5FA5B

Crystal structure of prmt5:mep50 in complex with mta and h4 peptide
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
308
structure length
301
Chain Sequence
PNAPACMERQLEAARYRSDGALLLGASSLSGRCWAGSLWLFKDPCAAPNEGFCSAGVQTEAGVADLTWVGERGILVASDSGAVELWELDENETLIVSKFCKYEHDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQVVLSSYRAHAAQVTCVAASPHKDSVFLSCSEDNRILLWDTRCPKPASQIGGYLPTSLAWHPQQSEVFVFGDENGTVSLVDTKSVLSSAVHSQCVTGLVFSPHSVPFLASLSEDCSLAVLDSSLSELFRSQAHRDFVRDATWSPLNHSLLTTVGWDHQVVHHVVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein arginine N-methyltransferase 5
publication title Disordered methionine metabolism in MTAP/CDKN2A-deleted cancers leads to dependence on PRMT5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/protein binding
total genus 81
structure length 301
sequence length 308
ec nomenclature
pdb deposition date 2015-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5fa5B00
3ODTA 3OKYB 5C2WB 2IWFA 3DWLC 3I2NA 2CO0A 2AQ5A 3K27A 3RRMC 4AOWA 3SN6B 4EWRA 4O9DA 4U1EI 5CXCA 5AJAA 2H68A 5FKQA 3I89A 4H5JA 2AGWA 3IIYA 2YNPA 5GXHA 5EM2A 3ULEC 3CFSB 4X63B 4L3HD 4JD2C 3CFVA 1PBYB 3SFZA 4ZOVA 3KRXB 3PXWD 2I0SA 4ZN4A 4J82A 1GOTB 4KFMB 2B5NA 1P22A 4A0AB 2CN2A 3PSCB 5FQDA 3I7HA 3MMYA 5EAPA 3EI4B 3MKSB 4D0KA 1GXRA 3RLMD 4FA9D 4GMBA 1S4UX 2IUQA 2AGZA 5K1CC 4GM9A 5EMLB 4MK0B 3NVQA 2XL3A 5FKTA 2P9KC 2G99A 3RFHA 3SXTD 5THAA 3I7LA 4PBYA 4J78A 4A2LA 1GP2B 2O9KA 4JSPC 4J73A 5CYKA 2H47A 1SQJA 3GFCA 3DXKC 4FA4D 5CXBA 4GGCA 4E5ZA 2QXVA 4O3UB 4QQEA 1K8KC 2P9UC 4FA1D 3BG1A 4J79A 5IGOA 3J81g 3IIWA 2J55H 4AEZA 2BCJB 2AGYA 2AH0A 5CXCB 3I7PA 3V7DB 5IGQA 2AGXA 4LG9A 5EM2B 5GXIA 4J84A 3SWSD 1PEVA 3DM0A 5EMKB 3ZWLB 4J86A 5IJ8E 4ESGA 2W18A 4XYIA 4A0BA 1PI6A 2OK4A 4GQ1A 5GMKn 2HXCA 4J0WA 3AL8A 4L1QD 5IT9g 5TF2A 4Z8LA 4Y7RA 5TDHB 1JJUB 2XU7A 3JAMg 2MTAH 5K19A 5H14A 4CY3A 1SQ9A 2H13A 4CC9A 4QT8A 4CY5A 4ZOYA 3EI1A 3UVKA 3FM0A 3MKQA 2YNOA 3UKUC 4X3EA 2H9PA 2Q7QA 4FB1D 3SBQA 3EG6A 3EWEA 4JT6C 4LGNA 5CYKB 3PSLA 1JMXB 2P9NC 2HYEA 3SLED 4ERQA 4NSXA 4I79A 2PM6B 5CXBB 4JSVC 2AH1A 4E5ZB 2H14A 4J8BA 3RSEC 2XL2A 1NR0A 2YNNA 4PSXB 5HE1B 3AH8B 4CI2A 4BH6A 2J57G 3EMHA 4CY2A 1L0QA 2GC7A 5TEEA 1ERJA 3C75H 4A0BB 3C5MA 2CNXA 3SBPA 2CN3A 3C9CA 5I5JA 3AL8B 4GZ8A 2B5MA 4QL1A 4YVDA 2YB8B 4A11A 1N6FA 2OVQB 4PBZA 4J8GA 1MDAH 4K3JB 2IUVA 3JPXA 5EALA 3FRXA 4FAVD 4D6VA 4A7JA 2OIZA 1VYHC 3EI1B 1N6EA 2I0RA 3OKTA 1N6DA 3IJ0A 4GQBB 5HQGA 4PC0A 2HJBA 3VH0A 1TBGA 3NVNA 1YFQA 3V9FA 4A08A 2HJ4A 4E54A 4PXWA 3I7KA 3UR4A 2OVRB 2H3XA 3P4FA 5JWZA 2Z2PA 5HYNB 3SMRA 4ERZA 3JZGA 3N0DA 4R7AB 1OLZA 3BWSA 5A2Qg 3IJCA 3GREA 3N0EA 3MZKA 4L3GD 2PM7B 3EI3A 3V5WB 5H1MA 4CI8A 2P9SC 3SJLD 4GGDA 3OL2A 4O3TB 4L9OA 2IWKA 3PVWB 5C9ZB 5AFU3 3SBRA 4ES0A 1B9XA 4CI3A 2OK6A 5IJ7E 4CZXA 4J0XA 3SCYA 4GQ2P 4N14A 3OW8A 3F3FA 3L4OD 3JRPA 3W15A 1R5MA 2H6NA 4GM8A 5HE3B 1XHMA 4FA5D 4ERYA 3U4YA 3VGZA 1RI6A 4PSWB 2B4EA 2TRCB 4A11B 4XEIC 4FAND 5EMJB 3JROA 4JSXC 4JT5C 4J81A 2H6QA 3AL9A 1OMWB 1A0RB 2B5LA 3I8CA 2EBSA 1JOFA 4ZOZA 1QNIA 4BL0A 5FXYA 3HFQA 2I0TA 3JZHA 5IC7A 2AGLA 3CIKB 3IJ1A 4A08B 2XYIA 4E54B 5HE2B 4BUJC 3B7FA 3JZNA 4U7AA 4IA9A 2YBAA 3I8EA 2P9LC 4GGAA 1U2VC 1MG2A 2QC5A 2I3SA 4A09A 3BG0A 1PGUA 3RN1D 3ORVD 3EI3B 5B4WA 2PBIB 1GG2B 3C99A 3EI2A 3OL2B 2OVPB 2IUPA 2Z2NA 4X60B 2CE9A 3UKRC 3JB9L 3MZLA 2GC4A 2J56H 3UVOA 2CO0C 4Y5RD 1Q47A 3PE7A 4JSNC 5FKSA 3F3PA 4GM3A 5EMMB 3I7OA 4UI9R 1SHYB 2PM9A 4X61B 