5FA5B

Crystal structure of prmt5:mep50 in complex with mta and h4 peptide
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
308
structure length
301
Chain Sequence
PNAPACMERQLEAARYRSDGALLLGASSLSGRCWAGSLWLFKDPCAAPNEGFCSAGVQTEAGVADLTWVGERGILVASDSGAVELWELDENETLIVSKFCKYEHDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQVVLSSYRAHAAQVTCVAASPHKDSVFLSCSEDNRILLWDTRCPKPASQIGGYLPTSLAWHPQQSEVFVFGDENGTVSLVDTKSVLSSAVHSQCVTGLVFSPHSVPFLASLSEDCSLAVLDSSLSELFRSQAHRDFVRDATWSPLNHSLLTTVGWDHQVVHHVVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein arginine N-methyltransferase 5
publication title Disordered methionine metabolism in MTAP/CDKN2A-deleted cancers leads to dependence on PRMT5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/protein binding
total genus 81
structure length 301
sequence length 308
ec nomenclature
pdb deposition date 2015-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5fa5B00
3IKOA 1U4CA 5B4WA 4J87A 1OLZA 4K3JB 5HE0B 1JMXB 3JB9L 3ORVD 5H14A 3PSCB 4O3UB 4J82A 3SMRA 3OL2B 4H5IA 2GC7A 5IJ7E 3E0CA 2XL3A 5K1CC 5GMKn 2Z2PA 1TYQC 4MK0B 4FB1D 2PM6B 2H6NA 4PC0A 5I5IA 2P9IC 5AJAA 3MXXA 2J56H 5EMKB 3AH8B 4CY3A 3FRXA 4J84A 4A09A 3PE7A 4J79A 4CZYA 2IWFA 3B7FA 4GM3A 2P9LC 4U1EI 2UZXB 3ODTA 4L3HD 5SXMA 5EAPA 2AQ5A 1MG2A 4A7JA 4TZ4A 2OK6A 2I3SA 1QNIA 3RFGA 3SHFA 2OIZA 2IUVA 2OJYA 4A0BB 3JZGA 1XKSA 3SBPA 3F3GA 3J81g 2HJBA 4J81A 5CYKB 4J0XA 2UZYB 4ZOXA 3I7KA 4A0AA 4J8GA 1MG3A 2PBIB 3EU7A 3OKTA 4CY1A 4N14A 2P9KC 1R5MA 1GXRA 3K26A 3IJ0A 3SFZA 4J8BA 3UVNA 1L0QA 1GP2B 2P9NC 1SQJA 4BH6A 2Z2OA 3DM0A 2YB8B 3BG1A 4ESGA 3RRMC 3AL8A 3VGZA 3I8EA 5IGOA 4GM8A 4ERZA 2Q7QA 4GGDA 4L3GD 4FA9D 4AEZA 4E5ZB 4D6VA 3J80g 4G56B 4A09B 4ZOVA 1OMWB 3AFCA 2P9SC 3RN0D 3FGBA 1MDAH 3C75H 5CXCB 3PXSD 2H13A 3MZKA 5C2WB 4BUJC 3MMYA 3KRXB 4CZVA 2P9UC 4JSXC 3OW8A 4CI8A 4QQEA 3JPXA 2CN3A 4X60B 5EMMB 4J73A 2CO0C 2HYEA 4PXWA 4L9OA 3RN1D 2W18A 5IT9g 4JT6C 5A2Qg 1B9YA 3PXWD 2I3TA 5FKTA 4J78A 3JZHA 3JRPA 4YVDA 3SLED 3ZWLB 1NEXB 5GXIA 3AL9A 2QC5A 4A0AB 2IUPA 1Q47A 4NSXA 3NVQA 4LG9A 3FM0A 2IURA 4Z8LA 3JAMg 4JSVC 2G9AA 2IAAA 4JD2C 5H1MA 1GG2B 5IC7A 5TEEA 3UVMA 5HE3B 3UVLA 2H6KA 3SBRA 3I7HA 3EI2A 4ERYA 1N6DA 2H6QA 3EI4A 3AL8B 5FKQA 3RFHA 2CN2A 5C2VB 1N6EA 4A2LA 5I5JA 1GOTB 2OVPB 5KDOB 4A08A 2AGWA 2I0SA 3GREA 3N0DA 3DSMA 3ULEC 2IUQA 2XL2A 3IIWA 5EAMA 4J0WA 3VA6A 4PSWB 4QL1A 2AGYA 3K27A 5I5MA 5H17A 3CFVA 4L1QD 3SCYA 3C99A 4QRJA 2HKRA 2PM9A 4CY2A 3SXTD 4GGAA 3V7DB 3I7NA 2B5LA 3SJLD 4GQBB 3JROA 4FWWA 2BCJB 1K8KC 2IWKA 3I7LA 5EMJB 5FQDA 3V9FA 4D0KA 4CI3A 3OL2A 3I2NA 4XEIC 3DXKC 1XHMA 4ZOZA 5HE1B 2HESX 3EI3A 1JJUB 3I8CA 3I89A 1NR0A 1PEVA 1FWXA 3PSLA 1K32A 1PI6A 4CZXA 3PVWB 3UR4A 5AMSA 4AOWA 1TBGA 3SBQA 3C5MA 2J55H 4EWRA 2TRCB 5FKRA 4I79A 4ES0A 1B9XA 2XU7A 3MKSB 1YFQA 2H68A 5THAA 5GSAA 3P4FA 4U7AA 4E54A 2B5NA 2H9MA 4O1QD 