4GQ2P

S. pombe nup120-nup37 complex
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
382
structure length
371
Chain Sequence
NQYQLPLNVRPYTTTWCSQSPSCSNLLAIGHDTGITIYCASEEQTPGSTGLTLQELFTIQTGLPTLHLSFSSSCSYSESPVYSLFLACVCQDNTVRLIITKNETIITQHVLGGKSGHHNFVNDIDIADVYSADNRLAEQVIASVGDDCTLIIWRLTDEGPILAGYPLSSPGISVQFRPSNPNQLIVGERNGNIRIFDWTLNLSAEENSQTELVKNPWLLTLNTLPLVNTCHSSGIASSLANVRWIGSDGSGILAMCKSGAWLRWNLFANNDYNEISDSTMKLGPKNLLPNVQGISLFPSLLGACPHPRYMDYFATAHSQHGLIQLINTYEKDSNSIPIQLGMPIVDFCWHQDGSHLAIATEGSVLLTRLMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoporin nup120
publication title Structural evolution of the membrane-coating module of the nuclear pore complex.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transport protein
total genus 81
structure length 371
sequence length 382
ec nomenclature
pdb deposition date 2012-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4gq2P00
1RI6A 2EBSA 3OL2B 4XYHA 2CO0A 4J81A 4A0AB 3EI4B 2CN3A 3F3FA 2J55H 4J8GA 5GXIA 3HFQA 4E54B 3VH0A 3UVNA 2UZYB 4GQ1A 2CE8A 3PXSD 4J8BA 4JD2C 1JJUB 4A2MA 5C9ZB 2BCJB 5KDOB 2QC5A 2IWFA 3BWSA 3J81g 2AGYA 2HJBA 3I7HA 2G9AA 3EI1A 3DXMC 4GGCA 4U7AA 5HQGA 4PC0A 1U4CA 4YVDA 3JPXA 3V9FA 3OKTA 1PGUA 4L1QD 3V5WB 1VYHC 1JOFA 3AH8B 1K32A 4FHLA 2I0TA 4GM9A 3SFZA 2H9MA 3K27A 2I0SA 5C2VB 5I5MA 4JSXC 3ULEC 5GMKn 1U2VC 4LGNA 4PXWA 5K19A 2O9KA 5EAMA 3EMHA 5HE3B 4FB1D 5HYNB 3C99A 4J84A 3NVXA 2H9PA 3VGZA 3RRMC 3SJLD 4A11B 2BBKH 4ESGA 3KRWB 3OL2A 3FRXA 3UKUC 3JRPA 3I89A 4GM8A 4U1EI 1FWXA 4A0AA 3EI4A 3MZLA 2I3TA 4E54A 1OLZA 4ERQA 4D6VA 3RSEC 3L4OD 3PVWB 4X3EA 1SQJA 3RMZD 4A08B 5B4WA 4XEIC 3SHFA 1Q47A 4CY3A 4XYIA 4R7AB 3CFSB 3SBQA 2PM9B 4L3HD 3RN0D 3EI2A 5TEEA 2HKRA 5K1CC 3PXWD 4CC9A 4OWRA 4GZ8A 3CIKB 4FA5D 3EU7A 4LG9A 4BL0A 1JMZB 3N0EA 2P9UC 2G99A 3OTTA 5JWZA 1MDAH 2PM7B 4I79A 4GGDA 4JXMA 4A09B 4CY2A 2IUQA 1N6DA 1OMWB 2CN2A 3SBRA 1GG2B 3IJ0A 3IJ1A 3BG1A 4CZXA 4Z8LA 4PSXB 4X60B 4GQBB 4O45A 4ZN4A 3C75H 4L3GD 3U4YA 2Z2OA 4A11A 2YBAA 3IIYA 3EI3A 5EMKB 3I2NA 4PBYA 3UR4A 2HESX 4Y5RD 4O3UB 4CZYA 4HDJA 3C5MA 5AMSA 3MMYA 2H47A 3KRXB 3MZKA 5I5JA 4IA9A 3CFVA 4N14A 2YMUA 2IURA 4A08A 3ORVD 3JZGA 3V7DB 2XL2A 3SN6B 2OVPB 4JSPC 1GP2B 2PM9A 5TDHB 3EI2B 3IIWA 5IJ7E 2YNOA 3GREA 1B9YA 4BUJC 2YNPA 5EALA 3OKWA 5IC7A 4J82A 4L9OA 4AOWA 5IT9g 1S4UX 4E5ZB 1GXRA 2CNXA 4ZOVA 1P22A 4A09A 2GNQA 1XKSA 2XL3A 4CI1A 1SHYB 3EWEA 2OK6A 2XYIA 3FGBA 5SXMA 3SVWD 5FKQA 5HE1B 4ES0A 5TF2A 3E0CA 3VA6A 3PVUB 4A2LA 5FKSA 4FAND 3OW8A 4QQEA 2I3SA 4JT6C 1PI6A 3C9CA 3UKRC 2H13A 2H9NA 4A7JA 3PXTD 3AL9A 3EI3B 4JT5C 1XHMA 2OJYA 2H6KA 2PBIB 5H1MA 5CXCB 3AL8B 5I5IA 1K8KC 5FKRA 5HE2B 3NVQA 5THAA 4UI9R 4MK0B 5A2Qg 4G56B 4GQ2P 3SWSD 3L4MD 2AGXA 4Y7RA 3I7OA 2CE9A 5H17A 3A0FA 3FM0A 4CY5A 4CI3A 3IJCA 2YNNA 4H5IA 1SQ9A 2B5NA 4LG8A 2OVRB 5EM2B 1XIPA 5IGQA 5FKTA 3ODTA 5IGOA 3W15A 3NVNA 5FXYA 4E5ZA 4J86A 2HYEA 3JB9L 4QRJA 5EARA 2CO0C 2H3XA 4ZOZA 2I0RA 3PSLA 3MKSB 2AGLA 1NR0A 5HE0B 4FA1D 3N0DA 3JZNA 4X61B 2IWKA 3GFCA 4CI2A 3J80g 5AFU3 3AFCA 3MKQA 3OKYB 4CI8A 2AGZA 2XU7A 2B5LA 2AH0A 4O3TB 2B4EA 3UVMA 4D0KA 2AQ5A 5CXCA 3AL8A 1L0QA 1PEVA 4JSNC 3F3GA 3I8CA 5AJAA 3DSMA 3SMRA 5CXBB 2OIZA 3PSCB 3DXKC 3I8EA 3EG6A 2H68A 2H9LA 3ZWLB 2P9NC 1YFQA 1B9XA 5TEFA 1MG3A 2W18A 4J73A 2B5MA 5EM2A 4J78A 2GC4A 3SBPA 3SLED 4X63B 3JAMg 3P4FA 3BG0A 1PBYB 3PE7A 1GOTB 5CYKB 4ZOXA 5IJ8E 2H6QA 3JROA 5FQDA 2P9PC 2P9LC 3UVLA 3DM0A 2MTAH 4TZ4A 4AEZA 2H14A 4KFMB 