1MG3A

Mutation of alpha phe55 of methylamine dehydrogenase alters the reorganization energy and electronic coupling for its electron transfer reaction with amicyanin
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
382
structure length
382
Chain Sequence
EAETQAQETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHAAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Methylamine dehydrogenase, heavy chain
publication title MUTATION OF ALPHA PHE55 OF METHYLAMINE DEHYDROGENASE ALTERS THE REORGANIZATION ENERGY AND ELECTRONIC COUPLING FOR ITS ELECTRON TRANSFER REACTION WITH AMICYANIN
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 93
structure length 382
sequence length 382
chains with identical sequence E, I, M
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2002-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1mg3A00
4A09B 4XEIC 4A08B 4LGNA 5H17A 1XHMA 4K3JB 2CNXA 3F3PA 2CN3A 5SXMA 2AH0A 3UVOA 2CE9A 3RMZD 3I7HA 4GGCA 1PI6A 1FWXA 2HYEA 4JD2C 1PBYB 4ERQA 2H9NA 5TEEA 2G9AA 4A7JA 3DSMA 4PNKB 4OZUA 3NVNA 2AGLA 5FQDA 4HDJA 3PVWB 4CY1A 3EI3A 4QL1A 4J0WA 4J8GA 5TEFA 2I3TA 2H47A 2IUVA 3JROA 3HFQA 4LG9A 3DXKC 3I2NA 3IIWA 5C9ZB 1PGUA 2GNQA 1R5MA 3OL2A 4J87A 4PBYA 5GSAA 2H14A 2O9KA 3OW8A 5K1CC 4BUJC 4JSVC 3RN1D 5THAA 1QNIA 4ZOVA 4L1QD 3ODTA 5I5MA 4Z8LA 3EI2A 2Z2PA 4U7AA 4G56B 2HKRA 1B9XA 2OVRB 3V7DB 4BH6A 1NEXB 3I8CA 5IGQA 2HXCA 4JXMA 2OVPB 4JSXC 4CZYA 2MTAH 2HJ4A 3GFCA 1A0RB 2J57G 2IUPA 1MG3A 1K8KC 3OKWA 3DXMC 2IWKA 2YB8B 3AH8B 4FA1D 4UI9R 3ULEC 5CYKA 1OMWB 4BL0A 5EMJB 4J79A 5EAPA 4AOWA 4ZOYA 1JOFA 1MDAH 4GMBA 3PXSD 3SBPA 5H1MA 1PEVA 3V5WB 3EMHA 3IKOA 4GQ2P 2CO0A 4PXWA 4J78A 4TZ4A 4QT8A 3FM0A 4ESGA 5GMKn 4JT6C 4QRJA 3CFVA 4ES0A 4CY5A 2PM6B 4CY2A 1JJUB 3C75H 3SN6B 3FRXA 4KFMB 4E54B 3JAMg 1XIPA 2AH1A 1GOTB 2HJBA 2OJYA 3EI4A 5AJAA 2H6KA 5EALA 4LG8A 2I3SA 3NVXA 2UZYB 4CZVA 3BG0A 3IIYA 4J0XA 4FA5D 2Z2OA 3RRMC 2P9NC 2BCJB 2AGYA 1YFQA 3PVUB 3UKUC 3VA6A 1NR0A 3I8EA 1ERJA 2B5NA 4QQEA 5HQGA 2H6QA 4CY3A 2H9LA 3DWLC 5HE2B 2IAAA 5HE0B 3SWSD 3IJ0A 2PM7B 3SMRA 4FHLA 4ERZA 4A2MA 4ZN4A 4I79A 3SLED 3PXWD 2IUQA 3BG1A 2B5MA 2I0SA 3EI3B 3I7OA 5FKRA 3L4OD 4GM9A 2J55H 3K27A 5KDOB 2QXVA 4H5JA 2YBAA 4L9OA 4N14A 4A11A 3I7NA 4H5IA 3EG6A 3OL2B 4PSWB 4XYIA 2G99A 3IJ1A 3MZKA 3AL9A 4PBZA 5HE3B 4A0AA 4X60B 3MMYA 4GM8A 2H3XA 2H9MA 3VGZA 2OVQB 4IA9A 3EI2B 3E0CA 2I0RA 4FWWA 5JWZA 3U4YA 3AL8A 4GGAA 2XYIA 2CO0C 3PSLA 3UVMA 4A0BA 5FKQA 4GQ1A 4PSXB 5IC7A 3I7KA 3KRXB 2AGZA 2AQ5A 4J73A 3SBRA 3C5MA 2XL3A 4OWRA 1JMXB 4O9DA 2B4EA 4O3TB 3JPXA 3RFGA 3CFSB 2XU7A 2YNOA 2IWFA 4IMMA 4JSNC 3SBQA 4EWRA 5EARA 5B4WA 5I5IA 3MZLA 3I89A 3NVQA 5EAMA 4ZOXA 5FA5B 3GREA 3JZGA 3OKYA 3K26A 5IJ8E 3BWSA 1N6FA 5CYKB 5TDHB 3B7FA 1GG2B 3SXTD 3JB9L 2P9KC 1N6DA 3OKYB 5A2Qg 4FB1D 2H13A 3UVNA 2P9PC 4J81A 3FGBA 4E5ZA 2AGWA 2CN2A 4O45A 1U2VC 3RN0D 2AGXA 3AFCA 4E5ZB 2PM9A 2GC7A 5HYNB 3F3GA 2HESX 5CXBA 3SCYA 2PBIB 4MK0B 4GGDA 5EMMB 1RI6A 4O1QD 4A09A 4A08A 4ZOZA 2P9IC 3MKSB 3I7PA 4CI1A 5HE1B 3EI4B 5FXYA 5I5JA 4K3ID 3PXTD 4ERYA 4YVDA 5AMSA 2J56H 5GXIA 4J8BA 2YNNA 3VH0A 2B5LA 1N6EA 2P9SC 4D6VA 1P22A 2BBKH 4FAVD 5AFU3 3EU7A 3OKTA 4A2LA 3V9FA 3MKQA 4JSPC 4NSXA 4J84A 3SHFA 2IURA 2P9LC 4CZXA 5IJ7E 2CE8A 5EM2A 5FKTA 4CC9A 1TBGA 5IGOA 4X3EA 2H68A 1SQJA 3I7LA 1JMZB 3MXXA 1GXRA 2Z2NA 5EM2B 3EWEA 2H6NA 3IJCA 2GC4A 2Q7QA 5H14A 4FAND 3KRWB 1SQ9A 4JT5C 3JZHA 4X61B 3ZWLB 1MG2A 1TYQC 2HKMA 