1MG3A

Mutation of alpha phe55 of methylamine dehydrogenase alters the reorganization energy and electronic coupling for its electron transfer reaction with amicyanin
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
382
structure length
382
Chain Sequence
b'EAETQAQETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHAAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine dehydrogenase, heavy chain
molecule tags Oxidoreductase
source organism Paracoccus denitrificans
publication title MUTATION OF ALPHA PHE55 OF METHYLAMINE DEHYDROGENASE ALTERS THE REORGANIZATION ENERGY AND ELECTRONIC COUPLING FOR ITS ELECTRON TRANSFER REACTION WITH AMICYANIN
pubmed doi rcsb
total genus 93
structure length 382
sequence length 382
chains with identical sequence E, I, M
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2002-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1mg3A00
4X61B 2I3TA 4ESGA 4K3ID 3VA6A 5EALA 1GXRA 3OKYA 4AEZA 3IIWA 3JB9L 3OL2B 4JT5C 4J0WA 2Q7QA 3FM0A 2HJBA 3V9FA 1U2VC 1OMWB 3I7NA 4HDJA 4CI2A 3JZNA 3EWEA 4NSXA 2AH0A 5IGOA 3SLED 1S4UX 3AH8B 3SMRA 4A08B 3EI4B 2J56H 3EU7A 3JZHA 5AJAA 4CY5A 2HJ4A 3MKSB 5I5MA 2I3SA 3RMZD 4GGCA 2G9AA 3FGBA 3UKRC 2O9KA 1JOFA 4U1EI 1GOTB 4CZXA 5KDOB 3UVLA 3PSLA 5C2WB 3EMHA 2IWFA 3HFQA 4A2MA 2P9LC 3J81g 5TF2A 4Y5RD 3SBPA 3C5MA 3MZKA 4J79A 4OWRA 4IA9A 4JXMA 2EBSA 3JPXA 5CYKB 2P9PC 5CXCA 4PSWB 3SBRA 4JT6C 2HKMA 4O9DA 3DSMA 3W15A 3L4OD 4PC0A 5TEEA 2B4EA 3SVWD 5I5IA 2OVPB 3OKTA 3I8EA 2UZXB 2H14A 4PXWA 3SXTD 4FA4D 3SBQA 4ES0A 3I7HA 2YBAA 5IJ8E 4L3GD 4A0BB 4PBYA 4A11B 3I2NA 1NEXB 3U4YA 2GNQA 3RFGA 4I79A 4XEIC 5EM2A 4BUJC 3RSEC 2H6QA 3IKOA 2PBIB 5GXHA 5K1CC 3OKYB 4FHLA 3I8CA 4L3HD 5FA5B 5CXBB 2G99A 4D6VA 1XKSA 4GM9A 1PI6A 5AMSA 4J86A 2GC7A 4CI3A 4H5IA 2I0RA 1JMZB 4D0KA 1K8KC 4BH6A 2AGYA 4IMMA 3V5WB 2AGWA 3OTTA 4ERQA 4FA5D 4X3EA 4ZOYA 3RRMC 3UVMA 5AFU3 3I7PA 3JAMg 4OZUA 4A08A 4ZN4A 3CFSB 3KRXB 2CNXA 2I0TA 3RN0D 2CE9A 4A0AB 4JSXC 5JWZA 2P9KC 4A09A 5IT9g 3EI1A 2IAAA 4GQ2P 3IJ0A 4JSPC 1ERJA 2AH1A 5FKSA 2CN3A 3SN6B 3MXXA 5C9ZB 5FKTA 4GQBB 2AGXA 3NVQA 3ODTA 3ULEC 5IC7A 3PVWB 1TBGA 5EMMB 3P4FA 5CYKA 4ZOZA 3RN1D 3ZWLB 4GZ8A 5EARA 4Z8LA 2OVRB 5I5JA 1NR0A 2IUVA 5GSAA 4FB1D 1N6EA 3E0CA 3I7OA 2IUPA 1MG3A 3JROA 5EMJB 3SWSD 4K3JB 1N6DA 3AL8A 3EI2A 2H68A 5EMLB 4CC9A 4E5ZA 2XU7A 2YMUA 4QT8A 2OK4A 4GM3A 3C9CA 4A11A 4FWWA 3PXWD 5FKQA 3DXKC 3MKQA 4O1QD 3DWLC 3C75H 3EI3B 5HE0B 3OKWA 3I89A 4J0XA 1GG2B 2PM9B 4CY3A 1XIPA 2J55H 4G56B 1PBYB 2H3XA 2AQ5A 3CFVA 2H47A 3DM0A 5K19A 3SJLD 5CXBA 3B7FA 4TZ4A 2Z2PA 4J78A 4XYHA 2CO0C 4J81A 5H1MA 2IURA 5C2VB 1SQ9A 4A7JA 2HESX 3IIYA 4LGNA 1PGUA 1VYHC 4UI9R 4JSVC 3NVXA 2W18A 2H9LA 2TRCB 4J8GA 4QQEA 5B4WA 4CY2A 4R7AB 5IGQA 3SHFA 2B5LA 2P9IC 1PEVA 4A0AA 4FAVD 4A09B 3DXMC 4PSXB 3SFZA 2J57G 2CN2A 4GMBA 3EI1B 1MG2A 2AGLA 3NVNA 4GGDA 4KFMB 4Y7RA 3SCYA 1MDAH 5HQGA 2XYIA 4L1QD 5SXMA 4LG8A 4GM8A 1TYQC 4YVDA 4J73A 5H14A 4J8BA 5EAMA 2H9NA 5H17A 3RFHA 1SQJA 1A0RB 3PSCB 2H13A 5TEFA 4CZVA 3PE7A 3GFCA 2OJYA 1B9XA 1P22A 3AL9A 3JZGA 2QXVA 3N0EA 3UVNA 3BG1A 3UR4A 4O3UB 4ERZA 3BWSA 2OIZA 3GREA 3ORVD 1N6FA 3AL8B 2H6NA 4CZYA 2MTAH 3EI2B 4CI1A 3VH0A 2UZYB 5THAA 2YNOA 4X63B 4E5ZB 2YNPA 3VGZA 4JSNC 3N0DA 3C99A 2GC4A 2BCJB 2PM7B 2Z2OA 3K27A 5FQDA 2QC5A 2I0SA 2YNNA 3EI3A 4X60B 4MK0B 4E54A 1JJUB 2PM9A 3F3PA 3UKUC 1L0QA 4CI8A 5HE2B 3PXTD 4QL1A 3BG0A 5EMKB 3OL2A 3MMYA 1YFQA 4ZOVA 4U7AA 4ZOXA 