3PVUB 4JT6C 2EICA 3UR4A 3RMZD 2XL2A 3RRMC 3EI3A 3HFQA 4A09A 1TYEA 4RE6A 3SHFA 3SVWD 5EM2A 3ZE2A 4LG8A 1VYHC 3OF7A 3RN1D 3I7OA 5I5IA 1MG2A 3JAMg 3SBPA 3W15A 2EIBA 3MZLA 2VDNA 1Q47A 1T2XA 3RLMD 4NBMA 1UOPA 3RFHA 1K32A 3ZWLB 4J8GA 1C9LA 2XL3A 1XKSA 4A0AB 3UKUC 4A0BB 1GXRA 1PI6A 2H9PA 4Z8LA 4FA1D 4O45A 5GXIA 5HYNB 1GP2B 3IJ0A 4BP9A 2VDQA 5HQGA 4ZOYA 2EBSA 4A11A 4Y7RA 4J8BA 3F3GA 3JPXA 5IJ7E 3EQ7A 1GOFA 1I2MB 2P9PC 2PM7B 5GXHA 3V7DB 3EWEA 3IULA 2MTAH 3EQ8A 3IJEA 4YVDA 5TF2A 2B5NA 5GMKn 4GQ2P 3JROA 2H6NA 3K6SA 3FRXA 4DNVA 3JZHA 3C9CA 4CY5A 2I0RA 2GC4A 1JV2A 4O3TB 5FKTA 3UKRC 3K27A 3J81g 3NVXA 3EMHA 3VH0A 4WK2A 4D0KA 1GOHA 2Q7QA 4FA9D 4FAND 3DM0A 4JSVC 2YB8B 1JMXB 2UZYB 4D9SA 3V5WB 4CZYA 4U7AA 1QNIA 4GGDA 3RN0D 1S4UX 4BL0A 1N6EA 2VC2A 4PXWA 5CYKB 4HDJA 4BCDA 5FQDA 3O4GA 1L5GA 4AMYA 2PM9A 5M5UA 1A12A 2CO0C 4OWRA 2H3XA 4A7JA 5C86A 5FKSA 3U4YA 3OL2B 2YNOA 3IUNA 1E8MA 3EI4A 3SXTD 4AOWA 5H1MA 2G99A 3PSLA 2QR5A 3VI3A 4BP8A 4FWWA 2OK4A 4O2WA 4O02A 5FKQA 5HE3B 2IUPA 3V4VA 3CFSB 3IIYA 1VZ3A 5EAPA 3SLED 3SCYA 3I7NA 4DNWA 4CI8A 4LG9A 3O4IA 3VI4A 5JWZA 2GNQA 1TBGA 3ZE1A 2Z2OA 2I0SA 1B9YA 4L1MA 4OZUA 5EMJB 2O9KA 3O4JA 4XYHA 1MDAH 1RI6A 4FHLA 2AH0A 4DNUA 4A08B 4G1MA 2I3TA 3NVQA 5I5JA 4QAMA 3OKTA 4X63B 3I7PA 4A2LA 3V4PA 3EI2B 2H9MA 3OTTA 4MMXA 1GG2B 4GM9A 4UM9A 5EMLB 5M5SA 4X3EA 4CZVA 2H13A 2OJYA 4ERZA 2HJ4A 5B4WA 3I7HA 4PSWB 4H5JA 5M61A 3IJCA 3DDUA 4J79A 4E54B 2AGYA 2H9LA 3MKQA 1N6FA 4JHPC 2H47A 2P9SC 5CXCA 3AH8B 2HU8A 2J57G 1UOOA 3RFGA 4CI2A 5K1CC 3A0FA 5FFGA 5H14A 1PGUA 3ZDZA 4BCCA 3NIDA 2CNXA 5FFOA 3EI1B 5TEEA 4GZ8A 1H2XA 2JKXA 3EI3B 3AL9A 3IJ1A 4ZN4A 4I79A 2OVPB 3IUMA 3GREA 4A09B 3MUNA 5EM2B 2H6QA 2HU7A 2IWKA 2P9NC 5EAMA 3GD1I 5M5VA 4J77A 1U8CA 5HE1B 2IUQA 1QFMA 5E6UA 2CN2A 4X60B 2VDKA 2P9UC 2EIDA 2I3SA 1NEXB 2OK6A 5FLXg 1VE6A 4O9DA 4WK4A 4JXMA 5FKRA 4BCBA 1PBYB 4MK0B 1SHYB 3ORVD 5AMSA 2J55H 4RE5A 2XZGA 5GSAA 4N14A 5AJAA 2UZXB 1O6GA 5AFU3 3PXTD 3ZE0A 1U4CA 4A11B 3AL8A 1U2VC 5CXBB 1JMZB 3JZNA 1H2WA 1SQ9A 2P9IC 5TEFA 3OKYA 3L4OD 4ZOXA
chains in the Genus database with same CATH topology
3SJLD 5IJ8E 1B9XA 4QT8A 3I7LA 5C9ZB 2H9NA 5IGQA 4GQ1A 3C75H 3SFZA 3OW8A 2IUVA 1JJUB 2AGXA 4GM8A 5K19A 2P9KC 3JB9L 3GFCA 4QRJA 1L0QA 2I0TA 3DWLC 2HKMA 3UVOA 4H5IA 4ESGA 2OVQB 4JSXC 5EALA 2OIZA 5EARA 4CZXA 4FAVD 3J80g 1TYQC 1MG3A 3SWSD 1XHMA 2B4EA 4J0XA 3ODTA 2YMUA 4L3GD 4L9OA 4E5ZA 4JSNC 2PM9B 3IKOA 4IMMA 4JSPC 4CY3A 4FB1D 4CY1A 4Y5RD 2YNPA 4ZOVA 3IIWA 2Z2PA 4ERYA 2BCJB 4X61B 3RSEC 3EI4B 5C2WB 3I8CA 2HJBA 2QC5A 3JRPA 3PVWB 3VA6A 1OLZA 1GOTB 4PC0A 4L1QD 4ES0A 2P9LC 4JT5C 4PBZA 5IGOA 3NVNA 5IT9g 3I89A 4A0AA 3F3PA 2H68A 