3W15A 4AEZA 5K19A 3J80g 3RLMD 4A11B 2XL2A 5EMLB 5C2VB 4FA4D 2H9PA 2OK4A 5FLXg 4A0AB 1VYHC 5C2WB 3PE7A 4J82A 1S4UX 2EBSA 2OIZA 1L0QA 3C9CA 4U1EI 1GP2B 3RSEC 3PSCB 3AL8B 3N0DA 3OTTA 1Q47A 3L4MD 4A0BB 2P9UC 4L3HD 3JZNA 5IT9g 3RFHA 5TF2A 3SVWD 1U4CA 3C99A 3UVLA 4R7AB 3UVKA 3SFZA 3DM0A 2TRCB 4GQBB 3EI1A 1OLZA 3ORVD 4CI8A 4CI2A 4FA9D 4O3UB 2OK6A 3EI1B 4XYHA 1SHYB 5EMKB 2QC5A 4CI3A 4Y5RD 3CIKB 4D0KA 5FKSA 2W18A 4Y7RA 2YNPA 4GZ8A 4PC0A 3UKRC 3SJLD 2UZXB 3JRPA 3N0EA 4X63B 3J81g 3UR4A 4J77A 1B9YA 3F3FA 3P4FA 3A0FA 5CXCA 5GXHA 4L3GD 2PM9B 1XKSA 2YMUA 4E54A 5CXBB 2I0TA 4GM3A 1K32A 4J86A 5CXCB
chains in the Genus database with same CATH superfamily
4A09B 4XEIC 4A08B 4LGNA 5H17A 1XHMA 4K3JB 2CNXA 3F3PA 2HU5A 2CN3A 5SXMA 3MVDK 2AH0A 3UVOA 2CE9A 3RMZD 1YR2A 2VDRA 3I7HA 4GGCA 1PI6A 4NENA 1FWXA 2HYEA 4JD2C 1PBYB 4QAMA 4ERQA 2H9NA 5TEEA 2G9AA 4A7JA 3DSMA 4WK0A 5E6SA 2XDWA 1GOFA 4PNKB 3ZDZA 2VDMA 4OZUA 3NVNA 2AGLA 5FQDA 4HDJA 3PVWB 4CY1A 2VZ3A 3EI3A 4QL1A 4J0WA 4J8GA 5TEFA 2I3TA 1U8CA 2H47A 2IUVA 3JROA 3HFQA 4LG9A 3DXKC 1TYEA 3I2NA 3IIWA 3FCSA 5C9ZB 1PGUA 2VDNA 2GNQA 3DDUA 1R5MA 1H2XA 3O4GA 3O4HA 3OL2A 4J87A 4PBYA 5GSAA 1O6FA 2H14A 2O9KA 3OW8A 2EIEA 5K1CC 4BUJC 4JSVC 3RN1D 5M5VA 5THAA 1QNIA 2HU7A 4ZOVA 4L1QD 5E6UA 3ODTA 5I5MA 4Z8LA 3EI2A 2Z2PA 4U7AA 4G56B 1UOOA 5FFOA 4Z7OA 2HKRA 1B9XA 1VZ3A 2OVRB 3V7DB 4BH6A 1NEXB 3I8CA 5IGQA 2HXCA 4JXMA 2OVPB 3GC3B 4JSXC 4CZYA 2MTAH 2HJ4A 3GFCA 1A0RB 2J57G 2VZ1A 1H2WA 2IUPA 3NIFA 1K8KC 1MG3A 3OKWA 1C9LA 3DXMC 2IWKA 2XE4A 3NIDA 2YB8B 3AH8B 3T3PA 4FA1D 4UI9R 4BP9A 3ULEC 4JHPC 5C92A 5CYKA 1OMWB 4BL0A 1BPOA 5EMJB 4J79A 5EAPA 4AOWA 4DNVA 4ZOYA 1JOFA 1MDAH 4GMBA 3PXSD 5E6RA 3SBPA 5H1MA 1PEVA 1QFMA 4MMYA 3V5WB 2JKXA 4BCCA 1UOPA 4O2WA 3EMHA 4L1MA 1T2XA 2VDLA 3IKOA 4GQ2P 2CO0A 4PXWA 4BCBA 2HU8A 4J78A 4TZ4A 1UOQA 2EIDA 4QT8A 3FM0A 4ESGA 5GMKn 4JT6C 1O6GA 4QRJA 3CFVA 4ES0A 4NBMA 4CY5A 2PM6B 4CY2A 1JJUB 3C75H 3SN6B 4O02A 3FRXA 4KFMB 3V4VA 4E54B 3JAMg 1XIPA 2AH1A 1GOTB 2HJBA 2OJYA 3EI4A 5AJAA 2H6KA 5EALA 4LG8A 1I2MB 2I3SA 3NVXA 4IRZA 2UZYB 4CZVA 1QFSA 3BG0A 3IIYA 4J0XA 4FA5D 3ZE0A 2Z2OA 3IUJA 3RRMC 2P9NC 5M61A 2BCJB 2AGYA 4AX4A 1E8MA 1YFQA 3NIGA 3PVUB 4AMYA 3UKUC 3VA6A 1NR0A 3I8EA 1ERJA 1C9IA 2B5NA 4QQEA 5HQGA 2H6QA 4CY3A 2H9LA 4G1MA 3DWLC 5HE2B 2IAAA 5HE0B 3SWSD 3IJ0A 2PM7B 2VC2A 4FHLA 3SMRA 4ERZA 4BCDA 4A2MA 3T3MA 4ZN4A 4I79A 3SLED 3PXWD 2IUQA 3ZE2A 3BG1A 2B5MA 2I0SA 3EI3B 3I7OA 5FKRA 3L4OD 1M1XA 4GM9A 2J55H 1JV2A 3K27A 3IULA 5KDOB 2QXVA 4H5JA 2YBAA 4L9OA 4N14A 4UM8A 4A11A 3I7NA 4H5IA 3EG6A 3V4PA 3OL2B 4PSWB 4XYIA 2G99A 3IJ1A 3MZKA 3AL9A 4PBZA 5HE3B 4A0AA 3VI4A 3VI3A 4X60B 3MMYA 4GM8A 2H3XA 3K72A 2H9MA 3VGZA 2OVQB 5M5SA 4IA9A 3EI2B 3E0CA 4D9SA 2I0RA 4FWWA 5JWZA 3U4YA 3AL8A 4GGAA 2XYIA 3KCIA 2CO0C 3PSLA 3UVMA 4A0BA 5FKQA 4GQ1A 4PSXB 3K6SA 5IC7A 3IURA 3I7KA 3KRXB 1JTDB 2AGZA 2AQ5A 4J73A 3SBRA 3C5MA 2XL3A 4OWRA 1JMXB 4O9DA 3ZDXA 2B4EA 2VDQA 4O3TB 3JPXA 3RFGA 3CFSB 2XU7A 2YNOA 2IWFA 3OF7A 4IMMA 4JSNC 4MMZA 4WK4A 3SBQA 4EWRA 5EARA 4DNUA 2QZPA 5B4WA 5I5IA 3MZLA 3I89A 3NVQA 4AN0A 4DNWA 5EAMA 4ZOXA 3O4JA 5HDBA 5FA5B 3GREA 3JZGA 3OKYA 3K26A 5IJ8E 3BWSA 1N6FA 3IUQA 5CYKB 5TDHB 3B7FA 1GG2B 3SXTD 3JB9L 2P9KC 1N6DA 3OKYB 2VDKA 4JHNA 3EQ8A 5A2Qg 4FB1D 2H13A 3UVNA 3QHYB 4Z7NA 2P9PC 4J81A 3FGBA 4E5ZA 2AGWA 2CN2A 4O45A 1E5TA 1U2VC 3RN0D 2AGXA 3AFCA 4E5ZB 2PM9A 2GC7A 3MUNA 5HYNB 2QR5A 3F3GA 2HESX 5CXBA 3SCYA 2PBIB 4MK0B 1VE7A 