4J82A 5GMKn 4CY1A 3CIKB 3MZLA 2YB8B 2IUQA 2H9PA 5HE3B 5EAPA 1SHYB 4ERYA 2OVQB 4L9OA 3RLMD 4O45A 4BL0A 3A0FA 1K32A 1QNIA 3K26A 4J77A 1XHMA 3EI4A 2B5NA 5HE1B 3JRPA 1RI6A 3EG6A 3KRWB 2XL2A 4GGAA 3PVUB 2H9MA 4PNKB 1B9YA 1JMXB 2P9UC 4JD2C 2P9SC 4LG9A 2PM6B 4PBZA 2BBKH 4QRJA 4AOWA 5A2Qg 5HYNB 2XL3A 2HYEA 1GP2B 3IJ1A 3AFCA 3IJCA 3PXSD 5IJ7E 2CE8A 3I7KA 2AGZA 4FA9D 2IWKA 4XYIA 3FRXA 5CXCB 2Z2NA 2B5MA 2HKRA 1FWXA 3V7DB 4A2LA 2OK6A 2P9NC 3UVKA 5FXYA 3OW8A 4GQ1A 3J80g 1OLZA 5TDHB 3UVOA 2HXCA 3L4MD 2CO0A 1R5MA 3F3GA 4H5JA 4O3TB 5FKRA 4N14A 4A0BA 4FA1D 2H6KA 4FAND 5FLXg 1Q47A 1U4CA 4EWRA 4J84A 4J87A 5GXIA 5EM2B 3F3FA 4E54B 3I7LA
chains in the Genus database with same CATH superfamily
3ZE0A 1VE6A 4X61B 5E6UA 2I3TA 4ESGA 3IJEA 4K3ID 1C9IA 3VA6A 5EALA 1GXRA 3OKYA 4AEZA 3IIWA 3JB9L 3OL2B 4JT5C 4AN1A 4J0WA 2Q7QA 3FM0A 2WQ8A 3ZDZA 2HJBA 3V9FA 1U2VC 1OMWB 3I7NA 5M5UA 4HDJA 4CI2A 3JZNA 3EWEA 3NIGA 4NSXA 2AH0A 4G1MA 5IGOA 3SLED 1S4UX 1E5TA 4WK0A 3AH8B 3SMRA 4BCCA 3EI4B 4UM8A 4A08B 2J56H 3EU7A 3JZHA 5AJAA 1UOPA 4CY5A 2HJ4A 3MKSB 3IURA 5I5MA 2VDKA 3QI0A 2I3SA 3RMZD 4GGCA 4O02A 2G9AA 3FGBA 3K6SA 1GOFA 3UKRC 4DNVA 2O9KA 1JOFA 4NBMA 4U1EI 1GOTB 2QR5A 4CZXA 5KDOB 3UVLA 1M1XA 3PSLA 5C2WB 3EMHA 1T2XA 2IWFA 3HFQA 4A2MA 1O6FA 2P9LC 3J81g 5TF2A 4Y5RD 3SBPA 5FFGA 3C5MA 4Z7OA 3MZKA 4J79A 4OWRA 4IA9A 4JXMA 2EBSA 3EQ8A 3JPXA 5CYKB 2P9PC 2VDNA 5CXCA 1E8NA 4PSWB 3SBRA 4JT6C 2HKMA 4O9DA 3DSMA 3W15A 3L4OD 4PC0A 5TEEA 1UTCA 2B4EA 3SVWD 5I5IA 2OVPB 3OKTA 3I8EA 3K71A 2UZXB 5M5SA 2H14A 4PXWA 3SXTD 4FA4D 3SBQA 4O2WA 4ES0A 3I7HA 2YBAA 5IJ8E 4L3GD 4A0BB 4PBYA 4A11B 3I2NA 1NEXB 3U4YA 2GNQA 3RFGA 4NENA 3VI3A 4I79A 4XEIC 3IUJA 5EM2A 4BUJC 3RSEC 1K3IA 2H6QA 2EIBA 2PBIB 3IKOA 5HDBA 5GXHA 4WJKA 5K1CC 3OKYB 4FHLA 3I8CA 4L3HD 4RE6A 5FA5B 1GOGA 5CXBB 2G99A 4D6VA 1XKSA 4GM9A 1PI6A 5AMSA 4J86A 2GC7A 4CI3A 4H5IA 2I0RA 1JMZB 4D0KA 1K8KC 4BH6A 2AGYA 4IMMA 3V5WB 2AGWA 3OTTA 4ERQA 4FA5D 4Z7NA 4X3EA 4ZOYA 3RRMC 3UVMA 5AFU3 1L5GA 3I7PA 3JAMg 4OZUA 4A08A 4ZN4A 3CFSB 3KRXB 2CNXA 2I0TA 3EQ7A 2HU5A 3RN0D 4Z7QA 5M61A 2CE9A 2XE4A 4JSXC 5JWZA 4A0AB 4NC4A 2P9KC 4A09A 2VDLA 5IT9g 2VZ3A 3EI1A 2IAAA 4GQ2P 1BPOA 2QZPA 3IJ0A 4JSPC 1ERJA 2AH1A 5FKSA 2CN3A 3SN6B 3MXXA 5C9ZB 5FKTA 4GQBB 2AGXA 3NVQA 3IUMA 3ODTA 4AX4A 3ULEC 5IC7A 2XDWA 2VDOA 3PVWB 2VZ1A 5M5VA 1TBGA 5EMMB 3FCUA 3P4FA 5CYKA 4ZOZA 3ZDYA 3RN1D 3ZWLB 1JTDB 4BP9A 4GZ8A 5EARA 4Z8LA 2OVRB 3K72A 1QFSA 5I5JA 1NR0A 2IUVA 4G55A 1H2WA 4AN0A 4FB1D 5GSAA 1N6EA 1VZ2A 3E0CA 5FFOA 1VE7A 3I7OA 2IUPA 4BCBA 1MG3A 4G1EA 3JROA 3O4JA 5EMJB 2VDPA 3SWSD 4K3JB 1N6DA 3AL8A 3EI2A 2H68A 5EMLB 2JKXA 3IUQA 4CC9A 4E5ZA 2XU7A 3MVDK 2YMUA 4QT8A 2EIDA 2OK4A 4GM3A 3C9CA 4A11A 4FWWA 3PXWD 5FKQA 3DXKC 3MKQA 4O1QD 3DWLC 2VDRA 3C75H 3EI3B 3OF7A 5HE0B 3OKWA 3I89A 1GG2B 2PM9B 4J0XA 3GD1I 4CY3A 3O4GA 1XIPA 2J55H 4G56B 1PBYB 2H3XA 2AQ5A 3NIFA 3CFVA 3V4VA 1I2MB 2H47A 3DM0A 5K19A 3SJLD 2EIEA 5CXBA 3B7FA 4QAMA 4TZ4A 2Z2PA 4J78A 4XYHA 2CO0C 4J81A 1A12A 2XZGA 5H1MA 2IURA 5C2VB 1SQ9A 4A7JA 2HESX 3QHYB 3IIYA 4LGNA 1PGUA 1VYHC 4UI9R 4JSVC 3NVXA 1VZ3A 2W18A 3FCSA 2H9LA 2TRCB 2VDMA 4J8GA 4QQEA 5B4WA 4AMZA 1C9LA 4CY2A 4R7AB 1GOHA 4DNUA 4WK2A 5IGQA 4MMYA 4WK4A 3SHFA 5M5TA 2B5LA 2P9IC 1PEVA 4A0AA 3VI4A 4FAVD 4A09B 3DXMC 4PSXB 3SFZA 2J57G 2CN2A 4GMBA 4JHPC 3EI1B 1MG2A 2AGLA 2VDQA 3NVNA 4GGDA 4KFMB 4Y7RA 2HU7A 3SCYA 1MDAH 5HQGA 2XYIA 4L1QD 5SXMA 4LG8A 4GM8A 1H2YA 1TYQC 4YVDA 1U8CA 4J73A 5H14A 