5FA5B

Crystal structure of prmt5:mep50 in complex with mta and h4 peptide
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
308
structure length
301
Chain Sequence
PNAPACMERQLEAARYRSDGALLLGASSLSGRCWAGSLWLFKDPCAAPNEGFCSAGVQTEAGVADLTWVGERGILVASDSGAVELWELDENETLIVSKFCKYEHDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQVVLSSYRAHAAQVTCVAASPHKDSVFLSCSEDNRILLWDTRCPKPASQIGGYLPTSLAWHPQQSEVFVFGDENGTVSLVDTKSVLSSAVHSQCVTGLVFSPHSVPFLASLSEDCSLAVLDSSLSELFRSQAHRDFVRDATWSPLNHSLLTTVGWDHQVVHHVVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/protein binding
molecule keywords Protein arginine N-methyltransferase 5
publication title Disordered methionine metabolism in MTAP/CDKN2A-deleted cancers leads to dependence on PRMT5.
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 301
sequence length 308
ec nomenclature
pdb deposition date 2015-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5fa5B00
2PBIB 3KRWB 4OZUA 5FLXg 1A0RB 4ERZA 1GP2B 4UI9R 3OTTA 3IJ0A 2I3TA 1XHMA 4CY2A 2QC5A 2H9MA 4JSXC 2H6NA 5HYNB 4J84A 3SLED 4FA9D 3NVXA 4CY3A 4CC9A 2AGZA 4D0KA 4EWRA 4JT5C 3SJLD 5GXHA 2HKRA 1NR0A 3OKYA 2MTAH 2YNPA 3IIYA 3PXTD 3JB9L 2AQ5A 4NSXA 2GC4A 3SMRA 3L4MD 4J8BA 1JMXB 4GGAA 5K19A 2TRCB 1B9YA 4HDJA 2B5NA 2CN2A 3SN6B 1PGUA 4AEZA 3C5MA 5TDHB 5THAA 3JZHA 3F3GA 3UVNA 4O3UB 4QL1A 3HFQA 4FAVD 5HE1B 5GMKn 3V9FA 3L4OD 3DXKC 4ERYA 4LG8A 4J8GA 2P9UC 4BH6A 5GXIA 3CIKB 2Z2NA 5FKSA 5EM2B 5AJAA 3JRPA 2PM6B 5FXYA 4FA5D 3P4FA 2XYIA 1MG3A 1K32A 2CO0A 3PVUB 3EI2B 5FKTA 4QQEA 5IGQA 3K27A 2HESX 1OLZA 2HJBA 4X60B 3MKSB 3ODTA 2YNOA 3C9CA 4GM9A 3RN1D 3A0FA 4A09A 5H1MA 2IUPA 3U4YA 3PVWB 4ZOXA 4J86A 4GQBB 3SHFA 4GGDA 2B5MA 5I5IA 2B5LA 5CXCB 5HQGA 1SQJA 3ORVD 2PM9B 2H6QA 3KRXB 1GOTB 2AGYA 4A0BA 4CI2A 4X3EA 3DWLC 3I89A 2H47A 5FKQA 1U4CA 3OL2B 4XEIC 2H9NA 4PBYA 4CZXA 3UVOA 2P9PC 1P22A 5CXBB 3RFGA 5EAMA 1Q47A 5C2WB 4PSWB 4GM8A 3JPXA 3I8EA 4XYHA 2CE9A 5IGOA 1N6DA 2P9NC 5C9ZB 1TYQC 5EAPA 1FWXA 2AGWA 4O9DA 3N0EA 4JSNC 2W18A 3FM0A 5EALA 1MG2A 3C99A 2UZYB 4L3GD 1PEVA 4ZOYA 3V5WB 2Z2OA 2H14A 3IJCA 3BG0A 2HYEA 2XL3A 3IKOA 4PNKB 3JZGA 4J0XA 2AH0A 3W15A 2I0SA 3CFVA 2P9LC 4A0AA 4L9OA 3VA6A 1RI6A 4U7AA 4J73A 3N0DA 5HE2B 2IAAA 3OKYB 3PXWD 2HJ4A 4R7AB 3K26A 1TBGA 1SQ9A 3NVNA 3MZLA 4JSPC 3I2NA 3EU7A 3AL8A 4FAND 2P9IC 5IT9g 3SVWD 1U2VC 3I8CA 3F3PA 4O3TB 2AH1A 3EI4A 2EBSA 4LGNA 5CYKA 4GQ1A 4CI1A 2GNQA 5FQDA 4PXWA 3FRXA 4A2LA 4Y5RD 2OVPB 2Q7QA 3SBQA 4IA9A 4QT8A 5H14A 2UZXB 2G9AA 4A08A 4ZOVA 1PI6A 4KFMB 1OMWB 1XIPA 3FGBA 2YBAA 1SHYB 2H6KA 3GREA 4A09B 1N6EA 5EMLB 3JAMg 3RRMC 4XYIA 3SFZA 4L1QD 4I79A 3MZKA 1JOFA 4MK0B 5EMMB 3OW8A 2G99A 1N6FA 3E0CA 2AGXA 4FB1D 2PM7B 3EI3A 4A0BB 4J77A 4BL0A 2HXCA 3PE7A 4H5JA 5GSAA 3OKTA 2XU7A 2GC7A 3UKUC 3V7DB 4J0WA 4E5ZA 2OK4A 3IIWA 4Y7RA 4O1QD 2IWKA 4J78A 1B9XA 2H3XA 4J79A 5EMKB 5HE0B 4H5IA 4BUJC 4D6VA 3EI1A 3I7HA 4ERQA 4CY5A 2BCJB 2H9LA 4CY1A 2BBKH 4QRJA 4A11A 4Z8LA 3I7LA 2I0RA 2H13A 5HE3B 4GQ2P 4J82A 2I0TA 3UKRC 4K3JB 2O9KA 3AH8B 4E54A 2I3SA 5IJ7E 3I7OA 2J57G 2CN3A 5I5JA 3F3FA 3BG1A 3UR4A 4X63B 5I5MA 3MXXA 4GZ8A 3UVMA 4A0AB 4K3ID 2P9SC 2Z2PA 3EWEA 3J80g 4FA1D 5C2VB 3J81g 4ZOZA 4JT6C 2YMUA 4JXMA 3MMYA 2IUQA 3AL9A 5TF2A 3AL8B 4TZ4A 2XL2A 5TEEA 5K1CC 3MKQA 5FKRA 2YB8B 4O45A 3SBRA 4CI8A 3SBPA 3EI4B 1YFQA 4CZYA 2CO0C 4X61B 4GMBA 5CYKB 5EMJB 3I7KA 5TEFA 3SCYA 2HKMA 4FA4D 3DXMC 4CI3A 4PBZA 3B7FA 5AFU3 4A7JA 2H9PA 1MDAH 4OWRA 4A2MA 5JWZA 5A2Qg 3SWSD 