4OWRA 3KRWB 4LG8A 5I5IA 4XYHA 3K26A 3UVNA 4G56B 1B9YA 2H9LA 3PVUB 4K3ID 5FKRA 3OKYA 4CI1A 5I5MA 2HESX 5TEFA 1JMZB 4J87A 2UZYB 1FWXA 1K32A 3J80g 2P9IC 3VA6A 5C2VB 2YMUA 1NEXB 4JXMA 4QRJA 3OTTA 4ZOXA 2I3TA 3EU7A 4HDJA 3RMZD 2CE8A 4PNKB 4O45A 5EAMA 2IAAA 3OKWA 5KDOB 5GSAA 4A09B 3MXXA 2GNQA 4O1QD 3FGBA 2IURA 3F3GA 4OZUA 5H17A 3EI2B 2H6KA 2Z2OA 5FA5B 4A0AA 4CZVA 3EI4A 3IKOA 4FHLA 3DXMC 4FWWA 1MG3A 3NVXA 4IMMA 5HE0B 4CZYA 2G9AA 3PXTD 3PXSD 1TYQC 3SVWD 3A0FA 4CY1A 5SXMA 2H9NA 2OJYA 3SHFA 3L4MD 5EARA 3UVLA 3E0CA 2P9PC 5AMSA 1XIPA 4TZ4A 3RN0D 3UVMA 3RFGA 1XKSA 5FLXg 2PM9B 3AFCA 4H5IA 2UZXB 2H9MA 3DSMA 1U4CA 2BBKH 3I7NA 2HKMA 4J77A 4A2MA 2HKRA
chains in the Genus database with same CATH superfamily
3T3MA 3ODTA 3OKYB 5C2WB 2IWFA 1U8CA 4RE5A 1YR2A 3DWLC 3I2NA 2CO0A 2VDPA 2AQ5A 3K27A 1JTDB 3RRMC 4AOWA 3SN6B 4EWRA 2VDLA 4O9DA 4U1EI 5CXCA 5AJAA 2H68A 5FKQA 3I89A 4H5JA 2AGWA 1UOPA 1M1XA 3IIYA 2YNPA 5GXHA 5EM2A 3ULEC 3CFSB 4X63B 4L3HD 4JD2C 3CFVA 2VDNA 1PBYB 3SFZA 4ZOVA 3KRXB 3PXWD 2I0SA 4ZN4A 4J82A 1GOTB 4KFMB 5E6RA 2B5NA 1P22A 4A0AB 5M5SA 2CN2A 3PSCB 5FQDA 3I7HA 3MMYA 5EAPA 3EI4B 3MKSB 5M61A 4D0KA 2VDQA 1GXRA 4AN1A 4UM8A 2VZ1A 3RLMD 4FA9D 4GMBA 3QHYB 1S4UX 2IUQA 2AGZA 5K1CC 1JV2A 4GM9A 5EMLB 4MK0B 2EIDA 3NVQA 2XL3A 4IRZA 5FKTA 4MMYA 4QAMA 2P9KC 2G99A 3RFHA 3SXTD 5THAA 1A12A 3I7LA 3T3PA 4PBYA 4J78A 4NC4A 5E6UA 1GP2B 2O9KA 4A2LA 4JSPC 4DNVA 4J73A 5CYKA 2H47A 1SQJA 3GFCA 3DXKC 1I2MB 4FA4D 5CXBA 3IUJA 4GGCA 4E5ZA 3O4JA 2QXVA 4O3UB 4QQEA 1K8KC 2P9UC 4FA1D 3BG1A 4J79A 5E6SA 5IGOA 3J81g 3IIWA 4UM9A 2J55H 4AEZA 2BCJB 2AGYA 1H2WA 2AH0A 5CXCB 3I7PA 3V7DB 5IGQA 2AGXA 4LG9A 5EM2B 5GXIA 4J84A 3SWSD 1PEVA 3DM0A 5EMKB 1TYEA 3ZWLB 3DDUA 4J86A 4ESGA 5IJ8E 2W18A 4XYIA 4A0BA 2VDRA 1PI6A 3MVDK 2OK4A 2EIBA 4GQ1A 5GMKn 1UTCA 2HXCA 4BP9A 4J0WA 3AL8A 3FCUA 4L1QD 5IT9g 4D9SA 5TF2A 4Z8LA 4Y7RA 5TDHB 1JJUB 2XU7A 3JAMg 2VC2A 2MTAH 5K19A 5H14A 4CY3A 1SQ9A 2H13A 4CC9A 4QT8A 4CY5A 4ZOYA 3EI1A 3UVKA 3FM0A 3MKQA 4WJKA 2YNOA 3UKUC 4X3EA 1GOHA 2H9PA 2Q7QA 4FB1D 2XE4A 3SBQA 3IUQA 3EG6A 3EWEA 1VE7A 3MUNA 4JT6C 4LGNA 5CYKB 3PSLA 1JMXB 1QFMA 2P9NC 2HYEA 3SLED 4ERQA 3NIDA 4NSXA 4I79A 2PM6B 5CXBB 1VE6A 4JSVC 2AH1A 4E5ZB 2H14A 4J8BA 3RSEC 2XL2A 2HU8A 1NR0A 2YNNA 4PSXB 5HE1B 3AH8B 4BP8A 4CI2A 4BH6A 2J57G 2VZ3A 3IURA 3IULA 5FFGA 4Z7NA 3EMHA 4CY2A 1L0QA 2GC7A 3EQ7A 5TEEA 5M5TA 1ERJA 3C75H 4G55A 3K71A 4A0BB 3C5MA 1UOOA 3EQ8A 4JHNA 2CNXA 3SBPA 2CN3A 1E8MA 3C9CA 5I5JA 3AL8B 4GZ8A 2B5MA 4DNWA 4QL1A 2JKXA 2HU5A 2VDOA 4YVDA 2YB8B 4A11A 1N6FA 2OVQB 4PBZA 2VDMA 4J8GA 4L1MA 5M5UA 1MDAH 4K3JB 2IUVA 3JPXA 5EALA 3FRXA 4FAVD 4D6VA 4A7JA 3QI0A 4WK4A 2OIZA 1VYHC 4WK0A 3EI1B 1N6EA 2I0RA 3OKTA 1N6DA 3IJ0A 4GQBB 5HQGA 4PC0A 2HJBA 3VH0A 1TBGA 3NVNA 1YFQA 3V9FA 4A08A 2HJ4A 4O02A 3K72A 4E54A 4PXWA 1H2ZA 2EICA 3I7KA 1VZ2A 3UR4A 2OVRB 2H3XA 3P4FA 5JWZA 2Z2PA 5HYNB 3OF7A 3SMRA 4ERZA 3JZGA 4O2WA 2WQ8A 3N0DA 4R7AB 1OLZA 3BWSA 5A2Qg 3IJCA 1T2XA 3GREA 3N0EA 3MZKA 4L3GD 2PM7B 3EI3A 3V5WB 5H1MA 4NENA 4CI8A 4G1EA 2P9SC 3SJLD 4GGDA 3OL2A 4O3TB 4L9OA 2IWKA 3PVWB 5C9ZB 5AFU3 3SBRA 4ES0A 1B9XA 4CI3A 2OK6A 5IJ7E 4CZXA 1H2YA 5M5RA 4J0XA 3SCYA 4GQ2P 4N14A 2HU7A 3OW8A 3F3FA 3L4OD 3JRPA 3W15A 1R5MA 2H6NA 4GM8A 5HE3B 1XHMA 4FA5D 4ERYA 3VI4A 3U4YA 3VGZA 1RI6A 4PSWB 3V4VA 3ZDXA 3NIFA 2B4EA 2TRCB 4A11B 4XEIC 4FAND 5EMJB 3JROA 4JSXC 4JT5C 3O4HA 4J81A 3IUNA 2H6QA 4BCBA 3AL9A 1OMWB 1A0RB 2B5LA 3I8CA 3VI3A 2EBSA 1JOFA 4ZOZA 