4GQ2P

S. pombe nup120-nup37 complex
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
382
structure length
371
Chain Sequence
NQYQLPLNVRPYTTTWCSQSPSCSNLLAIGHDTGITIYCASEEQTPGSTGLTLQELFTIQTGLPTLHLSFSSSCSYSESPVYSLFLACVCQDNTVRLIITKNETIITQHVLGGKSGHHNFVNDIDIADVYSADNRLAEQVIASVGDDCTLIIWRLTDEGPILAGYPLSSPGISVQFRPSNPNQLIVGERNGNIRIFDWTLNLSAEENSQTELVKNPWLLTLNTLPLVNTCHSSGIASSLANVRWIGSDGSGILAMCKSGAWLRWNLFANNDYNEISDSTMKLGPKNLLPNVQGISLFPSLLGACPHPRYMDYFATAHSQHGLIQLINTYEKDSNSIPIQLGMPIVDFCWHQDGSHLAIATEGSVLLTRLMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Nucleoporin nup120
publication title Structural evolution of the membrane-coating module of the nuclear pore complex.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 81
structure length 371
sequence length 382
ec nomenclature
pdb deposition date 2012-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4gq2P00
3RSEC 2XYIA 3OL2A 4ERZA 3JPXA 4ZOVA 4CY3A 5IJ8E 4JT5C 4OZUA 5K1CC 3I7HA 3JZHA 3CFSB 2IUVA 4FA9D 4J82A 4L3GD 3V7DB 3I8CA 3OKTA 2CN2A 2B4EA 2TRCB 3F3GA 3DWLC 2I3TA 2OVRB 4O3TB 4E5ZB 3L4MD 4X63B 5EM2B 2AH1A 1XHMA 4PC0A 5HE1B 3DXMC 3RFGA 3N0DA 2IWKA 2H9LA 1N6EA 2J55H 3RN1D 3CIKB 5KDOB 1GG2B 3KRXB 2PM6B 5CYKA 2P9UC 3IIWA 3B7FA 4JT6C 2IUPA 3AFCA 3NVXA 3NVNA 3P4FA 4GGDA 4E5ZA 4JSNC 2H6KA 1TYQC 3SWSD 2J56H 2P9NC 3IJCA 2YNNA 3IJ1A 2Z2PA 1MG2A 4A0BB 4J73A 3EI3B 3FM0A 4LGNA 3UVOA 4GMBA 3PXTD 3EG6A 2CNXA 1B9XA 2AH0A 4A7JA 1RI6A 2OVQB 4D0KA 5FQDA 3AL9A 3UKUC 2HXCA 4GQ1A 3A0FA 2HKMA 3N0EA 4H5JA 4CI8A 3MZKA 4X3EA 3I7KA 4GQBB 4GZ8A 5B4WA 2P9IC 3RLMD 1JMZB 4JD2C 3E0CA 3BWSA 2Q7QA 4KFMB 2HYEA 4A0BA 3ZWLB 1P22A 5FKTA 2B5LA 2CE9A 4D6VA 5JWZA 3SFZA 2AGWA 5H1MA 4FA1D 2CO0C 4O3UB 4A11A 4CZYA 2P9PC 5IJ7E 3BG0A 5C9ZB 5TEEA 5C2WB 3C99A 3DXKC 2H68A 5HE3B 2I0SA 3I7NA 3VH0A 4A09A 5IGOA 4J8GA 1K32A 3FGBA 3VA6A 4CZXA 4PBZA 5HYNB 4N14A 4IMMA 2GNQA 2YNOA 5EAMA 1NR0A 2IURA 2GC4A 5GSAA 4L3HD 5IT9g 3OTTA 3EI1A 5H17A 1JMXB 5FXYA 4ES0A 1U2VC 4Y5RD 3RN0D 2AGLA 3EU7A 4J8BA 4J87A 5EMMB 1Q47A 5SXMA 3EI4B 2QC5A 3V9FA 5CXBB 3GFCA 4J77A 4FA4D 2HJ4A 3OW8A 3PVWB 2GC7A 2CE8A 4CY2A 4UI9R 1PEVA 4NSXA 1PGUA 4J0WA 5A2Qg 2OVPB 5EMKB 3HFQA 4CI3A 4QL1A 4HDJA 4A2MA 5CXCB 3MZLA 5FKQA 3SBPA 3SN6B 2B5NA 4CY1A 1OMWB 1GP2B 2OIZA 2HKRA 4EWRA 1GXRA 2G99A 2OK4A 4ZOXA 1N6DA 3FRXA 3OKYB 5CXBA 5EM2A 1JJUB 1K8KC 3JROA 3VGZA 1ERJA 2B5MA 1A0RB 1GOTB 2YMUA 2H6NA 3UR4A 2CO0A 4GGCA 1JOFA 4G56B 2IAAA 5HE2B 4GQ2P 5HE0B 4LG8A 4PSWB 2H13A 1SQJA 4FHLA 4J0XA 1FWXA 4FWWA 4E54B 5TF2A 4IA9A 4U1EI 5I5IA 1QNIA 3F3FA 4X60B 2PM9B 3SCYA 4A0AB 3AL8B 4AOWA 3ORVD 3EI2B 2I3SA 3ODTA 3C5MA 4FAVD 2AGYA 1YFQA 2H6QA 3I7LA 4PBYA 1VYHC 4L1QD 3U4YA 2O9KA 4XYHA 3AH8B 3V5WB 2BBKH 3C9CA 4GM9A 5C2VB 1R5MA 3MKSB 4XYIA 2EBSA 3EI3A 4JSVC 5I5JA 4QQEA 2OJYA 5FKRA 2Z2NA 3UVLA 2AGZA 4CC9A 4A08B 5GXIA 2P9SC 3AL8A 4MK0B 2P9LC 2G9AA 2UZXB 5AJAA 2H14A 4K3ID 3JZNA 3OL2B 5FKSA 4J78A 3CFVA 3DSMA 4ZOZA 4CY5A 4BH6A 4H5IA 4U7AA 3RRMC 4CZVA 3J80g 3IJ0A 2XL3A 3SMRA 5HQGA 4ESGA 2AGXA 2PBIB 2YBAA 5EMLB 3NVQA 1OLZA 3PXWD 4J86A 5GMKn 4ZOYA 2HESX 3K27A 1L0QA 2Z2OA 5IC7A 3SHFA 2MTAH 5TEFA 3I7OA 5AMSA 2P9KC 4J81A 3C75H 3JB9L 2XU7A 4FA5D 3F3PA 4BUJC 3I7PA 2YNPA 3JZGA 3PSLA 5CYKB 2PM7B 5H14A 1PBYB 4JXMA 4JSXC 1S4UX 3MMYA 3L4OD 1N6FA 3MXXA 4BL0A 1PI6A 4CI2A 3SLED 4J79A 3EI4A 5TDHB 3SXTD 3SJLD 1MDAH 2J57G 4J84A 2H9MA 3BG1A 2H47A 3K26A 3PSCB 4TZ4A 5K19A 2BCJB 3EMHA 1SQ9A 3RFHA 2OK6A 3J81g 