3IUMA 4G55A 4GGDA 5EMMB 1RI6A 4O1QD 4A09A 4A08A 4ZOZA 2P9IC 3MKSB 3I7PA 4CI1A 5HE1B 3EI4B 5FXYA 5I5JA 4K3ID 3PXTD 4ERYA 1H2ZA 1GOHA 4YVDA 5AMSA 5M5UA 2J56H 5GXIA 4J8BA 2YNNA 3VH0A 2B5LA 1N6EA 2P9SC 4D6VA 1P22A 2BBKH 3EQ9A 4FAVD 3EU7A 5AFU3 3OKTA 4NAAA 3V9FA 4A2LA 3MKQA 4JSPC 3GD1I 4NSXA 4J84A 3SHFA 2IURA 2P9LC 4CZXA 5IJ7E 2CE8A 5M5TA 5EM2A 5FKTA 4CC9A 1TBGA 5IGOA 4X3EA 4NC4A 2H68A 3FCUA 1SQJA 3I7LA 1JMZB 3MXXA 1GXRA 2Z2NA 5EM2B 3EWEA 2H6NA 3O4IA 4MMXA 3IJCA 2GC4A 2Q7QA 2VDOA 5H14A 4G1EA 4FAND 3KRWB 4AN1A 2XZGA 1SQ9A 4JT5C 4X61B 3ZWLB 1MG2A 1TYQC 2HKMA 3W15A 4AEZA 5K19A 3J80g 3RLMD 4WJKA 4A11B 2XL2A 5EMLB 5C2VB 1GOGA 4FA4D 2H9PA 2OK4A 5FLXg 3K71A 2EIBA 4A0AB 1VYHC 5C2WB 3ZE1A 3PE7A 4J82A 1S4UX 2EBSA 2OIZA 1L0QA 3C9CA 1VE6A 4U1EI 1GP2B 3RSEC 3PSCB 3AL8B 3N0DA 3OTTA 3L4MD 1Q47A 3IUNA 2VDPA 4A0BB 2P9UC 2WQ8A 4L3HD 3JZNA 5IT9g 5M5RA 3RFHA 5TF2A 3SVWD 1U4CA 3C99A 3UVLA 4R7AB 3UVKA 3SFZA 3DM0A 2TRCB 4GQBB 4Z7QA 5C86A 3EI1A 1OLZA 3ORVD 4RE6A 4CI8A 4CI2A 4J86A 4FA9D 4O3UB 2OK6A 3EI1B 4AMZA 4XYHA 1UTCA 3ZDYA 3QI0A 5FFGA 1SHYB 5EMKB 1L5GA 2QC5A 4CI3A 4Y5RD 3CIKB 4D0KA 5FKSA 1VZ2A 3IJEA 2W18A 4Y7RA 2YNPA 2EICA 4GZ8A 4PC0A 3UKRC 3SJLD 2UZXB 1A12A 3JRPA 3N0EA 3MUOA 4X63B 3J81g 3UR4A 4J77A 1B9YA 1K3IA 3F3FA 1H2YA 4UM9A 4BP8A 4RE5A 3EQ7A 3IVMA 3P4FA 3A0FA 2BKLA 5CXCA 5GXHA 4L3GD 2PM9B 1XKSA 2YMUA 4E54A 5CXBB 2I0TA 4WK2A 4GM3A 1K32A 1E8NA 3JZHA 5CXCB
chains in the Genus database with same CATH topology
4A09B 4XEIC 4A08B 4LGNA 5H17A 1XHMA 4K3JB 2CNXA 3F3PA 2CN3A 5SXMA 2AH0A 3UVOA 2CE9A 3RMZD 3I7HA 4GGCA 1PI6A 1FWXA 2HYEA 4JD2C 1PBYB 4ERQA 2H9NA 5TEEA 2G9AA 4A7JA 3DSMA 4PNKB 4OZUA 3NVNA 2AGLA 5FQDA 4HDJA 3PVWB 4CY1A 3EI3A 4QL1A 4J0WA 4J8GA 5TEFA 2I3TA 2H47A 2IUVA 3JROA 3HFQA 4LG9A 3DXKC 3I2NA 3IIWA 5C9ZB 1PGUA 2GNQA 1R5MA 3OL2A 4J87A 4PBYA 5GSAA 2H14A 2O9KA 3OW8A 5K1CC 4BUJC 4JSVC 3RN1D 5THAA 1QNIA 4ZOVA 4L1QD 3ODTA 5I5MA 4Z8LA 3EI2A 2Z2PA 4U7AA 4G56B 2HKRA 1B9XA 2OVRB 3V7DB 4BH6A 1NEXB 3I8CA 5IGQA 2HXCA 4JXMA 2OVPB 4JSXC 4CZYA 2MTAH 2HJ4A 3GFCA 1A0RB 2J57G 2IUPA 1MG3A 1K8KC 3OKWA 3DXMC 2IWKA 2YB8B 3AH8B 4FA1D 4UI9R 3ULEC 5CYKA 1OMWB 4BL0A 5EMJB 4J79A 5EAPA 4AOWA 4ZOYA 1JOFA 1MDAH 4GMBA 3PXSD 3SBPA 5H1MA 1PEVA 3V5WB 3EMHA 3IKOA 4GQ2P 2CO0A 4PXWA 4J78A 4TZ4A 4QT8A 3FM0A 4ESGA 5GMKn 4JT6C 4QRJA 3CFVA 4ES0A 4CY5A 2PM6B 4CY2A 1JJUB 3C75H 3SN6B 3FRXA 4KFMB 4E54B 3JAMg 1XIPA 2AH1A 1GOTB 2HJBA 2OJYA 3EI4A 5AJAA 2H6KA 5EALA 4LG8A 2I3SA 3NVXA 2UZYB 4CZVA 3BG0A 3IIYA 4J0XA 4FA5D 2Z2OA 3RRMC 2P9NC 2BCJB 2AGYA 1YFQA 3PVUB 3UKUC 3VA6A 1NR0A 3I8EA 1ERJA 2B5NA 4QQEA 5HQGA 2H6QA 4CY3A 2H9LA 3DWLC 5HE2B 2IAAA 5HE0B 3SWSD 3IJ0A 2PM7B 3SMRA 4FHLA 4ERZA 4A2MA 4ZN4A 4I79A 3SLED 3PXWD 2IUQA 3BG1A 2B5MA 2I0SA 3EI3B 3I7OA 5FKRA 3L4OD 4GM9A 2J55H 3K27A 5KDOB 2QXVA 4H5JA 2YBAA 4L9OA 4N14A 4A11A 3I7NA 4H5IA 3EG6A 3OL2B 4PSWB 4XYIA 2G99A 3IJ1A 3MZKA 3AL9A 4PBZA 5HE3B 4A0AA 4X60B 3MMYA 4GM8A 2H3XA 2H9MA 3VGZA 2OVQB 4IA9A 3EI2B 3E0CA 2I0RA 4FWWA 5JWZA 3U4YA 3AL8A 4GGAA 2XYIA 2CO0C 3PSLA 3UVMA 4A0BA 5FKQA 4GQ1A 4PSXB 5IC7A 3I7KA 3KRXB 2AGZA 2AQ5A 4J73A 3SBRA 3C5MA 2XL3A 4OWRA 1JMXB 4O9DA 2B4EA 4O3TB 3JPXA 3RFGA 3CFSB 2XU7A 2YNOA 2IWFA 4IMMA 4JSNC 3SBQA 4EWRA 5EARA 5B4WA 5I5IA 3MZLA 3I89A 3NVQA 5EAMA 4ZOXA 5FA5B 3GREA 3JZGA 3OKYA 3K26A 5IJ8E 3BWSA 1N6FA 5CYKB 5TDHB 3B7FA 1GG2B 3SXTD 3JB9L 2P9KC 1N6DA 3OKYB 5A2Qg 4FB1D 2H13A 3UVNA 2P9PC 4J81A 3FGBA 4E5ZA 2AGWA 