1QNIA 1O6GA 4MMZA 4BL0A 5FXYA 3IVMA 3V4PA 3HFQA 2I0TA 3JZHA 3EQ9A 5IC7A 3K6SA 2AGLA 3CIKB 3IJ1A 1L5GA 1VZ3A 2QR5A 4A08B 2XYIA 5HDBA 4AMZA 4E54B 3FCSA 5HE2B 3GD1I 4BUJC 3B7FA 3JZNA 4U7AA 5C92A 4IA9A 2YBAA 3I8EA 2P9LC 1O6FA 1U2VC 4GGAA 1MG2A 1BPOA 4AMYA 2QC5A 2I3SA 4AN0A 4A09A 3ZE0A 3BG0A 4BCCA 1PGUA 3RN1D 3ORVD 3EI3B 5B4WA 2PBIB 1C9IA 1GG2B 4NAAA 3C99A 3GC3B 3EI2A 4G1MA 3OL2B 4WK2A 2OVPB 2IUPA 2Z2NA 2VDKA 4X60B 2CE9A 3UKRC 3JB9L 1E8NA 1C9LA 3MZLA 1K3IA 2EIEA 2GC4A 2J56H 3UVOA 2CO0C 4Y5RD 1Q47A 3PE7A 4JSNC 5FKSA 3F3PA 5C86A 4GM3A 5EMMB 3ZE1A 3I7OA 4UI9R 1SHYB 2PM9A 4X61B 4OWRA 3KRWB 2QZPA 4LG8A 5I5IA 4XYHA 3K26A 3UVNA 4G56B 1B9YA 4AX4A 2H9LA 3PVUB 4K3ID 2XDWA 5FKRA 3OKYA 3ZDYA 4CI1A 5I5MA 3MUOA 2HESX 5TEFA 1JMZB 4J87A 2UZYB 1FWXA 2BKLA 1K32A 3NIGA 3J80g 2P9IC 3VA6A 5C2VB 1E5TA 2YMUA 1NEXB 4JXMA 4QRJA 3ZDZA 5M5VA 3OTTA 4ZOXA 1GOFA 2I3TA 3EU7A 4HDJA 3RMZD 2CE8A 4PNKB 3O4GA 2XZGA 4O45A 5EAMA 2IAAA 3OKWA 5KDOB 1UOQA 5GSAA 4A09B 3MXXA 2GNQA 4O1QD 3FGBA 4BCDA 2IURA 3F3GA 4OZUA 5H17A 3EI2B 2H6KA 2Z2OA 5FA5B 4MMXA 4A0AA 4DNUA 4CZVA 3EI4A 3IKOA 4FHLA 3DXMC 3O4IA 4FWWA 3IUMA 1MG3A 4NBMA 3NVXA 4IMMA 5HE0B 4CZYA 2G9AA 3PXTD 3PXSD 1TYQC 3KCIA 4JHPC 3SVWD 3A0FA 1H2XA 5SXMA 4CY1A 2H9NA 2OJYA 3SHFA 3L4MD 5EARA 3UVLA 4Z7QA 3E0CA 2P9PC 1GOGA 5AMSA 1XIPA 3IJEA 4TZ4A 3RN0D 1QFSA 3UVMA 3RFGA 1XKSA 4Z7OA 5FLXg 2PM9B 3AFCA 4H5IA 2UZXB 2H9MA 3DSMA 4RE6A 1U4CA 2BBKH 3I7NA 2HKMA 4J77A 3ZE2A 5FFOA 4A2MA 2HKRA
chains in the Genus database with same CATH topology
3ODTA 3OKYB 5C2WB 2IWFA 3DWLC 3I2NA 2CO0A 2AQ5A 3K27A 3RRMC 4AOWA 3SN6B 4EWRA 4O9DA 4U1EI 5CXCA 5AJAA 2H68A 5FKQA 3I89A 4H5JA 2AGWA 3IIYA 2YNPA 5GXHA 5EM2A 3ULEC 3CFSB 4X63B 4L3HD 4JD2C 3CFVA 1PBYB 3SFZA 4ZOVA 3KRXB 3PXWD 2I0SA 4ZN4A 4J82A 1GOTB 4KFMB 2B5NA 1P22A 4A0AB 2CN2A 3PSCB 5FQDA 3I7HA 3MMYA 5EAPA 3EI4B 3MKSB 4D0KA 1GXRA 3RLMD 4FA9D 4GMBA 1S4UX 2IUQA 2AGZA 5K1CC 4GM9A 5EMLB 4MK0B 3NVQA 2XL3A 5FKTA 2P9KC 2G99A 3RFHA 3SXTD 5THAA 3I7LA 4PBYA 4J78A 4A2LA 1GP2B 2O9KA 4JSPC 4J73A 5CYKA 2H47A 1SQJA 3GFCA 3DXKC 4FA4D 5CXBA 4GGCA 4E5ZA 2QXVA 4O3UB 4QQEA 1K8KC 2P9UC 4FA1D 3BG1A 4J79A 5IGOA 3J81g 3IIWA 2J55H 4AEZA 2BCJB 2AGYA 2AH0A 5CXCB 3I7PA 3V7DB 5IGQA 2AGXA 4LG9A 5EM2B 5GXIA 4J84A 3SWSD 1PEVA 3DM0A 5EMKB 3ZWLB 4J86A 5IJ8E 4ESGA 2W18A 4XYIA 4A0BA 1PI6A 2OK4A 4GQ1A 5GMKn 2HXCA 4J0WA 3AL8A 4L1QD 5IT9g 5TF2A 4Z8LA 4Y7RA 5TDHB 1JJUB 2XU7A 3JAMg 2MTAH 5K19A 5H14A 4CY3A 1SQ9A 2H13A 4CC9A 4QT8A 4CY5A 4ZOYA 3EI1A 3UVKA 3FM0A 3MKQA 2YNOA 3UKUC 4X3EA 2H9PA 2Q7QA 4FB1D 3SBQA 3EG6A 3EWEA 4JT6C 4LGNA 5CYKB 3PSLA 1JMXB 2P9NC 2HYEA 3SLED 4ERQA 4NSXA 4I79A 2PM6B 5CXBB 4JSVC 2AH1A 4E5ZB 2H14A 4J8BA 3RSEC 2XL2A 1NR0A 2YNNA 4PSXB 5HE1B 3AH8B 4CI2A 4BH6A 2J57G 3EMHA 4CY2A 1L0QA 2GC7A 5TEEA 1ERJA 3C75H 4A0BB 3C5MA 2CNXA 3SBPA 2CN3A 3C9CA 5I5JA 3AL8B 4GZ8A 2B5MA 4QL1A 4YVDA 2YB8B 4A11A 1N6FA 2OVQB 4PBZA 4J8GA 1MDAH 4K3JB 2IUVA 3JPXA 5EALA 3FRXA 4FAVD 4D6VA 4A7JA 2OIZA 1VYHC 3EI1B 1N6EA 2I0RA 3OKTA 1N6DA 3IJ0A 4GQBB 5HQGA 4PC0A 2HJBA 3VH0A 1TBGA 3NVNA 1YFQA 3V9FA 4A08A 2HJ4A 4E54A 4PXWA 3I7KA 3UR4A 2OVRB 2H3XA 3P4FA 5JWZA 2Z2PA 5HYNB 3SMRA 4ERZA 3JZGA 3N0DA 4R7AB 1OLZA 3BWSA 5A2Qg 3IJCA 3GREA 3N0EA 3MZKA 4L3GD 2PM7B 3EI3A 3V5WB 5H1MA 4CI8A 2P9SC 3SJLD 4GGDA 3OL2A 4O3TB 4L9OA 2IWKA 3PVWB 5C9ZB 5AFU3 3SBRA 4ES0A 1B9XA 4CI3A 2OK6A 5IJ7E 4CZXA 4J0XA 3SCYA 4GQ2P 4N14A 3OW8A 3F3FA 3L4OD 3JRPA 3W15A 1R5MA 2H6NA 4GM8A 