4G56B 3DXKC 4A0BA 4FA4D 4GGAA 2AH1A 3F3FA 1K8KC 3EI1A 5FXYA 4J0WA 4GM3A 4PNKB 2B5LA 3N0EA 4ZOZA 4D6VA 5A2Qg 3BWSA 4XEIC 3SBQA 1YFQA 4XYIA 2B5MA 4J87A 3MZKA 4J82A 2AGZA 3KRWB 1JOFA 1FWXA 4O1QD 4JD2C 4AEZA 3PE7A 2J56H 5HE0B 3OKWA 2CE9A 3DXMC 4GMBA 2OVRB 2HYEA 4CI3A 3SBRA 4PBYA 2TRCB 2HESX 3BG1A 4BH6A 2HKRA 2G9AA 3AFCA 2XU7A 3MXXA 5CXCB 3MKSB 5CXBA 4K3ID 3N0DA 2W18A 3UVNA 4A2MA 5KDOB 4J81A 1PEVA 2AGWA 4BUJC 3FM0A 5CYKA 4QQEA 3DSMA 2CE8A 3ULEC 3SN6B 4PSXB 3UVMA 3OL2A 4L3HD 1OMWB 4UI9R 3CFVA 2AGLA 3PSCB 4IA9A 3FGBA 2PBIB 3B7FA 4CI1A 2IWFA 5HE2B 2IAAA 3BG0A 5EMKB 1A0RB 4K3JB 4FA5D 4NSXA 3PXWD 2QXVA 3V9FA 3PXSD 3SMRA 3JZGA 1SQJA 4KFMB 4GQBB 5SXMA 2CO0A 4U1EI 4J73A 1XIPA 4QL1A 3AL8B 4J86A 2IURA 1P22A 3OKYB 3I8EA 2PM6B 4EWRA 5C2VB 4CC9A 2CN3A 2H14A 2XYIA 3I2NA 4A08A 3E0CA 3UVKA 5H17A 3I7KA 3L4MD 2HXCA 4J84A 1N6DA 4GGCA 3EI2A 2YBAA 3KRXB 1R5MA 1NR0A 2H6KA 2YNNA 3VGZA 5I5MA 4LGNA 3CIKB 1ERJA 4ERQA 5EMMB 5TDHB 4E54A 4R7AB 2Z2NA 4O3UB 3MMYA 4CY2A 3K26A 3P4FA 3EU7A 5FA5B 4J78A 2BBKH 3EG6A 2AQ5A 3C5MA 5THAA 2GC7A 3C99A 5IC7A 4E5ZB 3UVLA 4TZ4A 3PVUB 4JT6C 3UR4A 3RMZD 2XL2A 3RRMC 3EI3A 3HFQA 4A09A 3SHFA 3SVWD 5EM2A 4LG8A 1VYHC 3RN1D 3I7OA 5I5IA 1MG2A 3JAMg 3SBPA 3W15A 3MZLA 1Q47A 3RLMD 3RFHA 1K32A 3ZWLB 4J8GA 2XL3A 1XKSA 4A0AB 3UKUC 4A0BB 1GXRA 1PI6A 2H9PA 4Z8LA 4FA1D 4O45A 5GXIA 5HYNB 1GP2B 3IJ0A 5HQGA 4ZOYA 2EBSA 4A11A 4Y7RA 4J8BA 3F3GA 3JPXA 5IJ7E 2P9PC 2PM7B 5GXHA 3V7DB 3EWEA 2MTAH 4YVDA 5TF2A 2B5NA 5GMKn 4GQ2P 3JROA 2H6NA 3FRXA 3JZHA 3C9CA 4CY5A 2I0RA 2GC4A 4O3TB 5FKTA 3UKRC 3K27A 3J81g 3NVXA 3EMHA 3VH0A 4D0KA 2Q7QA 4FA9D 4FAND 3DM0A 4JSVC 2YB8B 1JMXB 2UZYB 3V5WB 4CZYA 4U7AA 1QNIA 4GGDA 3RN0D 1S4UX 4BL0A 1N6EA 4PXWA 5CYKB 4HDJA 5FQDA 2PM9A 2CO0C 4OWRA 2H3XA 4A7JA 5FKSA 3U4YA 3OL2B 2YNOA 3EI4A 3SXTD 4AOWA 5H1MA 2G99A 3PSLA 4FWWA 2OK4A 5FKQA 5HE3B 2IUPA 3CFSB 3IIYA 5EAPA 3SLED 3SCYA 3I7NA 4CI8A 4LG9A 5JWZA 2GNQA 1TBGA 2Z2OA 2I0SA 1B9YA 4OZUA 5EMJB 2O9KA 4XYHA 1MDAH 1RI6A 4FHLA 2AH0A 4A08B 2I3TA 3NVQA 5I5JA 3OKTA 4X63B 3I7PA 4A2LA 3EI2B 2H9MA 3OTTA 1GG2B 4GM9A 5EMLB 4X3EA 4CZVA 2H13A 2OJYA 4ERZA 2HJ4A 5B4WA 3I7HA 4PSWB 4H5JA 3IJCA 4J79A 4E54B 2AGYA 2H9LA 3MKQA 1N6FA 2H47A 2P9SC 5CXCA 3AH8B 2J57G 3RFGA 4CI2A 5K1CC 3A0FA 5H14A 1PGUA 2CNXA 3EI1B 5TEEA 4GZ8A 3EI3B 3AL9A 3IJ1A 4ZN4A 4I79A 2OVPB 3GREA 4A09B 5EM2B 2H6QA 2IWKA 2P9NC 5EAMA 4J77A 5HE1B 2IUQA 2CN2A 4X60B 2P9UC 2I3SA 5FLXg 1NEXB 2OK6A 4O9DA 4JXMA 5FKRA 1PBYB 4MK0B 1SHYB 3ORVD 5AMSA 2J55H 5GSAA 4N14A 5AJAA 2UZXB 5AFU3 3PXTD 1U4CA 4A11B 3AL8A 1U2VC 5CXBB 1JMZB 3JZNA 1SQ9A 2P9IC 5TEFA 3OKYA 3L4OD 4ZOXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SJL