3JZNA 4A08B 1XKSA 4GM3A 3PSCB 5KDOB 2P9KC 3RFHA 2J56H 3PXSD 4GGCA 4AOWA 5AMSA 5EM2A 4L3HD 2OK6A 4LG9A 2IWFA 3RSEC 3GFCA 4G56B 3EI2A 1PBYB 2IUVA 4ESGA 1VYHC 3AFCA 4JD2C 3I7PA 3BWSA 3PSLA 3EI3B 2B4EA 3NVQA 4U1EI 1S4UX 3IJ1A 3SXTD 1QNIA 5EARA 4CZVA 3UVKA 3VH0A 4PC0A 3RLMD 4N14A 3UVLA 3DSMA 5IC7A 3EMHA 5CXCA 5FA5B 1ERJA 2CE8A 4E5ZB 2PM9A 4IMMA 3EG6A 3C75H 2OVRB 4FWWA 3EI1B 2QXVA 4YVDA 3VGZA 3CFSB 3OL2A 4J87A 4A11B 1K8KC 1NEXB 5CXBA 3RMZD 3ZWLB 5IJ8E 4JSVC 1JJUB 3I7NA 4J81A 4ES0A 3JROA 2AGLA 3DM0A 3OKWA 3ULEC 5H17A 4PSXB 1JMZB 2YNNA 4FHLA 4E54B 5B4WA 2H68A 2IURA 4ZN4A 2J55H 2OVQB 2CNXA 1GXRA 1GG2B 1L0QA 5SXMA 1R5MA 2OIZA 2OJYA 3RN0D
chains in the Genus database with same CATH superfamily
2PBIB 3KRWB 4OZUA 5FLXg 3OF7A 3KCIA 1A0RB 4ERZA 1GP2B 3NIDA 4UI9R 4JHPC 3OTTA 3IJ0A 2I3TA 3IUNA 1XHMA 4CY2A 2QC5A 2H9MA 4JSXC 2H6NA 5HYNB 4J84A 3MUOA 3SLED 3EQ8A 4DNVA 4FA9D 3O4JA 1VE7A 3NVXA 4CC9A 2AGZA 4CY3A 4D0KA 4EWRA 4JT5C 3SJLD 5GXHA 2HKRA 1NR0A 3OKYA 1H2WA 2MTAH 2YNPA 3IIYA 3PXTD 2VDRA 2AQ5A 3JB9L 2VDOA 4NSXA 2GC4A 3SMRA 3L4MD 4J8BA 1JMXB 4GGAA 5K19A 2TRCB 1B9YA 2QZPA 4AMYA 4HDJA 2B5NA 2CN2A 3SN6B 1PGUA 4AEZA 3C5MA 2VDLA 5TDHB 5THAA 3JZHA 3F3GA 3UVNA 4O3UB 4BCCA 1L5GA 4QL1A 3HFQA 4FAVD 5HE1B 5GMKn 3V9FA 3L4OD 3DXKC 4ERYA 1UOQA 4LG8A 4J8GA 2P9UC 4DNUA 4BH6A 5GXIA 3CIKB 2Z2NA 5FKSA 5EM2B 1JV2A 5AJAA 5FFGA 3JRPA 2PM6B 5FXYA 4FA5D 3P4FA 2XYIA 1MG3A 1K32A 2CO0A 3IUJA 3PVUB 3EI2B 5FKTA 4QQEA 5IGQA 3K27A 4WK0A 4L1MA 2HESX 3ZDXA 1OLZA 2HJBA 4X60B 2XDWA 3MKSB 1H2XA 3ODTA 2YNOA 3C9CA 4GM9A 4BCDA 5M5TA 5M5SA 3RN1D 3A0FA 4A09A 5H1MA 2IUPA 3U4YA 3PVWB 4ZOXA 4J86A 4GQBB 3SHFA 2WQ8A 3K72A 4GGDA 2B5MA 5I5IA 2B5LA 5CXCB 5HQGA 1C9LA 1SQJA 3ORVD 2PM9B 4WK2A 2H6QA 3KRXB 1GOTB 4MMZA 2AGYA 4A0BA 4CI2A 4X3EA 3DWLC 3I89A 2H47A 5FKQA 3ZDZA 1U4CA 3OL2B 4XEIC 2H9NA 4PBYA 4CZXA 3UVOA 2P9PC 3ZDYA 1P22A 5CXBB 3RFGA 5C92A 5EAMA 1Q47A 5C2WB 4PSWB 4GM8A 3JPXA 3ZE1A 3I8EA 4XYHA 2CE9A 5IGOA 3IURA 2VDKA 1N6DA 2P9NC 5C9ZB 1TYQC 5EAPA 1FWXA 2AGWA 4IRZA 4O9DA 3N0EA 4JSNC 2W18A 3FM0A 1UOPA 5EALA 1MG2A 3C99A 1TYEA 2UZYB 4L3GD 1PEVA 4ZOYA 4D9SA 3V5WB 2XE4A 4NC4A 2Z2OA 5HDBA 4AX4A 2H14A 3IJCA 3BG0A 2HYEA 2XL3A 3IKOA 2HU7A 4PNKB 3GD1I 3JZGA 2AH0A 2EIBA 4J0XA 3W15A 2I0SA 3CFVA 2P9LC 4A0AA 4L9OA 4UM8A 3VA6A 1RI6A 4U7AA 4J73A 3N0DA 5HE2B 2IAAA 2EIEA 3OKYB 3PXWD 2HJ4A 4R7AB 5M5UA 3K26A 1TBGA 2VC2A 2VDMA 1SQ9A 3NVNA 3MZLA 4JSPC 3I2NA 4UM9A 3EU7A 1A12A 3IVMA 4JHNA 3AL8A 4FAND 2P9IC 5IT9g 3SVWD 1U2VC 3GC3B 3I8CA 3F3PA 4QAMA 1VZ3A 4O2WA 4O3TB 2AH1A 1GOGA 1JTDB 3EI4A 4DNWA 5E6RA 1O6FA 2EBSA 4LGNA 3O4HA 5CYKA 4GQ1A 4CI1A 1K3IA 4MMYA 2GNQA 2QR5A 5FQDA 3V4PA 4PXWA 3FRXA 4A2LA 1I2MB 4Y5RD 2OVPB 2Q7QA 3SBQA 3ZE2A 4IA9A 4QT8A 5H14A 2UZXB 3VI4A 2G9AA 4A08A 4ZOVA 1PI6A 4KFMB 1E5TA 1OMWB 1XIPA 3NIGA 3FGBA 2YBAA 1SHYB 2H6KA 3GREA 4A09B 1N6EA 5EMLB 1GOHA 5C86A 3JAMg 3RRMC 4XYIA 3SFZA 2VZ1A 4I79A 4L1QD 3MZKA 1JOFA 4MK0B 1M1XA 4G1EA 5EMMB 3T3MA 3OW8A 3IJEA 2G99A 2JKXA 3K6SA 1N6FA 3E0CA 4Z7NA 2AGXA 4FB1D 2PM7B 3EI3A 1UTCA 3QI0A 4A0BB 4J77A 1T2XA 4BL0A 2HXCA 3PE7A 3EQ9A 4H5JA 5GSAA 1GOFA 1YR2A 3OKTA 2XU7A 1E8NA 2GC7A 3UKUC 3V7DB 4J0WA 4E5ZA 2OK4A 3IIWA 3V4VA 4AN0A 4Y7RA 4O1QD 2IWKA 4WK4A 4J78A 1B9XA 2H3XA 4J79A 5EMKB 5HE0B 4H5IA 4BUJC 4D6VA 3EI1A 4BP9A 3I7HA 4AMZA 3T3PA 4ERQA 3NIFA 4CY5A 2BCJB 2H9LA 4CY1A 2BBKH 4QRJA 4A11A 4Z8LA 3I7LA 2I0RA 2H13A 5HE3B 4GQ2P 4NBMA 3FCUA 4J82A 2I0TA 3UKRC 4K3JB 2O9KA 