3EI2B 4CI1A 3EI4B 3EWEA 3GFCA 2I0TA 4R7AB 3VH0A 3W15A 2CE9A 4GGCA 4J77A 4UI9R 2OK4A 2YBAA 1S4UX 2P9PC 3DXMC 4A08B 3JZNA 4PNKB 5FKSA 4PBZA 3RLMD 3I7OA 4PSXB 4A11A 1JMZB 4Y5RD 2PM9B 3OTTA 4JSNC 4ZOYA 3L4OD 2J57G 3UKUC 4OZUA 5FXYA 3KRWB 3SN6B 3F3PA 2O9KA 1JOFA 4PBYA 3F3FA 5FA5B 4GZ8A 2YNPA 1PGUA 5EM2A 2BBKH 2H9NA 3OKYA 4ERQA 2I0RA 3A0FA 3HFQA 3DWLC 2YMUA 3PXTD 4BL0A 4FA1D 4JXMA 3EI3B 5FLXg 5EMLB 5IJ8E 1RI6A 2AGXA 2GC4A 2H9LA 3EI1A 5CXBA 2OVQB 4O9DA 3IJ1A 4O3TB 2PM7B 3U4YA 4E5ZA 4CY5A 2CNXA 3L4MD 2QXVA 3RMZD 2B4EA 3MKQA 5CXCA 3BWSA 3CFSB 4IA9A 3C9CA 3EMHA 4CC9A 5IGQA 4E54B 2YNNA 5EALA 3I7PA 1A0RB 5GXHA 2H3XA 3IIYA 4IMMA 2EBSA 3MZLA 3UVKA 3CIKB 2HXCA 2B5MA 2G99A 3PVUB 2AH1A 4LGNA 1XIPA 5HQGA 4O45A 2AGLA 5HYNB 4A11B 2OVRB 3SWSD 2H14A 4JSPC 4ZN4A 4XYIA 5HE2B 5JWZA 4X63B 3OKWA 2Z2NA 2HKMA 1P22A 2AH0A 2CO0A 4FAVD 2H9PA 4LG8A 4FA5D 4GM9A 2AGZA 2XYIA 4FA4D 1SHYB 2H47A 3UKRC 2YNOA 5EM2B 4X61B 4GQ1A 4K3ID 3UVOA 3OKYB 3BG0A 1SQ9A 4CI2A 4OWRA 3IJCA 5TDHB 4QT8A 2CE8A 4GMBA 3EI1B 5CXBB 4A2MA 3RSEC 1U2VC 4FAND 4J86A 4A0BA 4XYHA 4H5JA 4X3EA 4JT5C 3NVNA 5CYKA 3V5WB 2MTAH 5AFU3 5TF2A 1VYHC 3N0EA 3SVWD 2HJ4A 5C9ZB 5TEFA 1ERJA 3EG6A 4FHLA 3NVXA 1N6FA 4KFMB 4GQ2P 5EARA 2GNQA 5K19A 4HDJA 1PBYB 4Y7RA
chains in the Genus database with same CATH superfamily
3IKOA 1U4CA 5B4WA 5M5VA 4J87A 1OLZA 2QZPA 4K3JB 1A12A 5HE0B 1JMXB 3JB9L 4NBMA 3ORVD 5H14A 3PSCB 4O3UB 4J82A 3SMRA 3OL2B 3GD1I 4H5IA 1VZ2A 2GC7A 5IJ7E 3E0CA 2XL3A 5K1CC 3T3MA 5GMKn 2Z2PA 1TYQC 3ZDZA 4MK0B 4FB1D 2PM6B 4AN0A 5E6SA 2H6NA 3K71A 1VZ3A 5C86A 4PC0A 3IULA 5I5IA 2P9IC 4O2WA 5AJAA 3MXXA 2J56H 3IUNA 5EMKB 3AH8B 5M61A 2VDKA 4CY3A 3FRXA 4J84A 3DDUA 4A09A 3PE7A 4J79A 4O02A 4WK2A 4CZYA 2IWFA 3B7FA 4GM3A 2EICA 2P9LC 4U1EI 2UZXB 3ODTA 4L3HD 5SXMA 5EAPA 2AQ5A 1MG2A 4A7JA 4TZ4A 2OK6A 2I3SA 1K3IA 1QNIA 3RFGA 2OIZA 3SHFA 2IUVA 2OJYA 3O4HA 4A0BB 3JZGA 1XKSA 3SBPA 4AX4A 3F3GA 3J81g 2HJBA 4J81A 5CYKB 4J0XA 2UZYB 3ZE2A 4ZOXA 1GOGA 1L5GA 3FCSA 3I7KA 4A0AA 4J8GA 2VDRA 2XZGA 1MG3A 2PBIB 3EU7A 3OKTA 4CY1A 4N14A 2P9KC 2WQ8A 1R5MA 1GXRA 3K26A 3IJ0A 3SFZA 4J8BA 3UVNA 5FFGA 1L0QA 1GP2B 1C9IA 2EIDA 2P9NC 1U8CA 1SQJA 4BH6A 2Z2OA 3DM0A 4WK0A 2YB8B 3BG1A 4MMYA 1QFMA 4ESGA 3RRMC 1JTDB 3AL8A 1H2ZA 3VGZA 3I8EA 1E8NA 5IGOA 4GM8A 4ERZA 2Q7QA 2VZ1A 4GGDA 4L3GD 4FA9D 4AEZA 4E5ZB 4RE5A 4D6VA 3J80g 4G56B 4A09B 4ZOVA 1OMWB 4AMZA 3AFCA 2P9SC 3RN0D 3FGBA 1MDAH 3C75H 5CXCB 3PXSD 2H13A 3MZKA 5C2WB 4BCDA 4BUJC 3MMYA 3KRXB 4CZVA 2P9UC 4JSXC 3OW8A 4CI8A 3EQ9A 4QQEA 3JPXA 2CN3A 4X60B 5EMMB 1JV2A 4J73A 2CO0C 2HYEA 4PXWA 4UM8A 4L9OA 4MMXA 3RN1D 2W18A 4DNWA 4L1MA 5IT9g 4JT6C 5A2Qg 1B9YA 3PXWD 2I3TA 5FKTA 4J78A 3JZHA 3JRPA 4YVDA 4Z7NA 3SLED 5C92A 3ZWLB 1NEXB 5GXIA 3NIFA 4NC4A 3AL9A 2VDOA 2QC5A 4A0AB 2EIBA 2IUPA 1Q47A 4NSXA 3ZDYA 5HDBA 3NVQA 4LG9A 1I2MB 3OF7A 3FM0A 1H2XA 2IURA 4Z8LA 3JAMg 4JSVC 2G9AA 