3UVNA 3I2NA 4LG9A 4Z8LA 1U4CA 2CN3A 3PE7A 5FLXg 5CXCA 4K3JB 4ZN4A 3JAMg 3IKOA 3SVWD 3OKWA 3IIYA 4FAND 4I79A 5EARA 3EWEA 3OKYA 4PXWA 5GXHA 2YB8B 4O1QD 4CI1A 4PNKB 2UZYB 4XEIC 3PVUB 2H9NA 2I0TA 5EAPA 4O45A 3DM0A 4QT8A 3SBQA 1NEXB 4ERQA 1SHYB 4A11B 3SBRA 2H3XA 3UVKA 4JSPC 4GGAA 3KRWB 2IUQA 2AQ5A 4E54A 4GM8A 3I89A 3JRPA 4Y7RA 1XIPA 4YVDA 3RMZD 4R7AB 5IGQA 4A09B 4A0AA 2PM9A 4O9DA 5I5MA 2I0RA 3UVMA 3EI2A 1TBGA 5EMJB 2H9PA 3W15A 3ULEC 2IWFA 4QRJA 4FB1D 2QXVA 5AFU3 3MKQA 2HJBA 2XL2A 4X61B 5THAA 4GM3A 4ERYA 4L9OA 1B9YA 1XKSA 5FA5B 4A2LA 3I8EA 3UKRC 3EI1B 5EALA 4PSXB 1MG3A 3GREA 4A08A 2W18A 3PXSD 4AEZA 4OWRA
chains in the Genus database with same CATH superfamily
3RSEC 1E8NA 1GOGA 2XYIA 3OL2A 4ERZA 3JPXA 4ZOVA 4CY3A 5IJ8E 4JT5C 4OZUA 5K1CC 3I7HA 3IUMA 3JZHA 3CFSB 4DNWA 2IUVA 4FA9D 4J82A 4L3GD 3V7DB 3I8CA 5C86A 3OKTA 2CN2A 3KCIA 2B4EA 2TRCB 3F3GA 3DWLC 2EIBA 2I3TA 4AX4A 2OVRB 2XDWA 4O3TB 3L4MD 4X63B 4E5ZB 5EM2B 2AH1A 1XHMA 4L1MA 4PC0A 2EIDA 5HE1B 3DXMC 3RFGA 3N0DA 2IWKA 4RE5A 2H9LA 1E8MA 1N6EA 3T3MA 2J55H 2VC2A 3RN1D 3CIKB 5KDOB 1GG2B 1UOPA 3KRXB 3T3PA 3GC3B 2PM6B 5CYKA 2P9UC 3IIWA 3B7FA 4JT6C 2IUPA 3AFCA 3NVXA 3NVNA 3P4FA 4GGDA 2VDPA 3IUNA 4E5ZA 2HU7A 4JSNC 2H6KA 1TYQC 3SWSD 4O2WA 2J56H 5HDBA 2P9NC 3IJCA 2YNNA 3IJ1A 2Z2PA 1MG2A 5C92A 3FCSA 4A0BB 4J73A 3EI3B 3FM0A 4MMZA 2VZ3A 4LGNA 1O6GA 3UVOA 4GMBA 1VE7A 3ZDYA 3PXTD 2EICA 3EG6A 2CNXA 1B9XA 2AH0A 2XZGA 4QAMA 4A7JA 1RI6A 2OVQB 4D0KA 5FQDA 1H2WA 3AL9A 3UKUC 1JV2A 2HXCA 4GQ1A 3A0FA 2HKMA 3N0EA 4H5JA 4CI8A 3MZKA 2VDQA 4BCDA 4X3EA 3IJEA 3O4IA 3I7KA 4GQBB 4GZ8A 5B4WA 2P9IC 3RLMD 1JMZB 4JD2C 3E0CA 4BCBA 3BWSA 2Q7QA 4KFMB 2HYEA 3EQ8A 4A0BA 3ZWLB 1P22A 5FKTA 2B5LA 4BP8A 2CE9A 4D6VA 5JWZA 3SFZA 3VI3A 2AGWA 5H1MA 4AN1A 4FA1D 2CO0C 4O3UB 4A11A 4CZYA 2P9PC 1M1XA 5IJ7E 3BG0A 5C9ZB 1H2XA 5TEEA 5C2WB 3C99A 3DXKC 2H68A 5HE3B 3NIDA 1GOFA 2I0SA 3I7NA 3VH0A 4A09A 5IGOA 4J8GA 1K32A 3FGBA 3VA6A 3ZE2A 4CZXA 4PBZA 5HYNB 4N14A 4IMMA 1UOQA 2GNQA 2YNOA 3FCUA 3MUNA 5EAMA 1NR0A 2IURA 2GC4A 5GSAA 4L3HD 5IT9g 3OTTA 3EI1A 1GOHA 5H17A 1JMXB 5FXYA 4ES0A 1U2VC 4Y5RD 3RN0D 3O4GA 2AGLA 3EU7A 4J8BA 4J87A 5EMMB 1Q47A 5SXMA 3EI4B 2QC5A 5M5UA 3V9FA 5CXBB 3GFCA 4J77A 4FA4D 2HJ4A 3OW8A 1JTDB 2VZ1A 3PVWB 2GC7A 2CE8A 4CY2A 2WQ8A 4UI9R 1PEVA 4NSXA 1PGUA 4J0WA 4O02A 5A2Qg 2OVPB 5EMKB 3HFQA 4CI3A 4QL1A 4HDJA 4A2MA 5CXCB 3MZLA 4NENA 4WK2A 5FKQA 1BPOA 3SBPA 3SN6B 2B5NA 4CY1A 1OMWB 1GP2B 2OIZA 3ZE1A 2HKRA 4EWRA 1GXRA 2G99A 2OK4A 4ZOXA 1N6DA 3FRXA 3OKYB 5M5VA 5CXBA 5EM2A 1JJUB 1K8KC 3JROA 3VGZA 1ERJA 2B5MA 1A0RB 1GOTB 2YMUA 5E6RA 2H6NA 5E6UA 3UR4A 2CO0A 4GGCA 1JOFA 3EQ7A 4G56B 2IAAA 4NC4A 4WK0A 4NBMA 5HE2B 4D9SA 4GQ2P 5HE0B 4LG8A 4PSWB 2H13A 1SQJA 4FHLA 4J0XA 3ZDXA 1FWXA 4FWWA 1L5GA 2VDNA 4E54B 5TF2A 4IA9A 1QFSA 4U1EI 5I5IA 1QNIA 3F3FA 4X60B 2PM9B 3SCYA 4A0AB 3AL8B 4AOWA 4DNUA 3ORVD 3EI2B 2VDRA 1C9LA 3O4JA 2I3SA 3ODTA 1H2YA 3C5MA 4G55A 4FAVD 3IVMA 2AGYA 1YFQA 3DDUA 2H6QA 3I7LA 4PBYA 1VYHC 2QZPA 4L1QD 3U4YA 2O9KA 4XYHA 3AH8B 3V5WB 5M5TA 2BBKH 3C9CA 4GM9A 5C2VB 1R5MA 3MKSB 4XYIA 5M5RA 2EBSA 3EI3A 4JSVC 5I5JA 1UOOA 4QQEA 2OJYA 5FKRA 2Z2NA 3UVLA 2AGZA 4BP9A 4CC9A 4Z7OA 4A08B 2VDOA 3IUQA 1H2ZA 5GXIA 2P9SC 3AL8A 4MK0B 2P9LC 2G9AA 2UZXB 5AJAA 2H14A 3QHYB 4K3ID 4IRZA 3JZNA 3OL2B 5M61A 3OF7A 5FKSA 2VDMA 4J78A 3CFVA 3DSMA 3MVDK 2VDLA 4ZOZA 1C9IA 4CY5A 4BH6A 4H5IA 4U7AA 3RRMC 5FFOA 4CZVA 3J80g 3IJ0A 3K71A 2XL3A 3SMRA 5HQGA 4ESGA 1A12A 