3AH8B 3MUNA 4E54A 1H2ZA 2I3SA 5IJ7E 3I7OA 2J57G 2CN3A 5I5JA 3F3FA 3BG1A 3UR4A 4X63B 5I5MA 5M5VA 3MXXA 4GZ8A 3UVMA 4A0AB 4K3ID 2P9SC 2Z2PA 3EWEA 3J80g 3O4IA 4FA1D 5C2VB 1E8MA 3IUQA 3DDUA 3VI3A 3J81g 4ZOZA 4JT6C 1U8CA 2YMUA 4JXMA 3MMYA 2IUQA 3AL9A 5TF2A 3AL8B 4TZ4A 2XL2A 5TEEA 3FCSA 5K1CC 3QHYB 3MKQA 5FKRA 2YB8B 4O45A 3SBRA 4Z7QA 4CI8A 2EIDA 3SBPA 3EI4B 1YFQA 4CZYA 2CO0C 1O6GA 4X61B 4GMBA 5CYKB 5EMJB 3I7KA 5TEFA 3SCYA 4RE5A 2HKMA 4FA4D 3DXMC 4CI3A 4PBZA 4NENA 5M5RA 3B7FA 1QFSA 2EICA 2VZ3A 2H9PA 2HU5A 1MDAH 3IULA 4NAAA 4OWRA 4A7JA 5AFU3 4A2MA 5JWZA 5A2Qg 3SWSD 1QFMA 3JZNA 4A08B 1XKSA 4GM3A 3PSCB 5KDOB 2P9KC 3RFHA 4RE6A 2J56H 2VDPA 4G1MA 3MVDK 2BKLA 3PXSD 4GGCA 4AOWA 5AMSA 5EM2A 4L3HD 2OK6A 2XZGA 4LG9A 2IWFA 3RSEC 3GFCA 4G56B 5E6SA 3EI2A 1BPOA 1PBYB 1VE6A 2IUVA 4ESGA 1VYHC 3AFCA 4JD2C 3I7PA 3BWSA 3PSLA 3EI3B 5M61A 2B4EA 3NVQA 4U1EI 1S4UX 4G55A 4AN1A 3IJ1A 3ZE0A 3SXTD 3K71A 1QNIA 5EARA 4CZVA 3UVKA 4Z7OA 3VH0A 4BP8A 4PC0A 3IUMA 3RLMD 4N14A 1C9IA 3O4GA 3UVLA 3DSMA 5IC7A 2VDNA 3EMHA 5CXCA 5FA5B 1ERJA 2CE8A 4E5ZB 2PM9A 4IMMA 5FFOA 1VZ2A 3EG6A 3C75H 2OVRB 4FWWA 3EI1B 2QXVA 4WJKA 2HU8A 4YVDA 3VGZA 3CFSB 3OL2A 4J87A 4A11B 1K8KC 1NEXB 5CXBA 3RMZD 3ZWLB 3EQ7A 5IJ8E 4JSVC 1JJUB 3I7NA 4J81A 4MMXA 3JROA 2AGLA 4ES0A 3DM0A 3OKWA 3ULEC 5H17A 4PSXB 5E6UA 1JMZB 4BCBA 2YNNA 2VDQA 4FHLA 4E54B 5B4WA 2H68A 2IURA 4ZN4A 2J55H 2OVQB 2CNXA 1GXRA 1GG2B 1L0QA 5SXMA 1R5MA 2OIZA 1UOOA 4O02A 2OJYA 1H2YA 3RN0D
chains in the Genus database with same CATH topology
2PBIB 3KRWB 4OZUA 5FLXg 1A0RB 4ERZA 1GP2B 4UI9R 3OTTA 3IJ0A 2I3TA 1XHMA 4CY2A 2QC5A 2H9MA 4JSXC 2H6NA 5HYNB 4J84A 3SLED 4FA9D 3NVXA 4CY3A 4CC9A 2AGZA 4D0KA 4EWRA 4JT5C 3SJLD 5GXHA 2HKRA 1NR0A 3OKYA 2MTAH 2YNPA 3IIYA 3PXTD 3JB9L 2AQ5A 4NSXA 2GC4A 3SMRA 3L4MD 4J8BA 1JMXB 4GGAA 5K19A 2TRCB 1B9YA 4HDJA 2B5NA 2CN2A 3SN6B 1PGUA 4AEZA 3C5MA 5TDHB 5THAA 3JZHA 3F3GA 3UVNA 4O3UB 4QL1A 3HFQA 4FAVD 5HE1B 5GMKn 3V9FA 3L4OD 3DXKC 4ERYA 4LG8A 4J8GA 2P9UC 4BH6A 5GXIA 3CIKB 2Z2NA 5FKSA 5EM2B 5AJAA 3JRPA 2PM6B 5FXYA 4FA5D 3P4FA 2XYIA 1MG3A 1K32A 2CO0A 3PVUB 3EI2B 5FKTA 4QQEA 5IGQA 3K27A 2HESX 1OLZA 2HJBA 4X60B 3MKSB 3ODTA 2YNOA 3C9CA 4GM9A 3RN1D 3A0FA 4A09A 5H1MA 2IUPA 3U4YA 3PVWB 4ZOXA 4J86A 4GQBB 3SHFA 4GGDA 2B5MA 5I5IA 2B5LA 5CXCB 5HQGA 1SQJA 3ORVD 2PM9B 2H6QA 3KRXB 1GOTB 2AGYA 4A0BA 4CI2A 4X3EA 3DWLC 3I89A 2H47A 5FKQA 1U4CA 3OL2B 4XEIC 2H9NA 4PBYA 4CZXA 3UVOA 2P9PC 1P22A 5CXBB 3RFGA 5EAMA 1Q47A 5C2WB 4PSWB 4GM8A 3JPXA 3I8EA 4XYHA 2CE9A 5IGOA 1N6DA 2P9NC 5C9ZB 1TYQC 5EAPA 1FWXA 2AGWA 4O9DA 3N0EA 4JSNC 2W18A 3FM0A 5EALA 1MG2A 3C99A 2UZYB 4L3GD 1PEVA 4ZOYA 3V5WB 2Z2OA 2H14A 3IJCA 3BG0A 2HYEA 2XL3A 3IKOA 4PNKB 3JZGA 4J0XA 2AH0A 3W15A 2I0SA 3CFVA 2P9LC 4A0AA 4L9OA 3VA6A 1RI6A 4U7AA 4J73A 3N0DA 5HE2B 2IAAA 3OKYB 3PXWD 2HJ4A 4R7AB 3K26A 1TBGA 1SQ9A 3NVNA 3MZLA 4JSPC 3I2NA 3EU7A 3AL8A 4FAND 2P9IC 5IT9g 3SVWD 1U2VC 3I8CA 3F3PA 4O3TB 2AH1A 3EI4A 2EBSA 4LGNA 5CYKA 4GQ1A 4CI1A 2GNQA 5FQDA 4PXWA 3FRXA 4A2LA 4Y5RD 2OVPB 2Q7QA 3SBQA 4IA9A 4QT8A 5H14A 2UZXB 2G9AA 4A08A 4ZOVA 1PI6A 4KFMB 1OMWB 1XIPA 3FGBA 2YBAA 1SHYB 2H6KA 3GREA 4A09B 1N6EA 5EMLB 3JAMg 3RRMC 4XYIA 3SFZA 4L1QD 4I79A 3MZKA 1JOFA 4MK0B 5EMMB 3OW8A 2G99A 1N6FA 3E0CA 2AGXA 4FB1D 2PM7B 3EI3A 4A0BB 4J77A 4BL0A 2HXCA 3PE7A 4H5JA 5GSAA 3OKTA 2XU7A 2GC7A 3UKUC 3V7DB 4J0WA 4E5ZA 2OK4A 3IIWA 4Y7RA 4O1QD 2IWKA 4J78A 1B9XA 2H3XA 4J79A 5EMKB 5HE0B 4H5IA 4BUJC 4D6VA 3EI1A 