D;  5IJ8 E;  1B9X A;  4QT8 A;  3I7L A;  5C9Z B;  2H9N A;  5IGQ A;  4GQ1 A;  3C75 H;  3SFZ A;  3OW8 A;  2IUV A;  1JJU B;  2AGX A;  4GM8 A;  5K19 A;  2P9K C;  3JB9 L;  3GFC A;  4QRJ A;  1L0Q A;  2I0T A;  3DWL C;  2HKM A;  3UVO A;  4H5I A;  4ESG A;  2OVQ B;  4JSX C;  5EAL A;  2OIZ A;  5EAR A;  4CZX A;  4FAV D;  3J80 g;  1TYQ C;  1MG3 A;  3SWS D;  1XHM A;  2B4E A;  4J0X A;  3ODT A;  2YMU A;  4L3G D;  4L9O A;  4E5Z A;  4JSN C;  2PM9 B;  3IKO A;  4IMM A;  4JSP C;  4CY3 A;  4FB1 D;  4CY1 A;  4Y5R D;  2YNP A;  4ZOV A;  3IIW A;  2Z2P A;  4ERY A;  2BCJ B;  4X61 B;  3RSE C;  3EI4 B;  5C2W B;  3I8C A;  2HJB A;  2QC5 A;  3JRP A;  3PVW B;  3VA6 A;  1OLZ A;  1GOT B;  4PC0 A;  4L1Q D;  4ES0 A;  2P9L C;  4JT5 C;  4PBZ A;  5IGO A;  3NVN A;  5IT9 g;  3I89 A;  4A0A A;  3F3P A;  2H68 A;  4G56 B;  3DXK C;  4A0B A;  4FA4 D;  4GGA A;  2AH1 A;  3F3F A;  1K8K C;  3EI1 A;  5FXY A;  4J0W A;  4GM3 A;  4PNK B;  2B5L A;  3N0E A;  4ZOZ A;  4D6V A;  5A2Q g;  3BWS A;  4XEI C;  3SBQ A;  1YFQ A;  4XYI A;  2B5M A;  4J87 A;  3MZK A;  4J82 A;  2AGZ A;  3KRW B;  1JOF A;  1FWX A;  4O1Q D;  4JD2 C;  4AEZ A;  3PE7 A;  2J56 H;  5HE0 B;  3OKW A;  2CE9 A;  3DXM C;  4GMB A;  2OVR B;  2HYE A;  4CI3 A;  3SBR A;  4PBY A;  2TRC B;  2HES X;  3BG1 A;  4BH6 A;  2HKR A;  2G9A A;  3AFC A;  2XU7 A;  3MXX A;  5CXC B;  3MKS B;  5CXB A;  4K3I D;  3N0D A;  2W18 A;  3UVN A;  4A2M A;  5KDO B;  4J81 A;  1PEV A;  2AGW A;  4BUJ C;  3FM0 A;  5CYK A;  4QQE A;  3DSM A;  2CE8 A;  3ULE C;  3SN6 B;  4PSX B;  3UVM A;  3OL2 A;  4L3H D;  1OMW B;  4UI9 R;  3CFV A;  2AGL A;  3PSC B;  4IA9 A;  3FGB A;  2PBI B;  3B7F A;  4CI1 A;  2IWF A;  5HE2 B;  2IAA A;  3BG0 A;  5EMK B;  1A0R B;  4K3J B;  4FA5 D;  4NSX A;  3PXW D;  2QXV A;  3V9F A;  3PXS D;  3SMR A;  3JZG A;  1SQJ A;  4KFM B;  4GQB B;  5SXM A;  2CO0 A;  4U1E I;  4J73 A;  1XIP A;  4QL1 A;  3AL8 B;  4J86 A;  2IUR A;  1P22 A;  3OKY B;  3I8E A;  2PM6 B;  4EWR A;  5C2V B;  4CC9 A;  2CN3 A;  2H14 A;  2XYI A;  3I2N A;  4A08 A;  3E0C A;  3UVK A;  5H17 A;  3I7K A;  3L4M D;  2HXC A;  4J84 A;  1N6D A;  4GGC A;  3EI2 A;  2YBA A;  3KRX B;  1R5M A;  1NR0 A;  2H6K A;  2YNN A;  3VGZ A;  5I5M A;  4LGN A;  3CIK B;  1ERJ A;  4ERQ A;  5EMM B;  5TDH B;  4E54 A;  4R7A B;  2Z2N A;  4O3U B;  3MMY A;  4CY2 A;  3K26 A;  3P4F A;  3EU7 A;  5FA5 B;  4J78 A;  2BBK H;  3EG6 A;  2AQ5 A;  3C5M A;  5THA A;  2GC7 A;  3C99 A;  5IC7 A;  4E5Z B;  3UVL A;  4TZ4 A;  3PVU B;  4JT6 C;  3UR4 A;  3RMZ D;  2XL2 A;  3RRM C;  3EI3 A;  3HFQ A;  4A09 A;  3SHF A;  3SVW D;  5EM2 A;  4LG8 A;  1VYH C;  3RN1 D;  3I7O A;  5I5I A;  1MG2 A;  3JAM g;  