4AMYA 2AGXA 2PBIB 2YBAA 5EMLB 3QI0A 2HU8A 3NVQA 1OLZA 3PXWD 4J86A 4NAAA 5GMKn 4ZOYA 2HESX 3K27A 1L0QA 2Z2OA 3V4VA 5IC7A 3SHFA 2MTAH 5TEFA 3I7OA 4Z7NA 5AMSA 2P9KC 3NIGA 4J81A 3C75H 3JB9L 2XU7A 4FA5D 3F3PA 4BUJC 4DNVA 1E5TA 3I7PA 1VZ3A 2XE4A 2YNPA 3JZGA 3PSLA 5CYKB 2PM7B 4G1MA 3NIFA 5H14A 4UM8A 1PBYB 4JXMA 4JSXC 1S4UX 2JKXA 3MMYA 3L4OD 4RE6A 1T2XA 1N6FA 3MXXA 4BL0A 1PI6A 4MMYA 4CI2A 1QFMA 1VZ2A 3SLED 4UM9A 4J79A 4AMZA 3EI4A 5TDHB 3SXTD 1O6FA 3SJLD 1MDAH 2J57G 4J84A 2H9MA 3BG1A 1I2MB 3IULA 2H47A 3K26A 3IUJA 3PSCB 4TZ4A 3ZDZA 2BCJB 5K19A 3EMHA 1SQ9A 3RFHA 2OK6A 3J81g 3UVNA 3VI4A 4JHPC 3I2NA 2VDKA 1TYEA 4LG9A 3K6SA 3O4HA 4Z8LA 1U4CA 2CN3A 3PE7A 5FLXg 5CXCA 4K3JB 4ZN4A 3JAMg 3IKOA 3SVWD 3ZE0A 3OKWA 2BKLA 3IIYA 4FAND 2EIEA 4I79A 5EARA 2HU5A 3EWEA 3OKYA 5M5SA 4PXWA 3GD1I 5GXHA 2YB8B 4O1QD 4CI1A 4PNKB 2UZYB 4XEIC 3PVUB 2H9NA 2I0TA 4Z7QA 5EAPA 4O45A 3DM0A 4JHNA 4BCCA 4QT8A 4MMXA 1UTCA 3SBQA 1NEXB 4ERQA 1SHYB 4A11B 3SBRA 2H3XA 5FFGA 4JSPC 4GGAA 3K72A 3UVKA 4AN0A 3KRWB 2IUQA 4WK4A 2AQ5A 4E54A 4WJKA 4GM8A 3I89A 3JRPA 4Y7RA 1XIPA 4YVDA 3RMZD 4R7AB 5IGQA 4A09B 4A0AA 2PM9A 4O9DA 5I5MA 2I0RA 3UVMA 3EI2A 1TBGA 5EMJB 1YR2A 5E6SA 2H9PA 3W15A 3ULEC 2IWFA 4QRJA 4FB1D 2QXVA 5AFU3 3MKQA 3IURA 2HJBA 2XL2A 4X61B 5THAA 4GM3A 3V4PA 4ERYA 4L9OA 1B9YA 1VE6A 1XKSA 5FA5B 4A2LA 3I8EA 4G1EA 3UKRC 5EALA 3EI1B 1U8CA 4PSXB 2QR5A 1MG3A 3GREA 4A08A 2W18A 3PXSD 4AEZA 4OWRA 3MUOA 3EQ9A 1K3IA
chains in the Genus database with same CATH topology
3RSEC 2XYIA 3OL2A 4ERZA 3JPXA 4ZOVA 4CY3A 5IJ8E 4JT5C 4OZUA 5K1CC 3I7HA 3JZHA 3CFSB 2IUVA 4FA9D 4J82A 4L3GD 3V7DB 3I8CA 3OKTA 2CN2A 2B4EA 2TRCB 3F3GA 3DWLC 2I3TA 2OVRB 4O3TB 4E5ZB 3L4MD 4X63B 5EM2B 2AH1A 1XHMA 4PC0A 5HE1B 3DXMC 3RFGA 3N0DA 2IWKA 2H9LA 1N6EA 2J55H 3RN1D 3CIKB 5KDOB 1GG2B 3KRXB 2PM6B 5CYKA 2P9UC 3IIWA 3B7FA 4JT6C 2IUPA 3AFCA 3NVXA 3NVNA 3P4FA 4GGDA 4E5ZA 4JSNC 2H6KA 1TYQC 3SWSD 2J56H 2P9NC 3IJCA 2YNNA 3IJ1A 2Z2PA 1MG2A 4A0BB 4J73A 3EI3B 3FM0A 4LGNA 3UVOA 4GMBA 3PXTD 3EG6A 2CNXA 1B9XA 2AH0A 4A7JA 1RI6A 2OVQB 4D0KA 5FQDA 3AL9A 3UKUC 2HXCA 4GQ1A 3A0FA 2HKMA 3N0EA 4H5JA 4CI8A 3MZKA 4X3EA 3I7KA 4GQBB 4GZ8A 5B4WA 2P9IC 3RLMD 1JMZB 4JD2C 3E0CA 3BWSA 2Q7QA 4KFMB 2HYEA 4A0BA 3ZWLB 1P22A 5FKTA 2B5LA 2CE9A 4D6VA 5JWZA 3SFZA 2AGWA 5H1MA 4FA1D 2CO0C 4O3UB 4A11A 4CZYA 2P9PC 5IJ7E 3BG0A 5C9ZB 5TEEA 5C2WB 3C99A 3DXKC 2H68A 5HE3B 2I0SA 3I7NA 3VH0A 4A09A 5IGOA 4J8GA 1K32A 3FGBA 3VA6A 4CZXA 4PBZA 5HYNB 4N14A 4IMMA 2GNQA 2YNOA 5EAMA 1NR0A 2IURA 2GC4A 5GSAA 4L3HD 5IT9g 3OTTA 3EI1A 5H17A 1JMXB 5FXYA 4ES0A 1U2VC 4Y5RD 3RN0D 2AGLA 3EU7A 4J8BA 4J87A 5EMMB 1Q47A 5SXMA 3EI4B 2QC5A 3V9FA 5CXBB 3GFCA 4J77A 4FA4D 2HJ4A 3OW8A 3PVWB 2GC7A 2CE8A 4CY2A 4UI9R 1PEVA 4NSXA 1PGUA 4J0WA 5A2Qg 2OVPB 5EMKB 3HFQA 4CI3A 4QL1A 4HDJA 4A2MA 5CXCB 3MZLA 5FKQA 3SBPA 3SN6B 2B5NA 4CY1A 1OMWB 1GP2B 2OIZA 2HKRA 4EWRA 1GXRA 2G99A 2OK4A 4ZOXA 1N6DA 3FRXA 3OKYB 5CXBA 5EM2A 1JJUB 1K8KC 3JROA 3VGZA 1ERJA 2B5MA 1A0RB 1GOTB 2YMUA 2H6NA 3UR4A 2CO0A 4GGCA 1JOFA 4G56B 2IAAA 5HE2B 4GQ2P 5HE0B 4LG8A 4PSWB 2H13A 1SQJA 4FHLA 4J0XA 1FWXA 4FWWA 4E54B 5TF2A 4IA9A 4U1EI 5I5IA 1QNIA 3F3FA 4X60B 2PM9B 3SCYA 4A0AB 3AL8B 4AOWA 3ORVD 3EI2B 2I3SA 3ODTA 3C5MA 4FAVD 2AGYA 1YFQA 2H6QA 3I7LA 4PBYA 1VYHC 4L1QD 3U4YA 2O9KA 4XYHA 3AH8B 3V5WB 2BBKH 3C9CA 4GM9A 5C2VB 1R5MA 3MKSB 4XYIA 2EBSA 3EI3A 4JSVC 5I5JA 4QQEA 2OJYA 5FKRA 2Z2NA 3UVLA 2AGZA 4CC9A 4A08B 5GXIA 2P9SC 3AL8A 4MK0B 2P9LC 