3I7HA 4ERQA 4CY5A 2BCJB 2H9LA 4CY1A 2BBKH 4QRJA 4A11A 4Z8LA 3I7LA 2I0RA 2H13A 5HE3B 4GQ2P 4J82A 2I0TA 3UKRC 4K3JB 2O9KA 3AH8B 4E54A 2I3SA 5IJ7E 3I7OA 2J57G 2CN3A 5I5JA 3F3FA 3BG1A 3UR4A 4X63B 5I5MA 3MXXA 4GZ8A 3UVMA 4A0AB 4K3ID 2P9SC 2Z2PA 3EWEA 3J80g 4FA1D 5C2VB 3J81g 4ZOZA 4JT6C 2YMUA 4JXMA 3MMYA 2IUQA 3AL9A 5TF2A 3AL8B 4TZ4A 2XL2A 5TEEA 5K1CC 3MKQA 5FKRA 2YB8B 4O45A 3SBRA 4CI8A 3SBPA 3EI4B 1YFQA 4CZYA 2CO0C 4X61B 4GMBA 5CYKB 5EMJB 3I7KA 5TEFA 3SCYA 2HKMA 4FA4D 3DXMC 4CI3A 4PBZA 3B7FA 5AFU3 4A7JA 2H9PA 1MDAH 4OWRA 4A2MA 5JWZA 5A2Qg 3SWSD 3JZNA 4A08B 1XKSA 4GM3A 3PSCB 5KDOB 2P9KC 3RFHA 2J56H 3PXSD 4GGCA 4AOWA 5AMSA 5EM2A 4L3HD 2OK6A 4LG9A 2IWFA 3RSEC 3GFCA 4G56B 3EI2A 1PBYB 2IUVA 4ESGA 1VYHC 3AFCA 4JD2C 3I7PA 3BWSA 3PSLA 3EI3B 2B4EA 3NVQA 4U1EI 1S4UX 3IJ1A 3SXTD 1QNIA 5EARA 4CZVA 3UVKA 3VH0A 4PC0A 3RLMD 4N14A 3UVLA 3DSMA 5IC7A 3EMHA 5CXCA 5FA5B 1ERJA 2CE8A 4E5ZB 2PM9A 4IMMA 3EG6A 3C75H 2OVRB 4FWWA 3EI1B 2QXVA 4YVDA 3VGZA 3CFSB 3OL2A 4J87A 4A11B 1K8KC 1NEXB 5CXBA 3RMZD 3ZWLB 5IJ8E 4JSVC 1JJUB 3I7NA 4J81A 4ES0A 3JROA 2AGLA 3DM0A 3OKWA 3ULEC 5H17A 4PSXB 1JMZB 2YNNA 4FHLA 4E54B 5B4WA 2H68A 2IURA 4ZN4A 2J55H 2OVQB 2CNXA 1GXRA 1GG2B 1L0QA 5SXMA 1R5MA 2OIZA 2OJYA 3RN0D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PBI B;  3KRW B;  4OZU A;  5FLX g;  1A0R B;  4ERZ A;  1GP2 B;  4UI9 R;  3OTT A;  3IJ0 A;  2I3T A;  1XHM A;  4CY2 A;  2QC5 A;  2H9M A;  4JSX C;  2H6N A;  5HYN B;  4J84 A;  3SLE D;  4FA9 D;  3NVX A;  4CY3 A;  4CC9 A;  2AGZ A;  4D0K A;  4EWR A;  4JT5 C;  3SJL D;  5GXH A;  2HKR A;  1NR0 A;  3OKY A;  2MTA H;  2YNP A;  3IIY A;  3PXT D;  3JB9 L;  2AQ5 A;  4NSX A;  2GC4 A;  3SMR A;  3L4M D;  4J8B A;  1JMX B;  4GGA A;  5K19 A;  2TRC B;  1B9Y A;  4HDJ A;  2B5N A;  2CN2 A;  3SN6 B;  1PGU A;  4AEZ A;  3C5M A;  5TDH B;  5THA A;  3JZH A;  3F3G A;  3UVN A;  4O3U B;  4QL1 A;  3HFQ A;  4FAV D;  5HE1 B;  5GMK n;  3V9F A;  3L4O D;  3DXK C;  4ERY A;  4LG8 A;  4J8G A;  2P9U C;  4BH6 A;  5GXI A;  3CIK B;  2Z2N A;  5FKS A;  5EM2 B;  5AJA A;  3JRP A;  2PM6 B;  5FXY A;  4FA5 D;  3P4F A;  2XYI A;  1MG3 A;  1K32 A;  2CO0 A;  3PVU B;  3EI2 B;  5FKT A;  4QQE A;  5IGQ A;  3K27 A;  2HES X;  1OLZ A;  2HJB A;  4X60 B;  3MKS B;  3ODT A;  2YNO A;  3C9C A;  4GM9 A;  3RN1 D;  3A0F A;  4A09 A;  5H1M A;  2IUP A;  3U4Y A;  3PVW B;  4ZOX A;  4J86 A;  4GQB B;  3SHF A;  4GGD A;  2B5M A;  5I5I A;  2B5L A;  5CXC B;  5HQG A;  1SQJ A;  3ORV D;  2PM9 B;  2H6Q A;  3KRX B;  1GOT B;  2AGY A;  4A0B A;  4CI2 A;  4X3E A;  3DWL C;  3I89 A;  2H47 A;  5FKQ A;  1U4C A;  3OL2 B;  4XEI C;  2H9N A;  4PBY A;  4CZX A;  3UVO A;  2P9P C;  1P22 A;  5CXB B;  3RFG A;  5EAM A;  1Q47 A;  5C2W B;  4PSW B;  4GM8 A;  3JPX A;  3I8E A;  4XYH A;  2CE9 A;  5IGO A;  1N6D A;  2P9N C;  5C9Z B;  1TYQ C;  5EAP A;  1FWX A;  2AGW A;  4O9D A;  3N0E A;  4JSN C;  2W18 A;  3FM0 A;  5EAL A;  1MG2 A;  3C99 A;  2UZY B;  4L3G D;  1PEV A;  4ZOY A;  3V5W B;  2Z2O A;  2H14 A;  3IJC A;  3BG0 A;  2HYE A;  2XL3 A;  3IKO A;  4PNK B;  3JZG A;  4J0X A;  2AH0 A;  3W15 A;  2I0S A;  3CFV A;  2P9L C;  4A0A A;  4L9O A;  3VA6 A;  1RI6 A;  4U7A A;  4J73 A;  3N0D A;  5HE2 B;  2IAA A;  3OKY B;  3PXW D;  2HJ4 A;  4R7A B;  3K26 A;  1TBG A;  1SQ9 A;  3NVN A;  3MZL A;  4JSP C;  3I2N A;  3EU7 A;  3AL8 A;  4FAN D;  2P9I C;  5IT9 g;  3SVW D;  1U2V C;  3I8C A;  3F3P A;  4O3T B;  2AH1 A;  3EI4 A;  2EBS A;  4LGN A;  5CYK A;  