4J8BA 5EAMA 2H9NA 5H17A 3RFHA 1SQJA 1A0RB 3PSCB 2H13A 5TEFA 4CZVA 3PE7A 3GFCA 2BKLA 2OJYA 1B9XA 1P22A 3AL9A 3JZGA 2QXVA 3N0EA 4MMZA 3UVNA 3BG1A 3UR4A 4O3UB 4ERZA 1JV2A 3BWSA 1UOQA 2OIZA 3GREA 3ORVD 1N6FA 3AL8B 2H6NA 4CZYA 1O6GA 2MTAH 3EI2B 4CI1A 3VH0A 2UZYB 3EQ9A 5THAA 2YNOA 4X63B 4E5ZB 3IULA 2YNPA 3VGZA 4JSNC 3N0DA 4NAAA 3C99A 2GC4A 2BCJB 2PM7B 2Z2OA 3K27A 3T3MA 5FQDA 2QC5A 2I0SA 2YNNA 3EI3A 4X60B 4MK0B 4BCDA 4E54A 4UM9A 4AMYA 3O4HA 1JJUB 2PM9A 2EICA 3F3PA 2VC2A 3MUNA 3ZE2A 3UKUC 1L0QA 4CI8A 5HE2B 3PXTD 4QL1A 3BG0A 4RE5A 5EMKB 3OL2A 1YR2A 4BP8A 3MMYA 1YFQA 4ZOVA 4U7AA 4ZOXA 4J82A 5GMKn 3IVMA 4CY1A 3CIKB 3MZLA 2YB8B 2IUQA 4DNWA 2H9PA 5HE3B 4IRZA 1SHYB 5EAPA 4ERYA 2OVQB 4L9OA 3RLMD 3ZE1A 4O45A 4BL0A 3A0FA 1K32A 3KCIA 1QNIA 3K26A 4J77A 1XHMA 3EI4A 2B5NA 5HE1B 3JRPA 4L1MA 1RI6A 4D9SA 3EG6A 3KRWB 2XL2A 4GGAA 3PVUB 2H9MA 4PNKB 1B9YA 1JMXB 2P9UC 4JD2C 2P9SC 4LG9A 1E8MA 2PM6B 4PBZA 2BBKH 5C86A 4QRJA 4AOWA 5A2Qg 5HYNB 2XL3A 2HYEA 1GP2B 3GC3B 3IJ1A 3AFCA 3IJCA 4MMXA 5C92A 3PXSD 5IJ7E 2CE8A 3I7KA 2AGZA 3V4PA 4FA9D 3IUNA 2IWKA 4XYIA 3FRXA 5CXCB 2Z2NA 1H2XA 2B5MA 2HKRA 1FWXA 5E6SA 3V7DB 1H2ZA 3T3PA 4A2LA 2OK6A 2P9NC 3UVKA 1TYEA 5FXYA 3OW8A 3NIDA 3O4IA 4GQ1A 3J80g 1OLZA 2HU8A 5TDHB 3UVOA 2HXCA 3L4MD 2CO0A 1R5MA 3F3GA 4H5JA 4O3TB 1QFMA 5FKRA 5E6RA 4N14A 3ZDXA 4A0BA 4FA1D 2H6KA 4FAND 5FLXg 1Q47A 1U4CA 5M5RA 4EWRA 4J84A 4JHNA 3DDUA 4J87A 5GXIA 5EM2B 3F3FA 4E54B 3I7LA 3MUOA 1UOOA
chains in the Genus database with same CATH topology
4X61B 2I3TA 4ESGA 4K3ID 3VA6A 5EALA 1GXRA 3OKYA 4AEZA 3IIWA 3JB9L 3OL2B 4JT5C 4J0WA 2Q7QA 3FM0A 2HJBA 3V9FA 1U2VC 1OMWB 3I7NA 4HDJA 4CI2A 3JZNA 3EWEA 4NSXA 2AH0A 5IGOA 3SLED 1S4UX 3AH8B 3SMRA 4A08B 3EI4B 2J56H 3EU7A 3JZHA 5AJAA 4CY5A 2HJ4A 3MKSB 5I5MA 2I3SA 3RMZD 4GGCA 2G9AA 3FGBA 3UKRC 2O9KA 1JOFA 4U1EI 1GOTB 4CZXA 5KDOB 3UVLA 3PSLA 5C2WB 3EMHA 2IWFA 3HFQA 4A2MA 2P9LC 3J81g 5TF2A 4Y5RD 3SBPA 3C5MA 3MZKA 4J79A 4OWRA 4IA9A 4JXMA 2EBSA 3JPXA 5CYKB 2P9PC 5CXCA 4PSWB 3SBRA 4JT6C 2HKMA 4O9DA 3DSMA 3W15A 3L4OD 4PC0A 5TEEA 2B4EA 3SVWD 5I5IA 2OVPB 3OKTA 3I8EA 2UZXB 2H14A 4PXWA 3SXTD 4FA4D 3SBQA 4ES0A 3I7HA 2YBAA 5IJ8E 4L3GD 4A0BB 4PBYA 4A11B 3I2NA 1NEXB 3U4YA 2GNQA 3RFGA 4I79A 4XEIC 5EM2A 4BUJC 3RSEC 2H6QA 3IKOA 2PBIB 5GXHA 5K1CC 3OKYB 4FHLA 3I8CA 4L3HD 5FA5B 5CXBB 2G99A 4D6VA 1XKSA 4GM9A 1PI6A 5AMSA 4J86A 2GC7A 4CI3A 4H5IA 2I0RA 1JMZB 4D0KA 1K8KC 4BH6A 2AGYA 4IMMA 3V5WB 2AGWA 3OTTA 4ERQA 4FA5D 4X3EA 4ZOYA 3RRMC 3UVMA 5AFU3 3I7PA 3JAMg 4OZUA 4A08A 4ZN4A 3CFSB 3KRXB 2CNXA 2I0TA 3RN0D 2CE9A 4A0AB 4JSXC 5JWZA 2P9KC 4A09A 5IT9g 3EI1A 2IAAA 4GQ2P 3IJ0A 4JSPC 1ERJA 2AH1A 5FKSA 2CN3A 3SN6B 3MXXA 5C9ZB 5FKTA 4GQBB 2AGXA 3NVQA 3ODTA 3ULEC 5IC7A 3PVWB 1TBGA 5EMMB 3P4FA 5CYKA 4ZOZA 3RN1D 3ZWLB 4GZ8A 5EARA 4Z8LA 2OVRB 5I5JA 1NR0A 2IUVA 5GSAA 4FB1D 1N6EA 3E0CA 3I7OA 2IUPA 1MG3A 3JROA 5EMJB 3SWSD 4K3JB 1N6DA 3AL8A 3EI2A 2H68A 5EMLB 4CC9A 4E5ZA 2XU7A 2YMUA 4QT8A 2OK4A 4GM3A 3C9CA 4A11A 4FWWA 3PXWD 5FKQA 3DXKC 3MKQA 4O1QD 3DWLC 3C75H 3EI3B 5HE0B 3OKWA 3I89A 4J0XA 1GG2B 2PM9B 4CY3A 1XIPA 2J55H 4G56B 1PBYB 2H3XA 2AQ5A 3CFVA 2H47A 3DM0A 5K19A 3SJLD 5CXBA 3B7FA 4TZ4A 2Z2PA 4J78A 4XYHA 2CO0C 4J81A 5H1MA 2IURA 5C2VB 1SQ9A 4A7JA 2HESX 3IIYA 4LGNA 1PGUA 1VYHC 4UI9R 4JSVC 3NVXA 2W18A 2H9LA 2TRCB 4J8GA 4QQEA 5B4WA 4CY2A 4R7AB 5IGQA 3SHFA 2B5LA 2P9IC 1PEVA 4A0AA 4FAVD 4A09B 3DXMC 4PSXB 3SFZA 2J57G 2CN2A 4GMBA 3EI1B 1MG2A 2AGLA 3NVNA 4GGDA 