5HE3B 1XHMA 4FA5D 4ERYA 3U4YA 3VGZA 1RI6A 4PSWB 2B4EA 2TRCB 4A11B 4XEIC 4FAND 5EMJB 3JROA 4JSXC 4JT5C 4J81A 2H6QA 3AL9A 1OMWB 1A0RB 2B5LA 3I8CA 2EBSA 1JOFA 4ZOZA 1QNIA 4BL0A 5FXYA 3HFQA 2I0TA 3JZHA 5IC7A 2AGLA 3CIKB 3IJ1A 4A08B 2XYIA 4E54B 5HE2B 4BUJC 3B7FA 3JZNA 4U7AA 4IA9A 2YBAA 3I8EA 2P9LC 4GGAA 1U2VC 1MG2A 2QC5A 2I3SA 4A09A 3BG0A 1PGUA 3RN1D 3ORVD 3EI3B 5B4WA 2PBIB 1GG2B 3C99A 3EI2A 3OL2B 2OVPB 2IUPA 2Z2NA 4X60B 2CE9A 3UKRC 3JB9L 3MZLA 2GC4A 2J56H 3UVOA 2CO0C 4Y5RD 1Q47A 3PE7A 4JSNC 5FKSA 3F3PA 4GM3A 5EMMB 3I7OA 4UI9R 1SHYB 2PM9A 4X61B 4OWRA 3KRWB 4LG8A 5I5IA 4XYHA 3K26A 3UVNA 4G56B 1B9YA 2H9LA 3PVUB 4K3ID 5FKRA 3OKYA 4CI1A 5I5MA 2HESX 5TEFA 1JMZB 4J87A 2UZYB 1FWXA 1K32A 3J80g 2P9IC 3VA6A 5C2VB 2YMUA 1NEXB 4JXMA 4QRJA 3OTTA 4ZOXA 2I3TA 3EU7A 4HDJA 3RMZD 2CE8A 4PNKB 4O45A 5EAMA 2IAAA 3OKWA 5KDOB 5GSAA 4A09B 3MXXA 2GNQA 4O1QD 3FGBA 2IURA 3F3GA 4OZUA 5H17A 3EI2B 2H6KA 2Z2OA 5FA5B 4A0AA 4CZVA 3EI4A 3IKOA 4FHLA 3DXMC 4FWWA 1MG3A 3NVXA 4IMMA 5HE0B 4CZYA 2G9AA 3PXTD 3PXSD 1TYQC 3SVWD 3A0FA 4CY1A 5SXMA 2H9NA 2OJYA 3SHFA 3L4MD 5EARA 3UVLA 3E0CA 2P9PC 5AMSA 1XIPA 4TZ4A 3RN0D 3UVMA 3RFGA 1XKSA 5FLXg 2PM9B 3AFCA 4H5IA 2UZXB 2H9MA 3DSMA 1U4CA 2BBKH 3I7NA 2HKMA 4J77A 4A2MA 2HKRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ODT A;  3OKY B;  5C2W B;  2IWF A;  3DWL C;  3I2N A;  2CO0 A;  2AQ5 A;  3K27 A;  3RRM C;  4AOW A;  3SN6 B;  4EWR A;  4O9D A;  4U1E I;  5CXC A;  5AJA A;  2H68 A;  5FKQ A;  3I89 A;  4H5J A;  2AGW A;  3IIY A;  2YNP A;  5GXH A;  5EM2 A;  3ULE C;  3CFS B;  4X63 B;  4L3H D;  4JD2 C;  3CFV A;  1PBY B;  3SFZ A;  4ZOV A;  3KRX B;  3PXW D;  2I0S A;  4ZN4 A;  4J82 A;  1GOT B;  4KFM B;  2B5N A;  1P22 A;  4A0A B;  2CN2 A;  3PSC B;  5FQD A;  3I7H A;  3MMY A;  5EAP A;  3EI4 B;  3MKS B;  4D0K A;  1GXR A;  3RLM D;  4FA9 D;  4GMB A;  1S4U X;  2IUQ A;  2AGZ A;  5K1C C;  4GM9 A;  5EML B;  4MK0 B;  3NVQ A;  2XL3 A;  5FKT A;  2P9K C;  2G99 A;  3RFH A;  3SXT D;  5THA A;  3I7L A;  4PBY A;  4J78 A;  4A2L A;  1GP2 B;  2O9K A;  4JSP C;  4J73 A;  5CYK A;  2H47 A;  1SQJ A;  3GFC A;  3DXK C;  4FA4 D;  5CXB A;  4GGC A;  4E5Z A;  2QXV A;  4O3U B;  4QQE A;  1K8K C;  2P9U C;  4FA1 D;  3BG1 A;  4J79 A;  5IGO A;  3J81 g;  3IIW A;  2J55 H;  4AEZ A;  2BCJ B;  2AGY A;  2AH0 A;  5CXC B;  3I7P A;  3V7D B;  5IGQ A;  2AGX A;  4LG9 A;  5EM2 B;  5GXI A;  4J84 A;  3SWS D;  1PEV A;  3DM0 A;  5EMK B;  3ZWL B;  4J86 A;  5IJ8 E;  4ESG A;  2W18 A;  4XYI A;  4A0B A;  1PI6 A;  2OK4 A;  4GQ1 A;  5GMK n;  2HXC A;  4J0W A;  3AL8 A;  4L1Q D;  5IT9 g;  5TF2 A;  4Z8L A;  4Y7R A;  5TDH B;  1JJU B;  2XU7 A;  3JAM g;  2MTA H;  5K19 A;  5H14 A;  4CY3 A;  1SQ9 A;  2H13 A;  4CC9 A;  4QT8 A;  4CY5 A;  4ZOY A;  3EI1 A;  3UVK A;  3FM0 A;  3MKQ A;  2YNO A;  3UKU C;  4X3E A;  2H9P A;  2Q7Q A;  4FB1 D;  3SBQ A;  3EG6 A;  3EWE A;  4JT6 C;  4LGN A;  5CYK B;  3PSL A;  1JMX B;  2P9N C;  2HYE A;  3SLE D;  4ERQ A;  4NSX A;  4I79 A;  2PM6 B;  5CXB B;  4JSV C;  2AH1 A;  4E5Z B;  2H14 A;  4J8B A;  3RSE C;  2XL2 A;  1NR0 A;  2YNN A;  4PSX B;  5HE1 B;  3AH8 B;  4CI2 A;  4BH6 A;  2J57 G;  3EMH A;  4CY2 A;  1L0Q A;  2GC7 A;  5TEE A;  1ERJ A;  3C75 H;  4A0B B;  3C5M A;  2CNX A;  3SBP A;  2CN3 A;  3C9C A;  5I5J A;  3AL8 B;  4GZ8 A;  2B5M A;  4QL1 A;  4YVD A;  2YB8 B;  4A11 A;  1N6F A;  2OVQ B;  4PBZ A;  4J8G A;  1MDA H;  4K3J B;  2IUV A;  3JPX A;  5EAL A;  3FRX A;  4FAV D;  4D6V A;  4A7J A;  