3SBP A;  3W15 A;  3MZL A;  1Q47 A;  3RLM D;  3RFH A;  1K32 A;  3ZWL B;  4J8G A;  2XL3 A;  1XKS A;  4A0A B;  3UKU C;  4A0B B;  1GXR A;  1PI6 A;  2H9P A;  4Z8L A;  4FA1 D;  4O45 A;  5GXI A;  5HYN B;  1GP2 B;  3IJ0 A;  5HQG A;  4ZOY A;  2EBS A;  4A11 A;  4Y7R A;  4J8B A;  3F3G A;  3JPX A;  5IJ7 E;  2P9P C;  2PM7 B;  5GXH A;  3V7D B;  3EWE A;  2MTA H;  4YVD A;  5TF2 A;  2B5N A;  5GMK n;  4GQ2 P;  3JRO A;  2H6N A;  3FRX A;  3JZH A;  3C9C A;  4CY5 A;  2I0R A;  2GC4 A;  4O3T B;  5FKT A;  3UKR C;  3K27 A;  3J81 g;  3NVX A;  3EMH A;  3VH0 A;  4D0K A;  2Q7Q A;  4FA9 D;  4FAN D;  3DM0 A;  4JSV C;  2YB8 B;  1JMX B;  2UZY B;  3V5W B;  4CZY A;  4U7A A;  1QNI A;  4GGD A;  3RN0 D;  1S4U X;  4BL0 A;  1N6E A;  4PXW A;  5CYK B;  4HDJ A;  5FQD A;  2PM9 A;  2CO0 C;  4OWR A;  2H3X A;  4A7J A;  5FKS A;  3U4Y A;  3OL2 B;  2YNO A;  3EI4 A;  3SXT D;  4AOW A;  5H1M A;  2G99 A;  3PSL A;  4FWW A;  2OK4 A;  5FKQ A;  5HE3 B;  2IUP A;  3CFS B;  3IIY A;  5EAP A;  3SLE D;  3SCY A;  3I7N A;  4CI8 A;  4LG9 A;  5JWZ A;  2GNQ A;  1TBG A;  2Z2O A;  2I0S A;  1B9Y A;  4OZU A;  5EMJ B;  2O9K A;  4XYH A;  1MDA H;  1RI6 A;  4FHL A;  2AH0 A;  4A08 B;  2I3T A;  3NVQ A;  5I5J A;  3OKT A;  4X63 B;  3I7P A;  4A2L A;  3EI2 B;  2H9M A;  3OTT A;  1GG2 B;  4GM9 A;  5EML B;  4X3E A;  4CZV A;  2H13 A;  2OJY A;  4ERZ A;  2HJ4 A;  5B4W A;  3I7H A;  4PSW B;  4H5J A;  3IJC A;  4J79 A;  4E54 B;  2AGY A;  2H9L A;  3MKQ A;  1N6F A;  2H47 A;  2P9S C;  5CXC A;  3AH8 B;  2J57 G;  3RFG A;  4CI2 A;  5K1C C;  3A0F A;  5H14 A;  1PGU A;  2CNX A;  3EI1 B;  5TEE A;  4GZ8 A;  3EI3 B;  3AL9 A;  3IJ1 A;  4ZN4 A;  4I79 A;  2OVP B;  3GRE A;  4A09 B;  5EM2 B;  2H6Q A;  2IWK A;  2P9N C;  5EAM A;  4J77 A;  5HE1 B;  2IUQ A;  2CN2 A;  4X60 B;  2P9U C;  2I3S A;  5FLX g;  1NEX B;  2OK6 A;  4O9D A;  4JXM A;  5FKR A;  1PBY B;  4MK0 B;  1SHY B;  3ORV D;  5AMS A;  2J55 H;  5GSA A;  4N14 A;  5AJA A;  2UZX B;  5AFU 3;  3PXT D;  1U4C A;  4A11 B;  3AL8 A;  1U2V C;  5CXB B;  1JMZ B;  3JZN A;  1SQ9 A;  2P9I C;  5TEF A;  3OKY A;  3L4O D;  4ZOX A; 
#chains in the Genus database with same CATH topology
 3SJL D;  5IJ8 E;  1B9X A;  4QT8 A;  3ZDY A;  3I7L A;  5C9Z B;  2H9N A;  4MMY A;  5IGQ A;  4GQ1 A;  3C75 H;  3SFZ A;  3OW8 A;  2IUV A;  1JJU B;  2AGX A;  4GM8 A;  5K19 A;  2P9K C;  3JB9 L;  3GFC A;  4QRJ A;  1L0Q A;  2I0T A;  3DWL C;  2HKM A;  3GC3 B;  3NIG A;  3UVO A;  4H5I A;  4ESG A;  2OVQ B;  4JSX C;  1C9I A;  5EAL A;  2OIZ A;  5EAR A;  4CZX A;  4FAV D;  3J80 g;  4Z7O A;  2QZP A;  1TYQ C;  2VDO A;  2VDL A;  1MG3 A;  3SWS D;  1XHM A;  2B4E A;  4J0X A;  3IUQ A;  3ODT A;  2YMU