4KFMB 4Y7RA 3SCYA 1MDAH 5HQGA 2XYIA 4L1QD 5SXMA 4LG8A 4GM8A 1TYQC 4YVDA 4J73A 5H14A 4J8BA 5EAMA 2H9NA 5H17A 3RFHA 1SQJA 1A0RB 3PSCB 2H13A 5TEFA 4CZVA 3PE7A 3GFCA 2OJYA 1B9XA 1P22A 3AL9A 3JZGA 2QXVA 3N0EA 3UVNA 3BG1A 3UR4A 4O3UB 4ERZA 3BWSA 2OIZA 3GREA 3ORVD 1N6FA 3AL8B 2H6NA 4CZYA 2MTAH 3EI2B 4CI1A 3VH0A 2UZYB 5THAA 2YNOA 4X63B 4E5ZB 2YNPA 3VGZA 4JSNC 3N0DA 3C99A 2GC4A 2BCJB 2PM7B 2Z2OA 3K27A 5FQDA 2QC5A 2I0SA 2YNNA 3EI3A 4X60B 4MK0B 4E54A 1JJUB 2PM9A 3F3PA 3UKUC 1L0QA 4CI8A 5HE2B 3PXTD 4QL1A 3BG0A 5EMKB 3OL2A 3MMYA 1YFQA 4ZOVA 4U7AA 4ZOXA 4J82A 5GMKn 4CY1A 3CIKB 3MZLA 2YB8B 2IUQA 2H9PA 5HE3B 5EAPA 1SHYB 4ERYA 2OVQB 4L9OA 3RLMD 4O45A 4BL0A 3A0FA 1K32A 1QNIA 3K26A 4J77A 1XHMA 3EI4A 2B5NA 5HE1B 3JRPA 1RI6A 3EG6A 3KRWB 2XL2A 4GGAA 3PVUB 2H9MA 4PNKB 1B9YA 1JMXB 2P9UC 4JD2C 2P9SC 4LG9A 2PM6B 4PBZA 2BBKH 4QRJA 4AOWA 5A2Qg 5HYNB 2XL3A 2HYEA 1GP2B 3IJ1A 3AFCA 3IJCA 3PXSD 5IJ7E 2CE8A 3I7KA 2AGZA 4FA9D 2IWKA 4XYIA 3FRXA 5CXCB 2Z2NA 2B5MA 2HKRA 1FWXA 3V7DB 4A2LA 2OK6A 2P9NC 3UVKA 5FXYA 3OW8A 4GQ1A 3J80g 1OLZA 5TDHB 3UVOA 2HXCA 3L4MD 2CO0A 1R5MA 3F3GA 4H5JA 4O3TB 5FKRA 4N14A 4A0BA 4FA1D 2H6KA 4FAND 5FLXg 1Q47A 1U4CA 4EWRA 4J84A 4J87A 5GXIA 5EM2B 3F3FA 4E54B 3I7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X61 B;  2I3T A;  4ESG A;  4K3I D;  3VA6 A;  5EAL A;  1GXR A;  3OKY A;  4AEZ A;  3IIW A;  3JB9 L;  3OL2 B;  4JT5 C;  4J0W A;  2Q7Q A;  3FM0 A;  2HJB A;  3V9F A;  1U2V C;  1OMW B;  3I7N A;  4HDJ A;  4CI2 A;  3JZN A;  3EWE A;  4NSX A;  2AH0 A;  5IGO A;  3SLE D;  1S4U X;  3AH8 B;  3SMR A;  4A08 B;  3EI4 B;  2J56 H;  3EU7 A;  3JZH A;  5AJA A;  4CY5 A;  2HJ4 A;  3MKS B;  5I5M A;  2I3S A;  3RMZ D;  4GGC A;  2G9A A;  3FGB A;  3UKR C;  2O9K A;  1JOF A;  4U1E I;  1GOT B;  4CZX A;  5KDO B;  3UVL A;  3PSL A;  5C2W B;  3EMH A;  2IWF A;  3HFQ A;  4A2M A;  2P9L C;  3J81 g;  5TF2 A;  4Y5R D;  3SBP A;  3C5M A;  3MZK A;  4J79 A;  4OWR A;  4IA9 A;  4JXM A;  2EBS A;  3JPX A;  5CYK B;  2P9P C;  5CXC A;  4PSW B;  3SBR A;  4JT6 C;  2HKM A;  4O9D A;  3DSM A;  3W15 A;  3L4O D;  4PC0 A;  5TEE A;  2B4E A;  3SVW D;  5I5I A;  2OVP B;  3OKT A;  3I8E A;  2UZX B;  2H14 A;  4PXW A;  3SXT D;  4FA4 D;  3SBQ A;  4ES0 A;  3I7H A;  2YBA A;  5IJ8 E;  4L3G D;  4A0B B;  4PBY A;  4A11 B;  3I2N A;  1NEX B;  3U4Y A;  2GNQ A;  3RFG A;  4I79 A;  4XEI C;  5EM2 A;  4BUJ C;  3RSE C;  2H6Q A;  3IKO A;  2PBI B;  5GXH A;  5K1C C;  3OKY B;  4FHL A;  3I8C A;  4L3H D;  5FA5 B;  5CXB B;  2G99 A;  4D6V A;  1XKS A;  4GM9 A;  1PI6 A;  5AMS A;  4J86 A;  2GC7 A;  4CI3 A;  4H5I A;  2I0R A;  1JMZ B;  4D0K A;  1K8K C;  4BH6 A;  2AGY A;  4IMM A;  3V5W B;  2AGW A;  3OTT A;  4ERQ A;  4FA5 D;  4X3E A;  4ZOY A;  3RRM C;  3UVM A;  5AFU 3;  3I7P A;  3JAM g;  4OZU A;  4A08 A;  4ZN4 A;  3CFS B;  3KRX B;  2CNX A;  2I0T A;  3RN0 D;  2CE9 A;  4A0A B;  4JSX C;  5JWZ A;  2P9K C;  4A09 A;  5IT9 g;  3EI1 A;  2IAA A;  4GQ2 P;  3IJ0 A;  4JSP C;  1ERJ A;  2AH1 A;  5FKS A;  2CN3 A;  3SN6 B;  3MXX A;  5C9Z B;  5FKT A;  4GQB B;  2AGX A;  3NVQ A;  3ODT A;  3ULE C;  5IC7 A;  3PVW B;  1TBG A;  5EMM B;  3P4F A;  5CYK A;  4ZOZ A;  3RN1 D;  3ZWL B;  4GZ8 A;  5EAR A;  4Z8L A;  2OVR B;  5I5J A;  1NR0 A;  2IUV A;  5GSA A;  4FB1 D;  1N6E A;  3E0C A;  3I7O A;  2IUP A;  1MG3 A;  3JRO A;  5EMJ B;  3SWS D;  4K3J B;  1N6D A;  3AL8 A;  3EI2 A;  2H68 A;  5EML B;  4CC9 A;  4E5Z A;  2XU7 A;  2YMU A;  4QT8 A;  2OK4 A;  4GM3 