2OIZ A;  1VYH C;  3EI1 B;  1N6E A;  2I0R A;  3OKT A;  1N6D A;  3IJ0 A;  4GQB B;  5HQG A;  4PC0 A;  2HJB A;  3VH0 A;  1TBG A;  3NVN A;  1YFQ A;  3V9F A;  4A08 A;  2HJ4 A;  4E54 A;  4PXW A;  3I7K A;  3UR4 A;  2OVR B;  2H3X A;  3P4F A;  5JWZ A;  2Z2P A;  5HYN B;  3SMR A;  4ERZ A;  3JZG A;  3N0D A;  4R7A B;  1OLZ A;  3BWS A;  5A2Q g;  3IJC A;  3GRE A;  3N0E A;  3MZK A;  4L3G D;  2PM7 B;  3EI3 A;  3V5W B;  5H1M A;  4CI8 A;  2P9S C;  3SJL D;  4GGD A;  3OL2 A;  4O3T B;  4L9O A;  2IWK A;  3PVW B;  5C9Z B;  5AFU 3;  3SBR A;  4ES0 A;  1B9X A;  4CI3 A;  2OK6 A;  5IJ7 E;  4CZX A;  4J0X A;  3SCY A;  4GQ2 P;  4N14 A;  3OW8 A;  3F3F A;  3L4O D;  3JRP A;  3W15 A;  1R5M A;  2H6N A;  4GM8 A;  5HE3 B;  1XHM A;  4FA5 D;  4ERY A;  3U4Y A;  3VGZ A;  1RI6 A;  4PSW B;  2B4E A;  2TRC B;  4A11 B;  4XEI C;  4FAN D;  5EMJ B;  3JRO A;  4JSX C;  4JT5 C;  4J81 A;  2H6Q A;  3AL9 A;  1OMW B;  1A0R B;  2B5L A;  3I8C A;  2EBS A;  1JOF A;  4ZOZ A;  1QNI A;  4BL0 A;  5FXY A;  3HFQ A;  2I0T A;  3JZH A;  5IC7 A;  2AGL A;  3CIK B;  3IJ1 A;  4A08 B;  2XYI A;  4E54 B;  5HE2 B;  4BUJ C;  3B7F A;  3JZN A;  4U7A A;  4IA9 A;  2YBA A;  3I8E A;  2P9L C;  4GGA A;  1U2V C;  1MG2 A;  2QC5 A;  2I3S A;  4A09 A;  3BG0 A;  1PGU A;  3RN1 D;  3ORV D;  3EI3 B;  5B4W A;  2PBI B;  1GG2 B;  3C99 A;  3EI2 A;  3OL2 B;  2OVP B;  2IUP A;  2Z2N A;  4X60 B;  2CE9 A;  3UKR C;  3JB9 L;  3MZL A;  2GC4 A;  2J56 H;  3UVO A;  2CO0 C;  4Y5R D;  1Q47 A;  3PE7 A;  4JSN C;  5FKS A;  3F3P A;  4GM3 A;  5EMM B;  3I7O A;  4UI9 R;  1SHY B;  2PM9 A;  4X61 B;  4OWR A;  3KRW B;  4LG8 A;  5I5I A;  4XYH A;  3K26 A;  3UVN A;  4G56 B;  1B9Y A;  2H9L A;  3PVU B;  4K3I D;  5FKR A;  3OKY A;  4CI1 A;  5I5M A;  2HES X;  5TEF A;  1JMZ B;  4J87 A;  2UZY B;  1FWX A;  1K32 A;  3J80 g;  2P9I C;  3VA6 A;  5C2V B;  2YMU A;  1NEX B;  4JXM A;  4QRJ A;  3OTT A;  4ZOX A;  2I3T A;  3EU7 A;  4HDJ A;  3RMZ D;  2CE8 A;  4PNK B;  4O45 A;  5EAM A;  2IAA A;  3OKW A;  5KDO B;  5GSA A;  4A09 B;  3MXX A;  2GNQ A;  4O1Q D;  3FGB A;  2IUR A;  3F3G A;  4OZU A;  5H17 A;  3EI2 B;  2H6K A;  2Z2O A;  5FA5 B;  4A0A A;  4CZV A;  3EI4 A;  3IKO A;  4FHL A;  3DXM C;  4FWW A;  1MG3 A;  3NVX A;  4IMM A;  5HE0 B;  4CZY A;  2G9A A;  3PXT D;  3PXS D;  1TYQ C;  3SVW D;  3A0F A;  4CY1 A;  5SXM A;  2H9N A;  2OJY A;  3SHF A;  3L4M D;  5EAR A;  3UVL A;  3E0C A;  2P9P C;  5AMS A;  1XIP A;  4TZ4 A;  3RN0 D;  3UVM A;  3RFG A;  1XKS A;  5FLX g;  2PM9 B;  3AFC A;  4H5I A;  2UZX B;  2H9M A;  3DSM A;  1U4C A;  2BBK H;  3I7N A;  2HKM A;  4J77 A;  4A2M A;  2HKR A; 
#chains in the Genus database with same CATH topology
 3T3M A;  3ODT A;  3OKY B;  5C2W B;  2IWF A;  1U8C A;  4RE5 A;  1YR2 A;  3DWL C;  3I2N A;  2CO0 A;  2VDP A;  2AQ5 A;  3K27 A;  1JTD B;  3RRM C;  4AOW A;  3SN6 B;  4EWR A;  2VDL A;  4O9D A;  4U1E I;  5CXC A;  5AJA A;  2H68 A;  5FKQ A;  3I89 A;  4H5J A;  2AGW A;  1UOP A;  1M1X A;  3IIY A;  2YNP A;  5GXH A;  5EM2 A;  3ULE C;  3CFS B;  4X63 B;  4L3H D;  4JD2 C;  3CFV A;  2VDN A;  1PBY B;  3SFZ A;  4ZOV A;  3KRX B;  3PXW D;  2I0S A;  4ZN4 A;  4J82 A;  1GOT B;  4KFM B;  5E6R A;  2B5N A;  1P22 A;  4A0A B;  5M5S A;  2CN2 A;  3PSC B;  5FQD A;  3I7H A;  3MMY A;  5EAP A;  3EI4 B;  3MKS B;  5M61 A;  4D0K A;  2VDQ A;  1GXR A;  4AN1 A;  4UM8 A;  2VZ1 A;  3RLM D;  4FA9 D;  4GMB A;  3QHY B;  1S4U X;  2IUQ A;  2AGZ A;  5K1C C;  1JV2 A;  4GM9 A;  5EML B;  4MK0 B;  