2CN2A 4O45A 1U2VC 3RN0D 2AGXA 3AFCA 4E5ZB 2PM9A 2GC7A 5HYNB 3F3GA 2HESX 5CXBA 3SCYA 2PBIB 4MK0B 4GGDA 5EMMB 1RI6A 4O1QD 4A09A 4A08A 4ZOZA 2P9IC 3MKSB 3I7PA 4CI1A 5HE1B 3EI4B 5FXYA 5I5JA 4K3ID 3PXTD 4ERYA 4YVDA 5AMSA 2J56H 5GXIA 4J8BA 2YNNA 3VH0A 2B5LA 1N6EA 2P9SC 4D6VA 1P22A 2BBKH 4FAVD 5AFU3 3EU7A 3OKTA 4A2LA 3V9FA 3MKQA 4JSPC 4NSXA 4J84A 3SHFA 2IURA 2P9LC 4CZXA 5IJ7E 2CE8A 5EM2A 5FKTA 4CC9A 1TBGA 5IGOA 4X3EA 2H68A 1SQJA 3I7LA 1JMZB 3MXXA 1GXRA 2Z2NA 5EM2B 3EWEA 2H6NA 3IJCA 2GC4A 2Q7QA 5H14A 4FAND 3KRWB 1SQ9A 4JT5C 3JZHA 4X61B 3ZWLB 1MG2A 1TYQC 2HKMA 3W15A 4AEZA 5K19A 3J80g 3RLMD 4A11B 2XL2A 5EMLB 5C2VB 4FA4D 2H9PA 2OK4A 5FLXg 4A0AB 1VYHC 5C2WB 3PE7A 4J82A 1S4UX 2EBSA 2OIZA 1L0QA 3C9CA 4U1EI 1GP2B 3RSEC 3PSCB 3AL8B 3N0DA 3OTTA 1Q47A 3L4MD 4A0BB 2P9UC 4L3HD 3JZNA 5IT9g 3RFHA 5TF2A 3SVWD 1U4CA 3C99A 3UVLA 4R7AB 3UVKA 3SFZA 3DM0A 2TRCB 4GQBB 3EI1A 1OLZA 3ORVD 4CI8A 4CI2A 4FA9D 4O3UB 2OK6A 3EI1B 4XYHA 1SHYB 5EMKB 2QC5A 4CI3A 4Y5RD 3CIKB 4D0KA 5FKSA 2W18A 4Y7RA 2YNPA 4GZ8A 4PC0A 3UKRC 3SJLD 2UZXB 3JRPA 3N0EA 4X63B 3J81g 3UR4A 4J77A 1B9YA 3F3FA 3P4FA 3A0FA 5CXCA 5GXHA 4L3GD 2PM9B 1XKSA 2YMUA 4E54A 5CXBB 2I0TA 4GM3A 1K32A 4J86A 5CXCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A09 B;  4XEI C;  4A08 B;  4LGN A;  5H17 A;  1XHM A;  4K3J B;  2CNX A;  3F3P A;  2CN3 A;  5SXM A;  2AH0 A;  3UVO A;  2CE9 A;  3RMZ D;  3I7H A;  4GGC A;  1PI6 A;  1FWX A;  2HYE A;  4JD2 C;  1PBY B;  4ERQ A;  2H9N A;  5TEE A;  2G9A A;  4A7J A;  3DSM A;  4PNK B;  4OZU A;  3NVN A;  2AGL A;  5FQD A;  4HDJ A;  3PVW B;  4CY1 A;  3EI3 A;  4QL1 A;  4J0W A;  4J8G A;  5TEF A;  2I3T A;  2H47 A;  2IUV A;  3JRO A;  3HFQ A;  4LG9 A;  3DXK C;  3I2N A;  3IIW A;  5C9Z B;  1PGU A;  2GNQ A;  1R5M A;  3OL2 A;  4J87 A;  4PBY A;  5GSA A;  2H14 A;  2O9K A;  3OW8 A;  5K1C C;  4BUJ C;  4JSV C;  3RN1 D;  5THA A;  1QNI A;  4ZOV A;  4L1Q D;  3ODT A;  5I5M A;  4Z8L A;  3EI2 A;  2Z2P A;  4U7A A;  4G56 B;  2HKR A;  1B9X A;  2OVR B;  3V7D B;  4BH6 A;  1NEX B;  3I8C A;  5IGQ A;  2HXC A;  4JXM A;  2OVP B;  4JSX C;  4CZY A;  2MTA H;  2HJ4 A;  3GFC A;  1A0R B;  2J57 G;  2IUP A;  1MG3 A;  1K8K C;  3OKW A;  3DXM C;  2IWK A;  2YB8 B;  3AH8 B;  4FA1 D;  4UI9 R;  3ULE C;  5CYK A;  1OMW B;  4BL0 A;  5EMJ B;  4J79 A;  5EAP A;  4AOW A;  4ZOY A;  1JOF A;  1MDA H;  4GMB A;  3PXS D;  3SBP A;  5H1M A;  1PEV A;  3V5W B;  3EMH A;  3IKO A;  4GQ2 P;  2CO0 A;  4PXW A;  4J78 A;  4TZ4 A;  4QT8 A;  3FM0 A;  4ESG A;  5GMK n;  4JT6 C;  4QRJ A;  3CFV A;  4ES0 A;  4CY5 A;  2PM6 B;  4CY2 A;  1JJU B;  3C75 H;  3SN6 B;  3FRX A;  4KFM B;  4E54 B;  3JAM g;  1XIP A;  2AH1 A;  1GOT B;  2HJB A;  2OJY A;  3EI4 A;  5AJA A;  2H6K A;  5EAL A;  4LG8 A;  2I3S A;  3NVX A;  2UZY B;  4CZV A;  3BG0 A;  3IIY A;  4J0X A;  4FA5 D;  2Z2O A;  3RRM C;  2P9N C;  2BCJ B;  2AGY A;  1YFQ A;  3PVU B;  3UKU C;  3VA6 A;  1NR0 A;  3I8E A;  1ERJ A;  2B5N A;  4QQE A;  5HQG A;  2H6Q A;  4CY3 A;  2H9L A;  3DWL C;  5HE2 B;  2IAA A;  5HE0 B;  3SWS D;  3IJ0 A;  2PM7 B;  3SMR A;  4FHL A;  4ERZ A;  4A2M A;  4ZN4 A;  4I79 A;  3SLE D;  3PXW D;  2IUQ A;  3BG1 A;  2B5M A;  2I0S A;  3EI3 B;  3I7O A;  5FKR A;  3L4O D;  4GM9 A;  2J55 H;  3K27 A;  5KDO B;  2QXV A;  4H5J A;  2YBA A;  4L9O A;  4N14 A;  4A11 A;  3I7N A;  4H5I A;  3EG6 A;  3OL2 B;  4PSW B;  4XYI A;  2G99 A;  3IJ1 A;  3MZK A;  3AL9 A;  4PBZ A;  5HE3 B;  4A0A A;  4X60 B;  3MMY A;  4GM8 