2IUPA 3OKYA 3UVOA 4A0BA 2J56H 4GM3A 5FA5B 3MXXA 4JSVC 2OVQB 4ERZA 2AH1A 4FAVD 2YB8B 3K26A 3JZHA 1N6EA 3B7FA 4NSXA 2UZXB 1QNIA 4J79A 5EAPA 5CXBA 4J87A 4PBZA 2J57G 2P9SC 1TBGA 4FWWA 4OZUA 4O9DA 1JMXB 5FLXg 1N6FA 4H5JA 4ERYA 2QXVA 4FA9D 2OK4A 4QT8A 1R5MA 3F3PA 2HXCA 4J0WA 4FA4D 3I7PA 3I7KA 3RN1D 3I7NA 4K3JB 2PM6B 2TRCB 5H14A 1ERJA 2P9IC 4J0XA 5CYKA 3RFHA 3I7LA 2H6NA 3RFGA 2HJ4A 3EI1B 2P9KC 2IAAA 4O1QD 4GMBA 1NEXB 2Q7QA 2Z2NA 4EWRA 3IKOA 4K3ID 1TYQC 4ZOYA 4GGAA 4A0BB 2IUVA 1A0RB 2GC7A 4CZVA 4QL1A 1MG2A 3SCYA 3DWLC 4CY1A 4PSWB 5EMMB 3SXTD 5GXHA 3RLMD 5C2WB 5EMJB 5EMLB 3UVKA 5GSAA 4J77A 4IMMA 2Z2PA 4BH6A 2AGWA 2HKMA 4PNKB
chains in the Genus database with same CATH superfamily
2HU5A 1RI6A 2EBSA 3OL2B 4XYHA 2CO0A 2WQ8A 2VDNA 4J81A 4A0AB 3EI4B 2CN3A 2EIEA 2J55H 3F3FA 4J8GA 5GXIA 3HFQA 4E54B 3VH0A 3UVNA 2UZYB 4GQ1A 2CE8A 4WK2A 3PXSD 4J8BA 4JHPC 4JD2C 1JJUB 4A2MA 5C9ZB 2BCJB 5KDOB 2QC5A 1GOHA 2IWFA 3BWSA 3J81g 4Z7OA 2AGYA 3ZDYA 2HJBA 3EQ8A 3I7HA 3GC3B 2BKLA 3IUMA 2G9AA 3EI1A 3DXMC 4GGCA 4U7AA 5HQGA 2VC2A 4PC0A 1U4CA 4YVDA 3JPXA 3V9FA 3OKTA 1PGUA 1QFMA 3IURA 4L1QD 3V5WB 1VYHC 1JOFA 3AH8B 1K32A 2VDQA 4FHLA 2I0TA 4O02A 4GM9A 3SFZA 2H9MA 3K27A 4D9SA 2I0SA 5C2VB 5I5MA 4JSXC 3ULEC 5GMKn 1GOGA 1U2VC 4LGNA 2VZ3A 4PXWA 5K19A 2O9KA 5M5UA 3IUNA 5EAMA 1M1XA 3EMHA 5HE3B 4FB1D 5HYNB 3C99A 4J84A 3NVXA 2H9PA 3VGZA 3RRMC 3SJLD 4A11B 4L1MA 2BBKH 4ESGA 3KRWB 3OL2A 3FRXA 3UKUC 3JRPA 3I89A 4GM8A 4U1EI 1FWXA 4A0AA 1JV2A 3EI4A 3FCSA 3MZLA 3QI0A 2I3TA 4G1MA 4E54A 1OLZA 1VE6A 4ERQA 4D6VA 3RSEC 2VDMA 3L4OD 3PVWB 1A12A 4X3EA 3NIDA 1SQJA 3RMZD 4A08B 5B4WA 4XEIC 3SHFA 1Q47A 4CY3A 4XYIA 4MMZA 3CFSB 4R7AB 3SBQA 2PM9B 4L3HD 3RN0D 3EI2A 5TEEA 2HKRA 5K1CC 3PXWD 4CC9A 3K6SA 4OWRA 4GZ8A 3CIKB 4FA5D 3EU7A 4LG9A 4BL0A 3EQ7A 1JMZB 3N0EA 2P9UC 2VZ1A 2G99A 3OTTA 5JWZA 2QZPA 1MDAH 2PM7B 4I79A 3EQ9A 4GGDA 4JXMA 4A09B 3V4VA 3V4PA 2IUQA 4CY2A 4AMZA 4NC4A 1N6DA 1OMWB 2CN2A 3SBRA 1GG2B 3IJ0A 3IJ1A 3BG1A 4CZXA 4Z8LA 4PSXB 4X60B 4GQBB 4O45A 4ZN4A 3C75H 4L3GD 3U4YA 2Z2OA 4UM8A 4A11A 2YBAA 3IIYA 3EI3A 5EMKB 3I2NA 1E5TA 4PBYA 3UR4A 3IUQA 2HESX 4Y5RD 4O3UB 4CZYA 4HDJA 3C5MA 5AMSA 3MMYA 2H47A 3KRXB 3NIFA 3MZKA 1I2MB 5I5JA 4IA9A 3CFVA 3VI3A 4N14A 2YMUA 2IURA 4A08A 3ORVD 3JZGA 3V7DB 2XL2A 3SN6B 2OVPB 1O6FA 4JSPC 1UTCA 1GP2B 2PM9A 3IUJA 5TDHB 3ZE0A 3MVDK 3IIWA 3EI2B 5IJ7E 2YNOA 3GREA 1B9YA 1L5GA 4BUJC 2YNPA 5EALA 3OKWA 5IC7A 4J82A 4L9OA 4BCCA 4AOWA 5IT9g 1S4UX 3ZDXA 4E5ZB 4NENA 2HU8A 1GXRA 2CNXA 3MUNA 4ZOVA 1P22A 1UOQA 4A09A 2GNQA 4WK0A 1XKSA 2XL3A 4CI1A 1SHYB 2QR5A 2OK6A 2XYIA 3EWEA 3FGBA 5M61A 5SXMA 3SVWD 5E6RA 5FKQA 5HE1B 4ES0A 5TF2A 3E0CA 3VA6A 3KCIA 3IJEA 3O4GA 3PVUB 1H2XA 5M5RA 4A2LA 5FKSA 4FAND 3OW8A 4QQEA 4WK4A 2I3SA 4JT6C 1H2WA 5C86A 1PI6A 3C9CA 3UKRC 2H13A 2H9NA 3O4IA 4A7JA 3PXTD 3AL9A 3EI3B 4JT5C 1XHMA 2EIBA 2OJYA 2H6KA 2PBIB 4AN1A 3T3PA 5H1MA 5CXCB 3AL8B 5I5IA 1K8KC 5E6SA 5FKRA 5HE2B 3NVQA 5THAA 4UI9R 5FFGA 1UOOA 3O4HA 4G1EA 4MK0B 5A2Qg 2VDKA 4G56B 4GQ2P 5HDBA 3SWSD 3L4MD 2AGXA 1GOFA 4Y7RA 3I7OA 2CE9A 5H17A 3A0FA 3FM0A 1TYEA 4CY5A 4CI3A 3IJCA 2YNNA 4NAAA 4AX4A 2EICA 4H5IA 1SQ9A 2B5NA 4LG8A 2OVRB 2XZGA 5EM2B 1XIPA 5IGQA 5FKTA 3ODTA 5IGOA 3W15A 1VZ3A 2VDPA 3NVNA 2VDLA 5FXYA 4E5ZA 5FFOA 4J86A 2HYEA 3JB9L 4QRJA 5EARA 4DNUA 2CO0C 2H3XA 4ZOZA 2I0RA 1H2ZA 3PSLA 3MKSB 1BPOA 2AGLA 1NR0A 5HE0B 4FA1D 3N0DA 1T2XA 3JZNA 4X61B 2IWKA 3GFCA 4CI2A 3J80g 5AFU3 2JKXA 3AFCA 3MKQA 3OKYB 