2EID A;  3NVQ A;  2XL3 A;  4IRZ A;  5FKT A;  4MMY A;  4QAM A;  2P9K C;  2G99 A;  3RFH A;  3SXT D;  5THA A;  1A12 A;  3I7L A;  3T3P A;  4PBY A;  4J78 A;  4NC4 A;  5E6U A;  1GP2 B;  2O9K A;  4A2L A;  4JSP C;  4DNV A;  4J73 A;  5CYK A;  2H47 A;  1SQJ A;  3GFC A;  3DXK C;  1I2M B;  4FA4 D;  5CXB A;  3IUJ A;  4GGC A;  4E5Z A;  3O4J A;  2QXV A;  4O3U B;  4QQE A;  1K8K C;  2P9U C;  4FA1 D;  3BG1 A;  4J79 A;  5E6S A;  5IGO A;  3J81 g;  3IIW A;  4UM9 A;  2J55 H;  4AEZ A;  2BCJ B;  2AGY A;  1H2W A;  2AH0 A;  5CXC B;  3I7P A;  3V7D B;  5IGQ A;  2AGX A;  4LG9 A;  5EM2 B;  5GXI A;  4J84 A;  3SWS D;  1PEV A;  3DM0 A;  5EMK B;  1TYE A;  3ZWL B;  3DDU A;  4J86 A;  4ESG A;  5IJ8 E;  2W18 A;  4XYI A;  4A0B A;  2VDR A;  1PI6 A;  3MVD K;  2OK4 A;  2EIB A;  4GQ1 A;  5GMK n;  1UTC A;  2HXC A;  4BP9 A;  4J0W A;  3AL8 A;  3FCU A;  4L1Q D;  5IT9 g;  4D9S A;  5TF2 A;  4Z8L A;  4Y7R A;  5TDH B;  1JJU B;  2XU7 A;  3JAM g;  2VC2 A;  2MTA H;  5K19 A;  5H14 A;  4CY3 A;  1SQ9 A;  2H13 A;  4CC9 A;  4QT8 A;  4CY5 A;  4ZOY A;  3EI1 A;  3UVK A;  3FM0 A;  3MKQ A;  4WJK A;  2YNO A;  3UKU C;  4X3E A;  1GOH A;  2H9P A;  2Q7Q A;  4FB1 D;  2XE4 A;  3SBQ A;  3IUQ A;  3EG6 A;  3EWE A;  1VE7 A;  3MUN A;  4JT6 C;  4LGN A;  5CYK B;  3PSL A;  1JMX B;  1QFM A;  2P9N C;  2HYE A;  3SLE D;  4ERQ A;  3NID A;  4NSX A;  4I79 A;  2PM6 B;  5CXB B;  1VE6 A;  4JSV C;  2AH1 A;  4E5Z B;  2H14 A;  4J8B A;  3RSE C;  2XL2 A;  2HU8 A;  1NR0 A;  2YNN A;  4PSX B;  5HE1 B;  3AH8 B;  4BP8 A;  4CI2 A;  4BH6 A;  2J57 G;  2VZ3 A;  3IUR A;  3IUL A;  5FFG A;  4Z7N A;  3EMH A;  4CY2 A;  1L0Q A;  2GC7 A;  3EQ7 A;  5TEE A;  5M5T A;  1ERJ A;  3C75 H;  4G55 A;  3K71 A;  4A0B B;  3C5M A;  1UOO A;  3EQ8 A;  4JHN A;  2CNX A;  3SBP A;  2CN3 A;  1E8M A;  3C9C A;  5I5J A;  3AL8 B;  4GZ8 A;  2B5M A;  4DNW A;  4QL1 A;  2JKX A;  2HU5 A;  2VDO A;  4YVD A;  2YB8 B;  4A11 A;  1N6F A;  2OVQ B;  4PBZ A;  2VDM A;  4J8G A;  4L1M A;  5M5U A;  1MDA H;  4K3J B;  2IUV A;  3JPX A;  5EAL A;  3FRX A;  4FAV D;  4D6V A;  4A7J A;  3QI0 A;  4WK4 A;  2OIZ A;  1VYH C;  4WK0 A;  3EI1 B;  1N6E A;  2I0R A;  3OKT A;  1N6D A;  3IJ0 A;  4GQB B;  5HQG A;  4PC0 A;  2HJB A;  3VH0 A;  1TBG A;  3NVN A;  1YFQ A;  3V9F A;  4A08 A;  2HJ4 A;  4O02 A;  3K72 A;  4E54 A;  4PXW A;  1H2Z A;  2EIC A;  3I7K A;  1VZ2 A;  3UR4 A;  2OVR B;  2H3X A;  3P4F A;  5JWZ A;  2Z2P A;  5HYN B;  3OF7 A;  3SMR A;  4ERZ A;  3JZG A;  4O2W A;  2WQ8 A;  3N0D A;  4R7A B;  1OLZ A;  3BWS A;  5A2Q g;  3IJC A;  1T2X A;  3GRE A;  3N0E A;  3MZK A;  4L3G D;  2PM7 B;  3EI3 A;  3V5W B;  5H1M A;  4NEN A;  4CI8 A;  4G1E A;  2P9S C;  3SJL D;  4GGD A;  3OL2 A;  4O3T B;  4L9O A;  2IWK A;  3PVW B;  5C9Z B;  5AFU 3;  3SBR A;  4ES0 A;  1B9X A;  4CI3 A;  2OK6 A;  5IJ7 E;  4CZX A;  1H2Y A;  5M5R A;  4J0X A;  3SCY A;  4GQ2 P;  4N14 A;  2HU7 A;  3OW8 A;  3F3F A;  3L4O D;  3JRP A;  3W15 A;  1R5M A;  2H6N A;  4GM8 A;  5HE3 B;  1XHM A;  4FA5 D;  4ERY A;  3VI4 A;  3U4Y A;  3VGZ A;  1RI6 A;  4PSW B;  3V4V A;  3ZDX A;  3NIF A;  2B4E A;  2TRC B;  4A11 B;  4XEI C;  4FAN D;  5EMJ B;  3JRO A;  4JSX C;  4JT5 C;  3O4H A;  4J81 A;  3IUN A;  2H6Q A;  4BCB A;  3AL9 A;  1OMW B;  1A0R B;  2B5L A;  3I8C A;  3VI3 A;  2EBS A;  1JOF A;  4ZOZ A;  1QNI A;  1O6G A;  4MMZ A;  4BL0 A;  5FXY A;  3IVM A;  3V4P A;  3HFQ A;  2I0T A;  3JZH A;  3EQ9 A;  5IC7 A;  3K6S A;  2AGL A;  3CIK B;  3IJ1 A;  1L5G A;  1VZ3 A;  