A;  3KCI A;  2VZ3 A;  4L3G D;  4L9O A;  4E5Z A;  4JSN C;  2PM9 B;  3IKO A;  4IMM A;  4JSP C;  3QI0 A;  4CY3 A;  4FB1 D;  4CY1 A;  1BPO A;  4Y5R D;  2YNP A;  4ZOV A;  3IIW A;  2Z2P A;  4ERY A;  2BCJ B;  4X61 B;  1O6F A;  3RSE C;  3EI4 B;  5C2W B;  3I8C A;  2HJB A;  2VDM A;  2QC5 A;  3JRP A;  3PVW B;  3VA6 A;  1OLZ A;  1VE7 A;  1GOT B;  4PC0 A;  4L1Q D;  2XDW A;  4ES0 A;  2P9L C;  4JT5 C;  4PBZ A;  5IGO A;  4WJK A;  4Z7N A;  5C92 A;  3NVN A;  3FCU A;  3FCS A;  5E6S A;  3I89 A;  5IT9 g;  4A0A A;  3F3P A;  2H68 A;  4G56 B;  3DXK C;  4A0B A;  4FA4 D;  4GGA A;  5M5T A;  3IUR A;  2BKL A;  2AH1 A;  3F3F A;  1K8K C;  3EI1 A;  5FXY A;  1UOQ A;  4G55 A;  4J0W A;  4GM3 A;  4PNK B;  1UTC A;  2B5L A;  1H2Y A;  3N0E A;  4ZOZ A;  4D6V A;  3MVD K;  5A2Q g;  4AN1 A;  3BWS A;  4XEI C;  3SBQ A;  1YFQ A;  4XYI A;  2B5M A;  4J87 A;  3MZK A;  5E6R A;  4J82 A;  2AGZ A;  1GOG A;  3KRW B;  1JOF A;  1FWX A;  2VZ1 A;  4JD2 C;  4O1Q D;  1JTD B;  5HDB A;  2HU5 A;  3PE7 A;  4AEZ A;  2J56 H;  5HE0 B;  2WQ8 A;  3OKW A;  2CE9 A;  3DXM C;  4GMB A;  2OVR B;  2HYE A;  4CI3 A;  3SBR A;  4PBY A;  2TRC B;  2HES X;  3BG1 A;  4BH6 A;  2VDP A;  4Z7Q A;  2HKR A;  2G9A A;  3AFC A;  2XU7 A;  3MXX A;  3O4H A;  5CXC B;  3MKS B;  5CXB A;  4K3I D;  4UM8 A;  3N0D A;  2W18 A;  3UVN A;  4A2M A;  3EQ9 A;  2VDR A;  5KDO B;  4J81 A;  1M1X A;  1PEV A;  2AGW A;  4BUJ C;  3FM0 A;  5CYK A;  4AMZ A;  1H2Z A;  4QQE A;  3DSM A;  4WK0 A;  2CE8 A;  3K72 A;  3ULE C;  3SN6 B;  1K3I A;  4PSX B;  3UVM A;  3OL2 A;  4L3H D;  1OMW B;  4UI9 R;  4MMZ A;  3CFV A;  2AGL A;  4NC4 A;  3PSC B;  1VZ2 A;  5M5R A;  4IA9 A;  3FGB A;  2EIE A;  2PBI B;  3K71 A;  3B7F A;  4CI1 A;  2IWF A;  5HE2 B;  2IAA A;  3BG0 A;  5EMK B;  1A0R B;  4K3J B;  4FA5 D;  4NSX A;  3PXW D;  2QXV A;  3QHY B;  3V9F A;  1QFS A;  3PXS D;  3SMR A;  3JZG A;  1SQJ A;  1YR2 A;  1E8N A;  2XE4 A;  4KFM B;  4GQB B;  5SXM A;  2CO0 A;  4U1E I;  4J73 A;  1XIP A;  4QL1 A;  3AL8 B;  4J86 A;  2IUR A;  3T3M A;  1P22 A;  3OKY B;  3I8E A;  3IUJ A;  2PM6 B;  4EWR A;  5C2V B;  4CC9 A;  2CN3 A;  2H14 A;  2XYI A;  3I2N A;  4A08 A;  4JHN A;  3E0C A;  3UVK A;  4AX4 A;  5H17 A;  3L4M D;  3I7K A;  4G1E A;  2HXC A;  3IVM A;  4J84 A;  1N6D A;  3MUO A;  4GGC A;  3ZDX A;  3EI2 A;  2YBA A;  4NEN A;  3KRX B;  1R5M A;  1NR0 A;  2H6K A;  4AN0 A;  2YNN A;  4NAA A;  3VGZ A;  5I5M A;  4LGN A;  3CIK B;  1ERJ A;  4ERQ A;  5EMM B;  5TDH B;  4E54 A;  4R7A B;  2Z2N A;  4O3U B;  3MMY A;  4CY2 A;  3K26 A;  3P4F A;  3EU7 A;  4IRZ A;  5FA5 B;  3T3P A;  1E5T A;  4J78 A;  2BBK H;  3EG6 A;  2AQ5 A;  3C5M A;  5THA A;  2GC7 A;  3C99 A;  5IC7 