4BP9A 4BP8A 4JHNA 4CI8A 2AGZA 2XU7A 2B5LA 2AH0A 4G55A 4O3TB 2B4EA 3UVMA 4D0KA 2AQ5A 5CXCA 3AL8A 1L0QA 1PEVA 4JSNC 4Z7QA 3F3GA 3I8CA 5AJAA 3DSMA 3SMRA 5CXBB 2OIZA 4DNVA 3PSCB 3DXKC 3I8EA 3EG6A 1QFSA 2H68A 2H9LA 3ZDZA 3ZWLB 2P9NC 1YFQA 1B9XA 5TEFA 1MG3A 2W18A 3FCUA 2XE4A 4BCBA 4J73A 2B5MA 5EM2A 4J78A 2GC4A 3SBPA 3SLED 4X63B 3JAMg 3P4FA 3BG0A 4IRZA 1PBYB 3PE7A 1GOTB 5CYKB 4ZOXA 5IJ8E 2H6QA 3MUOA 3JROA 5FQDA 1JTDB 1VZ2A 2P9PC 3GD1I 3ZE1A 4DNWA 2P9LC 2VDRA 3UVLA 3DM0A 1VE7A 3OF7A 2MTAH 4TZ4A 3ZE2A 1E8NA 4AEZA 2H14A 3QHYB 1E8MA 5C92A 3VI4A 3K72A 4KFMB 2IUPA 3OKYA 4NBMA 4RE5A 3UVOA 4A0BA 2J56H 3O4JA 4GM3A 5FA5B 3MXXA 4JSVC 2OVQB 4ERZA 2AH1A 4FAVD 4MMXA 2YB8B 3K26A 3DDUA 3JZHA 1N6EA 2VDOA 3B7FA 4NSXA 2UZXB 1UOPA 3IVMA 1QNIA 4J79A 5EAPA 5CXBA 4J87A 4PBZA 2J57G 2P9SC 1TBGA 4BCDA 4FWWA 4OZUA 4WJKA 4O9DA 1O6GA 1JMXB 2EIDA 5FLXg 1N6FA 4H5JA 4ERYA 4RE6A 2QXVA 4QAMA 4FA9D 3K71A 2OK4A 4QT8A 1R5MA 2XDWA 1H2YA 3F3PA 2HXCA 4J0WA 4FA4D 3I7PA 3I7KA 1K3IA 3I7NA 3RN1D 4K3JB 2PM6B 2TRCB 5H14A 1ERJA 2P9IC 4J0XA 5CYKA 3RFHA 3I7LA 2H6NA 3RFGA 3IULA 2HJ4A 3EI1B 2P9KC 2IAAA 4O1QD 4GMBA 1NEXB 2Q7QA 2Z2NA 1C9IA 4EWRA 3IKOA 4K3ID 1TYQC 5M5VA 4UM9A 4ZOYA 4GGAA 4A0BB 2IUVA 1A0RB 2GC7A 4CZVA 4QL1A 1MG2A 1C9LA 3DWLC 3SCYA 4PSWB 4CY1A 3SXTD 4Z7NA 5EMMB 5GXHA 4AMYA 3RLMD 4MMYA 5C2WB 1U8CA 2HU7A 5EMLB 5EMJB 3UVKA 5GSAA 1YR2A 4J77A 4O2WA 4IMMA 2Z2PA 3NIGA 5M5SA 4AN0A 5M5TA 4BH6A 2AGWA 2HKMA 5E6UA 4PNKB 3T3MA
chains in the Genus database with same CATH topology
1RI6A 2EBSA 3OL2B 4XYHA 2CO0A 4J81A 4A0AB 3EI4B 2CN3A 3F3FA 2J55H 4J8GA 5GXIA 3HFQA 4E54B 3VH0A 3UVNA 2UZYB 4GQ1A 2CE8A 3PXSD 4J8BA 4JD2C 1JJUB 4A2MA 5C9ZB 2BCJB 5KDOB 2QC5A 2IWFA 3BWSA 3J81g 2AGYA 2HJBA 3I7HA 2G9AA 3EI1A 3DXMC 4GGCA 4U7AA 5HQGA 4PC0A 1U4CA 4YVDA 3JPXA 3V9FA 3OKTA 1PGUA 4L1QD 3V5WB 1VYHC 1JOFA 3AH8B 1K32A 4FHLA 2I0TA 4GM9A 3SFZA 2H9MA 3K27A 2I0SA 5C2VB 5I5MA 4JSXC 3ULEC 5GMKn 1U2VC 4LGNA 4PXWA 5K19A 2O9KA 5EAMA 3EMHA 5HE3B 4FB1D 5HYNB 3C99A 4J84A 3NVXA 2H9PA 3VGZA 3RRMC 3SJLD 4A11B 2BBKH 4ESGA 3KRWB 3OL2A 3FRXA 3UKUC 3JRPA 3I89A 4GM8A 4U1EI 1FWXA 4A0AA 3EI4A 3MZLA 2I3TA 4E54A 1OLZA 4ERQA 4D6VA 3RSEC 3L4OD 3PVWB 4X3EA 1SQJA 3RMZD 4A08B 5B4WA 4XEIC 3SHFA 1Q47A 4CY3A 4XYIA 4R7AB 3CFSB 3SBQA 2PM9B 4L3HD 3RN0D 3EI2A 5TEEA 2HKRA 5K1CC 3PXWD 4CC9A 4OWRA 4GZ8A 3CIKB 4FA5D 3EU7A 4LG9A 4BL0A 1JMZB 3N0EA 2P9UC 2G99A 3OTTA 5JWZA 1MDAH 2PM7B 4I79A 4GGDA 4JXMA 4A09B 4CY2A 2IUQA 1N6DA 1OMWB 2CN2A 3SBRA 1GG2B 3IJ0A 3IJ1A 3BG1A 4CZXA 4Z8LA 4PSXB 4X60B 4GQBB 4O45A 4ZN4A 3C75H 4L3GD 3U4YA 2Z2OA 4A11A 2YBAA 3IIYA 3EI3A 5EMKB 3I2NA 4PBYA 3UR4A 2HESX 4Y5RD 4O3UB 4CZYA 4HDJA 3C5MA 5AMSA 3MMYA 2H47A 3KRXB 3MZKA 5I5JA 4IA9A 3CFVA 4N14A 2YMUA 2IURA 4A08A 3ORVD 3JZGA 3V7DB 2XL2A 3SN6B 2OVPB 4JSPC 1GP2B 2PM9A 5TDHB 3EI2B 3IIWA 5IJ7E 2YNOA 3GREA 1B9YA 4BUJC 2YNPA 5EALA 3OKWA 5IC7A 4J82A 4L9OA 4AOWA 5IT9g 1S4UX 4E5ZB 1GXRA 2CNXA 4ZOVA 1P22A 4A09A 2GNQA 1XKSA 2XL3A 4CI1A 1SHYB 3EWEA 2OK6A 2XYIA 3FGBA 5SXMA 3SVWD 5FKQA 5HE1B 4ES0A 5TF2A 3E0CA 3VA6A 3PVUB 4A2LA 5FKSA 4FAND 3OW8A 4QQEA 2I3SA 4JT6C 1PI6A 3C9CA 3UKRC 2H13A 2H9NA 4A7JA 3PXTD 3AL9A 3EI3B 4JT5C 1XHMA 2OJYA 2H6KA 2PBIB 5H1MA 5CXCB 3AL8B 5I5IA 1K8KC 5FKRA 5HE2B 3NVQA 5THAA 4UI9R 4MK0B 5A2Qg 4G56B 4GQ2P 3SWSD 3L4MD 2AGXA 4Y7RA 3I7OA 2CE9A 5H17A 3A0FA 3FM0A 4CY5A 4CI3A 3IJCA 2YNNA 4H5IA 1SQ9A 2B5NA 4LG8A 2OVRB 5EM2B 1XIPA 5IGQA 5FKTA 3ODTA 5IGOA 3W15A 3NVNA 