2IAAA 4JD2C 5H1MA 4UM9A 1GG2B 5IC7A 5TEEA 3UVMA 5HE3B 4G55A 1GOFA 3UVLA 4MMZA 2H6KA 3SBRA 3I7HA 3EI2A 4ERYA 1N6DA 2H6QA 3EI4A 3AL8B 5FKQA 3VI4A 3RFHA 2CN2A 4IRZA 5C2VB 1N6EA 1H2WA 4A2LA 5I5JA 1GOTB 2OVPB 5KDOB 4A08A 2AGWA 2I0SA 3GREA 3N0DA 3DSMA 3ULEC 2IUQA 2XL2A 3IIWA 5EAMA 4J0WA 3VA6A 4PSWB 4QL1A 2AGYA 3K27A 3FCUA 3IJEA 5H17A 5I5MA 3CFVA 4L1QD 3SCYA 3C99A 4QRJA 2HKRA 2PM9A 1TYEA 1GOHA 4CY2A 3SXTD 4GGAA 2HU7A 4NENA 3V7DB 3I7NA 5E6UA 1VE6A 5M5SA 2B5LA 4NAAA 3SJLD 4GQBB 3JROA 1VE7A 4FWWA 2BCJB 1K8KC 2IWKA 3I7LA 5EMJB 5FQDA 3V9FA 4D0KA 4CI3A 3OL2A 3I2NA 4XEIC 3DXKC 1XHMA 4ZOZA 3IVMA 5HE1B 2HESX 5M5RA 3EI3A 1JJUB 3I8CA 3I89A 5M5TA 1NR0A 2VDLA 1PEVA 1FWXA 3PSLA 1K32A 4BCBA 1PI6A 4CZXA 3PVWB 3UR4A 5AMSA 4AOWA 1TBGA 3SBQA 3MUOA 3C5MA 2J55H 4EWRA 2TRCB 5FKRA 2VDQA 4I79A 1QFSA 4ES0A 1B9XA 2XU7A 4G1MA 3MKSB 1YFQA 2H68A 5THAA 5GSAA 4WJKA 3P4FA 4U7AA 4E54A 2B5NA 3V4VA 3K72A 2H9MA 4O1QD 4AN1A 1E8MA 3EI2B 4D9SA 4CI1A 2XDWA 3EI4B 3EWEA 3GFCA 2I0TA 1UTCA 5E6RA 4R7AB 3VH0A 2VDPA 1YR2A 3NIGA 2CE9A 4GGCA 4JHPC 4J77A 3W15A 4UI9R 2OK4A 2YBAA 3IUJA 1S4UX 2P9PC 3DXMC 4A08B 3JZNA 3O4GA 4PNKB 5FKSA 4PBZA 3RLMD 1BPOA 3I7OA 3IUQA 4PSXB 4A11A 1JMZB 3T3PA 4Y5RD 3MVDK 2PM9B 3OTTA 4JSNC 4ZOYA 3L4OD 1H2YA 2J57G 3UKUC 4OZUA 5FXYA 3KRWB 3SN6B 3F3PA 2O9KA 1JOFA 1E5TA 3F3FA 4PBYA 5FA5B 3ZDXA 4GZ8A 1UOOA 2YNPA 1PGUA 1C9LA 5EM2A 3ZE1A 2BBKH 2VZ3A 2H9NA 3OKYA 2HU8A 4ERQA 2I0RA 3A0FA 2VC2A 4JHNA 3HFQA 3DWLC 2YMUA 3PXTD 4BL0A 4G1EA 4JXMA 4FA1D 3EI3B 5FLXg 5EMLB 5IJ8E 1RI6A 2AGXA 3QI0A 2GC4A 4BCCA 2H9LA 3EI1A 5CXBA 2JKXA 2OVQB 4O9DA 3IJ1A 2HU5A 4O3TB 2PM7B 3U4YA 4E5ZA 3EQ8A 4CY5A 2CNXA 3L4MD 2QXVA 3RMZD 2B4EA 3MKQA 5CXCA 3BWSA 3CFSB 4IA9A 3C9CA 4Z7OA 3EMHA 4CC9A 5IGQA 4WK4A 4E54B 2YNNA 5EALA 3I7PA 1O6GA 1A0RB 5GXHA 2H3XA 1T2XA 3IIYA 4IMMA 4DNUA 2EBSA 3KCIA 3MZLA 3EQ7A 3UVKA 3CIKB 2HXCA 2B5MA 2G99A 3GC3B 3PVUB 2AH1A 4LGNA 1XIPA 5HQGA 2VDMA 4BP8A 1O6FA 3O4IA 4O45A 2VDNA 2AGLA 3MUNA 3O4JA 5HYNB 4A11B 2OVRB 3SWSD 2H14A 4JSPC 4ZN4A 4XYIA 5HE2B 5JWZA 4X63B 3OKWA 2Z2NA 3NIDA 2HKMA 1P22A 2AH0A 2CO0A 4FAVD 1UOPA 2H9PA 4LG8A 4FA5D 4Z7QA 4GM9A 2AGZA 2XYIA 4FA4D 1SHYB 2H47A 3UKRC 2YNOA 5EM2B 3IURA 4RE6A 4GQ1A 4X61B 3ZE0A 4K3ID 3IUMA 3UVOA 3OKYB 3BG0A 5M5UA 1SQ9A 4CI2A 4QAMA 4OWRA 3IJCA 5TDHB 1M1XA 4QT8A 2CE8A 4GMBA 2QR5A 3EI1B 5CXBB 4A2MA 3RSEC 1U2VC 4DNVA 3V4PA 5FFOA 4FAND 2XE4A 4J86A 4A0BA 4XYHA 4BP9A 4H5JA 1UOQA 2EIEA 4X3EA 4JT5C 4AMYA 3NVNA 5CYKA 3V5WB 2MTAH 5AFU3 5TF2A 1VYHC 3N0EA 3SVWD 2HJ4A 5C9ZB 5TEFA 2BKLA 1ERJA 3EG6A 4FHLA 3VI3A 3NVXA 1N6FA 4KFMB 4GQ2P 5EARA 2GNQA 5K19A 4HDJA 3K6SA 3QHYB 1PBYB 4Y7RA
chains in the Genus database with same CATH topology