A;  3C9C A;  4A11 A;  4FWW A;  3PXW D;  5FKQ A;  3DXK C;  3MKQ A;  4O1Q D;  3DWL C;  3C75 H;  3EI3 B;  5HE0 B;  3OKW A;  3I89 A;  4J0X A;  1GG2 B;  2PM9 B;  4CY3 A;  1XIP A;  2J55 H;  4G56 B;  1PBY B;  2H3X A;  2AQ5 A;  3CFV A;  2H47 A;  3DM0 A;  5K19 A;  3SJL D;  5CXB A;  3B7F A;  4TZ4 A;  2Z2P A;  4J78 A;  4XYH A;  2CO0 C;  4J81 A;  5H1M A;  2IUR A;  5C2V B;  1SQ9 A;  4A7J A;  2HES X;  3IIY A;  4LGN A;  1PGU A;  1VYH C;  4UI9 R;  4JSV C;  3NVX A;  2W18 A;  2H9L A;  2TRC B;  4J8G A;  4QQE A;  5B4W A;  4CY2 A;  4R7A B;  5IGQ A;  3SHF A;  2B5L A;  2P9I C;  1PEV A;  4A0A A;  4FAV D;  4A09 B;  3DXM C;  4PSX B;  3SFZ A;  2J57 G;  2CN2 A;  4GMB A;  3EI1 B;  1MG2 A;  2AGL A;  3NVN A;  4GGD A;  4KFM B;  4Y7R A;  3SCY A;  1MDA H;  5HQG A;  2XYI A;  4L1Q D;  5SXM A;  4LG8 A;  4GM8 A;  1TYQ C;  4YVD A;  4J73 A;  5H14 A;  4J8B A;  5EAM A;  2H9N A;  5H17 A;  3RFH A;  1SQJ A;  1A0R B;  3PSC B;  2H13 A;  5TEF A;  4CZV A;  3PE7 A;  3GFC A;  2OJY A;  1B9X A;  1P22 A;  3AL9 A;  3JZG A;  2QXV A;  3N0E A;  3UVN A;  3BG1 A;  3UR4 A;  4O3U B;  4ERZ A;  3BWS A;  2OIZ A;  3GRE A;  3ORV D;  1N6F A;  3AL8 B;  2H6N A;  4CZY A;  2MTA H;  3EI2 B;  4CI1 A;  3VH0 A;  2UZY B;  5THA A;  2YNO A;  4X63 B;  4E5Z B;  2YNP A;  3VGZ A;  4JSN C;  3N0D A;  3C99 A;  2GC4 A;  2BCJ B;  2PM7 B;  2Z2O A;  3K27 A;  5FQD A;  2QC5 A;  2I0S A;  2YNN A;  3EI3 A;  4X60 B;  4MK0 B;  4E54 A;  1JJU B;  2PM9 A;  3F3P A;  3UKU C;  1L0Q A;  4CI8 A;  5HE2 B;  3PXT D;  4QL1 A;  3BG0 A;  5EMK B;  3OL2 A;  3MMY A;  1YFQ A;  4ZOV A;  4U7A A;  4ZOX A;  4J82 A;  5GMK n;  4CY1 A;  3CIK B;  3MZL A;  2YB8 B;  2IUQ A;  2H9P A;  5HE3 B;  5EAP A;  1SHY B;  4ERY A;  2OVQ B;  4L9O A;  3RLM D;  4O45 A;  4BL0 A;  3A0F A;  1K32 A;  1QNI A;  3K26 A;  4J77 A;  1XHM A;  3EI4 A;  2B5N A;  5HE1 B;  3JRP A;  1RI6 A;  3EG6 A;  3KRW B;  2XL2 A;  4GGA A;  3PVU B;  2H9M A;  4PNK B;  1B9Y A;  1JMX B;  2P9U C;  4JD2 C;  2P9S C;  4LG9 A;  2PM6 B;  4PBZ A;  2BBK H;  4QRJ A;  4AOW A;  5A2Q g;  5HYN B;  2XL3 A;  2HYE A;  1GP2 B;  3IJ1 A;  3AFC A;  3IJC A;  3PXS D;  5IJ7 E;  2CE8 A;  3I7K A;  2AGZ A;  4FA9 D;  2IWK A;  4XYI A;  3FRX A;  5CXC B;  2Z2N A;  2B5M A;  2HKR A;  1FWX A;  3V7D B;  4A2L A;  2OK6 A;  2P9N C;  3UVK A;  5FXY A;  3OW8 A;  4GQ1 A;  3J80 g;  1OLZ A;  5TDH B;  3UVO A;  2HXC A;  3L4M D;  2CO0 A;  1R5M A;  3F3G A;  4H5J A;  4O3T B;  5FKR A;  4N14 A;  4A0B A;  4FA1 D;  2H6K A;  4FAN D;  5FLX g;  1Q47 A;  1U4C A;  4EWR A;  4J84 A;  4J87 A;  5GXI A;  5EM2 B;  3F3F A;  4E54 B;  3I7L A; 
#chains in the Genus database with same CATH topology
 3ZE0 A;  1VE6 A;  4X61 B;  5E6U A;  2I3T A;  4ESG A;  3IJE A;  4K3I D;  1C9I A;  3VA6 A;  5EAL A;  1GXR A;  3OKY A;  4AEZ A;  3IIW A;  3JB9 L;  3OL2 B;  4JT5 C;  4AN1 A;  4J0W A;  2Q7Q A;  3FM0 A;  2WQ8 A;  3ZDZ A;  2HJB A;  3V9F A;  1U2V C;  1OMW B;  3I7N A;  5M5U A;  4HDJ A;  4CI2 A;  3JZN A;  3EWE A;  3NIG A;  4NSX A;  2AH0 A;  4G1M A;  5IGO A;  3SLE D;  1S4U X;  1E5T A;  4WK0 A;  3AH8 B;  3SMR A;  4BCC A;  3EI4 B;  4UM8 A;  4A08 B;  2J56 H;  3EU7 A;  3JZH A;  5AJA A;  1UOP A;  4CY5 A;  2HJ4 A;  3MKS B;  3IUR A;  5I5M A;  2VDK A;  3QI0 A;  2I3S A;  3RMZ D;  4GGC A;  4O02 A;  2G9A A;  3FGB A;  3K6S A;  1GOF A;  3UKR C;  4DNV A;  2O9K A;  1JOF A;  4NBM A;  4U1E I;  1GOT B;  2QR5 A;  4CZX A;  5KDO B;  3UVL A;  1M1X A;  3PSL A;  5C2W B;  3EMH A;  1T2X A;  