5FXYA 4E5ZA 4J86A 2HYEA 3JB9L 4QRJA 5EARA 2CO0C 2H3XA 4ZOZA 2I0RA 3PSLA 3MKSB 2AGLA 1NR0A 5HE0B 4FA1D 3N0DA 3JZNA 4X61B 2IWKA 3GFCA 4CI2A 3J80g 5AFU3 3AFCA 3MKQA 3OKYB 4CI8A 2AGZA 2XU7A 2B5LA 2AH0A 4O3TB 2B4EA 3UVMA 4D0KA 2AQ5A 5CXCA 3AL8A 1L0QA 1PEVA 4JSNC 3F3GA 3I8CA 5AJAA 3DSMA 3SMRA 5CXBB 2OIZA 3PSCB 3DXKC 3I8EA 3EG6A 2H68A 2H9LA 3ZWLB 2P9NC 1YFQA 1B9XA 5TEFA 1MG3A 2W18A 4J73A 2B5MA 5EM2A 4J78A 2GC4A 3SBPA 3SLED 4X63B 3JAMg 3P4FA 3BG0A 1PBYB 3PE7A 1GOTB 5CYKB 4ZOXA 5IJ8E 2H6QA 3JROA 5FQDA 2P9PC 2P9LC 3UVLA 3DM0A 2MTAH 4TZ4A 4AEZA 2H14A 4KFMB 2IUPA 3OKYA 3UVOA 4A0BA 2J56H 4GM3A 5FA5B 3MXXA 4JSVC 2OVQB 4ERZA 2AH1A 4FAVD 2YB8B 3K26A 3JZHA 1N6EA 3B7FA 4NSXA 2UZXB 1QNIA 4J79A 5EAPA 5CXBA 4J87A 4PBZA 2J57G 2P9SC 1TBGA 4FWWA 4OZUA 4O9DA 1JMXB 5FLXg 1N6FA 4H5JA 4ERYA 2QXVA 4FA9D 2OK4A 4QT8A 1R5MA 3F3PA 2HXCA 4J0WA 4FA4D 3I7PA 3I7KA 3RN1D 3I7NA 4K3JB 2PM6B 2TRCB 5H14A 1ERJA 2P9IC 4J0XA 5CYKA 3RFHA 3I7LA 2H6NA 3RFGA 2HJ4A 3EI1B 2P9KC 2IAAA 4O1QD 4GMBA 1NEXB 2Q7QA 2Z2NA 4EWRA 3IKOA 4K3ID 1TYQC 4ZOYA 4GGAA 4A0BB 2IUVA 1A0RB 2GC7A 4CZVA 4QL1A 1MG2A 3SCYA 3DWLC 4CY1A 4PSWB 5EMMB 3SXTD 5GXHA 3RLMD 5C2WB 5EMJB 5EMLB 3UVKA 5GSAA 4J77A 4IMMA 2Z2PA 4BH6A 2AGWA 2HKMA 4PNKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RI6 A;  2EBS A;  3OL2 B;  4XYH A;  2CO0 A;  4J81 A;  4A0A B;  3EI4 B;  2CN3 A;  3F3F A;  2J55 H;  4J8G A;  5GXI A;  3HFQ A;  4E54 B;  3VH0 A;  3UVN A;  2UZY B;  4GQ1 A;  2CE8 A;  3PXS D;  4J8B A;  4JD2 C;  1JJU B;  4A2M A;  5C9Z B;  2BCJ B;  5KDO B;  2QC5 A;  2IWF A;  3BWS A;  3J81 g;  2AGY A;  2HJB A;  3I7H A;  2G9A A;  3EI1 A;  3DXM C;  4GGC A;  4U7A A;  5HQG A;  4PC0 A;  1U4C A;  4YVD A;  3JPX A;  3V9F A;  3OKT A;  1PGU A;  4L1Q D;  3V5W B;  1VYH C;  1JOF A;  3AH8 B;  1K32 A;  4FHL A;  2I0T A;  4GM9 A;  3SFZ A;  2H9M A;  3K27 A;  2I0S A;  5C2V B;  5I5M A;  4JSX C;  3ULE C;  5GMK n;  1U2V C;  4LGN A;  4PXW A;  5K19 A;  2O9K A;  5EAM A;  3EMH A;  5HE3 B;  4FB1 D;  5HYN B;  3C99 A;  4J84 A;  3NVX A;  2H9P A;  3VGZ A;  3RRM C;  3SJL D;  4A11 B;  2BBK H;  4ESG A;  3KRW B;  3OL2 A;  3FRX A;  3UKU C;  3JRP A;  3I89 A;  4GM8 A;  4U1E I;  1FWX A;  4A0A A;  3EI4 A;  3MZL A;  2I3T A;  4E54 A;  1OLZ A;  4ERQ A;  4D6V A;  3RSE C;  3L4O D;  3PVW B;  4X3E A;  1SQJ A;  3RMZ D;  4A08 B;  5B4W A;  4XEI C;  3SHF A;  1Q47 A;  4CY3 A;  4XYI A;  4R7A B;  3CFS B;  3SBQ A;  2PM9 B;  4L3H D;  3RN0 D;  3EI2 A;  5TEE A;  2HKR A;  5K1C C;  3PXW D;  4CC9 A;  4OWR A;  4GZ8 A;  3CIK B;  4FA5 D;  3EU7 A;  4LG9 A;  4BL0 A;  1JMZ B;  3N0E A;  2P9U C;  2G99 A;  3OTT A;  5JWZ A;  1MDA H;  2PM7 B;  4I79 A;  4GGD A;  4JXM A;  4A09 B;  4CY2 A;  2IUQ A;  1N6D A;  1OMW B;  2CN2 A;  3SBR A;  1GG2 B;  3IJ0 A;  3IJ1 A;  3BG1 A;  4CZX A;  4Z8L A;  4PSX B;  4X60 B;  4GQB B;  4O45 A;  4ZN4 A;  3C75 H;  4L3G D;  3U4Y A;  2Z2O A;  4A11 A;  2YBA A;  3IIY A;  3EI3 A;  5EMK B;  3I2N A;  4PBY A;  3UR4 A;  2HES X;  4Y5R D;  4O3U B;  4CZY A;  4HDJ A;  3C5M A;  5AMS A;  3MMY A;  2H47 A;  3KRX B;  3MZK A;  5I5J A;  4IA9 A;  3CFV A;  4N14 A;  2YMU A;  2IUR A;  4A08 A;  3ORV D;  3JZG A;  3V7D B;  2XL2 A;  3SN6 B;  2OVP B;  4JSP C;  1GP2 B;  2PM9 A;  5TDH B;  3EI2 B;  3IIW A;  5IJ7 E;  2YNO A;  3GRE A;  1B9Y A;  4BUJ C;  2YNP A;  5EAL A;  3OKW A;  5IC7 A;  4J82 A;  4L9O A;  4AOW A;  5IT9 g;  1S4U X;  4E5Z B;  1GXR A;  2CNX A;  4ZOV A;  1P22 A;  4A09 A;  2GNQ A;  1XKS A;  