4GQ1 A;  4CI1 A;  2GNQ A;  5FQD A;  4PXW A;  3FRX A;  4A2L A;  4Y5R D;  2OVP B;  2Q7Q A;  3SBQ A;  4IA9 A;  4QT8 A;  5H14 A;  2UZX B;  2G9A A;  4A08 A;  4ZOV A;  1PI6 A;  4KFM B;  1OMW B;  1XIP A;  3FGB A;  2YBA A;  1SHY B;  2H6K A;  3GRE A;  4A09 B;  1N6E A;  5EML B;  3JAM g;  3RRM C;  4XYI A;  3SFZ A;  4L1Q D;  4I79 A;  3MZK A;  1JOF A;  4MK0 B;  5EMM B;  3OW8 A;  2G99 A;  1N6F A;  3E0C A;  2AGX A;  4FB1 D;  2PM7 B;  3EI3 A;  4A0B B;  4J77 A;  4BL0 A;  2HXC A;  3PE7 A;  4H5J A;  5GSA A;  3OKT A;  2XU7 A;  2GC7 A;  3UKU C;  3V7D B;  4J0W A;  4E5Z A;  2OK4 A;  3IIW A;  4Y7R A;  4O1Q D;  2IWK A;  4J78 A;  1B9X A;  2H3X A;  4J79 A;  5EMK B;  5HE0 B;  4H5I A;  4BUJ C;  4D6V A;  3EI1 A;  3I7H A;  4ERQ A;  4CY5 A;  2BCJ B;  2H9L A;  4CY1 A;  2BBK H;  4QRJ A;  4A11 A;  4Z8L A;  3I7L A;  2I0R A;  2H13 A;  5HE3 B;  4GQ2 P;  4J82 A;  2I0T A;  3UKR C;  4K3J B;  2O9K A;  3AH8 B;  4E54 A;  2I3S A;  5IJ7 E;  3I7O A;  2J57 G;  2CN3 A;  5I5J A;  3F3F A;  3BG1 A;  3UR4 A;  4X63 B;  5I5M A;  3MXX A;  4GZ8 A;  3UVM A;  4A0A B;  4K3I D;  2P9S C;  2Z2P A;  3EWE A;  3J80 g;  4FA1 D;  5C2V B;  3J81 g;  4ZOZ A;  4JT6 C;  2YMU A;  4JXM A;  3MMY A;  2IUQ A;  3AL9 A;  5TF2 A;  3AL8 B;  4TZ4 A;  2XL2 A;  5TEE A;  5K1C C;  3MKQ A;  5FKR A;  2YB8 B;  4O45 A;  3SBR A;  4CI8 A;  3SBP A;  3EI4 B;  1YFQ A;  4CZY A;  2CO0 C;  4X61 B;  4GMB A;  5CYK B;  5EMJ B;  3I7K A;  5TEF A;  3SCY A;  2HKM A;  4FA4 D;  3DXM C;  4CI3 A;  4PBZ A;  3B7F A;  5AFU 3;  4A7J A;  2H9P A;  1MDA H;  4OWR A;  4A2M A;  5JWZ A;  5A2Q g;  3SWS D;  3JZN A;  4A08 B;  1XKS A;  4GM3 A;  3PSC B;  5KDO B;  2P9K C;  3RFH A;  2J56 H;  3PXS D;  4GGC A;  4AOW A;  5AMS A;  5EM2 A;  4L3H D;  2OK6 A;  4LG9 A;  2IWF A;  3RSE C;  3GFC A;  4G56 B;  3EI2 A;  1PBY B;  2IUV A;  4ESG A;  1VYH C;  3AFC A;  4JD2 C;  3I7P A;  3BWS A;  3PSL A;  3EI3 B;  2B4E A;  3NVQ A;  4U1E I;  1S4U X;  3IJ1 A;  3SXT D;  1QNI A;  5EAR A;  4CZV A;  3UVK A;  3VH0 A;  4PC0 A;  3RLM D;  4N14 A;  3UVL A;  3DSM A;  5IC7 A;  3EMH A;  5CXC A;  5FA5 B;  1ERJ A;  2CE8 A;  4E5Z B;  2PM9 A;  4IMM A;  3EG6 A;  3C75 H;  2OVR B;  4FWW A;  3EI1 B;  2QXV A;  4YVD A;  3VGZ A;  3CFS B;  3OL2 A;  4J87 A;  4A11 B;  1K8K C;  1NEX B;  5CXB A;  3RMZ D;  3ZWL B;  5IJ8 E;  4JSV C;  1JJU B;  3I7N A;  4J81 A;  4ES0 A;  3JRO A;  2AGL A;  3DM0 A;  3OKW A;  3ULE C;  5H17 A;  4PSX B;  1JMZ B;  2YNN A;  4FHL A;  4E54 B;  5B4W A;  2H68 A;  2IUR A;  4ZN4 A;  2J55 H;  2OVQ B;  2CNX A;  1GXR A;  1GG2 B;  1L0Q A;  5SXM A;  1R5M A;  2OIZ A;  2OJY A;  3RN0 D; 
#chains in the Genus database with same CATH topology
 2PBI B;  3KRW B;  4OZU A;  5FLX g;  3OF7 A;  3KCI A;  1A0R B;  4ERZ A;  1GP2 B;  3NID A;  4UI9 R;  4JHP C;  3OTT A;  3IJ0 A;  2I3T A;  3IUN A;  1XHM A;  4CY2 A;  2QC5 A;  2H9M A;  4JSX C;  2H6N A;  5HYN B;  4J84 A;  3MUO A;  3SLE D;  3EQ8 A;  4DNV A;  4FA9 D;  3O4J A;  1VE7 A;  3NVX A;  4CC9 A;  2AGZ A;  4CY3 A;  4D0K A;  4EWR A;  4JT5 C;  3SJL D;  5GXH A;  2HKR A;  1NR0 A;  3OKY A;  1H2W A;  2MTA H;  2YNP A;  3IIY A;  3PXT D;  2VDR A;  2AQ5 A;  3JB9 L;  2VDO A;  4NSX A;  2GC4 A;  3SMR A;  3L4M D;  4J8B A;  1JMX B;  4GGA A;  5K19 A;  2TRC B;  1B9Y A;  2QZP A;  4AMY A;  4HDJ A;  2B5N A;  2CN2 A;  3SN6 B;  1PGU A;  4AEZ A;  3C5M A;  2VDL A;  5TDH B;  5THA A;  3JZH A;  3F3G A;  3UVN A;  4O3U B;  4BCC A;  1L5G A;  4QL1 A;  3HFQ A;  4FAV D;  5HE1 B;  5GMK