A;  2H3X A;  2H9M A;  3VGZ A;  2OVQ B;  4IA9 A;  3EI2 B;  3E0C A;  2I0R A;  4FWW A;  5JWZ A;  3U4Y A;  3AL8 A;  4GGA A;  2XYI A;  2CO0 C;  3PSL A;  3UVM A;  4A0B A;  5FKQ A;  4GQ1 A;  4PSX B;  5IC7 A;  3I7K A;  3KRX B;  2AGZ A;  2AQ5 A;  4J73 A;  3SBR A;  3C5M A;  2XL3 A;  4OWR A;  1JMX B;  4O9D A;  2B4E A;  4O3T B;  3JPX A;  3RFG A;  3CFS B;  2XU7 A;  2YNO A;  2IWF A;  4IMM A;  4JSN C;  3SBQ A;  4EWR A;  5EAR A;  5B4W A;  5I5I A;  3MZL A;  3I89 A;  3NVQ A;  5EAM A;  4ZOX A;  5FA5 B;  3GRE A;  3JZG A;  3OKY A;  3K26 A;  5IJ8 E;  3BWS A;  1N6F A;  5CYK B;  5TDH B;  3B7F A;  1GG2 B;  3SXT D;  3JB9 L;  2P9K C;  1N6D A;  3OKY B;  5A2Q g;  4FB1 D;  2H13 A;  3UVN A;  2P9P C;  4J81 A;  3FGB A;  4E5Z A;  2AGW A;  2CN2 A;  4O45 A;  1U2V C;  3RN0 D;  2AGX A;  3AFC A;  4E5Z B;  2PM9 A;  2GC7 A;  5HYN B;  3F3G A;  2HES X;  5CXB A;  3SCY A;  2PBI B;  4MK0 B;  4GGD A;  5EMM B;  1RI6 A;  4O1Q D;  4A09 A;  4A08 A;  4ZOZ A;  2P9I C;  3MKS B;  3I7P A;  4CI1 A;  5HE1 B;  3EI4 B;  5FXY A;  5I5J A;  4K3I D;  3PXT D;  4ERY A;  4YVD A;  5AMS A;  2J56 H;  5GXI A;  4J8B A;  2YNN A;  3VH0 A;  2B5L A;  1N6E A;  2P9S C;  4D6V A;  1P22 A;  2BBK H;  4FAV D;  5AFU 3;  3EU7 A;  3OKT A;  4A2L A;  3V9F A;  3MKQ A;  4JSP C;  4NSX A;  4J84 A;  3SHF A;  2IUR A;  2P9L C;  4CZX A;  5IJ7 E;  2CE8 A;  5EM2 A;  5FKT A;  4CC9 A;  1TBG A;  5IGO A;  4X3E A;  2H68 A;  1SQJ A;  3I7L A;  1JMZ B;  3MXX A;  1GXR A;  2Z2N A;  5EM2 B;  3EWE A;  2H6N A;  3IJC A;  2GC4 A;  2Q7Q A;  5H14 A;  4FAN D;  3KRW B;  1SQ9 A;  4JT5 C;  3JZH A;  4X61 B;  3ZWL B;  1MG2 A;  1TYQ C;  2HKM A;  3W15 A;  4AEZ A;  5K19 A;  3J80 g;  3RLM D;  4A11 B;  2XL2 A;  5EML B;  5C2V B;  4FA4 D;  2H9P A;  2OK4 A;  5FLX g;  4A0A B;  1VYH C;  5C2W B;  3PE7 A;  4J82 A;  1S4U X;  2EBS A;  2OIZ A;  1L0Q A;  3C9C A;  4U1E I;  1GP2 B;  3RSE C;  3PSC B;  3AL8 B;  3N0D A;  3OTT A;  1Q47 A;  3L4M D;  4A0B B;  2P9U C;  4L3H D;  3JZN A;  5IT9 g;  3RFH A;  5TF2 A;  3SVW D;  1U4C A;  3C99 A;  3UVL A;  4R7A B;  3UVK A;  3SFZ A;  3DM0 A;  2TRC B;  4GQB B;  3EI1 A;  1OLZ A;  3ORV D;  4CI8 A;  4CI2 A;  4FA9 D;  4O3U B;  2OK6 A;  3EI1 B;  4XYH A;  1SHY B;  5EMK B;  2QC5 A;  4CI3 A;  4Y5R D;  3CIK B;  4D0K A;  5FKS A;  2W18 A;  4Y7R A;  2YNP A;  4GZ8 A;  4PC0 A;  3UKR C;  3SJL D;  2UZX B;  3JRP A;  3N0E A;  4X63 B;  3J81 g;  3UR4 A;  4J77 A;  1B9Y A;  3F3F A;  3P4F A;  3A0F A;  5CXC A;  5GXH A;  4L3G D;  2PM9 B;  1XKS A;  2YMU A;  4E54 A;  5CXB B;  2I0T A;  4GM3 A;  1K32 A;  4J86 A;  5CXC B; 
#chains in the Genus database with same CATH topology
 4A09 B;  4XEI C;  4A08 B;  4LGN A;  5H17 A;  1XHM A;  4K3J B;  2CNX A;  3F3P A;  2HU5 A;  2CN3 A;  5SXM A;  3MVD K;  2AH0 A;  3UVO A;  2CE9 A;  3RMZ D;  1YR2 A;  2VDR A;  3I7H A;  4GGC A;  1PI6 A;  4NEN A;  1FWX A;  2HYE A;  4JD2 C;  1PBY B;  4QAM A;  4ERQ A;  2H9N A;  5TEE A;  2G9A A;  4A7J A;  3DSM A;  4WK0 A;  5E6S A;  2XDW A;  1GOF A;  4PNK B;  3ZDZ A;  2VDM A;  4OZU A;  3NVN A;  2AGL A;  5FQD A;  4HDJ A;  3PVW B;  4CY1 A;  2VZ3 A;  3EI3 A;  4QL1 A;  4J0W A;  4J8G A;  5TEF A;  2I3T A;  1U8C A;  2H47 A;  2IUV A;  3JRO A;  3HFQ A;  4LG9 A;  3DXK C;  1TYE A;  3I2N A;  3IIW A;  3FCS A;  5C9Z B;  1PGU A;  2VDN A;  2GNQ A;  3DDU A;  1R5M A;  1H2X A;  3O4G A;  3O4H A;  3OL2 A;  4J87 A;  4PBY A;  5GSA A;  1O6F A;  2H14 A;  2O9K A;  3OW8 A;  2EIE A;  5K1C C;  4BUJ C;  4JSV