2XL3 A;  4CI1 A;  1SHY B;  3EWE A;  2OK6 A;  2XYI A;  3FGB A;  5SXM A;  3SVW D;  5FKQ A;  5HE1 B;  4ES0 A;  5TF2 A;  3E0C A;  3VA6 A;  3PVU B;  4A2L A;  5FKS A;  4FAN D;  3OW8 A;  4QQE A;  2I3S A;  4JT6 C;  1PI6 A;  3C9C A;  3UKR C;  2H13 A;  2H9N A;  4A7J A;  3PXT D;  3AL9 A;  3EI3 B;  4JT5 C;  1XHM A;  2OJY A;  2H6K A;  2PBI B;  5H1M A;  5CXC B;  3AL8 B;  5I5I A;  1K8K C;  5FKR A;  5HE2 B;  3NVQ A;  5THA A;  4UI9 R;  4MK0 B;  5A2Q g;  4G56 B;  4GQ2 P;  3SWS D;  3L4M D;  2AGX A;  4Y7R A;  3I7O A;  2CE9 A;  5H17 A;  3A0F A;  3FM0 A;  4CY5 A;  4CI3 A;  3IJC A;  2YNN A;  4H5I A;  1SQ9 A;  2B5N A;  4LG8 A;  2OVR B;  5EM2 B;  1XIP A;  5IGQ A;  5FKT A;  3ODT A;  5IGO A;  3W15 A;  3NVN A;  5FXY A;  4E5Z A;  4J86 A;  2HYE A;  3JB9 L;  4QRJ A;  5EAR A;  2CO0 C;  2H3X A;  4ZOZ A;  2I0R A;  3PSL A;  3MKS B;  2AGL A;  1NR0 A;  5HE0 B;  4FA1 D;  3N0D A;  3JZN A;  4X61 B;  2IWK A;  3GFC A;  4CI2 A;  3J80 g;  5AFU 3;  3AFC A;  3MKQ A;  3OKY B;  4CI8 A;  2AGZ A;  2XU7 A;  2B5L A;  2AH0 A;  4O3T B;  2B4E A;  3UVM A;  4D0K A;  2AQ5 A;  5CXC A;  3AL8 A;  1L0Q A;  1PEV A;  4JSN C;  3F3G A;  3I8C A;  5AJA A;  3DSM A;  3SMR A;  5CXB B;  2OIZ A;  3PSC B;  3DXK C;  3I8E A;  3EG6 A;  2H68 A;  2H9L A;  3ZWL B;  2P9N C;  1YFQ A;  1B9X A;  5TEF A;  1MG3 A;  2W18 A;  4J73 A;  2B5M A;  5EM2 A;  4J78 A;  2GC4 A;  3SBP A;  3SLE D;  4X63 B;  3JAM g;  3P4F A;  3BG0 A;  1PBY B;  3PE7 A;  1GOT B;  5CYK B;  4ZOX A;  5IJ8 E;  2H6Q A;  3JRO A;  5FQD A;  2P9P C;  2P9L C;  3UVL A;  3DM0 A;  2MTA H;  4TZ4 A;  4AEZ A;  2H14 A;  4KFM B;  2IUP A;  3OKY A;  3UVO A;  4A0B A;  2J56 H;  4GM3 A;  5FA5 B;  3MXX A;  4JSV C;  2OVQ B;  4ERZ A;  2AH1 A;  4FAV D;  2YB8 B;  3K26 A;  3JZH A;  1N6E A;  3B7F A;  4NSX A;  2UZX B;  1QNI A;  4J79 A;  5EAP A;  5CXB A;  4J87 A;  4PBZ A;  2J57 G;  2P9S C;  1TBG A;  4FWW A;  4OZU A;  4O9D A;  1JMX B;  5FLX g;  1N6F A;  4H5J A;  4ERY A;  2QXV A;  4FA9 D;  2OK4 A;  4QT8 A;  1R5M A;  3F3P A;  2HXC A;  4J0W A;  4FA4 D;  3I7P A;  3I7K A;  3RN1 D;  3I7N A;  4K3J B;  2PM6 B;  2TRC B;  5H14 A;  1ERJ A;  2P9I C;  4J0X A;  5CYK A;  3RFH A;  3I7L A;  2H6N A;  3RFG A;  2HJ4 A;  3EI1 B;  2P9K C;  2IAA A;  4O1Q D;  4GMB A;  1NEX B;  2Q7Q A;  2Z2N A;  4EWR A;  3IKO A;  4K3I D;  1TYQ C;  4ZOY A;  4GGA A;  4A0B B;  2IUV A;  1A0R B;  2GC7 A;  4CZV A;  4QL1 A;  1MG2 A;  3SCY A;  3DWL C;  4CY1 A;  4PSW B;  5EMM B;  3SXT D;  5GXH A;  3RLM D;  5C2W B;  5EMJ B;  5EML B;  3UVK A;  5GSA A;  4J77 A;  4IMM A;  2Z2P A;  4BH6 A;  2AGW A;  2HKM A;  4PNK B; 
#chains in the Genus database with same CATH topology
 2HU5 A;  1RI6 A;  2EBS A;  3OL2 B;  4XYH A;  2CO0 A;  2WQ8 A;  2VDN A;  4J81 A;  4A0A B;  3EI4 B;  2CN3 A;  2EIE A;  2J55 H;  3F3F A;  4J8G A;  5GXI A;  3HFQ A;  4E54 B;  3VH0 A;  3UVN A;  2UZY B;  4GQ1 A;  2CE8 A;  4WK2 A;  3PXS D;  4J8B A;  4JHP C;  4JD2 C;  1JJU B;  4A2M A;  5C9Z B;  2BCJ B;  5KDO B;  2QC5 A;  1GOH A;  2IWF A;  3BWS A;  3J81 g;  4Z7O A;  2AGY A;  3ZDY A;  2HJB A;  3EQ8 A;  3I7H A;  3GC3 B;  2BKL A;  3IUM A;  2G9A A;  3EI1 A;  3DXM C;  4GGC A;  4U7A A;  5HQG A;  2VC2 A;  4PC0 A;  1U4C A;  4YVD A;  3JPX A;  3V9F A;  3OKT A;  1PGU A;  1QFM A;  3IUR A;  4L1Q D;  3V5W B;  1VYH C;  1JOF A;  3AH8 B;  1K32 A;  2VDQ A;  4FHL A;  2I0T A;  4O02 A;  4GM9 A;  3SFZ A;  2H9M A;  3K27 A;  4D9S A;  2I0S A;  5C2V B;  5I5M A;  4JSX C;  3ULE C;  5GMK n;  