2G9AA 2UZXB 5AJAA 2H14A 4K3ID 3JZNA 3OL2B 5FKSA 4J78A 3CFVA 3DSMA 4ZOZA 4CY5A 4BH6A 4H5IA 4U7AA 3RRMC 4CZVA 3J80g 3IJ0A 2XL3A 3SMRA 5HQGA 4ESGA 2AGXA 2PBIB 2YBAA 5EMLB 3NVQA 1OLZA 3PXWD 4J86A 5GMKn 4ZOYA 2HESX 3K27A 1L0QA 2Z2OA 5IC7A 3SHFA 2MTAH 5TEFA 3I7OA 5AMSA 2P9KC 4J81A 3C75H 3JB9L 2XU7A 4FA5D 3F3PA 4BUJC 3I7PA 2YNPA 3JZGA 3PSLA 5CYKB 2PM7B 5H14A 1PBYB 4JXMA 4JSXC 1S4UX 3MMYA 3L4OD 1N6FA 3MXXA 4BL0A 1PI6A 4CI2A 3SLED 4J79A 3EI4A 5TDHB 3SXTD 3SJLD 1MDAH 2J57G 4J84A 2H9MA 3BG1A 2H47A 3K26A 3PSCB 4TZ4A 5K19A 2BCJB 3EMHA 1SQ9A 3RFHA 2OK6A 3J81g 3UVNA 3I2NA 4LG9A 4Z8LA 1U4CA 2CN3A 3PE7A 5FLXg 5CXCA 4K3JB 4ZN4A 3JAMg 3IKOA 3SVWD 3OKWA 3IIYA 4FAND 4I79A 5EARA 3EWEA 3OKYA 4PXWA 5GXHA 2YB8B 4O1QD 4CI1A 4PNKB 2UZYB 4XEIC 3PVUB 2H9NA 2I0TA 5EAPA 4O45A 3DM0A 4QT8A 3SBQA 1NEXB 4ERQA 1SHYB 4A11B 3SBRA 2H3XA 3UVKA 4JSPC 4GGAA 3KRWB 2IUQA 2AQ5A 4E54A 4GM8A 3I89A 3JRPA 4Y7RA 1XIPA 4YVDA 3RMZD 4R7AB 5IGQA 4A09B 4A0AA 2PM9A 4O9DA 5I5MA 2I0RA 3UVMA 3EI2A 1TBGA 5EMJB 2H9PA 3W15A 3ULEC 2IWFA 4QRJA 4FB1D 2QXVA 5AFU3 3MKQA 2HJBA 2XL2A 4X61B 5THAA 4GM3A 4ERYA 4L9OA 1B9YA 1XKSA 5FA5B 4A2LA 3I8EA 3UKRC 3EI1B 5EALA 4PSXB 1MG3A 3GREA 4A08A 2W18A 3PXSD 4AEZA 4OWRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RSE C;  2XYI A;  3OL2 A;  4ERZ A;  3JPX A;  4ZOV A;  4CY3 A;  5IJ8 E;  4JT5 C;  4OZU A;  5K1C C;  3I7H A;  3JZH A;  3CFS B;  2IUV A;  4FA9 D;  4J82 A;  4L3G D;  3V7D B;  3I8C A;  3OKT A;  2CN2 A;  2B4E A;  2TRC B;  3F3G A;  3DWL C;  2I3T A;  2OVR B;  4O3T B;  4E5Z B;  3L4M D;  4X63 B;  5EM2 B;  2AH1 A;  1XHM A;  4PC0 A;  5HE1 B;  3DXM C;  3RFG A;  3N0D A;  2IWK A;  2H9L A;  1N6E A;  2J55 H;  3RN1 D;  3CIK B;  5KDO B;  1GG2 B;  3KRX B;  2PM6 B;  5CYK A;  2P9U C;  3IIW A;  3B7F A;  4JT6 C;  2IUP A;  3AFC A;  3NVX A;  3NVN A;  3P4F A;  4GGD A;  4E5Z A;  4JSN C;  2H6K A;  1TYQ C;  3SWS D;  2J56 H;  2P9N C;  3IJC A;  2YNN A;  3IJ1 A;  2Z2P A;  1MG2 A;  4A0B B;  4J73 A;  3EI3 B;  3FM0 A;  4LGN A;  3UVO A;  4GMB A;  3PXT D;  3EG6 A;  2CNX A;  1B9X A;  2AH0 A;  4A7J A;  1RI6 A;  2OVQ B;  4D0K A;  5FQD A;  3AL9 A;  3UKU C;  2HXC A;  4GQ1 A;  3A0F A;  2HKM A;  3N0E A;  4H5J A;  4CI8 A;  3MZK A;  4X3E A;  3I7K A;  4GQB B;  4GZ8 A;  5B4W A;  2P9I C;  3RLM D;  1JMZ B;  4JD2 C;  3E0C A;  3BWS A;  2Q7Q A;  4KFM B;  2HYE A;  4A0B A;  3ZWL B;  1P22 A;  5FKT A;  2B5L A;  2CE9 A;  4D6V A;  5JWZ A;  3SFZ A;  2AGW A;  5H1M A;  4FA1 D;  2CO0 C;  4O3U B;  4A11 A;  4CZY A;  2P9P C;  5IJ7 E;  3BG0 A;  5C9Z B;  5TEE A;  5C2W B;  3C99 A;  3DXK C;  2H68 A;  5HE3 B;  2I0S A;  3I7N A;  3VH0 A;  4A09 A;  5IGO A;  4J8G A;  1K32 A;  3FGB A;  3VA6 A;  4CZX A;  4PBZ A;  5HYN B;  4N14 A;  4IMM A;  2GNQ A;  2YNO A;  5EAM A;  1NR0 A;  2IUR A;  2GC4 A;  5GSA A;  4L3H D;  5IT9 g;  3OTT A;  3EI1 A;  5H17 A;  1JMX B;  5FXY A;  4ES0 A;  1U2V C;  4Y5R D;  3RN0 D;  2AGL A;  3EU7 A;  4J8B A;  4J87 A;  5EMM B;  1Q47 A;  5SXM A;  3EI4 B;  2QC5 A;  3V9F A;  5CXB B;  3GFC A;  4J77 A;  4FA4 D;  2HJ4 A;  3OW8 A;  3PVW B;  2GC7 A;  2CE8 A;  4CY2 A;  4UI9 R;  1PEV A;  4NSX A;  1PGU A;  4J0W A;  5A2Q g;  2OVP B;  5EMK B;  3HFQ A;  4CI3 A;  4QL1 A;  4HDJ A;  4A2M A;  5CXC B;  3MZL A;  5FKQ A;  3SBP A;  3SN6 B;  2B5N A;  4CY1 A;  1OMW B;  1GP2 B;  2OIZ A;  2HKR A;  4EWR A;  1GXR A;  2G99 A;  2OK4 A;  4ZOX A;  1N6D A;  3FRX A;  3OKY B;  5CXB A;  5EM2 A;  1JJU B;  1K8K C;  3JRO A;  3VGZ A;  1ERJ A;  2B5M A;  1A0R B;  1GOT B;  2YMU A;  2H6N A;  3UR4 A;  2CO0 A;  4GGC A;  1JOF A;  4G56 B;  2IAA A;  5HE2 B;  4GQ2 P;  5HE0 B;  4LG8 A;  4PSW B;  2H13 A;  1SQJ A;  4FHL A;  4J0X A;  1FWX A;  4FWW A;  4E54 B;  5TF2 A;  4IA9 A;  4U1E I;  5I5I A;  1QNI A;  3F3F A;  4X60 B;  2PM9 B;  3SCY A;  4A0A B;  3AL8 B;  4AOW A;  3ORV D;  3EI2 B;  2I3S A;  3ODT A;  3C5M A;  4FAV D;  2AGY A;  1YFQ A;  2H6Q A;  3I7L A;  4PBY A;  1VYH C;  4L1Q D;  3U4Y A;  2O9K A;  4XYH A;  3AH8 B;  3V5W B;  2BBK H;  3C9C A;  4GM9 A;  5C2V B;  1R5M A;  3MKS B;  4XYI A;  2EBS A;  3EI3 A;  4JSV C;  5I5J A;  4QQE A;  2OJY A;  5FKR A;  2Z2N A;  3UVL A;  2AGZ A;  4CC9 A;  4A08 B;  5GXI A;  2P9S C;  3AL8 A;  4MK0 B;  2P9L C;  2G9A A;  2UZX B;  5AJA A;  2H14 A;  4K3I D;  3JZN A;  3OL2 B;  5FKS A;  4J78 A;  3CFV A;  3DSM A;  4ZOZ A;  4CY5 A;  4BH6 A;  4H5I A;  4U7A A;  3RRM C;  4CZV A;  3J80 g;  3IJ0 A;  2XL3 A;  3SMR A;  5HQG A;  4ESG A;  2AGX A;  2PBI B;  2YBA A;  5EML B;  3NVQ A;  1OLZ A;  3PXW D;  4J86 A;  5GMK n;  4ZOY A;  2HES X;  3K27 A;  1L0Q A;  2Z2O A;  5IC7 A;  3SHF A;  2MTA H;  5TEF A;  3I7O A;  5AMS A;  2P9K C;  4J81 A;  3C75 H;  3JB9 L;  2XU7 A;  4FA5 D;  3F3P A;  4BUJ C;  3I7P A;  2YNP A;  3JZG A;  3PSL A;  5CYK B;  2PM7 B;  5H14 A;  1PBY B;  4JXM A;  4JSX C;  1S4U X;  3MMY A;  3L4O D;  1N6F A;  3MXX A;  4BL0 A;  1PI6 A;  4CI2 A;  3SLE D;  4J79 A;  3EI4 A;  5TDH B;  3SXT D;  3SJL D;  1MDA H;  2J57 G;  4J84 A;  2H9M A;  3BG1 A;  2H47 A;  3K26 A;  3PSC B;  4TZ4 A;  5K19 A;  2BCJ B;  3EMH A;  1SQ9 A;  3RFH A;  2OK6 A;  3J81 g;  3UVN A;  3I2N A;  4LG9 A;  4Z8L A;  1U4C A;  2CN3 A;  3PE7 A;  5FLX g;  5CXC A;  4K3J B;  4ZN4 A;  3JAM g;  3IKO A;  3SVW D;  3OKW A;  3IIY A;  4FAN D;  4I79 A;  5EAR A;  3EWE A;  3OKY A;  4PXW A;  5GXH A;  2YB8 B;  4O1Q D;  4CI1 A;  4PNK B;  2UZY B;  4XEI C;  3PVU B;  2H9N A;  2I0T A;  5EAP A;  4O45 A;  3DM0 A;  4QT8 A;  3SBQ A;  1NEX B;  4ERQ A;  1SHY B;  4A11 B;  3SBR A;  2H3X A;  3UVK A;  4JSP C;  4GGA A;  3KRW B;  2IUQ A;  2AQ5 A;  4E54 A;  4GM8 A;  3I89 A;  3JRP A;  4Y7R A;  1XIP A;  4YVD A;  3RMZ D;  4R7A B;  5IGQ A;  4A09 B;  4A0A A;  2PM9 A;  4O9D A;  5I5M A;  2I0R A;  3UVM A;  3EI2 A;  1TBG A;  5EMJ B;  2H9P A;  3W15 A;  3ULE C;  2IWF A;  4QRJ A;  4FB1 D;  2QXV A;  5AFU 3;  3MKQ A;  2HJB A;  2XL2 A;  4X61 B;  5THA A;  4GM3 A;  4ERY A;  4L9O A;  1B9Y A;  1XKS A;  5FA5 B;  4A2L A;  3I8E A;  3UKR C;  3EI1 B;  5EAL A;  4PSX B;  1MG3 A;  3GRE A;  4A08 A;  2W18 A;  3PXS D;  4AEZ A;  4OWR A; 
#chains in the Genus database with same CATH topology
 3RSE C;  1E8N A;  1GOG A;  2XYI A;  3OL2 A;  4ERZ A;  3JPX A;  4ZOV A;  4CY3 A;  5IJ8 E;  4JT5 C;  4OZU A;  5K1C C;  3I7H A;  3IUM A;  3JZH A;  3CFS B;  4DNW A;  2IUV A;  4FA9 D;  4J82 A;  4L3G D;  3V7D B;  3I8C A;  5C86 A;  3OKT A;  2CN2 A;  3KCI A;  2B4E A;  2TRC B;  3F3G A;  3DWL C;  2EIB A;  2I3T A;  4AX4 A;  2OVR B;  2XDW A;  4O3T B;  3L4M D;  4X63 B;  4E5Z B;  5EM2 B;  2AH1 A;  1XHM A;  4L1M A;  4PC0 A;  2EID A;  5HE1 B;  3DXM C;  3RFG A;  3N0D A;  2IWK A;  4RE5 A;  2H9L A;  1E8M A;  1N6E A;  3T3M A;  2J55 H;  2VC2 A;  3RN1 D;  3CIK B;  5KDO B;  1GG2 B;  1UOP A;  3KRX B;  3T3P A;  3GC3 B;  2PM6 B;  5CYK A;  2P9U C;  3IIW A;  3B7F A;  4JT6 C;  2IUP A;  3AFC A;  3NVX A;  3NVN A;  3P4F A;  4GGD A;  2VDP A;  3IUN A;  4E5Z A;  2HU7 A;  4JSN C;  2H6K A;  1TYQ C;  