A;  4E5Z B;  3NIF A;  3UVL A;  4TZ4 A;  3PVU B;  4JT6 C;  2EIC A;  3UR4 A;  3RMZ D;  2XL2 A;  3RRM C;  3EI3 A;  3HFQ A;  4A09 A;  1TYE A;  4RE6 A;  3SHF A;  3SVW D;  5EM2 A;  3ZE2 A;  4LG8 A;  1VYH C;  3OF7 A;  3RN1 D;  3I7O A;  5I5I A;  1MG2 A;  3JAM g;  3SBP A;  3W15 A;  2EIB A;  3MZL A;  2VDN A;  1Q47 A;  1T2X A;  3RLM D;  4NBM A;  1UOP A;  3RFH A;  1K32 A;  3ZWL B;  4J8G A;  1C9L A;  2XL3 A;  1XKS A;  4A0A B;  3UKU C;  4A0B B;  1GXR A;  1PI6 A;  2H9P A;  4Z8L A;  4FA1 D;  4O45 A;  5GXI A;  5HYN B;  1GP2 B;  3IJ0 A;  4BP9 A;  2VDQ A;  5HQG A;  4ZOY A;  2EBS A;  4A11 A;  4Y7R A;  4J8B A;  3F3G A;  3JPX A;  5IJ7 E;  3EQ7 A;  1GOF A;  1I2M B;  2P9P C;  2PM7 B;  5GXH A;  3V7D B;  3EWE A;  3IUL A;  2MTA H;  3EQ8 A;  3IJE A;  4YVD A;  5TF2 A;  2B5N A;  5GMK n;  4GQ2 P;  3JRO A;  2H6N A;  3K6S A;  3FRX A;  4DNV A;  3JZH A;  3C9C A;  4CY5 A;  2I0R A;  2GC4 A;  1JV2 A;  4O3T B;  5FKT A;  3UKR C;  3K27 A;  3J81 g;  3NVX A;  3EMH A;  3VH0 A;  4WK2 A;  4D0K A;  1GOH A;  2Q7Q A;  4FA9 D;  4FAN D;  3DM0 A;  4JSV C;  2YB8 B;  1JMX B;  2UZY B;  4D9S A;  3V5W B;  4CZY A;  4U7A A;  1QNI A;  4GGD A;  3RN0 D;  1S4U X;  4BL0 A;  1N6E A;  2VC2 A;  4PXW A;  5CYK B;  4HDJ A;  4BCD A;  5FQD A;  3O4G A;  1L5G A;  4AMY A;  2PM9 A;  5M5U A;  1A12 A;  2CO0 C;  4OWR A;  2H3X A;  4A7J A;  5C86 A;  5FKS A;  3U4Y A;  3OL2 B;  2YNO A;  3IUN A;  1E8M A;  3EI4 A;  3SXT D;  4AOW A;  5H1M A;  2G99 A;  3PSL A;  2QR5 A;  3VI3 A;  4BP8 A;  4FWW A;  2OK4 A;  4O2W A;  4O02 A;  5FKQ A;  5HE3 B;  2IUP A;  3V4V A;  3CFS B;  3IIY A;  1VZ3 A;  5EAP A;  3SLE D;  3SCY A;  3I7N A;  4DNW A;  4CI8 A;  4LG9 A;  3O4I A;  3VI4 A;  5JWZ A;  2GNQ A;  1TBG A;  3ZE1 A;  2Z2O A;  2I0S A;  1B9Y A;  4L1M A;  4OZU A;  5EMJ B;  2O9K A;  3O4J A;  4XYH A;  1MDA H;  1RI6 A;  4FHL A;  2AH0 A;  4DNU A;  4A08 B;  4G1M A;  2I3T A;  3NVQ A;  5I5J A;  4QAM A;  3OKT A;  4X63 B;  3I7P A;  4A2L A;  3V4P A;  3EI2 B;  2H9M A;  3OTT A;  4MMX A;  1GG2 B;  4GM9 A;  4UM9 A;  5EML B;  5M5S A;  4X3E A;  4CZV A;  2H13 A;  2OJY A;  4ERZ A;  2HJ4 A;  5B4W A;  3I7H A;  4PSW B;  4H5J A;  5M61 A;  3IJC A;  3DDU A;  4J79 A;  4E54 B;  2AGY A;  2H9L A;  3MKQ A;  1N6F A;  4JHP C;  2H47 A;  2P9S C;  5CXC A;  3AH8 B;  2HU8 A;  2J57 G;  1UOO A;  3RFG A;  4CI2 A;  5K1C C;  3A0F A;  5FFG A;  5H14 A;  1PGU A;  3ZDZ A;  4BCC A;  3NID A;  2CNX A;  5FFO A;  3EI1 B;  5TEE A;  4GZ8 A;  1H2X A;  2JKX A;  3EI3 B;  3AL9 A;  3IJ1 A;  4ZN4 A;  4I79 A;  2OVP B;  3IUM A;  3GRE A;  4A09 B;  3MUN A;  5EM2 B;  2H6Q A;  2HU7 A;  2IWK A;  2P9N C;  5EAM A;  3GD1 I;  5M5V A;  4J77 A;  1U8C A;  