C;  3RN1 D;  5M5V A;  5THA A;  1QNI A;  2HU7 A;  4ZOV A;  4L1Q D;  5E6U A;  3ODT A;  5I5M A;  4Z8L A;  3EI2 A;  2Z2P A;  4U7A A;  4G56 B;  1UOO A;  5FFO A;  4Z7O A;  2HKR A;  1B9X A;  1VZ3 A;  2OVR B;  3V7D B;  4BH6 A;  1NEX B;  3I8C A;  5IGQ A;  2HXC A;  4JXM A;  2OVP B;  3GC3 B;  4JSX C;  4CZY A;  2MTA H;  2HJ4 A;  3GFC A;  1A0R B;  2J57 G;  2VZ1 A;  1H2W A;  2IUP A;  3NIF A;  1K8K C;  1MG3 A;  3OKW A;  1C9L A;  3DXM C;  2IWK A;  2XE4 A;  3NID A;  2YB8 B;  3AH8 B;  3T3P A;  4FA1 D;  4UI9 R;  4BP9 A;  3ULE C;  4JHP C;  5C92 A;  5CYK A;  1OMW B;  4BL0 A;  1BPO A;  5EMJ B;  4J79 A;  5EAP A;  4AOW A;  4DNV A;  4ZOY A;  1JOF A;  1MDA H;  4GMB A;  3PXS D;  5E6R A;  3SBP A;  5H1M A;  1PEV A;  1QFM A;  4MMY A;  3V5W B;  2JKX A;  4BCC A;  1UOP A;  4O2W A;  3EMH A;  4L1M A;  1T2X A;  2VDL A;  3IKO A;  4GQ2 P;  2CO0 A;  4PXW A;  4BCB A;  2HU8 A;  4J78 A;  4TZ4 A;  1UOQ A;  2EID A;  4QT8 A;  3FM0 A;  4ESG A;  5GMK n;  4JT6 C;  1O6G A;  4QRJ A;  3CFV A;  4ES0 A;  4NBM A;  4CY5 A;  2PM6 B;  4CY2 A;  1JJU B;  3C75 H;  3SN6 B;  4O02 A;  3FRX A;  4KFM B;  3V4V A;  4E54 B;  3JAM g;  1XIP A;  2AH1 A;  1GOT B;  2HJB A;  2OJY A;  3EI4 A;  5AJA A;  2H6K A;  5EAL A;  4LG8 A;  1I2M B;  2I3S A;  3NVX A;  4IRZ A;  2UZY B;  4CZV A;  1QFS A;  3BG0 A;  3IIY A;  4J0X A;  4FA5 D;  3ZE0 A;  2Z2O A;  3IUJ A;  3RRM C;  2P9N C;  5M61 A;  2BCJ B;  2AGY A;  4AX4 A;  1E8M A;  1YFQ A;  3NIG A;  3PVU B;  4AMY A;  3UKU C;  3VA6 A;  1NR0 A;  3I8E A;  1ERJ A;  1C9I A;  2B5N A;  4QQE A;  5HQG A;  2H6Q A;  4CY3 A;  2H9L A;  4G1M A;  3DWL C;  5HE2 B;  2IAA A;  5HE0 B;  3SWS D;  3IJ0 A;  2PM7 B;  2VC2 A;  4FHL A;  3SMR A;  4ERZ A;  4BCD A;  4A2M A;  3T3M A;  4ZN4 A;  4I79 A;  3SLE D;  3PXW D;  2IUQ A;  3ZE2 A;  3BG1 A;  2B5M A;  2I0S A;  3EI3 B;  3I7O A;  5FKR A;  3L4O D;  1M1X A;  4GM9 A;  2J55 H;  1JV2 A;  3K27 A;  3IUL A;  5KDO B;  2QXV A;  4H5J A;  2YBA A;  4L9O A;  4N14 A;  4UM8 A;  4A11 A;  3I7N A;  4H5I A;  3EG6 A;  3V4P A;  3OL2 B;  4PSW B;  4XYI A;  2G99 A;  3IJ1 A;  3MZK A;  3AL9 A;  4PBZ A;  5HE3 B;  4A0A A;  3VI4 A;  3VI3 A;  4X60 B;  3MMY A;  4GM8 A;  2H3X A;  3K72 A;  2H9M A;  3VGZ A;  2OVQ B;  5M5S A;  4IA9 A;  3EI2 B;  3E0C A;  4D9S A;  2I0R A;  4FWW A;  5JWZ A;  3U4Y A;  3AL8 A;  4GGA A;  2XYI A;  3KCI A;  2CO0 C;  3PSL A;  3UVM A;  4A0B A;  5FKQ A;  4GQ1 A;  4PSX B;  3K6S A;  5IC7 A;  3IUR A;  3I7K A;  3KRX B;  1JTD B;  2AGZ A;  2AQ5 A;  4J73 A;  3SBR A;  3C5M A;  2XL3 A;  4OWR A;  1JMX B;  4O9D A;  3ZDX A;  2B4E A;  2VDQ A;  4O3T B;  3JPX A;  3RFG A;  3CFS B;  2XU7 A;  2YNO A;  2IWF A;  3OF7 A;  4IMM A;  4JSN C;  4MMZ A;  4WK4 A;  3SBQ A;  4EWR A;  5EAR A;  4DNU A;  2QZP A;  5B4W A;  5I5I A;  3MZL A;  3I89 A;  3NVQ A;  4AN0 A;  4DNW A;  5EAM A;  4ZOX A;  3O4J A;  5HDB A;  5FA5 B;  3GRE A;  3JZG A;  3OKY A;  3K26 A;  5IJ8 E;  3BWS A;  1N6F A;  3IUQ A;  5CYK B;  5TDH B;  3B7F A;  1GG2 B;  3SXT D;  3JB9 L;  2P9K C;  1N6D A;  3OKY B;  2VDK A;  4JHN A;  3EQ8 A;  5A2Q g;  4FB1 D;  2H13 A;  3UVN A;  3QHY B;  4Z7N A;  2P9P C;  4J81 A;  3FGB A;  4E5Z A;  2AGW A;  2CN2 A;  4O45 A;  1E5T A;  1U2V C;  3RN0 D;  2AGX A;  3AFC A;  4E5Z B;  2PM9 A;  2GC7 A;  3MUN A;  5HYN B;  2QR5 A;  3F3G A;  2HES X;  5CXB A;  3SCY A;  2PBI B;  4MK0 B;  1VE7 A;  3IUM A;  4G55 A;  4GGD A;  5EMM B;  1RI6 A;  4O1Q D;  4A09 A;  4A08 A;  4ZOZ A;  2P9I C;  3MKS B;  3I7P A;  