2IWF A;  3HFQ A;  4A2M A;  1O6F A;  2P9L C;  3J81 g;  5TF2 A;  4Y5R D;  3SBP A;  5FFG A;  3C5M A;  4Z7O A;  3MZK A;  4J79 A;  4OWR A;  4IA9 A;  4JXM A;  2EBS A;  3EQ8 A;  3JPX A;  5CYK B;  2P9P C;  2VDN A;  5CXC A;  1E8N A;  4PSW B;  3SBR A;  4JT6 C;  2HKM A;  4O9D A;  3DSM A;  3W15 A;  3L4O D;  4PC0 A;  5TEE A;  1UTC A;  2B4E A;  3SVW D;  5I5I A;  2OVP B;  3OKT A;  3I8E A;  3K71 A;  2UZX B;  5M5S A;  2H14 A;  4PXW A;  3SXT D;  4FA4 D;  3SBQ A;  4O2W A;  4ES0 A;  3I7H A;  2YBA A;  5IJ8 E;  4L3G D;  4A0B B;  4PBY A;  4A11 B;  3I2N A;  1NEX B;  3U4Y A;  2GNQ A;  3RFG A;  4NEN A;  3VI3 A;  4I79 A;  4XEI C;  3IUJ A;  5EM2 A;  4BUJ C;  3RSE C;  1K3I A;  2H6Q A;  2EIB A;  2PBI B;  3IKO A;  5HDB A;  5GXH A;  4WJK A;  5K1C C;  3OKY B;  4FHL A;  3I8C A;  4L3H D;  4RE6 A;  5FA5 B;  1GOG A;  5CXB B;  2G99 A;  4D6V A;  1XKS A;  4GM9 A;  1PI6 A;  5AMS A;  4J86 A;  2GC7 A;  4CI3 A;  4H5I A;  2I0R A;  1JMZ B;  4D0K A;  1K8K C;  4BH6 A;  2AGY A;  4IMM A;  3V5W B;  2AGW A;  3OTT A;  4ERQ A;  4FA5 D;  4Z7N A;  4X3E A;  4ZOY A;  3RRM C;  3UVM A;  5AFU 3;  1L5G A;  3I7P A;  3JAM g;  4OZU A;  4A08 A;  4ZN4 A;  3CFS B;  3KRX B;  2CNX A;  2I0T A;  3EQ7 A;  2HU5 A;  3RN0 D;  4Z7Q A;  5M61 A;  2CE9 A;  2XE4 A;  4JSX C;  5JWZ A;  4A0A B;  4NC4 A;  2P9K C;  4A09 A;  2VDL A;  5IT9 g;  2VZ3 A;  3EI1 A;  2IAA A;  4GQ2 P;  1BPO A;  2QZP A;  3IJ0 A;  4JSP C;  1ERJ A;  2AH1 A;  5FKS A;  2CN3 A;  3SN6 B;  3MXX A;  5C9Z B;  5FKT A;  4GQB B;  2AGX A;  3NVQ A;  3IUM A;  3ODT A;  4AX4 A;  3ULE C;  5IC7 A;  2XDW A;  2VDO A;  3PVW B;  2VZ1 A;  5M5V A;  1TBG A;  5EMM B;  3FCU A;  3P4F A;  5CYK A;  4ZOZ A;  3ZDY A;  3RN1 D;  3ZWL B;  1JTD B;  4BP9 A;  4GZ8 A;  5EAR A;  4Z8L A;  2OVR B;  3K72 A;  1QFS A;  5I5J A;  1NR0 A;  2IUV A;  4G55 A;  1H2W A;  4AN0 A;  4FB1 D;  5GSA A;  1N6E A;  1VZ2 A;  3E0C A;  5FFO A;  1VE7 A;  3I7O A;  2IUP A;  4BCB A;  1MG3 A;  4G1E A;  3JRO A;  3O4J A;  5EMJ B;  2VDP A;  3SWS D;  4K3J B;  1N6D A;  3AL8 A;  3EI2 A;  2H68 A;  5EML B;  2JKX A;  3IUQ A;  4CC9 A;  4E5Z A;  2XU7 A;  3MVD K;  2YMU A;  4QT8 A;  2EID A;  2OK4 A;  4GM3 A;  3C9C A;  4A11 A;  4FWW A;  3PXW D;  5FKQ A;  3DXK C;  3MKQ A;  4O1Q D;  3DWL C;  2VDR A;  3C75 H;  3EI3 B;  3OF7 A;  5HE0 B;  3OKW A;  3I89 A;  1GG2 B;  2PM9 B;  4J0X A;  3GD1 I;  4CY3 A;  3O4G A;  1XIP A;  2J55 H;  4G56 B;  1PBY B;  2H3X A;  2AQ5 A;  3NIF A;  3CFV A;  3V4V A;  1I2M B;  2H47 A;  3DM0 A;  5K19 A;  3SJL D;  2EIE A;  5CXB A;  3B7F A;  4QAM A;  4TZ4 A;  2Z2P A;  4J78 A;  4XYH A;  2CO0 C;  4J81 A;  1A12 A;  2XZG A;  5H1M A;  2IUR A;  5C2V B;  1SQ9 A;  4A7J A;  2HES X;  3QHY B;  3IIY A;  4LGN A;  1PGU A;  1VYH C;  4UI9 R;  4JSV C;  3NVX A;  1VZ3 A;  2W18 A;  3FCS A;  2H9L A;  2TRC B;  2VDM A;  4J8G A;  4QQE A;  5B4W A;  4AMZ A;  1C9L A;  4CY2 A;  4R7A B;  1GOH A;  4DNU A;  4WK2 A;  5IGQ A;  4MMY A;  4WK4 A;  3SHF A;  5M5T A;  2B5L A;  2P9I C;  1PEV A;  4A0A A;  3VI4 A;  4FAV D;  4A09 B;  3DXM C;  4PSX B;  3SFZ A;  2J57 G;  2CN2 A;  4GMB A;  4JHP C;  3EI1 B;  1MG2 A;  2AGL A;  2VDQ A;  3NVN A;  4GGD A;  4KFM B;  4Y7R A;  2HU7 A;  3SCY A;  1MDA H;  5HQG A;  2XYI A;  4L1Q D;  5SXM A;  4LG8 A;  4GM8 A;  1H2Y A;  1TYQ C;  4YVD A;  1U8C A;  4J73 A;  5H14 A;  4J8B A;  5EAM A;  2H9N A;  5H17 A;  3RFH A;  1SQJ A;  1A0R B;  3PSC B;  2H13 A;  5TEF A;  4CZV A;  3PE7 A;  3GFC A;  2BKL A;  2OJY A;  1B9X A;  