5HE1 B;  2IUQ A;  1QFM A;  5E6U A;  2CN2 A;  4X60 B;  2VDK A;  2P9U C;  2EID A;  2I3S A;  1NEX B;  2OK6 A;  5FLX g;  1VE6 A;  4O9D A;  4WK4 A;  4JXM A;  5FKR A;  4BCB A;  1PBY B;  4MK0 B;  1SHY B;  3ORV D;  5AMS A;  2J55 H;  4RE5 A;  2XZG A;  5GSA A;  4N14 A;  5AJA A;  2UZX B;  1O6G A;  5AFU 3;  3PXT D;  3ZE0 A;  1U4C A;  4A11 B;  3AL8 A;  1U2V C;  5CXB B;  1JMZ B;  3JZN A;  1H2W A;  1SQ9 A;  2P9I C;  5TEF A;  3OKY A;  3L4O D;  4ZOX A; 
#chains in the Genus database with same CATH homology
 3SJL D;  5IJ8 E;  1B9X A;  4QT8 A;  3I7L A;  5C9Z B;  2H9N A;  5IGQ A;  4GQ1 A;  3C75 H;  3SFZ A;  3OW8 A;  2IUV A;  1JJU B;  2AGX A;  4GM8 A;  5K19 A;  2P9K C;  3JB9 L;  3GFC A;  4QRJ A;  1L0Q A;  2I0T A;  3DWL C;  2HKM A;  3UVO A;  4H5I A;  4ESG A;  2OVQ B;  4JSX C;  5EAL A;  2OIZ A;  5EAR A;  4CZX A;  4FAV D;  3J80 g;  1TYQ C;  1MG3 A;  3SWS D;  1XHM A;  2B4E A;  4J0X A;  3ODT A;  2YMU A;  4L3G D;  4L9O A;  4E5Z A;  4JSN C;  2PM9 B;  3IKO A;  4IMM A;  4JSP C;  4CY3 A;  4FB1 D;  4CY1 A;  4Y5R D;  2YNP A;  4ZOV A;  3IIW A;  2Z2P A;  4ERY A;  2BCJ B;  4X61 B;  3RSE C;  3EI4 B;  5C2W B;  3I8C A;  2HJB A;  2QC5 A;  3JRP A;  3PVW B;  3VA6 A;  1OLZ A;  1GOT B;  4PC0 A;  4L1Q D;  4ES0 A;  2P9L C;  4JT5 C;  4PBZ A;  5IGO A;  3NVN A;  5IT9 g;  3I89 A;  4A0A A;  3F3P A;  2H68 A;  4G56 B;  3DXK C;  4A0B A;  4FA4 D;  4GGA A;  2AH1 A;  3F3F A;  1K8K C;  3EI1 A;  5FXY A;  4J0W A;  4GM3 A;  4PNK B;  2B5L A;  3N0E A;  4ZOZ A;  4D6V A;  5A2Q g;  3BWS A;  4XEI C;  3SBQ A;  1YFQ A;  4XYI A;  2B5M A;  4J87 A;  3MZK A;  4J82 A;  2AGZ A;  3KRW B;  1JOF A;  1FWX A;  4O1Q D;  4JD2 C;  4AEZ A;  3PE7 A;  2J56 H;  5HE0 B;  3OKW A;  2CE9 A;  3DXM C;  4GMB A;  2OVR B;  2HYE A;  4CI3 A;  3SBR A;  4PBY A;  2TRC B;  2HES X;  3BG1 A;  4BH6 A;  2HKR A;  2G9A A;  3AFC A;  2XU7 A;  3MXX A;  5CXC B;  3MKS B;  5CXB A;  4K3I D;  3N0D A;  2W18 A;  3UVN A;  4A2M A;  5KDO B;  4J81 A;  1PEV A;  2AGW A;  4BUJ C;  3FM0 A;  5CYK A;  4QQE A;  3DSM A;  2CE8 A;  3ULE C;  3SN6 B;  4PSX B;  3UVM A;  3OL2 A;  4L3H D;  1OMW B;  4UI9 R;  3CFV A;  2AGL A;  3PSC B;  4IA9 A;  3FGB A;  2PBI B;  3B7F A;  4CI1 A;  2IWF A;  5HE2 B;  2IAA A;  3BG0 A;  5EMK B;  1A0R B;  4K3J B;  4FA5 D;  4NSX A;  3PXW D;  2QXV A;  3V9F A;  3PXS D;  3SMR A;  3JZG A;  1SQJ A;  4KFM B;  4GQB B;  5SXM A;  2CO0 A;  4U1E I;  4J73 A;  1XIP A;  4QL1 A;  3AL8 B;  4J86 A;  2IUR A;  1P22 A;  3OKY B;  3I8E A;  2PM6 B;  4EWR A;  5C2V B;  4CC9 A;  2CN3 A;  2H14 A;  2XYI A;  3I2N A;  4A08 A;  3E0C A;  3UVK A;  5H17 A;  3I7K A;  3L4M D;  2HXC A;  4J84 A;  1N6D A;  4GGC A;  3EI2 A;  2YBA A;  