n;  3V9F A;  3L4O D;  3DXK C;  4ERY A;  1UOQ A;  4LG8 A;  4J8G A;  2P9U C;  4DNU A;  4BH6 A;  5GXI A;  3CIK B;  2Z2N A;  5FKS A;  5EM2 B;  1JV2 A;  5AJA A;  5FFG A;  3JRP A;  2PM6 B;  5FXY A;  4FA5 D;  3P4F A;  2XYI A;  1MG3 A;  1K32 A;  2CO0 A;  3IUJ A;  3PVU B;  3EI2 B;  5FKT A;  4QQE A;  5IGQ A;  3K27 A;  4WK0 A;  4L1M A;  2HES X;  3ZDX A;  1OLZ A;  2HJB A;  4X60 B;  2XDW A;  3MKS B;  1H2X A;  3ODT A;  2YNO A;  3C9C A;  4GM9 A;  4BCD A;  5M5T A;  5M5S A;  3RN1 D;  3A0F A;  4A09 A;  5H1M A;  2IUP A;  3U4Y A;  3PVW B;  4ZOX A;  4J86 A;  4GQB B;  3SHF A;  2WQ8 A;  3K72 A;  4GGD A;  2B5M A;  5I5I A;  2B5L A;  5CXC B;  5HQG A;  1C9L A;  1SQJ A;  3ORV D;  2PM9 B;  4WK2 A;  2H6Q A;  3KRX B;  1GOT B;  4MMZ A;  2AGY A;  4A0B A;  4CI2 A;  4X3E A;  3DWL C;  3I89 A;  2H47 A;  5FKQ A;  3ZDZ A;  1U4C A;  3OL2 B;  4XEI C;  2H9N A;  4PBY A;  4CZX A;  3UVO A;  2P9P C;  3ZDY A;  1P22 A;  5CXB B;  3RFG A;  5C92 A;  5EAM A;  1Q47 A;  5C2W B;  4PSW B;  4GM8 A;  3JPX A;  3ZE1 A;  3I8E A;  4XYH A;  2CE9 A;  5IGO A;  3IUR A;  2VDK A;  1N6D A;  2P9N C;  5C9Z B;  1TYQ C;  5EAP A;  1FWX A;  2AGW A;  4IRZ A;  4O9D A;  3N0E A;  4JSN C;  2W18 A;  3FM0 A;  1UOP A;  5EAL A;  1MG2 A;  3C99 A;  1TYE A;  2UZY B;  4L3G D;  1PEV A;  4ZOY A;  4D9S A;  3V5W B;  2XE4 A;  4NC4 A;  2Z2O A;  5HDB A;  4AX4 A;  2H14 A;  3IJC A;  3BG0 A;  2HYE A;  2XL3 A;  3IKO A;  2HU7 A;  4PNK B;  3GD1 I;  3JZG A;  2AH0 A;  2EIB A;  4J0X A;  3W15 A;  2I0S A;  3CFV A;  2P9L C;  4A0A A;  4L9O A;  4UM8 A;  3VA6 A;  1RI6 A;  4U7A A;  4J73 A;  3N0D A;  5HE2 B;  2IAA A;  2EIE A;  3OKY B;  3PXW D;  2HJ4 A;  4R7A B;  5M5U A;  3K26 A;  1TBG A;  2VC2 A;  2VDM A;  1SQ9 A;  3NVN A;  3MZL A;  4JSP C;  3I2N A;  4UM9 A;  3EU7 A;  1A12 A;  3IVM A;  4JHN A;  3AL8 A;  4FAN D;  2P9I C;  5IT9 g;  3SVW D;  1U2V C;  3GC3 B;  3I8C A;  3F3P A;  4QAM A;  1VZ3 A;  4O2W A;  4O3T B;  2AH1 A;  1GOG A;  1JTD B;  3EI4 A;  4DNW A;  5E6R A;  1O6F A;  2EBS A;  4LGN A;  3O4H A;  5CYK A;  4GQ1 A;  4CI1 A;  1K3I A;  4MMY A;  2GNQ A;  2QR5 A;  5FQD A;  3V4P A;  4PXW A;  3FRX A;  4A2L A;  1I2M B;  4Y5R D;  2OVP B;  2Q7Q A;  3SBQ A;  3ZE2 A;  4IA9 A;  4QT8 A;  5H14 A;  2UZX B;  3VI4 A;  2G9A A;  4A08 A;  4ZOV A;  1PI6 A;  4KFM B;  1E5T A;  1OMW B;  1XIP A;  3NIG A;  3FGB A;  2YBA A;  1SHY B;  2H6K A;  3GRE A;  4A09 B;  1N6E A;  5EML B;  1GOH A;  5C86 A;  3JAM g;  3RRM C;  4XYI A;  3SFZ A;  2VZ1 A;  4I79 A;  4L1Q D;  3MZK A;  1JOF A;  4MK0 B;  1M1X A;  4G1E A;  5EMM B;  3T3M A;  3OW8 A;  3IJE A;  2G99 A;  2JKX A;  3K6S A;  1N6F A;  3E0C A;  4Z7N A;  2AGX A;  4FB1 D;  2PM7 B;  3EI3 A;  1UTC A;  3QI0 A;  4A0B B;  4J77 A;  1T2X A;  4BL0 A;  2HXC A;  3PE7 A;  3EQ9 A;  4H5J A;  5GSA A;  1GOF A;  1YR2 A;  3OKT A;  2XU7 A;  1E8N A;  2GC7 A;  3UKU C;  3V7D B;  4J0W A;  4E5Z A;  2OK4 A;  3IIW A;  3V4V A;  4AN0 A;  4Y7R A;  4O1Q D;  2IWK A;  4WK4 A;  4J78 A;  1B9X A;  2H3X A;  4J79 A;  5EMK B;  5HE0 B;  4H5I A;  4BUJ C;  4D6V A;  3EI1 A;  4BP9 A;  3I7H A;  4AMZ A;  3T3P A;  4ERQ A;  3NIF A;  4CY5 A;  2BCJ B;  2H9L A;  4CY1 A;  2BBK H;  4QRJ A;  4A11 A;  4Z8L A;  3I7L A;  2I0R A;  2H13 A;  5HE3 B;  4GQ2 P;  4NBM A;  3FCU A;  4J82 A;  2I0T A;  3UKR C;  4K3J B;  2O9K A;  3AH8 B;  3MUN A;  4E54 A;  1H2Z A;  2I3S A;  5IJ7 E;  3I7O A;  2J57 G;  2CN3 A;  5I5J A;  3F3F A;  3BG1 A;  3UR4 A;  4X63 B;  5I5M A;  5M5V A;  3MXX A;  4GZ8 