2QR5 A;  4A08 B;  2XYI A;  5HDB A;  4AMZ A;  4E54 B;  3FCS A;  5HE2 B;  3GD1 I;  4BUJ C;  3B7F A;  3JZN A;  4U7A A;  5C92 A;  4IA9 A;  2YBA A;  3I8E A;  2P9L C;  1O6F A;  1U2V C;  4GGA A;  1MG2 A;  1BPO A;  4AMY A;  2QC5 A;  2I3S A;  4AN0 A;  4A09 A;  3ZE0 A;  3BG0 A;  4BCC A;  1PGU A;  3RN1 D;  3ORV D;  3EI3 B;  5B4W A;  2PBI B;  1C9I A;  1GG2 B;  4NAA A;  3C99 A;  3GC3 B;  3EI2 A;  4G1M A;  3OL2 B;  4WK2 A;  2OVP B;  2IUP A;  2Z2N A;  2VDK A;  4X60 B;  2CE9 A;  3UKR C;  3JB9 L;  1E8N A;  1C9L A;  3MZL A;  1K3I A;  2EIE A;  2GC4 A;  2J56 H;  3UVO A;  2CO0 C;  4Y5R D;  1Q47 A;  3PE7 A;  4JSN C;  5FKS A;  3F3P A;  5C86 A;  4GM3 A;  5EMM B;  3ZE1 A;  3I7O A;  4UI9 R;  1SHY B;  2PM9 A;  4X61 B;  4OWR A;  3KRW B;  2QZP A;  4LG8 A;  5I5I A;  4XYH A;  3K26 A;  3UVN A;  4G56 B;  1B9Y A;  4AX4 A;  2H9L A;  3PVU B;  4K3I D;  2XDW A;  5FKR A;  3OKY A;  3ZDY A;  4CI1 A;  5I5M A;  3MUO A;  2HES X;  5TEF A;  1JMZ B;  4J87 A;  2UZY B;  1FWX A;  2BKL A;  1K32 A;  3NIG A;  3J80 g;  2P9I C;  3VA6 A;  5C2V B;  1E5T A;  2YMU A;  1NEX B;  4JXM A;  4QRJ A;  3ZDZ A;  5M5V A;  3OTT A;  4ZOX A;  1GOF A;  2I3T A;  3EU7 A;  4HDJ A;  3RMZ D;  2CE8 A;  4PNK B;  3O4G A;  2XZG A;  4O45 A;  5EAM A;  2IAA A;  3OKW A;  5KDO B;  1UOQ A;  5GSA A;  4A09 B;  3MXX A;  2GNQ A;  4O1Q D;  3FGB A;  4BCD A;  2IUR A;  3F3G A;  4OZU A;  5H17 A;  3EI2 B;  2H6K A;  2Z2O A;  5FA5 B;  4MMX A;  4A0A A;  4DNU A;  4CZV A;  3EI4 A;  3IKO A;  4FHL A;  3DXM C;  3O4I A;  4FWW A;  3IUM A;  1MG3 A;  4NBM A;  3NVX A;  4IMM A;  5HE0 B;  4CZY A;  2G9A A;  3PXT D;  3PXS D;  1TYQ C;  3KCI A;  4JHP C;  3SVW D;  3A0F A;  1H2X A;  5SXM A;  4CY1 A;  2H9N A;  2OJY A;  3SHF A;  3L4M D;  5EAR A;  3UVL A;  4Z7Q A;  3E0C A;  2P9P C;  1GOG A;  5AMS A;  1XIP A;  3IJE A;  4TZ4 A;  3RN0 D;  1QFS A;  3UVM A;  3RFG A;  1XKS A;  4Z7O A;  5FLX g;  2PM9 B;  3AFC A;  4H5I A;  2UZX B;  2H9M A;  3DSM A;  4RE6 A;  1U4C A;  2BBK H;  3I7N A;  2HKM A;  4J77 A;  3ZE2 A;  5FFO A;  4A2M A;  2HKR A; 
#chains in the Genus database with same CATH homology
 3ODT A;  3OKY B;  5C2W B;  2IWF A;  3DWL C;  3I2N A;  2CO0 A;  2AQ5 A;  3K27 A;  3RRM C;  4AOW A;  3SN6 B;  4EWR A;  4O9D A;  4U1E I;  5CXC A;  5AJA A;  2H68 A;  5FKQ A;  3I89 A;  4H5J A;  2AGW A;  3IIY A;  2YNP A;  5GXH A;  5EM2 A;  3ULE C;  3CFS B;  4X63 B;  4L3H D;  4JD2 C;  3CFV A;  1PBY B;  3SFZ A;  4ZOV A;  3KRX B;  3PXW D;  2I0S A;  4ZN4 A;  4J82 A;  1GOT B;  4KFM B;  2B5N A;  1P22 A;  4A0A B;  2CN2 A;  3PSC B;  5FQD A;  3I7H A;  3MMY A;  5EAP A;  3EI4 B;  3MKS B;  4D0K A;  1GXR A;  3RLM D;  4FA9 D;  4GMB A;  1S4U X;  2IUQ A;  2AGZ A;  5K1C C;  4GM9 A;  5EML B;  4MK0 B;  3NVQ A;  2XL3 A;  5FKT A;  2P9K C;  2G99 A;  3RFH A;  3SXT D;  5THA A;  3I7L A;  4PBY A;  4J78 A;  4A2L A;  1GP2 B;  2O9K A;  4JSP C;  4J73 A;  5CYK A;  2H47 A;  1SQJ A;  3GFC A;  3DXK C;  4FA4 D;  5CXB A;  4GGC A;  4E5Z A;  2QXV A;  4O3U B;  4QQE A;  1K8K C;  2P9U C;  4FA1 D;  3BG1 A;  4J79 A;  5IGO A;  3J81 g;  3IIW A;  2J55 H;  4AEZ A;  2BCJ B;  2AGY A;  2AH0 A;  5CXC B;  3I7P A;  3V7D B;  5IGQ A;  2AGX A;  4LG9 A;  5EM2 B;  5GXI A;  4J84 A;  3SWS D;  1PEV A;  3DM0 A;  5EMK B;  3ZWL B;  4J86 A;  5IJ8 E;  4ESG A;  2W18 A;  4XYI A;  4A0B A;  1PI6 A;  2OK4 A;  4GQ1 A;  5GMK n;  2HXC A;  4J0W A;  3AL8 A;  4L1Q D;  5IT9 g;  5TF2 A;  4Z8L A;  4Y7R A;  5TDH B;  1JJU B;  2XU7 A;  3JAM g;  2MTA