1GOG A;  1U2V C;  4LGN A;  2VZ3 A;  4PXW A;  5K19 A;  2O9K A;  5M5U A;  3IUN A;  5EAM A;  1M1X A;  3EMH A;  5HE3 B;  4FB1 D;  5HYN B;  3C99 A;  4J84 A;  3NVX A;  2H9P A;  3VGZ A;  3RRM C;  3SJL D;  4A11 B;  4L1M A;  2BBK H;  4ESG A;  3KRW B;  3OL2 A;  3FRX A;  3UKU C;  3JRP A;  3I89 A;  4GM8 A;  4U1E I;  1FWX A;  4A0A A;  1JV2 A;  3EI4 A;  3FCS A;  3MZL A;  3QI0 A;  2I3T A;  4G1M A;  4E54 A;  1OLZ A;  1VE6 A;  4ERQ A;  4D6V A;  3RSE C;  2VDM A;  3L4O D;  3PVW B;  1A12 A;  4X3E A;  3NID A;  1SQJ A;  3RMZ D;  4A08 B;  5B4W A;  4XEI C;  3SHF A;  1Q47 A;  4CY3 A;  4XYI A;  4MMZ A;  3CFS B;  4R7A B;  3SBQ A;  2PM9 B;  4L3H D;  3RN0 D;  3EI2 A;  5TEE A;  2HKR A;  5K1C C;  3PXW D;  4CC9 A;  3K6S A;  4OWR A;  4GZ8 A;  3CIK B;  4FA5 D;  3EU7 A;  4LG9 A;  4BL0 A;  3EQ7 A;  1JMZ B;  3N0E A;  2P9U C;  2VZ1 A;  2G99 A;  3OTT A;  5JWZ A;  2QZP A;  1MDA H;  2PM7 B;  4I79 A;  3EQ9 A;  4GGD A;  4JXM A;  4A09 B;  3V4V A;  3V4P A;  2IUQ A;  4CY2 A;  4AMZ A;  4NC4 A;  1N6D A;  1OMW B;  2CN2 A;  3SBR A;  1GG2 B;  3IJ0 A;  3IJ1 A;  3BG1 A;  4CZX A;  4Z8L A;  4PSX B;  4X60 B;  4GQB B;  4O45 A;  4ZN4 A;  3C75 H;  4L3G D;  3U4Y A;  2Z2O A;  4UM8 A;  4A11 A;  2YBA A;  3IIY A;  3EI3 A;  5EMK B;  3I2N A;  1E5T A;  4PBY A;  3UR4 A;  3IUQ A;  2HES X;  4Y5R D;  4O3U B;  4CZY A;  4HDJ A;  3C5M A;  5AMS A;  3MMY A;  2H47 A;  3KRX B;  3NIF A;  3MZK A;  1I2M B;  5I5J A;  4IA9 A;  3CFV A;  3VI3 A;  4N14 A;  2YMU A;  2IUR A;  4A08 A;  3ORV D;  3JZG A;  3V7D B;  2XL2 A;  3SN6 B;  2OVP B;  1O6F A;  4JSP C;  1UTC A;  1GP2 B;  2PM9 A;  3IUJ A;  5TDH B;  3ZE0 A;  3MVD K;  3IIW A;  3EI2 B;  5IJ7 E;  2YNO A;  3GRE A;  1B9Y A;  1L5G A;  4BUJ C;  2YNP A;  5EAL A;  3OKW A;  5IC7 A;  4J82 A;  4L9O A;  4BCC A;  4AOW A;  5IT9 g;  1S4U X;  3ZDX A;  4E5Z B;  4NEN A;  2HU8 A;  1GXR A;  2CNX A;  3MUN A;  4ZOV A;  1P22 A;  1UOQ A;  4A09 A;  2GNQ A;  4WK0 A;  1XKS A;  2XL3 A;  4CI1 A;  1SHY B;  2QR5 A;  2OK6 A;  2XYI A;  3EWE A;  3FGB A;  5M61 A;  5SXM A;  3SVW D;  5E6R A;  5FKQ A;  5HE1 B;  4ES0 A;  5TF2 A;  3E0C A;  3VA6 A;  3KCI A;  3IJE A;  3O4G A;  3PVU B;  1H2X A;  5M5R A;  4A2L A;  5FKS A;  4FAN D;  3OW8 A;  4QQE A;  4WK4 A;  2I3S A;  4JT6 C;  1H2W A;  5C86 A;  1PI6 A;  3C9C A;  3UKR C;  2H13 A;  2H9N A;  3O4I A;  4A7J A;  3PXT D;  3AL9 A;  3EI3 B;  4JT5 C;  1XHM A;  2EIB A;  2OJY A;  2H6K A;  2PBI B;  4AN1 A;  3T3P A;  5H1M A;  5CXC B;  3AL8 B;  5I5I A;  1K8K C;  5E6S A;  5FKR A;  5HE2 B;  3NVQ A;  5THA A;  4UI9 R;  5FFG A;  1UOO A;  3O4H A;  4G1E A;  4MK0 B;  5A2Q g;  2VDK A;  4G56 B;  4GQ2 P;  5HDB A;  3SWS D;  3L4M D;  2AGX A;  1GOF A;  4Y7R A;  3I7O A;  2CE9 A;  5H17 A;  3A0F A;  3FM0 A;  1TYE A;  4CY5 A;  4CI3 A;  3IJC A;  2YNN A;  4NAA A;  4AX4 A;  2EIC A;  4H5I A;  1SQ9 A;  2B5N A;  4LG8 A;  2OVR B;  2XZG A;  5EM2 B;  1XIP A;  5IGQ A;  5FKT A;  3ODT A;  5IGO A;  3W15 A;  1VZ3 A;  2VDP A;  3NVN A;  2VDL A;  5FXY A;  4E5Z A;  5FFO A;  4J86 A;  2HYE A;  3JB9 L;  4QRJ A;  5EAR A;  4DNU A;  2CO0 C;  2H3X A;  4ZOZ A;  2I0R A;  1H2Z A;  3PSL A;  3MKS B;  1BPO A;  2AGL A;  1NR0 A;  5HE0 B;  4FA1 D;  3N0D A;  1T2X A;  3JZN A;  4X61 B;  2IWK A;  3GFC A;  4CI2 A;  3J80 g;  5AFU 3;  2JKX A;  3AFC A;  3MKQ A;  3OKY B;  4BP9 A;  4BP8 A;  4JHN A;  4CI8 A;  2AGZ A;  2XU7 A;  2B5L A;  2AH0 A;  4G55 A;  4O3T B;  2B4E A;  3UVM A;  4D0K A;  2AQ5 A;  5CXC A;  3AL8 A;  1L0Q A;  1PEV A;  4JSN C;  4Z7Q A;  3F3G A;  3I8C A;  5AJA A;  3DSM A;  3SMR A;  5CXB B;  2OIZ A;  4DNV A;  3PSC B;  3DXK C;  3I8E A;  3EG6 A;  1QFS A;  2H68 A;  2H9L A;  3ZDZ A;  3ZWL B;  2P9N C;  1YFQ A;  1B9X A;  5TEF A;  1MG3 A;  2W18 A;  3FCU A;  2XE4 A;  4BCB A;  4J73 A;  2B5M A;  5EM2 A;  4J78 A;  2GC4 A;  3SBP A;  3SLE D;  4X63 B;  3JAM g;  3P4F A;  3BG0 A;  4IRZ A;  1PBY B;  3PE7 A;  1GOT B;  5CYK B;  4ZOX A;  5IJ8 E;  2H6Q A;  3MUO A;  3JRO A;  5FQD A;  1JTD B;  1VZ2 A;  2P9P C;  3GD1 I;  3ZE1 A;  4DNW A;  2P9L C;  2VDR A;  3UVL A;  3DM0 A;  1VE7 A;  3OF7 A;  2MTA H;  4TZ4 A;  3ZE2 A;  1E8N A;  4AEZ A;  2H14 A;  3QHY B;  1E8M A;  5C92 A;  3VI4 A;  3K72 A;  4KFM B;  2IUP A;  3OKY A;  4NBM A;  4RE5 A;  3UVO A;  4A0B A;  2J56 H;  3O4J A;  4GM3 A;  5FA5 B;  3MXX A;  4JSV C;  2OVQ B;  4ERZ A;  2AH1 A;  4FAV D;  4MMX A;  2YB8 B;  3K26 A;  3DDU A;  3JZH A;  1N6E A;  2VDO A;  3B7F A;  4NSX A;  2UZX B;  1UOP A;  3IVM A;  1QNI A;  4J79 A;  5EAP A;  5CXB A;  4J87 A;  4PBZ A;  2J57 G;  2P9S C;  1TBG A;  4BCD A;  4FWW A;  4OZU A;  4WJK A;  4O9D A;  1O6G A;  1JMX B;  2EID A;  5FLX g;  1N6F A;  4H5J A;  4ERY A;  4RE6 A;  2QXV A;  4QAM A;  4FA9 D;  3K71 A;  2OK4 A;  4QT8 A;  1R5M A;  2XDW A;  1H2Y A;  3F3P A;  2HXC A;  4J0W A;  4FA4 D;  3I7P A;  3I7K A;  1K3I A;  3I7N A;  3RN1 D;  4K3J B;  2PM6 B;  2TRC B;  5H14 A;  1ERJ A;  2P9I C;  4J0X A;  5CYK A;  3RFH A;  3I7L A;  2H6N A;  3RFG A;  3IUL A;  2HJ4 A;  3EI1 B;  2P9K C;  2IAA A;  4O1Q D;  4GMB A;  1NEX B;  2Q7Q A;  2Z2N A;  1C9I A;  4EWR A;  3IKO A;  4K3I D;  1TYQ C;  5M5V A;  4UM9 A;  4ZOY A;  4GGA A;  4A0B B;  2IUV A;  1A0R B;  2GC7 A;  4CZV A;  4QL1 A;  1MG2 A;  1C9L A;  3DWL C;  3SCY A;  4PSW B;  4CY1 A;  3SXT D;  4Z7N A;  5EMM B;  5GXH A;  4AMY A;  3RLM D;  4MMY A;  5C2W B;  1U8C A;  2HU7 A;  5EML B;  5EMJ B;  3UVK A;  5GSA A;  1YR2 A;  4J77 A;  4O2W A;  4IMM A;  2Z2P A;  3NIG A;  5M5S A;  4AN0 A;  5M5T A;  4BH6 A;  2AGW A;  2HKM A;  5E6U A;  4PNK B;  3T3M A; 
#chains in the Genus database with same CATH homology
 1RI6 A;  2EBS A;  3OL2 B;  4XYH A;  2CO0 A;  4J81 A;  4A0A B;  3EI4 B;  2CN3 A;  3F3F A;  2J55 H;  4J8G A;  5GXI A;  3HFQ A;  4E54 B;  3VH0 A;  3UVN A;  2UZY B;  4GQ1 A;  2CE8 A;  3PXS D;  4J8B A;  4JD2 C;  1JJU B;  4A2M A;  5C9Z B;  2BCJ B;  5KDO B;  2QC5 A;  2IWF A;  3BWS A;  3J81 g;  2AGY A;  2HJB A;  3I7H A;  2G9A A;  3EI1 A;  3DXM C;  4GGC A;  4U7A A;  5HQG A;  4PC0 A;  1U4C A;  4YVD A;  3JPX A;  3V9F A;  3OKT A;  1PGU A;  4L1Q D;  3V5W B;  1VYH C;  1JOF A;  3AH8 B;  1K32 A;  4FHL A;  2I0T A;  4GM9 A;  3SFZ A;  2H9M A;  3K27 A;  2I0S A;  5C2V B;  5I5M A;  4JSX C;  3ULE C;  5GMK n;  1U2V C;  4LGN A;  4PXW A;  5K19 A;  2O9K A;  5EAM A;  3EMH A;  5HE3 B;  4FB1 D;  5HYN B;  3C99 A;  4J84 A;  3NVX A;  2H9P A;  3VGZ A;  3RRM C;  3SJL D;  4A11 B;  2BBK H;  4ESG A;  3KRW B;  3OL2 A;  3FRX A;  3UKU C;  3JRP A;  3I89 A;  4GM8 A;  4U1E I;  1FWX A;  4A0A A;  3EI4 A;  3MZL A;  2I3T A;  4E54 A;  1OLZ A;  4ERQ A;  4D6V A;  3RSE C;  3L4O D;  3PVW B;  4X3E A;  1SQJ A;  3RMZ D;  4A08 B;  5B4W A;  4XEI C;  3SHF A;  1Q47 A;  4CY3 A;  4XYI A;  4R7A B;  3CFS B;  3SBQ A;  2PM9 B;  4L3H D;  3RN0 D;  3EI2 A;  5TEE A;  2HKR A;  5K1C C;  3PXW D;  4CC9 A;  4OWR A;  4GZ8 A;  3CIK B;  4FA5 D;  3EU7 A;  4LG9 A;  4BL0 A;  1JMZ B;  3N0E A;  2P9U C;  2G99 A;  3OTT A;  5JWZ A;  1MDA H;  2PM7 