3IKOA 1U4CA 5B4WA 4J87A 1OLZA 4K3JB 5HE0B 1JMXB 3JB9L 3ORVD 5H14A 3PSCB 4O3UB 4J82A 3SMRA 3OL2B 4H5IA 2GC7A 5IJ7E 3E0CA 2XL3A 5K1CC 5GMKn 2Z2PA 1TYQC 4MK0B 4FB1D 2PM6B 2H6NA 4PC0A 5I5IA 2P9IC 5AJAA 3MXXA 2J56H 5EMKB 3AH8B 4CY3A 3FRXA 4J84A 4A09A 3PE7A 4J79A 4CZYA 2IWFA 3B7FA 4GM3A 2P9LC 4U1EI 2UZXB 3ODTA 4L3HD 5SXMA 5EAPA 2AQ5A 1MG2A 4A7JA 4TZ4A 2OK6A 2I3SA 1QNIA 3RFGA 3SHFA 2OIZA 2IUVA 2OJYA 4A0BB 3JZGA 1XKSA 3SBPA 3F3GA 3J81g 2HJBA 4J81A 5CYKB 4J0XA 2UZYB 4ZOXA 3I7KA 4A0AA 4J8GA 1MG3A 2PBIB 3EU7A 3OKTA 4CY1A 4N14A 2P9KC 1R5MA 1GXRA 3K26A 3IJ0A 3SFZA 4J8BA 3UVNA 1L0QA 1GP2B 2P9NC 1SQJA 4BH6A 2Z2OA 3DM0A 2YB8B 3BG1A 4ESGA 3RRMC 3AL8A 3VGZA 3I8EA 5IGOA 4GM8A 4ERZA 2Q7QA 4GGDA 4L3GD 4FA9D 4AEZA 4E5ZB 4D6VA 3J80g 4G56B 4A09B 4ZOVA 1OMWB 3AFCA 2P9SC 3RN0D 3FGBA 1MDAH 3C75H 5CXCB 3PXSD 2H13A 3MZKA 5C2WB 4BUJC 3MMYA 3KRXB 4CZVA 2P9UC 4JSXC 3OW8A 4CI8A 4QQEA 3JPXA 2CN3A 4X60B 5EMMB 4J73A 2CO0C 2HYEA 4PXWA 4L9OA 3RN1D 2W18A 5IT9g 4JT6C 5A2Qg 1B9YA 3PXWD 2I3TA 5FKTA 4J78A 3JZHA 3JRPA 4YVDA 3SLED 3ZWLB 1NEXB 5GXIA 3AL9A 2QC5A 4A0AB 2IUPA 1Q47A 4NSXA 3NVQA 4LG9A 3FM0A 2IURA 4Z8LA 3JAMg 4JSVC 2G9AA 2IAAA 4JD2C 5H1MA 1GG2B 5IC7A 5TEEA 3UVMA 5HE3B 3UVLA 2H6KA 3SBRA 3I7HA 3EI2A 4ERYA 1N6DA 2H6QA 3EI4A 3AL8B 5FKQA 3RFHA 2CN2A 5C2VB 1N6EA 4A2LA 5I5JA 1GOTB 2OVPB 5KDOB 4A08A 2AGWA 2I0SA 3GREA 3N0DA 3DSMA 3ULEC 2IUQA 2XL2A 3IIWA 5EAMA 4J0WA 3VA6A 4PSWB 4QL1A 2AGYA 3K27A 5I5MA 5H17A 3CFVA 4L1QD 3SCYA 3C99A 4QRJA 2HKRA 2PM9A 4CY2A 3SXTD 4GGAA 3V7DB 3I7NA 2B5LA 3SJLD 4GQBB 3JROA 4FWWA 2BCJB 1K8KC 2IWKA 3I7LA 5EMJB 5FQDA 3V9FA 4D0KA 4CI3A 3OL2A 3I2NA 4XEIC 3DXKC 1XHMA 4ZOZA 5HE1B 2HESX 3EI3A 1JJUB 3I8CA 3I89A 1NR0A 1PEVA 1FWXA 3PSLA 1K32A 1PI6A 4CZXA 3PVWB 3UR4A 5AMSA 4AOWA 1TBGA 3SBQA 3C5MA 2J55H 4EWRA 2TRCB 5FKRA 4I79A 4ES0A 1B9XA 2XU7A 3MKSB 1YFQA 2H68A 5THAA 5GSAA 3P4FA 4U7AA 4E54A 2B5NA 2H9MA 4O1QD 3EI2B 4CI1A 3EI4B 3EWEA 3GFCA 2I0TA 4R7AB 3VH0A 3W15A 2CE9A 4GGCA 4J77A 4UI9R 2OK4A 2YBAA 1S4UX 2P9PC 3DXMC 4A08B 3JZNA 4PNKB 5FKSA 4PBZA 3RLMD 3I7OA 4PSXB 4A11A 1JMZB 4Y5RD 2PM9B 3OTTA 4JSNC 4ZOYA 3L4OD 2J57G 3UKUC 4OZUA 5FXYA 3KRWB 3SN6B 3F3PA 2O9KA 1JOFA 4PBYA 3F3FA 5FA5B 4GZ8A 2YNPA 1PGUA 5EM2A 2BBKH 2H9NA 3OKYA 4ERQA 2I0RA 3A0FA 3HFQA 3DWLC 2YMUA 3PXTD 4BL0A 4FA1D 4JXMA 3EI3B 5FLXg 5EMLB 5IJ8E 1RI6A 2AGXA 2GC4A 2H9LA 3EI1A 5CXBA 2OVQB 4O9DA 3IJ1A 4O3TB 2PM7B 3U4YA 4E5ZA 4CY5A 2CNXA 3L4MD 2QXVA 3RMZD 2B4EA 3MKQA 5CXCA 3BWSA 3CFSB 4IA9A 3C9CA 3EMHA 4CC9A 5IGQA 4E54B 2YNNA 5EALA 3I7PA 1A0RB 5GXHA 2H3XA 3IIYA 4IMMA 2EBSA 3MZLA 3UVKA 3CIKB 2HXCA 2B5MA 2G99A 3PVUB 2AH1A 4LGNA 1XIPA 5HQGA 4O45A 2AGLA 5HYNB 4A11B 2OVRB 3SWSD 2H14A 4JSPC 4ZN4A 4XYIA 5HE2B 5JWZA 4X63B 3OKWA 2Z2NA 2HKMA 1P22A 2AH0A 2CO0A 4FAVD 2H9PA 4LG8A 4FA5D 4GM9A 2AGZA 2XYIA 4FA4D 1SHYB 2H47A 3UKRC 2YNOA 5EM2B 4X61B 4GQ1A 4K3ID 3UVOA 3OKYB 3BG0A 1SQ9A 4CI2A 4OWRA 3IJCA 5TDHB 4QT8A 2CE8A 4GMBA 3EI1B 5CXBB 4A2MA 3RSEC 1U2VC 4FAND 4J86A 4A0BA 4XYHA 4H5JA 4X3EA 4JT5C 3NVNA 5CYKA 3V5WB 2MTAH 5AFU3 5TF2A 1VYHC 3N0EA 3SVWD 