3KRX B;  1R5M A;  1NR0 A;  2H6K A;  2YNN A;  3VGZ A;  5I5M A;  4LGN A;  3CIK B;  1ERJ A;  4ERQ A;  5EMM B;  5TDH B;  4E54 A;  4R7A B;  2Z2N A;  4O3U B;  3MMY A;  4CY2 A;  3K26 A;  3P4F A;  3EU7 A;  5FA5 B;  4J78 A;  2BBK H;  3EG6 A;  2AQ5 A;  3C5M A;  5THA A;  2GC7 A;  3C99 A;  5IC7 A;  4E5Z B;  3UVL A;  4TZ4 A;  3PVU B;  4JT6 C;  3UR4 A;  3RMZ D;  2XL2 A;  3RRM C;  3EI3 A;  3HFQ A;  4A09 A;  3SHF A;  3SVW D;  5EM2 A;  4LG8 A;  1VYH C;  3RN1 D;  3I7O A;  5I5I A;  1MG2 A;  3JAM g;  3SBP A;  3W15 A;  3MZL A;  1Q47 A;  3RLM D;  3RFH A;  1K32 A;  3ZWL B;  4J8G A;  2XL3 A;  1XKS A;  4A0A B;  3UKU C;  4A0B B;  1GXR A;  1PI6 A;  2H9P A;  4Z8L A;  4FA1 D;  4O45 A;  5GXI A;  5HYN B;  1GP2 B;  3IJ0 A;  5HQG A;  4ZOY A;  2EBS A;  4A11 A;  4Y7R A;  4J8B A;  3F3G A;  3JPX A;  5IJ7 E;  2P9P C;  2PM7 B;  5GXH A;  3V7D B;  3EWE A;  2MTA H;  4YVD A;  5TF2 A;  2B5N A;  5GMK n;  4GQ2 P;  3JRO A;  2H6N A;  3FRX A;  3JZH A;  3C9C A;  4CY5 A;  2I0R A;  2GC4 A;  4O3T B;  5FKT A;  3UKR C;  3K27 A;  3J81 g;  3NVX A;  3EMH A;  3VH0 A;  4D0K A;  2Q7Q A;  4FA9 D;  4FAN D;  3DM0 A;  4JSV C;  2YB8 B;  1JMX B;  2UZY B;  3V5W B;  4CZY A;  4U7A A;  1QNI A;  4GGD A;  3RN0 D;  1S4U X;  4BL0 A;  1N6E A;  4PXW A;  5CYK B;  4HDJ A;  5FQD A;  2PM9 A;  2CO0 C;  4OWR A;  2H3X A;  4A7J A;  5FKS A;  3U4Y A;  3OL2 B;  2YNO A;  3EI4 A;  3SXT D;  4AOW A;  5H1M A;  2G99 A;  3PSL A;  4FWW A;  2OK4 A;  5FKQ A;  5HE3 B;  2IUP A;  3CFS B;  3IIY A;  5EAP A;  3SLE D;  3SCY A;  3I7N A;  4CI8 A;  4LG9 A;  5JWZ A;  2GNQ A;  1TBG A;  2Z2O A;  2I0S A;  1B9Y A;  4OZU A;  5EMJ B;  2O9K A;  4XYH A;  1MDA H;  1RI6 A;  4FHL A;  2AH0 A;  4A08 B;  2I3T A;  3NVQ A;  5I5J A;  3OKT A;  4X63 B;  3I7P A;  4A2L A;  3EI2 B;  2H9M A;  3OTT A;  1GG2 B;  4GM9 A;  5EML B;  4X3E A;  4CZV A;  2H13 A;  2OJY A;  4ERZ A;  2HJ4 A;  5B4W A;  3I7H A;  4PSW B;  4H5J A;  3IJC A;  4J79 A;  4E54 B;  2AGY A;  2H9L A;  3MKQ A;  1N6F A;  2H47 A;  2P9S C;  5CXC A;  3AH8 B;  2J57 G;  3RFG A;  4CI2 A;  5K1C C;  3A0F A;  5H14 A;  1PGU A;  2CNX A;  3EI1 B;  5TEE A;  4GZ8 A;  3EI3 B;  3AL9 A;  3IJ1 A;  4ZN4 A;  4I79 A;  2OVP B;  3GRE A;  4A09 B;  5EM2 B;  2H6Q A;  2IWK A;  2P9N C;  5EAM A;  4J77 A;  5HE1 B;  2IUQ A;  2CN2 A;  4X60 B;  2P9U C;  2I3S A;  5FLX g;  1NEX B;  2OK6 A;  4O9D A;  4JXM A;  5FKR A;  1PBY B;  4MK0 B;  1SHY B;  3ORV D;  5AMS A;  2J55 H;  5GSA A;  4N14 A;  5AJA A;  2UZX B;  5AFU 3;  3PXT D;  1U4C A;  4A11 B;  3AL8 A;  1U2V C;  5CXB B;  1JMZ B;  3JZN A;  1SQ9 A;  2P9I C;  5TEF A;  3OKY A;  3L4O D;  4ZOX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...