4CI1 A;  5HE1 B;  3EI4 B;  5FXY A;  5I5J A;  4K3I D;  3PXT D;  4ERY A;  1H2Z A;  1GOH A;  4YVD A;  5AMS A;  5M5U A;  2J56 H;  5GXI A;  4J8B A;  2YNN A;  3VH0 A;  2B5L A;  1N6E A;  2P9S C;  4D6V A;  1P22 A;  2BBK H;  3EQ9 A;  4FAV D;  3EU7 A;  5AFU 3;  3OKT A;  4NAA A;  3V9F A;  4A2L A;  3MKQ A;  4JSP C;  3GD1 I;  4NSX A;  4J84 A;  3SHF A;  2IUR A;  2P9L C;  4CZX A;  5IJ7 E;  2CE8 A;  5M5T A;  5EM2 A;  5FKT A;  4CC9 A;  1TBG A;  5IGO A;  4X3E A;  4NC4 A;  2H68 A;  3FCU A;  1SQJ A;  3I7L A;  1JMZ B;  3MXX A;  1GXR A;  2Z2N A;  5EM2 B;  3EWE A;  2H6N A;  3O4I A;  4MMX A;  3IJC A;  2GC4 A;  2Q7Q A;  2VDO A;  5H14 A;  4G1E A;  4FAN D;  3KRW B;  4AN1 A;  2XZG A;  1SQ9 A;  4JT5 C;  4X61 B;  3ZWL B;  1MG2 A;  1TYQ C;  2HKM A;  3W15 A;  4AEZ A;  5K19 A;  3J80 g;  3RLM D;  4WJK A;  4A11 B;  2XL2 A;  5EML B;  5C2V B;  1GOG A;  4FA4 D;  2H9P A;  2OK4 A;  5FLX g;  3K71 A;  2EIB A;  4A0A B;  1VYH C;  5C2W B;  3ZE1 A;  3PE7 A;  4J82 A;  1S4U X;  2EBS A;  2OIZ A;  1L0Q A;  3C9C A;  1VE6 A;  4U1E I;  1GP2 B;  3RSE C;  3PSC B;  3AL8 B;  3N0D A;  3OTT A;  3L4M D;  1Q47 A;  3IUN A;  2VDP A;  4A0B B;  2P9U C;  2WQ8 A;  4L3H D;  3JZN A;  5IT9 g;  5M5R A;  3RFH A;  5TF2 A;  3SVW D;  1U4C A;  3C99 A;  3UVL A;  4R7A B;  3UVK A;  3SFZ A;  3DM0 A;  2TRC B;  4GQB B;  4Z7Q A;  5C86 A;  3EI1 A;  1OLZ A;  3ORV D;  4RE6 A;  4CI8 A;  4CI2 A;  4J86 A;  4FA9 D;  4O3U B;  2OK6 A;  3EI1 B;  4AMZ A;  4XYH A;  1UTC A;  3ZDY A;  3QI0 A;  5FFG A;  1SHY B;  5EMK B;  1L5G A;  2QC5 A;  4CI3 A;  4Y5R D;  3CIK B;  4D0K A;  5FKS A;  1VZ2 A;  3IJE A;  2W18 A;  4Y7R A;  2YNP A;  2EIC A;  4GZ8 A;  4PC0 A;  3UKR C;  3SJL D;  2UZX B;  1A12 A;  3JRP A;  3N0E A;  3MUO A;  4X63 B;  3J81 g;  3UR4 A;  4J77 A;  1B9Y A;  1K3I A;  3F3F A;  1H2Y A;  4UM9 A;  4BP8 A;  4RE5 A;  3EQ7 A;  3IVM A;  3P4F A;  3A0F A;  2BKL A;  5CXC A;  5GXH A;  4L3G D;  2PM9 B;  1XKS A;  2YMU A;  4E54 A;  5CXB B;  2I0T A;  4WK2 A;  4GM3 A;  1K32 A;  1E8N A;  3JZH A;  5CXC B; 
#chains in the Genus database with same CATH homology
 4A09 B;  4XEI C;  4A08 B;  4LGN A;  5H17 A;  1XHM A;  4K3J B;  2CNX A;  3F3P A;  2CN3 A;  5SXM A;  2AH0 A;  3UVO A;  2CE9 A;  3RMZ D;  3I7H A;  4GGC A;  1PI6 A;  1FWX A;  2HYE A;  4JD2 C;  1PBY B;  4ERQ A;  2H9N A;  5TEE A;  2G9A A;  4A7J A;  3DSM A;  4PNK B;  4OZU A;  3NVN A;  2AGL A;  5FQD A;  4HDJ A;  3PVW B;  4CY1 A;  3EI3 A;  4QL1 A;  4J0W A;  4J8G A;  5TEF A;  2I3T A;  2H47 A;  2IUV A;  3JRO A;  3HFQ A;  4LG9 A;  3DXK C;  3I2N A;  3IIW A;  5C9Z B;  1PGU A;  2GNQ A;  1R5M A;  3OL2 A;  4J87 A;  4PBY A;  5GSA A;  2H14 A;  2O9K A;  3OW8 A;  5K1C C;  4BUJ C;  4JSV C;  3RN1 D;  5THA A;  1QNI A;  4ZOV A;  4L1Q D;  3ODT A;  5I5M A;  4Z8L A;  3EI2 A;  2Z2P A;  4U7A A;  4G56 B;  2HKR A;  1B9X A;  2OVR B;  3V7D B;  4BH6 A;  1NEX B;  3I8C A;  5IGQ A;  2HXC A;  4JXM A;  2OVP B;  4JSX C;  4CZY A;  2MTA H;  2HJ4 A;  3GFC A;  1A0R B;  2J57 G;  2IUP A;  1MG3 A;  1K8K C;  3OKW A;  3DXM C;  2IWK A;  2YB8 B;  3AH8 B;  4FA1 D;  4UI9 R;  3ULE C;  5CYK A;  1OMW B;  4BL0 A;  5EMJ B;  4J79 A;  5EAP A;  4AOW A;  4ZOY A;  1JOF A;  1MDA H;  4GMB A;  3PXS D;  3SBP A;  5H1M A;  1PEV A;  3V5W B;  3EMH A;  3IKO A;  4GQ2 P;  2CO0 A;  4PXW A;  4J78 A;  4TZ4 A;  4QT8 A;  3FM0 A;  4ESG A;  5GMK n;  4JT6 C;  4QRJ A;  3CFV A;  4ES0 A;  4CY5 A;  2PM6 B;  4CY2 A;  1JJU B;  3C75 H;  3SN6 B;  3FRX A;  4KFM