3SWS D;  4O2W A;  2J56 H;  5HDB A;  2P9N C;  3IJC A;  2YNN A;  3IJ1 A;  2Z2P A;  1MG2 A;  5C92 A;  3FCS A;  4A0B B;  4J73 A;  3EI3 B;  3FM0 A;  4MMZ A;  2VZ3 A;  4LGN A;  1O6G A;  3UVO A;  4GMB A;  1VE7 A;  3ZDY A;  3PXT D;  2EIC A;  3EG6 A;  2CNX A;  1B9X A;  2AH0 A;  2XZG A;  4QAM A;  4A7J A;  1RI6 A;  2OVQ B;  4D0K A;  5FQD A;  1H2W A;  3AL9 A;  3UKU C;  1JV2 A;  2HXC A;  4GQ1 A;  3A0F A;  2HKM A;  3N0E A;  4H5J A;  4CI8 A;  3MZK A;  2VDQ A;  4BCD A;  4X3E A;  3IJE A;  3O4I A;  3I7K A;  4GQB B;  4GZ8 A;  5B4W A;  2P9I C;  3RLM D;  1JMZ B;  4JD2 C;  3E0C A;  4BCB A;  3BWS A;  2Q7Q A;  4KFM B;  2HYE A;  3EQ8 A;  4A0B A;  3ZWL B;  1P22 A;  5FKT A;  2B5L A;  4BP8 A;  2CE9 A;  4D6V A;  5JWZ A;  3SFZ A;  3VI3 A;  2AGW A;  5H1M A;  4AN1 A;  4FA1 D;  2CO0 C;  4O3U B;  4A11 A;  4CZY A;  2P9P C;  1M1X A;  5IJ7 E;  3BG0 A;  5C9Z B;  1H2X A;  5TEE A;  5C2W B;  3C99 A;  3DXK C;  2H68 A;  5HE3 B;  3NID A;  1GOF A;  2I0S A;  3I7N A;  3VH0 A;  4A09 A;  5IGO A;  4J8G A;  1K32 A;  3FGB A;  3VA6 A;  3ZE2 A;  4CZX A;  4PBZ A;  5HYN B;  4N14 A;  4IMM A;  1UOQ A;  2GNQ A;  2YNO A;  3FCU A;  3MUN A;  5EAM A;  1NR0 A;  2IUR A;  2GC4 A;  5GSA A;  4L3H D;  5IT9 g;  3OTT A;  3EI1 A;  1GOH A;  5H17 A;  1JMX B;  5FXY A;  4ES0 A;  1U2V C;  4Y5R D;  3RN0 D;  3O4G A;  2AGL A;  3EU7 A;  4J8B A;  4J87 A;  5EMM B;  1Q47 A;  5SXM A;  3EI4 B;  2QC5 A;  5M5U A;  3V9F A;  5CXB B;  3GFC A;  4J77 A;  4FA4 D;  2HJ4 A;  3OW8 A;  1JTD B;  2VZ1 A;  3PVW B;  2GC7 A;  2CE8 A;  4CY2 A;  2WQ8 A;  4UI9 R;  1PEV A;  4NSX A;  1PGU A;  4J0W A;  4O02 A;  5A2Q g;  2OVP B;  5EMK B;  3HFQ A;  4CI3 A;  4QL1 A;  4HDJ A;  4A2M A;  5CXC B;  3MZL A;  4NEN A;  4WK2 A;  5FKQ A;  1BPO A;  3SBP A;  3SN6 B;  2B5N A;  4CY1 A;  1OMW B;  1GP2 B;  2OIZ A;  3ZE1 A;  2HKR A;  4EWR A;  1GXR A;  2G99 A;  2OK4 A;  4ZOX A;  1N6D A;  3FRX A;  3OKY B;  5M5V A;  5CXB A;  5EM2 A;  1JJU B;  1K8K C;  3JRO A;  3VGZ A;  1ERJ A;  2B5M A;  1A0R B;  1GOT B;  2YMU A;  5E6R A;  2H6N A;  5E6U A;  3UR4 A;  2CO0 A;  4GGC A;  1JOF A;  3EQ7 A;  4G56 B;  2IAA A;  4NC4 A;  4WK0 A;  4NBM A;  5HE2 B;  4D9S A;  4GQ2 P;  5HE0 B;  4LG8 A;  4PSW B;  2H13 A;  1SQJ A;  4FHL A;  4J0X A;  3ZDX A;  1FWX A;  4FWW A;  1L5G A;  2VDN A;  4E54 B;  5TF2 A;  4IA9 A;  1QFS A;  4U1E I;  5I5I A;  1QNI A;  3F3F A;  4X60 B;  2PM9 B;  3SCY A;  4A0A B;  3AL8 B;  4AOW A;  4DNU A;  3ORV D;  3EI2 B;  2VDR A;  1C9L A;  3O4J A;  2I3S A;  3ODT A;  1H2Y A;  3C5M A;  4G55 A;  4FAV D;  3IVM A;  2AGY A;  1YFQ A;  3DDU A;  2H6Q A;  3I7L A;  4PBY A;  1VYH C;  2QZP A;  4L1Q D;  3U4Y A;  2O9K A;  4XYH A;  3AH8 B;  3V5W B;  5M5T A;  2BBK H;  3C9C A;  4GM9 A;  5C2V B;  1R5M A;  3MKS B;  4XYI A;  5M5R A;  2EBS A;  3EI3 A;  4JSV C;  5I5J A;  1UOO A;  4QQE A;  2OJY A;  5FKR A;  2Z2N A;  3UVL A;  2AGZ A;  4BP9 A;  4CC9 A;  4Z7O A;  4A08 B;  2VDO A;  3IUQ A;  1H2Z A;  5GXI A;  2P9S C;  3AL8 A;  4MK0 B;  2P9L C;  2G9A A;  2UZX B;  5AJA A;  2H14 A;  3QHY B;  4K3I D;  4IRZ A;  3JZN A;  3OL2 B;  5M61 A;  3OF7 A;  5FKS A;  2VDM A;  4J78 A;  3CFV A;  3DSM A;  3MVD K;  2VDL A;  4ZOZ A;  1C9I A;  4CY5 A;  4BH6 A;  4H5I A;  4U7A A;  3RRM C;  5FFO A;  4CZV A;  3J80 g;  3IJ0 A;  3K71 A;  2XL3 A;  3SMR A;  5HQG A;  4ESG A;  1A12 A;  4AMY A;  2AGX A;  2PBI B;  2YBA A;  5EML B;  3QI0 A;  2HU8 A;  3NVQ A;  1OLZ A;  3PXW D;  4J86 A;  4NAA A;  5GMK n;  4ZOY A;  2HES