A;  3UVM A;  4A0A B;  4K3I D;  2P9S C;  2Z2P A;  3EWE A;  3J80 g;  3O4I A;  4FA1 D;  5C2V B;  1E8M A;  3IUQ A;  3DDU A;  3VI3 A;  3J81 g;  4ZOZ A;  4JT6 C;  1U8C A;  2YMU A;  4JXM A;  3MMY A;  2IUQ A;  3AL9 A;  5TF2 A;  3AL8 B;  4TZ4 A;  2XL2 A;  5TEE A;  3FCS A;  5K1C C;  3QHY B;  3MKQ A;  5FKR A;  2YB8 B;  4O45 A;  3SBR A;  4Z7Q A;  4CI8 A;  2EID A;  3SBP A;  3EI4 B;  1YFQ A;  4CZY A;  2CO0 C;  1O6G A;  4X61 B;  4GMB A;  5CYK B;  5EMJ B;  3I7K A;  5TEF A;  3SCY A;  4RE5 A;  2HKM A;  4FA4 D;  3DXM C;  4CI3 A;  4PBZ A;  4NEN A;  5M5R A;  3B7F A;  1QFS A;  2EIC A;  2VZ3 A;  2H9P A;  2HU5 A;  1MDA H;  3IUL A;  4NAA A;  4OWR A;  4A7J A;  5AFU 3;  4A2M A;  5JWZ A;  5A2Q g;  3SWS D;  1QFM A;  3JZN A;  4A08 B;  1XKS A;  4GM3 A;  3PSC B;  5KDO B;  2P9K C;  3RFH A;  4RE6 A;  2J56 H;  2VDP A;  4G1M A;  3MVD K;  2BKL A;  3PXS D;  4GGC A;  4AOW A;  5AMS A;  5EM2 A;  4L3H D;  2OK6 A;  2XZG A;  4LG9 A;  2IWF A;  3RSE C;  3GFC A;  4G56 B;  5E6S A;  3EI2 A;  1BPO A;  1PBY B;  1VE6 A;  2IUV A;  4ESG A;  1VYH C;  3AFC A;  4JD2 C;  3I7P A;  3BWS A;  3PSL A;  3EI3 B;  5M61 A;  2B4E A;  3NVQ A;  4U1E I;  1S4U X;  4G55 A;  4AN1 A;  3IJ1 A;  3ZE0 A;  3SXT D;  3K71 A;  1QNI A;  5EAR A;  4CZV A;  3UVK A;  4Z7O A;  3VH0 A;  4BP8 A;  4PC0 A;  3IUM A;  3RLM D;  4N14 A;  1C9I A;  3O4G A;  3UVL A;  3DSM A;  5IC7 A;  2VDN A;  3EMH A;  5CXC A;  5FA5 B;  1ERJ A;  2CE8 A;  4E5Z B;  2PM9 A;  4IMM A;  5FFO A;  1VZ2 A;  3EG6 A;  3C75 H;  2OVR B;  4FWW A;  3EI1 B;  2QXV A;  4WJK A;  2HU8 A;  4YVD A;  3VGZ A;  3CFS B;  3OL2 A;  4J87 A;  4A11 B;  1K8K C;  1NEX B;  5CXB A;  3RMZ D;  3ZWL B;  3EQ7 A;  5IJ8 E;  4JSV C;  1JJU B;  3I7N A;  4J81 A;  4MMX A;  3JRO A;  2AGL A;  4ES0 A;  3DM0 A;  3OKW A;  3ULE C;  5H17 A;  4PSX B;  5E6U A;  1JMZ B;  4BCB A;  2YNN A;  2VDQ A;  4FHL A;  4E54 B;  5B4W A;  2H68 A;  2IUR A;  4ZN4 A;  2J55 H;  2OVQ B;  2CNX A;  1GXR A;  1GG2 B;  1L0Q A;  5SXM A;  1R5M A;  2OIZ A;  1UOO A;  4O02 A;  2OJY A;  1H2Y A;  3RN0 D; 
#chains in the Genus database with same CATH homology
 2PBI B;  3KRW B;  4OZU A;  5FLX g;  1A0R B;  4ERZ A;  1GP2 B;  4UI9 R;  3OTT A;  3IJ0 A;  2I3T A;  1XHM A;  4CY2 A;  2QC5 A;  2H9M A;  4JSX C;  2H6N A;  5HYN B;  4J84 A;  3SLE D;  4FA9 D;  3NVX A;  4CY3 A;  4CC9 A;  2AGZ A;  4D0K A;  4EWR A;  4JT5 C;  3SJL D;  5GXH A;  2HKR A;  1NR0 A;  3OKY A;  2MTA H;  2YNP A;  3IIY A;  3PXT D;  3JB9 L;  2AQ5 A;  4NSX A;  2GC4 A;  3SMR A;  3L4M D;  4J8B A;  1JMX B;  4GGA A;  5K19 A;  2TRC B;  1B9Y A;  4HDJ A;  2B5N A;  2CN2 A;  3SN6 B;  1PGU A;  4AEZ A;  3C5M A;  5TDH B;  5THA A;  3JZH A;  3F3G A;  3UVN A;  4O3U B;  4QL1 A;  3HFQ A;  4FAV D;  5HE1 B;  5GMK n;  3V9F A;  3L4O D;  3DXK C;  4ERY A;  4LG8 A;  4J8G A;  2P9U C;  4BH6 A;  5GXI A;  3CIK B;  2Z2N A;  5FKS A;  5EM2 B;  5AJA A;  3JRP A;  2PM6 B;  5FXY A;  4FA5 D;  3P4F A;  2XYI A;  1MG3 A;  1K32 A;  2CO0 A;  3PVU B;  3EI2 B;  5FKT A;  4QQE A;  5IGQ A;  3K27 A;  2HES X;  1OLZ A;  2HJB A;  4X60 B;  3MKS B;  3ODT A;  2YNO A;  3C9C A;  4GM9 A;  3RN1 D;  3A0F A;  4A09 A;  5H1M A;  2IUP A;  3U4Y A;  3PVW B;  4ZOX A;  4J86 A;  4GQB B;  3SHF A;  4GGD A;  2B5M A;  5I5I A;  2B5L A;  5CXC B;  5HQG A;  1SQJ A;  3ORV D;  2PM9 B;  2H6Q A;  3KRX B;  1GOT B;  2AGY A;  4A0B A;  4CI2 A;  4X3E A;  3DWL C;  3I89 A;  2H47 A;  5FKQ A;  1U4C A;  3OL2 B;  4XEI C;  2H9N A;  4PBY A;  4CZX A;  3UVO