H;  5K19 A;  5H14 A;  4CY3 A;  1SQ9 A;  2H13 A;  4CC9 A;  4QT8 A;  4CY5 A;  4ZOY A;  3EI1 A;  3UVK A;  3FM0 A;  3MKQ A;  2YNO A;  3UKU C;  4X3E A;  2H9P A;  2Q7Q A;  4FB1 D;  3SBQ A;  3EG6 A;  3EWE A;  4JT6 C;  4LGN A;  5CYK B;  3PSL A;  1JMX B;  2P9N C;  2HYE A;  3SLE D;  4ERQ A;  4NSX A;  4I79 A;  2PM6 B;  5CXB B;  4JSV C;  2AH1 A;  4E5Z B;  2H14 A;  4J8B A;  3RSE C;  2XL2 A;  1NR0 A;  2YNN A;  4PSX B;  5HE1 B;  3AH8 B;  4CI2 A;  4BH6 A;  2J57 G;  3EMH A;  4CY2 A;  1L0Q A;  2GC7 A;  5TEE A;  1ERJ A;  3C75 H;  4A0B B;  3C5M A;  2CNX A;  3SBP A;  2CN3 A;  3C9C A;  5I5J A;  3AL8 B;  4GZ8 A;  2B5M A;  4QL1 A;  4YVD A;  2YB8 B;  4A11 A;  1N6F A;  2OVQ B;  4PBZ A;  4J8G A;  1MDA H;  4K3J B;  2IUV A;  3JPX A;  5EAL A;  3FRX A;  4FAV D;  4D6V A;  4A7J A;  2OIZ A;  1VYH C;  3EI1 B;  1N6E A;  2I0R A;  3OKT A;  1N6D A;  3IJ0 A;  4GQB B;  5HQG A;  4PC0 A;  2HJB A;  3VH0 A;  1TBG A;  3NVN A;  1YFQ A;  3V9F A;  4A08 A;  2HJ4 A;  4E54 A;  4PXW A;  3I7K A;  3UR4 A;  2OVR B;  2H3X A;  3P4F A;  5JWZ A;  2Z2P A;  5HYN B;  3SMR A;  4ERZ A;  3JZG A;  3N0D A;  4R7A B;  1OLZ A;  3BWS A;  5A2Q g;  3IJC A;  3GRE A;  3N0E A;  3MZK A;  4L3G D;  2PM7 B;  3EI3 A;  3V5W B;  5H1M A;  4CI8 A;  2P9S C;  3SJL D;  4GGD A;  3OL2 A;  4O3T B;  4L9O A;  2IWK A;  3PVW B;  5C9Z B;  5AFU 3;  3SBR A;  4ES0 A;  1B9X A;  4CI3 A;  2OK6 A;  5IJ7 E;  4CZX A;  4J0X A;  3SCY A;  4GQ2 P;  4N14 A;  3OW8 A;  3F3F A;  3L4O D;  3JRP A;  3W15 A;  1R5M A;  2H6N A;  4GM8 A;  5HE3 B;  1XHM A;  4FA5 D;  4ERY A;  3U4Y A;  3VGZ A;  1RI6 A;  4PSW B;  2B4E A;  2TRC B;  4A11 B;  4XEI C;  4FAN D;  5EMJ B;  3JRO A;  4JSX C;  4JT5 C;  4J81 A;  2H6Q A;  3AL9 A;  1OMW B;  1A0R B;  2B5L A;  3I8C A;  2EBS A;  1JOF A;  4ZOZ A;  1QNI A;  4BL0 A;  5FXY A;  3HFQ A;  2I0T A;  3JZH A;  5IC7 A;  2AGL A;  3CIK B;  3IJ1 A;  4A08 B;  2XYI A;  4E54 B;  5HE2 B;  4BUJ C;  3B7F A;  3JZN A;  4U7A A;  4IA9 A;  2YBA A;  3I8E A;  2P9L C;  4GGA A;  1U2V C;  1MG2 A;  2QC5 A;  2I3S A;  4A09 A;  3BG0 A;  1PGU A;  3RN1 D;  3ORV D;  3EI3 B;  5B4W A;  2PBI B;  1GG2 B;  3C99 A;  3EI2 A;  3OL2 B;  2OVP B;  2IUP A;  2Z2N A;  4X60 B;  2CE9 A;  3UKR C;  3JB9 L;  3MZL A;  2GC4 A;  2J56 H;  3UVO A;  2CO0 C;  4Y5R D;  1Q47 A;  3PE7 A;  4JSN C;  5FKS A;  3F3P A;  4GM3 A;  5EMM B;  3I7O A;  4UI9 R;  1SHY B;  2PM9 A;  4X61 B;  4OWR A;  3KRW B;  4LG8 A;  5I5I A;  4XYH A;  3K26 A;  3UVN A;  4G56 B;  1B9Y A;  2H9L A;  3PVU B;  4K3I D;  5FKR A;  3OKY A;  4CI1 A;  5I5M A;  2HES X;  5TEF A;  1JMZ B;  4J87 A;  2UZY B;  1FWX A;  1K32 A;  3J80 g;  2P9I C;  3VA6 A;  5C2V B;  2YMU A;  1NEX B;  4JXM A;  4QRJ A;  3OTT A;  4ZOX A;  2I3T A;  3EU7 A;  4HDJ A;  3RMZ D;  2CE8 A;  4PNK B;  4O45 A;  5EAM A;  2IAA A;  3OKW A;  5KDO B;  5GSA A;  4A09 B;  3MXX A;  2GNQ A;  4O1Q D;  3FGB A;  2IUR A;  3F3G A;  4OZU A;  5H17 A;  3EI2 B;  2H6K A;  2Z2O A;  5FA5 B;  4A0A A;  4CZV A;  3EI4 A;  3IKO A;  4FHL A;  3DXM C;  4FWW A;  1MG3 A;  3NVX A;  4IMM A;  5HE0 B;  4CZY A;  2G9A A;  3PXT D;  3PXS D;  1TYQ C;  3SVW D;  3A0F A;  4CY1 A;  5SXM A;  2H9N A;  2OJY A;  3SHF A;  3L4M D;  5EAR A;  3UVL A;  3E0C A;  2P9P C;  5AMS A;  1XIP A;  4TZ4 A;  3RN0 D;  3UVM A;  3RFG A;  1XKS A;  5FLX g;  2PM9 B;  3AFC A;  4H5I A;  2UZX B;  2H9M A;  3DSM A;  1U4C A;  2BBK H;  3I7N A;  2HKM A;  4J77 A;  4A2M A;  2HKR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...