1P22 A;  3AL9 A;  3JZG A;  2QXV A;  3N0E A;  4MMZ A;  3UVN A;  3BG1 A;  3UR4 A;  4O3U B;  4ERZ A;  1JV2 A;  3BWS A;  1UOQ A;  2OIZ A;  3GRE A;  3ORV D;  1N6F A;  3AL8 B;  2H6N A;  4CZY A;  1O6G A;  2MTA H;  3EI2 B;  4CI1 A;  3VH0 A;  2UZY B;  3EQ9 A;  5THA A;  2YNO A;  4X63 B;  4E5Z B;  3IUL A;  2YNP A;  3VGZ A;  4JSN C;  3N0D A;  4NAA A;  3C99 A;  2GC4 A;  2BCJ B;  2PM7 B;  2Z2O A;  3K27 A;  3T3M A;  5FQD A;  2QC5 A;  2I0S A;  2YNN A;  3EI3 A;  4X60 B;  4MK0 B;  4BCD A;  4E54 A;  4UM9 A;  4AMY A;  3O4H A;  1JJU B;  2PM9 A;  2EIC A;  3F3P A;  2VC2 A;  3MUN A;  3ZE2 A;  3UKU C;  1L0Q A;  4CI8 A;  5HE2 B;  3PXT D;  4QL1 A;  3BG0 A;  4RE5 A;  5EMK B;  3OL2 A;  1YR2 A;  4BP8 A;  3MMY A;  1YFQ A;  4ZOV A;  4U7A A;  4ZOX A;  4J82 A;  5GMK n;  3IVM A;  4CY1 A;  3CIK B;  3MZL A;  2YB8 B;  2IUQ A;  4DNW A;  2H9P A;  5HE3 B;  4IRZ A;  1SHY B;  5EAP A;  4ERY A;  2OVQ B;  4L9O A;  3RLM D;  3ZE1 A;  4O45 A;  4BL0 A;  3A0F A;  1K32 A;  3KCI A;  1QNI A;  3K26 A;  4J77 A;  1XHM A;  3EI4 A;  2B5N A;  5HE1 B;  3JRP A;  4L1M A;  1RI6 A;  4D9S A;  3EG6 A;  3KRW B;  2XL2 A;  4GGA A;  3PVU B;  2H9M A;  4PNK B;  1B9Y A;  1JMX B;  2P9U C;  4JD2 C;  2P9S C;  4LG9 A;  1E8M A;  2PM6 B;  4PBZ A;  2BBK H;  5C86 A;  4QRJ A;  4AOW A;  5A2Q g;  5HYN B;  2XL3 A;  2HYE A;  1GP2 B;  3GC3 B;  3IJ1 A;  3AFC A;  3IJC A;  4MMX A;  5C92 A;  3PXS D;  5IJ7 E;  2CE8 A;  3I7K A;  2AGZ A;  3V4P A;  4FA9 D;  3IUN A;  2IWK A;  4XYI A;  3FRX A;  5CXC B;  2Z2N A;  1H2X A;  2B5M A;  2HKR A;  1FWX A;  5E6S A;  3V7D B;  1H2Z A;  3T3P A;  4A2L A;  2OK6 A;  2P9N C;  3UVK A;  1TYE A;  5FXY A;  3OW8 A;  3NID A;  3O4I A;  4GQ1 A;  3J80 g;  1OLZ A;  2HU8 A;  5TDH B;  3UVO A;  2HXC A;  3L4M D;  2CO0 A;  1R5M A;  3F3G A;  4H5J A;  4O3T B;  1QFM A;  5FKR A;  5E6R A;  4N14 A;  3ZDX A;  4A0B A;  4FA1 D;  2H6K A;  4FAN D;  5FLX g;  1Q47 A;  1U4C A;  5M5R A;  4EWR A;  4J84 A;  4JHN A;  3DDU A;  4J87 A;  5GXI A;  5EM2 B;  3F3F A;  4E54 B;  3I7L A;  3MUO A;  1UOO A; 
#chains in the Genus database with same CATH homology
 4X61 B;  2I3T A;  4ESG A;  4K3I D;  3VA6 A;  5EAL A;  1GXR A;  3OKY A;  4AEZ A;  3IIW A;  3JB9 L;  3OL2 B;  4JT5 C;  4J0W A;  2Q7Q A;  3FM0 A;  2HJB A;  3V9F A;  1U2V C;  1OMW B;  3I7N A;  4HDJ A;  4CI2 A;  3JZN A;  3EWE A;  4NSX A;  2AH0 A;  5IGO A;  3SLE D;  1S4U X;  3AH8 B;  3SMR A;  4A08 B;  3EI4 B;  2J56 H;  3EU7 A;  3JZH A;  5AJA A;  4CY5 A;  2HJ4 A;  3MKS B;  5I5M A;  2I3S A;  3RMZ D;  4GGC A;  2G9A A;  3FGB A;  3UKR C;  2O9K A;  1JOF A;  4U1E I;  1GOT B;  4CZX A;  5KDO B;  3UVL A;  3PSL A;  5C2W B;  3EMH A;  2IWF A;  3HFQ A;  4A2M A;  2P9L C;  3J81 g;  5TF2 A;  4Y5R D;  3SBP A;  3C5M A;  3MZK A;  4J79 A;  4OWR A;  4IA9 A;  4JXM A;  2EBS A;  3JPX A;  5CYK B;  2P9P C;  5CXC A;  4PSW B;  3SBR A;  4JT6 C;  2HKM A;  4O9D A;  3DSM A;  3W15 A;  3L4O D;  4PC0 A;  5TEE A;  2B4E A;  3SVW D;  5I5I A;  2OVP B;  3OKT A;  3I8E A;  2UZX B;  2H14 A;  4PXW A;  3SXT D;  4FA4 D;  3SBQ A;  4ES0 A;  3I7H A;  2YBA A;  5IJ8 E;  4L3G D;  4A0B B;  4PBY A;  4A11 B;  3I2N A;  1NEX B;  3U4Y A;  2GNQ A;  3RFG A;  4I79 A;  4XEI C;  5EM2 A;  4BUJ C;  3RSE C;  2H6Q A;  3IKO A;  2PBI B;  5GXH A;  5K1C C;  3OKY B;  4FHL A;  3I8C A;  4L3H D;  5FA5 B;  5CXB B;  2G99 A;  4D6V A;  1XKS A;  4GM9 A;  1PI6 A;  5AMS A;  4J86 A;  2GC7 A;  4CI3 A;  4H5I A;  2I0R A;  1JMZ B;  4D0K A;  1K8K C;  4BH6 