X;  3K27 A;  1L0Q A;  2Z2O A;  3V4V A;  5IC7 A;  3SHF A;  2MTA H;  5TEF A;  3I7O A;  4Z7N A;  5AMS A;  2P9K C;  3NIG A;  4J81 A;  3C75 H;  3JB9 L;  2XU7 A;  4FA5 D;  3F3P A;  4BUJ C;  4DNV A;  1E5T A;  3I7P A;  1VZ3 A;  2XE4 A;  2YNP A;  3JZG A;  3PSL A;  5CYK B;  2PM7 B;  4G1M A;  3NIF A;  5H14 A;  4UM8 A;  1PBY B;  4JXM A;  4JSX C;  1S4U X;  2JKX A;  3MMY A;  3L4O D;  4RE6 A;  1T2X A;  1N6F A;  3MXX A;  4BL0 A;  1PI6 A;  4MMY A;  4CI2 A;  1QFM A;  1VZ2 A;  3SLE D;  4UM9 A;  4J79 A;  4AMZ A;  3EI4 A;  5TDH B;  3SXT D;  1O6F A;  3SJL D;  1MDA H;  2J57 G;  4J84 A;  2H9M A;  3BG1 A;  1I2M B;  3IUL A;  2H47 A;  3K26 A;  3IUJ A;  3PSC B;  4TZ4 A;  3ZDZ A;  2BCJ B;  5K19 A;  3EMH A;  1SQ9 A;  3RFH A;  2OK6 A;  3J81 g;  3UVN A;  3VI4 A;  4JHP C;  3I2N A;  2VDK A;  1TYE A;  4LG9 A;  3K6S A;  3O4H A;  4Z8L A;  1U4C A;  2CN3 A;  3PE7 A;  5FLX g;  5CXC A;  4K3J B;  4ZN4 A;  3JAM g;  3IKO A;  3SVW D;  3ZE0 A;  3OKW A;  2BKL A;  3IIY A;  4FAN D;  2EIE A;  4I79 A;  5EAR A;  2HU5 A;  3EWE A;  3OKY A;  5M5S A;  4PXW A;  3GD1 I;  5GXH A;  2YB8 B;  4O1Q D;  4CI1 A;  4PNK B;  2UZY B;  4XEI C;  3PVU B;  2H9N A;  2I0T A;  4Z7Q A;  5EAP A;  4O45 A;  3DM0 A;  4JHN A;  4BCC A;  4QT8 A;  4MMX A;  1UTC A;  3SBQ A;  1NEX B;  4ERQ A;  1SHY B;  4A11 B;  3SBR A;  2H3X A;  5FFG A;  4JSP C;  4GGA A;  3K72 A;  3UVK A;  4AN0 A;  3KRW B;  2IUQ A;  4WK4 A;  2AQ5 A;  4E54 A;  4WJK A;  4GM8 A;  3I89 A;  3JRP A;  4Y7R A;  1XIP A;  4YVD A;  3RMZ D;  4R7A B;  5IGQ A;  4A09 B;  4A0A A;  2PM9 A;  4O9D A;  5I5M A;  2I0R A;  3UVM A;  3EI2 A;  1TBG A;  5EMJ B;  1YR2 A;  5E6S A;  2H9P A;  3W15 A;  3ULE C;  2IWF A;  4QRJ A;  4FB1 D;  2QXV A;  5AFU 3;  3MKQ A;  3IUR A;  2HJB A;  2XL2 A;  4X61 B;  5THA A;  4GM3 A;  3V4P A;  4ERY A;  4L9O A;  1B9Y A;  1VE6 A;  1XKS A;  5FA5 B;  4A2L A;  3I8E A;  4G1E A;  3UKR C;  5EAL A;  3EI1 B;  1U8C A;  4PSX B;  2QR5 A;  1MG3 A;  3GRE A;  4A08 A;  2W18 A;  3PXS D;  4AEZ A;  4OWR A;  3MUO A;  3EQ9 A;  1K3I A; 
#chains in the Genus database with same CATH homology
 3RSE C;  2XYI A;  3OL2 A;  4ERZ A;  3JPX A;  4ZOV A;  4CY3 A;  5IJ8 E;  4JT5 C;  4OZU A;  5K1C C;  3I7H A;  3JZH A;  3CFS B;  2IUV A;  4FA9 D;  4J82 A;  4L3G D;  3V7D B;  3I8C A;  3OKT A;  2CN2 A;  2B4E A;  2TRC B;  3F3G A;  3DWL C;  2I3T A;  2OVR B;  4O3T B;  4E5Z B;  3L4M D;  4X63 B;  5EM2 B;  2AH1 A;  1XHM A;  4PC0 A;  5HE1 B;  3DXM C;  3RFG A;  3N0D A;  2IWK A;  2H9L A;  1N6E A;  2J55 H;  3RN1 D;  3CIK B;  5KDO B;  1GG2 B;  3KRX B;  2PM6 B;  5CYK A;  2P9U C;  3IIW A;  3B7F A;  4JT6 C;  2IUP A;  3AFC A;  3NVX A;  3NVN A;  3P4F A;  4GGD A;  4E5Z A;  4JSN C;  2H6K A;  1TYQ C;  3SWS D;  2J56 H;  2P9N C;  3IJC A;  2YNN A;  3IJ1 A;  2Z2P A;  1MG2 A;  4A0B B;  4J73 A;  3EI3 B;  3FM0 A;  4LGN A;  3UVO A;  4GMB A;  3PXT D;  3EG6 A;  2CNX A;  1B9X A;  2AH0 A;  4A7J A;  1RI6 A;  2OVQ B;  4D0K A;  5FQD A;  3AL9 A;  3UKU C;  2HXC A;  4GQ1 A;  3A0F A;  2HKM A;  3N0E A;  4H5J A;  4CI8 A;  3MZK A;  4X3E A;  3I7K A;  4GQB B;  4GZ8 A;  5B4W A;  2P9I C;  3RLM D;  1JMZ B;  4JD2 C;  3E0C A;  3BWS A;  2Q7Q A;  4KFM B;  2HYE A;  4A0B A;  3ZWL B;  1P22 A;  5FKT A;  2B5L A;  2CE9 A;  4D6V A;  5JWZ A;  3SFZ A;  2AGW A;  5H1M A;  4FA1 D;  2CO0 C;  4O3U B;  4A11 A;  4CZY A;  2P9P C;  5IJ7 E;  3BG0 A;  5C9Z B;  5TEE A;  5C2W B;  3C99 A;  3DXK C;  2H68 A;  5HE3 B;  2I0S A;  3I7N A;  3VH0 A;  