2HJ4A 5C9ZB 5TEFA 1ERJA 3EG6A 4FHLA 3NVXA 1N6FA 4KFMB 4GQ2P 5EARA 2GNQA 5K19A 4HDJA 1PBYB 4Y7RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IKO A;  1U4C A;  5B4W A;  4J87 A;  1OLZ A;  4K3J B;  5HE0 B;  1JMX B;  3JB9 L;  3ORV D;  5H14 A;  3PSC B;  4O3U B;  4J82 A;  3SMR A;  3OL2 B;  4H5I A;  2GC7 A;  5IJ7 E;  3E0C A;  2XL3 A;  5K1C C;  5GMK n;  2Z2P A;  1TYQ C;  4MK0 B;  4FB1 D;  2PM6 B;  2H6N A;  4PC0 A;  5I5I A;  2P9I C;  5AJA A;  3MXX A;  2J56 H;  5EMK B;  3AH8 B;  4CY3 A;  3FRX A;  4J84 A;  4A09 A;  3PE7 A;  4J79 A;  4CZY A;  2IWF A;  3B7F A;  4GM3 A;  2P9L C;  4U1E I;  2UZX B;  3ODT A;  4L3H D;  5SXM A;  5EAP A;  2AQ5 A;  1MG2 A;  4A7J A;  4TZ4 A;  2OK6 A;  2I3S A;  1QNI A;  3RFG A;  3SHF A;  2OIZ A;  2IUV A;  2OJY A;  4A0B B;  3JZG A;  1XKS A;  3SBP A;  3F3G A;  3J81 g;  2HJB A;  4J81 A;  5CYK B;  4J0X A;  2UZY B;  4ZOX A;  3I7K A;  4A0A A;  4J8G A;  1MG3 A;  2PBI B;  3EU7 A;  3OKT A;  4CY1 A;  4N14 A;  2P9K C;  1R5M A;  1GXR A;  3K26 A;  3IJ0 A;  3SFZ A;  4J8B A;  3UVN A;  1L0Q A;  1GP2 B;  2P9N C;  1SQJ A;  4BH6 A;  2Z2O A;  3DM0 A;  2YB8 B;  3BG1 A;  4ESG A;  3RRM C;  3AL8 A;  3VGZ A;  3I8E A;  5IGO A;  4GM8 A;  4ERZ A;  2Q7Q A;  4GGD A;  4L3G D;  4FA9 D;  4AEZ A;  4E5Z B;  4D6V A;  3J80 g;  4G56 B;  4A09 B;  4ZOV A;  1OMW B;  3AFC A;  2P9S C;  3RN0 D;  3FGB A;  1MDA H;  3C75 H;  5CXC B;  3PXS D;  2H13 A;  3MZK A;  5C2W B;  4BUJ C;  3MMY A;  3KRX B;  4CZV A;  2P9U C;  4JSX C;  3OW8 A;  4CI8 A;  4QQE A;  3JPX A;  2CN3 A;  4X60 B;  5EMM B;  4J73 A;  2CO0 C;  2HYE A;  4PXW A;  4L9O A;  3RN1 D;  2W18 A;  5IT9 g;  4JT6 C;  5A2Q g;  1B9Y A;  3PXW D;  2I3T A;  5FKT A;  4J78 A;  3JZH A;  3JRP A;  4YVD A;  3SLE D;  3ZWL B;  1NEX B;  5GXI A;  3AL9 A;  2QC5 A;  4A0A B;  2IUP A;  1Q47 A;  4NSX A;  3NVQ A;  4LG9 A;  3FM0 A;  2IUR A;  4Z8L A;  3JAM g;  4JSV C;  2G9A A;  2IAA A;  4JD2 C;  5H1M A;  1GG2 B;  5IC7 A;  5TEE A;  3UVM A;  5HE3 B;  3UVL A;  2H6K A;  3SBR A;  3I7H A;  3EI2 A;  4ERY A;  1N6D A;  2H6Q A;  3EI4 A;  3AL8 B;  5FKQ A;  3RFH A;  2CN2 A;  5C2V B;  1N6E A;  4A2L A;  5I5J A;  1GOT B;  2OVP B;  5KDO B;  4A08 A;  2AGW A;  2I0S A;  3GRE A;  3N0D A;  3DSM A;  3ULE C;  2IUQ A;  2XL2 A;  3IIW A;  5EAM A;  4J0W A;  3VA6 A;  4PSW B;  4QL1 A;  2AGY A;  3K27 A;  5I5M A;  5H17 A;  3CFV A;  4L1Q D;  3SCY A;  3C99 A;  4QRJ A;  2HKR A;  2PM9 A;  4CY2 A;  3SXT D;  4GGA A;  3V7D B;  3I7N A;  2B5L A;  3SJL D;  4GQB B;  3JRO A;  4FWW A;  2BCJ B;  1K8K C;  2IWK A;  3I7L A;  5EMJ B;  5FQD A;  3V9F A;  4D0K A;  4CI3 A;  3OL2 A;  3I2N A;  4XEI C;  3DXK C;  1XHM A;  4ZOZ A;  5HE1 B;  2HES X;  3EI3 A;  1JJU B;  3I8C A;  3I89 A;  1NR0 A;  1PEV A;  1FWX A;  3PSL A;  1K32 A;  1PI6 A;  4CZX A;  3PVW B;  3UR4 A;  5AMS A;  4AOW A;  1TBG A;  3SBQ A;  3C5M A;  2J55 H;  4EWR A;  2TRC B;  5FKR A;  4I79 