B;  4E54 B;  3JAM g;  1XIP A;  2AH1 A;  1GOT B;  2HJB A;  2OJY A;  3EI4 A;  5AJA A;  2H6K A;  5EAL A;  4LG8 A;  2I3S A;  3NVX A;  2UZY B;  4CZV A;  3BG0 A;  3IIY A;  4J0X A;  4FA5 D;  2Z2O A;  3RRM C;  2P9N C;  2BCJ B;  2AGY A;  1YFQ A;  3PVU B;  3UKU C;  3VA6 A;  1NR0 A;  3I8E A;  1ERJ A;  2B5N A;  4QQE A;  5HQG A;  2H6Q A;  4CY3 A;  2H9L A;  3DWL C;  5HE2 B;  2IAA A;  5HE0 B;  3SWS D;  3IJ0 A;  2PM7 B;  3SMR A;  4FHL A;  4ERZ A;  4A2M A;  4ZN4 A;  4I79 A;  3SLE D;  3PXW D;  2IUQ A;  3BG1 A;  2B5M A;  2I0S A;  3EI3 B;  3I7O A;  5FKR A;  3L4O D;  4GM9 A;  2J55 H;  3K27 A;  5KDO B;  2QXV A;  4H5J A;  2YBA A;  4L9O A;  4N14 A;  4A11 A;  3I7N A;  4H5I A;  3EG6 A;  3OL2 B;  4PSW B;  4XYI A;  2G99 A;  3IJ1 A;  3MZK A;  3AL9 A;  4PBZ A;  5HE3 B;  4A0A A;  4X60 B;  3MMY A;  4GM8 A;  2H3X A;  2H9M A;  3VGZ A;  2OVQ B;  4IA9 A;  3EI2 B;  3E0C A;  2I0R A;  4FWW A;  5JWZ A;  3U4Y A;  3AL8 A;  4GGA A;  2XYI A;  2CO0 C;  3PSL A;  3UVM A;  4A0B A;  5FKQ A;  4GQ1 A;  4PSX B;  5IC7 A;  3I7K A;  3KRX B;  2AGZ A;  2AQ5 A;  4J73 A;  3SBR A;  3C5M A;  2XL3 A;  4OWR A;  1JMX B;  4O9D A;  2B4E A;  4O3T B;  3JPX A;  3RFG A;  3CFS B;  2XU7 A;  2YNO A;  2IWF A;  4IMM A;  4JSN C;  3SBQ A;  4EWR A;  5EAR A;  5B4W A;  5I5I A;  3MZL A;  3I89 A;  3NVQ A;  5EAM A;  4ZOX A;  5FA5 B;  3GRE A;  3JZG A;  3OKY A;  3K26 A;  5IJ8 E;  3BWS A;  1N6F A;  5CYK B;  5TDH B;  3B7F A;  1GG2 B;  3SXT D;  3JB9 L;  2P9K C;  1N6D A;  3OKY B;  5A2Q g;  4FB1 D;  2H13 A;  3UVN A;  2P9P C;  4J81 A;  3FGB A;  4E5Z A;  2AGW A;  2CN2 A;  4O45 A;  1U2V C;  3RN0 D;  2AGX A;  3AFC A;  4E5Z B;  2PM9 A;  2GC7 A;  5HYN B;  3F3G A;  2HES X;  5CXB A;  3SCY A;  2PBI B;  4MK0 B;  4GGD A;  5EMM B;  1RI6 A;  4O1Q D;  4A09 A;  4A08 A;  4ZOZ A;  2P9I C;  3MKS B;  3I7P A;  4CI1 A;  5HE1 B;  3EI4 B;  5FXY A;  5I5J A;  4K3I D;  3PXT D;  4ERY A;  4YVD A;  5AMS A;  2J56 H;  5GXI A;  4J8B A;  2YNN A;  3VH0 A;  2B5L A;  1N6E A;  2P9S C;  4D6V A;  1P22 A;  2BBK H;  4FAV D;  5AFU 3;  3EU7 A;  3OKT A;  4A2L A;  3V9F A;  3MKQ A;  4JSP C;  4NSX A;  4J84 A;  3SHF A;  2IUR A;  2P9L C;  4CZX A;  5IJ7 E;  2CE8 A;  5EM2 A;  5FKT A;  4CC9 A;  1TBG A;  5IGO A;  4X3E A;  2H68 A;  1SQJ A;  3I7L A;  1JMZ B;  3MXX A;  1GXR A;  2Z2N A;  5EM2 B;  3EWE A;  2H6N A;  3IJC A;  2GC4 A;  2Q7Q A;  5H14 A;  4FAN D;  3KRW B;  1SQ9 A;  4JT5 C;  3JZH A;  4X61 B;  3ZWL B;  1MG2 A;  1TYQ C;  2HKM A;  3W15 A;  4AEZ A;  5K19 A;  3J80 g;  3RLM D;  4A11 B;  2XL2 A;  5EML B;  5C2V B;  4FA4 D;  2H9P A;  2OK4 A;  5FLX g;  4A0A B;  1VYH C;  5C2W B;  3PE7 A;  4J82 A;  1S4U X;  2EBS A;  2OIZ A;  1L0Q A;  3C9C A;  4U1E I;  1GP2 B;  3RSE C;  3PSC B;  3AL8 B;  3N0D A;  3OTT A;  1Q47 A;  3L4M D;  4A0B B;  2P9U C;  4L3H D;  3JZN A;  5IT9 g;  3RFH A;  5TF2 A;  3SVW D;  1U4C A;  3C99 A;  3UVL A;  4R7A B;  3UVK A;  3SFZ A;  3DM0 A;  2TRC B;  4GQB B;  3EI1 A;  1OLZ A;  3ORV D;  4CI8 A;  4CI2 A;  4FA9 D;  4O3U B;  2OK6 A;  3EI1 B;  4XYH A;  1SHY B;  5EMK B;  2QC5 A;  4CI3 A;  4Y5R D;  3CIK B;  4D0K A;  5FKS A;  2W18 A;  4Y7R A;  2YNP A;  4GZ8 A;  4PC0 A;  3UKR C;  3SJL D;  2UZX B;  3JRP A;  3N0E A;  4X63 B;  3J81 g;  3UR4 A;  4J77 A;  1B9Y A;  3F3F A;  3P4F A;  3A0F A;  5CXC A;  5GXH A;  4L3G D;  2PM9 B;  1XKS A;  2YMU A;  4E54 A;  5CXB B;  2I0T A;  4GM3 A;  1K32 A;  4J86 A;  5CXC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...