4A09 A;  5IGO A;  4J8G A;  1K32 A;  3FGB A;  3VA6 A;  4CZX A;  4PBZ A;  5HYN B;  4N14 A;  4IMM A;  2GNQ A;  2YNO A;  5EAM A;  1NR0 A;  2IUR A;  2GC4 A;  5GSA A;  4L3H D;  5IT9 g;  3OTT A;  3EI1 A;  5H17 A;  1JMX B;  5FXY A;  4ES0 A;  1U2V C;  4Y5R D;  3RN0 D;  2AGL A;  3EU7 A;  4J8B A;  4J87 A;  5EMM B;  1Q47 A;  5SXM A;  3EI4 B;  2QC5 A;  3V9F A;  5CXB B;  3GFC A;  4J77 A;  4FA4 D;  2HJ4 A;  3OW8 A;  3PVW B;  2GC7 A;  2CE8 A;  4CY2 A;  4UI9 R;  1PEV A;  4NSX A;  1PGU A;  4J0W A;  5A2Q g;  2OVP B;  5EMK B;  3HFQ A;  4CI3 A;  4QL1 A;  4HDJ A;  4A2M A;  5CXC B;  3MZL A;  5FKQ A;  3SBP A;  3SN6 B;  2B5N A;  4CY1 A;  1OMW B;  1GP2 B;  2OIZ A;  2HKR A;  4EWR A;  1GXR A;  2G99 A;  2OK4 A;  4ZOX A;  1N6D A;  3FRX A;  3OKY B;  5CXB A;  5EM2 A;  1JJU B;  1K8K C;  3JRO A;  3VGZ A;  1ERJ A;  2B5M A;  1A0R B;  1GOT B;  2YMU A;  2H6N A;  3UR4 A;  2CO0 A;  4GGC A;  1JOF A;  4G56 B;  2IAA A;  5HE2 B;  4GQ2 P;  5HE0 B;  4LG8 A;  4PSW B;  2H13 A;  1SQJ A;  4FHL A;  4J0X A;  1FWX A;  4FWW A;  4E54 B;  5TF2 A;  4IA9 A;  4U1E I;  5I5I A;  1QNI A;  3F3F A;  4X60 B;  2PM9 B;  3SCY A;  4A0A B;  3AL8 B;  4AOW A;  3ORV D;  3EI2 B;  2I3S A;  3ODT A;  3C5M A;  4FAV D;  2AGY A;  1YFQ A;  2H6Q A;  3I7L A;  4PBY A;  1VYH C;  4L1Q D;  3U4Y A;  2O9K A;  4XYH A;  3AH8 B;  3V5W B;  2BBK H;  3C9C A;  4GM9 A;  5C2V B;  1R5M A;  3MKS B;  4XYI A;  2EBS A;  3EI3 A;  4JSV C;  5I5J A;  4QQE A;  2OJY A;  5FKR A;  2Z2N A;  3UVL A;  2AGZ A;  4CC9 A;  4A08 B;  5GXI A;  2P9S C;  3AL8 A;  4MK0 B;  2P9L C;  2G9A A;  2UZX B;  5AJA A;  2H14 A;  4K3I D;  3JZN A;  3OL2 B;  5FKS A;  4J78 A;  3CFV A;  3DSM A;  4ZOZ A;  4CY5 A;  4BH6 A;  4H5I A;  4U7A A;  3RRM C;  4CZV A;  3J80 g;  3IJ0 A;  2XL3 A;  3SMR A;  5HQG A;  4ESG A;  2AGX A;  2PBI B;  2YBA A;  5EML B;  3NVQ A;  1OLZ A;  3PXW D;  4J86 A;  5GMK n;  4ZOY A;  2HES X;  3K27 A;  1L0Q A;  2Z2O A;  5IC7 A;  3SHF A;  2MTA H;  5TEF A;  3I7O A;  5AMS A;  2P9K C;  4J81 A;  3C75 H;  3JB9 L;  2XU7 A;  4FA5 D;  3F3P A;  4BUJ C;  3I7P A;  2YNP A;  3JZG A;  3PSL A;  5CYK B;  2PM7 B;  5H14 A;  1PBY B;  4JXM A;  4JSX C;  1S4U X;  3MMY A;  3L4O D;  1N6F A;  3MXX A;  4BL0 A;  1PI6 A;  4CI2 A;  3SLE D;  4J79 A;  3EI4 A;  5TDH B;  3SXT D;  3SJL D;  1MDA H;  2J57 G;  4J84 A;  2H9M A;  3BG1 A;  2H47 A;  3K26 A;  3PSC B;  4TZ4 A;  5K19 A;  2BCJ B;  3EMH A;  1SQ9 A;  3RFH A;  2OK6 A;  3J81 g;  3UVN A;  3I2N A;  4LG9 A;  4Z8L A;  1U4C A;  2CN3 A;  3PE7 A;  5FLX g;  5CXC A;  4K3J B;  4ZN4 A;  3JAM g;  3IKO A;  3SVW D;  3OKW A;  3IIY A;  4FAN D;  4I79 A;  5EAR A;  3EWE A;  3OKY A;  4PXW A;  5GXH A;  2YB8 B;  4O1Q D;  4CI1 A;  4PNK B;  2UZY B;  4XEI C;  3PVU B;  2H9N A;  2I0T A;  5EAP A;  4O45 A;  3DM0 A;  4QT8 A;  3SBQ A;  1NEX B;  4ERQ A;  1SHY B;  4A11 B;  3SBR A;  2H3X A;  3UVK A;  4JSP C;  4GGA A;  3KRW B;  2IUQ A;  2AQ5 A;  4E54 A;  4GM8 A;  3I89 A;  3JRP A;  4Y7R A;  1XIP A;  4YVD A;  3RMZ D;  4R7A B;  5IGQ A;  4A09 B;  4A0A A;  2PM9 A;  4O9D A;  5I5M A;  2I0R A;  3UVM A;  3EI2 A;  1TBG A;  5EMJ B;  2H9P A;  3W15 A;  3ULE C;  2IWF A;  4QRJ A;  4FB1 D;  2QXV A;  5AFU 3;  3MKQ A;  2HJB A;  2XL2 A;  4X61 B;  5THA A;  4GM3 A;  4ERY A;  4L9O A;  1B9Y A;  1XKS A;  5FA5 B;  4A2L A;  3I8E A;  3UKR C;  3EI1 B;  5EAL A;  4PSX B;  1MG3 A;  3GRE A;  4A08 A;  2W18 A;  3PXS D;  4AEZ A;  4OWR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...