A;  4ES0 A;  1B9X A;  2XU7 A;  3MKS B;  1YFQ A;  2H68 A;  5THA A;  5GSA A;  3P4F A;  4U7A A;  4E54 A;  2B5N A;  2H9M A;  4O1Q D;  3EI2 B;  4CI1 A;  3EI4 B;  3EWE A;  3GFC A;  2I0T A;  4R7A B;  3VH0 A;  3W15 A;  2CE9 A;  4GGC A;  4J77 A;  4UI9 R;  2OK4 A;  2YBA A;  1S4U X;  2P9P C;  3DXM C;  4A08 B;  3JZN A;  4PNK B;  5FKS A;  4PBZ A;  3RLM D;  3I7O A;  4PSX B;  4A11 A;  1JMZ B;  4Y5R D;  2PM9 B;  3OTT A;  4JSN C;  4ZOY A;  3L4O D;  2J57 G;  3UKU C;  4OZU A;  5FXY A;  3KRW B;  3SN6 B;  3F3P A;  2O9K A;  1JOF A;  4PBY A;  3F3F A;  5FA5 B;  4GZ8 A;  2YNP A;  1PGU A;  5EM2 A;  2BBK H;  2H9N A;  3OKY A;  4ERQ A;  2I0R A;  3A0F A;  3HFQ A;  3DWL C;  2YMU A;  3PXT D;  4BL0 A;  4FA1 D;  4JXM A;  3EI3 B;  5FLX g;  5EML B;  5IJ8 E;  1RI6 A;  2AGX A;  2GC4 A;  2H9L A;  3EI1 A;  5CXB A;  2OVQ B;  4O9D A;  3IJ1 A;  4O3T B;  2PM7 B;  3U4Y A;  4E5Z A;  4CY5 A;  2CNX A;  3L4M D;  2QXV A;  3RMZ D;  2B4E A;  3MKQ A;  5CXC A;  3BWS A;  3CFS B;  4IA9 A;  3C9C A;  3EMH A;  4CC9 A;  5IGQ A;  4E54 B;  2YNN A;  5EAL A;  3I7P A;  1A0R B;  5GXH A;  2H3X A;  3IIY A;  4IMM A;  2EBS A;  3MZL A;  3UVK A;  3CIK B;  2HXC A;  2B5M A;  2G99 A;  3PVU B;  2AH1 A;  4LGN A;  1XIP A;  5HQG A;  4O45 A;  2AGL A;  5HYN B;  4A11 B;  2OVR B;  3SWS D;  2H14 A;  4JSP C;  4ZN4 A;  4XYI A;  5HE2 B;  5JWZ A;  4X63 B;  3OKW A;  2Z2N A;  2HKM A;  1P22 A;  2AH0 A;  2CO0 A;  4FAV D;  2H9P A;  4LG8 A;  4FA5 D;  4GM9 A;  2AGZ A;  2XYI A;  4FA4 D;  1SHY B;  2H47 A;  3UKR C;  2YNO A;  5EM2 B;  4X61 B;  4GQ1 A;  4K3I D;  3UVO A;  3OKY B;  3BG0 A;  1SQ9 A;  4CI2 A;  4OWR A;  3IJC A;  5TDH B;  4QT8 A;  2CE8 A;  4GMB A;  3EI1 B;  5CXB B;  4A2M A;  3RSE C;  1U2V C;  4FAN D;  4J86 A;  4A0B A;  4XYH A;  4H5J A;  4X3E A;  4JT5 C;  3NVN A;  5CYK A;  3V5W B;  2MTA H;  5AFU 3;  5TF2 A;  1VYH C;  3N0E A;  3SVW D;  2HJ4 A;  5C9Z B;  5TEF A;  1ERJ A;  3EG6 A;  4FHL A;  3NVX A;  1N6F A;  4KFM B;  4GQ2 P;  5EAR A;  2GNQ A;  5K19 A;  4HDJ A;  1PBY B;  4Y7R A; 
#chains in the Genus database with same CATH topology
 3IKO A;  1U4C A;  5B4W A;  5M5V A;  4J87 A;  1OLZ A;  2QZP A;  4K3J B;  1A12 A;  5HE0 B;  1JMX B;  3JB9 L;  4NBM A;  3ORV D;  5H14 A;  3PSC B;  4O3U B;  4J82 A;  3SMR A;  3OL2 B;  3GD1 I;  4H5I A;  1VZ2 A;  2GC7 A;  5IJ7 E;  3E0C A;  2XL3 A;  5K1C C;  3T3M A;  5GMK n;  2Z2P A;  1TYQ C;  3ZDZ A;  4MK0 B;  4FB1 D;  2PM6 B;  4AN0 A;  5E6S A;  2H6N A;  3K71 A;  1VZ3 A;  5C86 A;  4PC0 A;  3IUL A;  5I5I A;  2P9I C;  4O2W A;  5AJA A;  3MXX A;  2J56 H;  3IUN A;  5EMK B;  3AH8 B;  5M61 A;  2VDK A;  4CY3 A;  3FRX A;  4J84 A;  3DDU A;  4A09 A;  3PE7 A;  4J79 A;  4O02 A;  4WK2 A;  4CZY A;  2IWF A;  3B7F A;  4GM3 A;  2EIC A;  2P9L C;  4U1E I;  2UZX B;  3ODT A;  4L3H D;  5SXM A;  5EAP A;  2AQ5 A;  1MG2 A;  4A7J A;  4TZ4 A;  2OK6 A;  2I3S A;  1K3I A;  1QNI A;  