A;  2AGY A;  4IMM A;  3V5W B;  2AGW A;  3OTT A;  4ERQ A;  4FA5 D;  4X3E A;  4ZOY A;  3RRM C;  3UVM A;  5AFU 3;  3I7P A;  3JAM g;  4OZU A;  4A08 A;  4ZN4 A;  3CFS B;  3KRX B;  2CNX A;  2I0T A;  3RN0 D;  2CE9 A;  4A0A B;  4JSX C;  5JWZ A;  2P9K C;  4A09 A;  5IT9 g;  3EI1 A;  2IAA A;  4GQ2 P;  3IJ0 A;  4JSP C;  1ERJ A;  2AH1 A;  5FKS A;  2CN3 A;  3SN6 B;  3MXX A;  5C9Z B;  5FKT A;  4GQB B;  2AGX A;  3NVQ A;  3ODT A;  3ULE C;  5IC7 A;  3PVW B;  1TBG A;  5EMM B;  3P4F A;  5CYK A;  4ZOZ A;  3RN1 D;  3ZWL B;  4GZ8 A;  5EAR A;  4Z8L A;  2OVR B;  5I5J A;  1NR0 A;  2IUV A;  5GSA A;  4FB1 D;  1N6E A;  3E0C A;  3I7O A;  2IUP A;  1MG3 A;  3JRO A;  5EMJ B;  3SWS D;  4K3J B;  1N6D A;  3AL8 A;  3EI2 A;  2H68 A;  5EML B;  4CC9 A;  4E5Z A;  2XU7 A;  2YMU A;  4QT8 A;  2OK4 A;  4GM3 A;  3C9C A;  4A11 A;  4FWW A;  3PXW D;  5FKQ A;  3DXK C;  3MKQ A;  4O1Q D;  3DWL C;  3C75 H;  3EI3 B;  5HE0 B;  3OKW A;  3I89 A;  4J0X A;  1GG2 B;  2PM9 B;  4CY3 A;  1XIP A;  2J55 H;  4G56 B;  1PBY B;  2H3X A;  2AQ5 A;  3CFV A;  2H47 A;  3DM0 A;  5K19 A;  3SJL D;  5CXB A;  3B7F A;  4TZ4 A;  2Z2P A;  4J78 A;  4XYH A;  2CO0 C;  4J81 A;  5H1M A;  2IUR A;  5C2V B;  1SQ9 A;  4A7J A;  2HES X;  3IIY A;  4LGN A;  1PGU A;  1VYH C;  4UI9 R;  4JSV C;  3NVX A;  2W18 A;  2H9L A;  2TRC B;  4J8G A;  4QQE A;  5B4W A;  4CY2 A;  4R7A B;  5IGQ A;  3SHF A;  2B5L A;  2P9I C;  1PEV A;  4A0A A;  4FAV D;  4A09 B;  3DXM C;  4PSX B;  3SFZ A;  2J57 G;  2CN2 A;  4GMB A;  3EI1 B;  1MG2 A;  2AGL A;  3NVN A;  4GGD A;  4KFM B;  4Y7R A;  3SCY A;  1MDA H;  5HQG A;  2XYI A;  4L1Q D;  5SXM A;  4LG8 A;  4GM8 A;  1TYQ C;  4YVD A;  4J73 A;  5H14 A;  4J8B A;  5EAM A;  2H9N A;  5H17 A;  3RFH A;  1SQJ A;  1A0R B;  3PSC B;  2H13 A;  5TEF A;  4CZV A;  3PE7 A;  3GFC A;  2OJY A;  1B9X A;  1P22 A;  3AL9 A;  3JZG A;  2QXV A;  3N0E A;  3UVN A;  3BG1 A;  3UR4 A;  4O3U B;  4ERZ A;  3BWS A;  2OIZ A;  3GRE A;  3ORV D;  1N6F A;  3AL8 B;  2H6N A;  4CZY A;  2MTA H;  3EI2 B;  4CI1 A;  3VH0 A;  2UZY B;  5THA A;  2YNO A;  4X63 B;  4E5Z B;  2YNP A;  3VGZ A;  4JSN C;  3N0D A;  3C99 A;  2GC4 A;  2BCJ B;  2PM7 B;  2Z2O A;  3K27 A;  5FQD A;  2QC5 A;  2I0S A;  2YNN A;  3EI3 A;  4X60 B;  4MK0 B;  4E54 A;  1JJU B;  2PM9 A;  3F3P A;  3UKU C;  1L0Q A;  4CI8 A;  5HE2 B;  3PXT D;  4QL1 A;  3BG0 A;  5EMK B;  3OL2 A;  3MMY A;  1YFQ A;  4ZOV A;  4U7A A;  4ZOX A;  4J82 A;  5GMK n;  4CY1 A;  3CIK B;  3MZL A;  2YB8 B;  2IUQ A;  2H9P A;  5HE3 B;  5EAP A;  1SHY B;  4ERY A;  2OVQ B;  4L9O A;  3RLM D;  4O45 A;  4BL0 A;  3A0F A;  1K32 A;  1QNI A;  3K26 A;  4J77 A;  1XHM A;  3EI4 A;  2B5N A;  5HE1 B;  3JRP A;  1RI6 A;  3EG6 A;  3KRW B;  2XL2 A;  4GGA A;  3PVU B;  2H9M A;  4PNK B;  1B9Y A;  1JMX B;  2P9U C;  4JD2 C;  2P9S C;  4LG9 A;  2PM6 B;  4PBZ A;  2BBK H;  4QRJ A;  4AOW A;  5A2Q g;  5HYN B;  2XL3 A;  2HYE A;  1GP2 B;  3IJ1 A;  3AFC A;  3IJC A;  3PXS D;  5IJ7 E;  2CE8 A;  3I7K A;  2AGZ A;  4FA9 D;  2IWK A;  4XYI A;  3FRX A;  5CXC B;  2Z2N A;  2B5M A;  2HKR A;  1FWX A;  3V7D B;  4A2L A;  2OK6 A;  2P9N C;  3UVK A;  5FXY A;  3OW8 A;  4GQ1 A;  3J80 g;  1OLZ A;  5TDH B;  3UVO A;  2HXC A;  3L4M D;  2CO0 A;  1R5M A;  3F3G A;  4H5J A;  4O3T B;  5FKR A;  4N14 A;  4A0B A;  4FA1 D;  2H6K A;  4FAN D;  5FLX g;  1Q47 A;  1U4C A;  4EWR A;  4J84 A;  4J87 A;  5GXI A;  5EM2 B;  3F3F A;  4E54 B;  3I7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...