A;  2P9P C;  1P22 A;  5CXB B;  3RFG A;  5EAM A;  1Q47 A;  5C2W B;  4PSW B;  4GM8 A;  3JPX A;  3I8E A;  4XYH A;  2CE9 A;  5IGO A;  1N6D A;  2P9N C;  5C9Z B;  1TYQ C;  5EAP A;  1FWX A;  2AGW A;  4O9D A;  3N0E A;  4JSN C;  2W18 A;  3FM0 A;  5EAL A;  1MG2 A;  3C99 A;  2UZY B;  4L3G D;  1PEV A;  4ZOY A;  3V5W B;  2Z2O A;  2H14 A;  3IJC A;  3BG0 A;  2HYE A;  2XL3 A;  3IKO A;  4PNK B;  3JZG A;  4J0X A;  2AH0 A;  3W15 A;  2I0S A;  3CFV A;  2P9L C;  4A0A A;  4L9O A;  3VA6 A;  1RI6 A;  4U7A A;  4J73 A;  3N0D A;  5HE2 B;  2IAA A;  3OKY B;  3PXW D;  2HJ4 A;  4R7A B;  3K26 A;  1TBG A;  1SQ9 A;  3NVN A;  3MZL A;  4JSP C;  3I2N A;  3EU7 A;  3AL8 A;  4FAN D;  2P9I C;  5IT9 g;  3SVW D;  1U2V C;  3I8C A;  3F3P A;  4O3T B;  2AH1 A;  3EI4 A;  2EBS A;  4LGN A;  5CYK A;  4GQ1 A;  4CI1 A;  2GNQ A;  5FQD A;  4PXW A;  3FRX A;  4A2L A;  4Y5R D;  2OVP B;  2Q7Q A;  3SBQ A;  4IA9 A;  4QT8 A;  5H14 A;  2UZX B;  2G9A A;  4A08 A;  4ZOV A;  1PI6 A;  4KFM B;  1OMW B;  1XIP A;  3FGB A;  2YBA A;  1SHY B;  2H6K A;  3GRE A;  4A09 B;  1N6E A;  5EML B;  3JAM g;  3RRM C;  4XYI A;  3SFZ A;  4L1Q D;  4I79 A;  3MZK A;  1JOF A;  4MK0 B;  5EMM B;  3OW8 A;  2G99 A;  1N6F A;  3E0C A;  2AGX A;  4FB1 D;  2PM7 B;  3EI3 A;  4A0B B;  4J77 A;  4BL0 A;  2HXC A;  3PE7 A;  4H5J A;  5GSA A;  3OKT A;  2XU7 A;  2GC7 A;  3UKU C;  3V7D B;  4J0W A;  4E5Z A;  2OK4 A;  3IIW A;  4Y7R A;  4O1Q D;  2IWK A;  4J78 A;  1B9X A;  2H3X A;  4J79 A;  5EMK B;  5HE0 B;  4H5I A;  4BUJ C;  4D6V A;  3EI1 A;  3I7H A;  4ERQ A;  4CY5 A;  2BCJ B;  2H9L A;  4CY1 A;  2BBK H;  4QRJ A;  4A11 A;  4Z8L A;  3I7L A;  2I0R A;  2H13 A;  5HE3 B;  4GQ2 P;  4J82 A;  2I0T A;  3UKR C;  4K3J B;  2O9K A;  3AH8 B;  4E54 A;  2I3S A;  5IJ7 E;  3I7O A;  2J57 G;  2CN3 A;  5I5J A;  3F3F A;  3BG1 A;  3UR4 A;  4X63 B;  5I5M A;  3MXX A;  4GZ8 A;  3UVM A;  4A0A B;  4K3I D;  2P9S C;  2Z2P A;  3EWE A;  3J80 g;  4FA1 D;  5C2V B;  3J81 g;  4ZOZ A;  4JT6 C;  2YMU A;  4JXM A;  3MMY A;  2IUQ A;  3AL9 A;  5TF2 A;  3AL8 B;  4TZ4 A;  2XL2 A;  5TEE A;  5K1C C;  3MKQ A;  5FKR A;  2YB8 B;  4O45 A;  3SBR A;  4CI8 A;  3SBP A;  3EI4 B;  1YFQ A;  4CZY A;  2CO0 C;  4X61 B;  4GMB A;  5CYK B;  5EMJ B;  3I7K A;  5TEF A;  3SCY A;  2HKM A;  4FA4 D;  3DXM C;  4CI3 A;  4PBZ A;  3B7F A;  5AFU 3;  4A7J A;  2H9P A;  1MDA H;  4OWR A;  4A2M A;  5JWZ A;  5A2Q g;  3SWS D;  3JZN A;  4A08 B;  1XKS A;  4GM3 A;  3PSC B;  5KDO B;  2P9K C;  3RFH A;  2J56 H;  3PXS D;  4GGC A;  4AOW A;  5AMS A;  5EM2 A;  4L3H D;  2OK6 A;  4LG9 A;  2IWF A;  3RSE C;  3GFC A;  4G56 B;  3EI2 A;  1PBY B;  2IUV A;  4ESG A;  1VYH C;  3AFC A;  4JD2 C;  3I7P A;  3BWS A;  3PSL A;  3EI3 B;  2B4E A;  3NVQ A;  4U1E I;  1S4U X;  3IJ1 A;  3SXT D;  1QNI A;  5EAR A;  4CZV A;  3UVK A;  3VH0 A;  4PC0 A;  3RLM D;  4N14 A;  3UVL A;  3DSM A;  5IC7 A;  3EMH A;  5CXC A;  5FA5 B;  1ERJ A;  2CE8 A;  4E5Z B;  2PM9 A;  4IMM A;  3EG6 A;  3C75 H;  2OVR B;  4FWW A;  3EI1 B;  2QXV A;  4YVD A;  3VGZ A;  3CFS B;  3OL2 A;  4J87 A;  4A11 B;  1K8K C;  1NEX B;  5CXB A;  3RMZ D;  3ZWL B;  5IJ8 E;  4JSV C;  1JJU B;  3I7N A;  4J81 A;  4ES0 A;  3JRO A;  2AGL A;  3DM0 A;  3OKW A;  3ULE C;  5H17 A;  4PSX B;  1JMZ B;  2YNN A;  4FHL A;  4E54 B;  5B4W A;  2H68 A;  2IUR A;  4ZN4 A;  2J55 H;  2OVQ B;  2CNX A;  1GXR A;  1GG2 B;  1L0Q A;  5SXM A;  1R5M A;  2OIZ A;  2OJY A;  3RN0 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...