3RFG A;  2OIZ A;  3SHF A;  2IUV A;  2OJY A;  3O4H A;  4A0B B;  3JZG A;  1XKS A;  3SBP A;  4AX4 A;  3F3G A;  3J81 g;  2HJB A;  4J81 A;  5CYK B;  4J0X A;  2UZY B;  3ZE2 A;  4ZOX A;  1GOG A;  1L5G A;  3FCS A;  3I7K A;  4A0A A;  4J8G A;  2VDR A;  2XZG A;  1MG3 A;  2PBI B;  3EU7 A;  3OKT A;  4CY1 A;  4N14 A;  2P9K C;  2WQ8 A;  1R5M A;  1GXR A;  3K26 A;  3IJ0 A;  3SFZ A;  4J8B A;  3UVN A;  5FFG A;  1L0Q A;  1GP2 B;  1C9I A;  2EID A;  2P9N C;  1U8C A;  1SQJ A;  4BH6 A;  2Z2O A;  3DM0 A;  4WK0 A;  2YB8 B;  3BG1 A;  4MMY A;  1QFM A;  4ESG A;  3RRM C;  1JTD B;  3AL8 A;  1H2Z A;  3VGZ A;  3I8E A;  1E8N A;  5IGO A;  4GM8 A;  4ERZ A;  2Q7Q A;  2VZ1 A;  4GGD A;  4L3G D;  4FA9 D;  4AEZ A;  4E5Z B;  4RE5 A;  4D6V A;  3J80 g;  4G56 B;  4A09 B;  4ZOV A;  1OMW B;  4AMZ A;  3AFC A;  2P9S C;  3RN0 D;  3FGB A;  1MDA H;  3C75 H;  5CXC B;  3PXS D;  2H13 A;  3MZK A;  5C2W B;  4BCD A;  4BUJ C;  3MMY A;  3KRX B;  4CZV A;  2P9U C;  4JSX C;  3OW8 A;  4CI8 A;  3EQ9 A;  4QQE A;  3JPX A;  2CN3 A;  4X60 B;  5EMM B;  1JV2 A;  4J73 A;  2CO0 C;  2HYE A;  4PXW A;  4UM8 A;  4L9O A;  4MMX A;  3RN1 D;  2W18 A;  4DNW A;  4L1M A;  5IT9 g;  4JT6 C;  5A2Q g;  1B9Y A;  3PXW D;  2I3T A;  5FKT A;  4J78 A;  3JZH A;  3JRP A;  4YVD A;  4Z7N A;  3SLE D;  5C92 A;  3ZWL B;  1NEX B;  5GXI A;  3NIF A;  4NC4 A;  3AL9 A;  2VDO A;  2QC5 A;  4A0A B;  2EIB A;  2IUP A;  1Q47 A;  4NSX A;  3ZDY A;  5HDB A;  3NVQ A;  4LG9 A;  1I2M B;  3OF7 A;  3FM0 A;  1H2X A;  2IUR A;  4Z8L A;  3JAM g;  4JSV C;  2G9A A;  2IAA A;  4JD2 C;  5H1M A;  4UM9 A;  1GG2 B;  5IC7 A;  5TEE A;  3UVM A;  5HE3 B;  4G55 A;  1GOF A;  3UVL A;  4MMZ A;  2H6K A;  3SBR A;  3I7H A;  3EI2 A;  4ERY A;  1N6D A;  2H6Q A;  3EI4 A;  3AL8 B;  5FKQ A;  3VI4 A;  3RFH A;  2CN2 A;  4IRZ A;  5C2V B;  1N6E A;  1H2W A;  4A2L A;  5I5J A;  1GOT B;  2OVP B;  5KDO B;  4A08 A;  2AGW A;  2I0S A;  3GRE A;  3N0D A;  3DSM A;  3ULE C;  2IUQ A;  2XL2 A;  3IIW A;  5EAM A;  4J0W A;  3VA6 A;  4PSW B;  4QL1 A;  2AGY A;  3K27 A;  3FCU A;  3IJE A;  5H17 A;  5I5M A;  3CFV A;  4L1Q D;  3SCY A;  3C99 A;  4QRJ A;  2HKR A;  2PM9 A;  1TYE A;  1GOH A;  4CY2 A;  3SXT D;  4GGA A;  2HU7 A;  4NEN A;  3V7D B;  3I7N A;  5E6U A;  1VE6 A;  5M5S A;  2B5L A;  4NAA A;  3SJL D;  4GQB B;  3JRO A;  1VE7 A;  4FWW A;  2BCJ B;  1K8K C;  2IWK A;  3I7L A;  5EMJ B;  5FQD A;  3V9F A;  4D0K A;  4CI3 A;  3OL2 A;  3I2N A;  4XEI C;  3DXK C;  1XHM A;  4ZOZ A;  3IVM A;  5HE1 B;  2HES X;  5M5R A;  3EI3 A;  1JJU B;  3I8C A;  3I89 A;  5M5T A;  1NR0 A;  2VDL A;  1PEV A;  1FWX A;  3PSL A;  1K32 A;  4BCB A;  1PI6 A;  4CZX A;  3PVW B;  3UR4 A;  5AMS A;  4AOW A;  1TBG A;  3SBQ A;  3MUO A;  3C5M A;  2J55 H;  4EWR A;  2TRC B;  5FKR A;  2VDQ A;  4I79 A;  1QFS A;  4ES0 A;  1B9X A;  2XU7 A;  4G1M A;  3MKS B;  1YFQ A;  2H68 A;  5THA A;  5GSA A;  4WJK A;  3P4F