B;  4I79 A;  4GGD A;  4JXM A;  4A09 B;  4CY2 A;  2IUQ A;  1N6D A;  1OMW B;  2CN2 A;  3SBR A;  1GG2 B;  3IJ0 A;  3IJ1 A;  3BG1 A;  4CZX A;  4Z8L A;  4PSX B;  4X60 B;  4GQB B;  4O45 A;  4ZN4 A;  3C75 H;  4L3G D;  3U4Y A;  2Z2O A;  4A11 A;  2YBA A;  3IIY A;  3EI3 A;  5EMK B;  3I2N A;  4PBY A;  3UR4 A;  2HES X;  4Y5R D;  4O3U B;  4CZY A;  4HDJ A;  3C5M A;  5AMS A;  3MMY A;  2H47 A;  3KRX B;  3MZK A;  5I5J A;  4IA9 A;  3CFV A;  4N14 A;  2YMU A;  2IUR A;  4A08 A;  3ORV D;  3JZG A;  3V7D B;  2XL2 A;  3SN6 B;  2OVP B;  4JSP C;  1GP2 B;  2PM9 A;  5TDH B;  3EI2 B;  3IIW A;  5IJ7 E;  2YNO A;  3GRE A;  1B9Y A;  4BUJ C;  2YNP A;  5EAL A;  3OKW A;  5IC7 A;  4J82 A;  4L9O A;  4AOW A;  5IT9 g;  1S4U X;  4E5Z B;  1GXR A;  2CNX A;  4ZOV A;  1P22 A;  4A09 A;  2GNQ A;  1XKS A;  2XL3 A;  4CI1 A;  1SHY B;  3EWE A;  2OK6 A;  2XYI A;  3FGB A;  5SXM A;  3SVW D;  5FKQ A;  5HE1 B;  4ES0 A;  5TF2 A;  3E0C A;  3VA6 A;  3PVU B;  4A2L A;  5FKS A;  4FAN D;  3OW8 A;  4QQE A;  2I3S A;  4JT6 C;  1PI6 A;  3C9C A;  3UKR C;  2H13 A;  2H9N A;  4A7J A;  3PXT D;  3AL9 A;  3EI3 B;  4JT5 C;  1XHM A;  2OJY A;  2H6K A;  2PBI B;  5H1M A;  5CXC B;  3AL8 B;  5I5I A;  1K8K C;  5FKR A;  5HE2 B;  3NVQ A;  5THA A;  4UI9 R;  4MK0 B;  5A2Q g;  4G56 B;  4GQ2 P;  3SWS D;  3L4M D;  2AGX A;  4Y7R A;  3I7O A;  2CE9 A;  5H17 A;  3A0F A;  3FM0 A;  4CY5 A;  4CI3 A;  3IJC A;  2YNN A;  4H5I A;  1SQ9 A;  2B5N A;  4LG8 A;  2OVR B;  5EM2 B;  1XIP A;  5IGQ A;  5FKT A;  3ODT A;  5IGO A;  3W15 A;  3NVN A;  5FXY A;  4E5Z A;  4J86 A;  2HYE A;  3JB9 L;  4QRJ A;  5EAR A;  2CO0 C;  2H3X A;  4ZOZ A;  2I0R A;  3PSL A;  3MKS B;  2AGL A;  1NR0 A;  5HE0 B;  4FA1 D;  3N0D A;  3JZN A;  4X61 B;  2IWK A;  3GFC A;  4CI2 A;  3J80 g;  5AFU 3;  3AFC A;  3MKQ A;  3OKY B;  4CI8 A;  2AGZ A;  2XU7 A;  2B5L A;  2AH0 A;  4O3T B;  2B4E A;  3UVM A;  4D0K A;  2AQ5 A;  5CXC A;  3AL8 A;  1L0Q A;  1PEV A;  4JSN C;  3F3G A;  3I8C A;  5AJA A;  3DSM A;  3SMR A;  5CXB B;  2OIZ A;  3PSC B;  3DXK C;  3I8E A;  3EG6 A;  2H68 A;  2H9L A;  3ZWL B;  2P9N C;  1YFQ A;  1B9X A;  5TEF A;  1MG3 A;  2W18 A;  4J73 A;  2B5M A;  5EM2 A;  4J78 A;  2GC4 A;  3SBP A;  3SLE D;  4X63 B;  3JAM g;  3P4F A;  3BG0 A;  1PBY B;  3PE7 A;  1GOT B;  5CYK B;  4ZOX A;  5IJ8 E;  2H6Q A;  3JRO A;  5FQD A;  2P9P C;  2P9L C;  3UVL A;  3DM0 A;  2MTA H;  4TZ4 A;  4AEZ A;  2H14 A;  4KFM B;  2IUP A;  3OKY A;  3UVO A;  4A0B A;  2J56 H;  4GM3 A;  5FA5 B;  3MXX A;  4JSV C;  2OVQ B;  4ERZ A;  2AH1 A;  4FAV D;  2YB8 B;  3K26 A;  3JZH A;  1N6E A;  3B7F A;  4NSX A;  2UZX B;  1QNI A;  4J79 A;  5EAP A;  5CXB A;  4J87 A;  4PBZ A;  2J57 G;  2P9S C;  1TBG A;  4FWW A;  4OZU A;  4O9D A;  1JMX B;  5FLX g;  1N6F A;  4H5J A;  4ERY A;  2QXV A;  4FA9 D;  2OK4 A;  4QT8 A;  1R5M A;  3F3P A;  2HXC A;  4J0W A;  4FA4 D;  3I7P A;  3I7K A;  3RN1 D;  3I7N A;  4K3J B;  2PM6 B;  2TRC B;  5H14 A;  1ERJ A;  2P9I C;  4J0X A;  5CYK A;  3RFH A;  3I7L A;  2H6N A;  3RFG A;  2HJ4 A;  3EI1 B;  2P9K C;  2IAA A;  4O1Q D;  4GMB A;  1NEX B;  2Q7Q A;  2Z2N A;  4EWR A;  3IKO A;  4K3I D;  1TYQ C;  4ZOY A;  4GGA A;  4A0B B;  2IUV A;  1A0R B;  2GC7 A;  4CZV A;  4QL1 A;  1MG2 A;  3SCY A;  3DWL C;  4CY1 A;  4PSW B;  5EMM B;  3SXT D;  5GXH A;  3RLM D;  5C2W B;  5EMJ B;  5EML B;  3UVK A;  5GSA A;  4J77 A;  4IMM A;  2Z2P A;  4BH6 A;  2AGW A;  2HKM A;  4PNK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...