A;  4U7A A;  4E54 A;  2B5N A;  3V4V A;  3K72 A;  2H9M A;  4O1Q D;  4AN1 A;  1E8M A;  3EI2 B;  4D9S A;  4CI1 A;  2XDW A;  3EI4 B;  3EWE A;  3GFC A;  2I0T A;  1UTC A;  5E6R A;  4R7A B;  3VH0 A;  2VDP A;  1YR2 A;  3NIG A;  2CE9 A;  4GGC A;  4JHP C;  4J77 A;  3W15 A;  4UI9 R;  2OK4 A;  2YBA A;  3IUJ A;  1S4U X;  2P9P C;  3DXM C;  4A08 B;  3JZN A;  3O4G A;  4PNK B;  5FKS A;  4PBZ A;  3RLM D;  1BPO A;  3I7O A;  3IUQ A;  4PSX B;  4A11 A;  1JMZ B;  3T3P A;  4Y5R D;  3MVD K;  2PM9 B;  3OTT A;  4JSN C;  4ZOY A;  3L4O D;  1H2Y A;  2J57 G;  3UKU C;  4OZU A;  5FXY A;  3KRW B;  3SN6 B;  3F3P A;  2O9K A;  1JOF A;  1E5T A;  3F3F A;  4PBY A;  5FA5 B;  3ZDX A;  4GZ8 A;  1UOO A;  2YNP A;  1PGU A;  1C9L A;  5EM2 A;  3ZE1 A;  2BBK H;  2VZ3 A;  2H9N A;  3OKY A;  2HU8 A;  4ERQ A;  2I0R A;  3A0F A;  2VC2 A;  4JHN A;  3HFQ A;  3DWL C;  2YMU A;  3PXT D;  4BL0 A;  4G1E A;  4JXM A;  4FA1 D;  3EI3 B;  5FLX g;  5EML B;  5IJ8 E;  1RI6 A;  2AGX A;  3QI0 A;  2GC4 A;  4BCC A;  2H9L A;  3EI1 A;  5CXB A;  2JKX A;  2OVQ B;  4O9D A;  3IJ1 A;  2HU5 A;  4O3T B;  2PM7 B;  3U4Y A;  4E5Z A;  3EQ8 A;  4CY5 A;  2CNX A;  3L4M D;  2QXV A;  3RMZ D;  2B4E A;  3MKQ A;  5CXC A;  3BWS A;  3CFS B;  4IA9 A;  3C9C A;  4Z7O A;  3EMH A;  4CC9 A;  5IGQ A;  4WK4 A;  4E54 B;  2YNN A;  5EAL A;  3I7P A;  1O6G A;  1A0R B;  5GXH A;  2H3X A;  1T2X A;  3IIY A;  4IMM A;  4DNU A;  2EBS A;  3KCI A;  3MZL A;  3EQ7 A;  3UVK A;  3CIK B;  2HXC A;  2B5M A;  2G99 A;  3GC3 B;  3PVU B;  2AH1 A;  4LGN A;  1XIP A;  5HQG A;  2VDM A;  4BP8 A;  1O6F A;  3O4I A;  4O45 A;  2VDN A;  2AGL A;  3MUN A;  3O4J A;  5HYN B;  4A11 B;  2OVR B;  3SWS D;  2H14 A;  4JSP C;  4ZN4 A;  4XYI A;  5HE2 B;  5JWZ A;  4X63 B;  3OKW A;  2Z2N A;  3NID A;  2HKM A;  1P22 A;  2AH0 A;  2CO0 A;  4FAV D;  1UOP A;  2H9P A;  4LG8 A;  4FA5 D;  4Z7Q A;  4GM9 A;  2AGZ A;  2XYI A;  4FA4 D;  1SHY B;  2H47 A;  3UKR C;  2YNO A;  5EM2 B;  3IUR A;  4RE6 A;  4GQ1 A;  4X61 B;  3ZE0 A;  4K3I D;  3IUM A;  3UVO A;  3OKY B;  3BG0 A;  5M5U A;  1SQ9 A;  4CI2 A;  4QAM A;  4OWR A;  3IJC A;  5TDH B;  1M1X A;  4QT8 A;  2CE8 A;  4GMB A;  2QR5 A;  3EI1 B;  5CXB B;  4A2M A;  3RSE C;  1U2V C;  4DNV A;  3V4P A;  5FFO A;  4FAN D;  2XE4 A;  4J86 A;  4A0B A;  4XYH A;  4BP9 A;  4H5J A;  1UOQ A;  2EIE A;  4X3E A;  4JT5 C;  4AMY A;  3NVN A;  5CYK A;  3V5W B;  2MTA H;  5AFU 3;  5TF2 A;  1VYH C;  3N0E A;  3SVW D;  2HJ4 A;  5C9Z B;  5TEF A;  2BKL A;  1ERJ A;  3EG6 A;  4FHL A;  3VI3 A;  3NVX A;  1N6F A;  4KFM B;  4GQ2 P;  5EAR A;  2GNQ A;  5K19 A;  4HDJ A;  3K6S A;  3QHY B;  1PBY B;  4Y7R A; 
#chains in the Genus database with same CATH homology
 3IKO A;  1U4C A;  5B4W A;  4J87 A;  1OLZ A;  4K3J B;  5HE0 B;  1JMX B;  3JB9 L;  3ORV D;  5H14 A;  3PSC B;  4O3U B;  4J82 A;  3SMR A;  3OL2 B;  4H5I A;  2GC7 A;  5IJ7 E;  3E0C A;  2XL3 A;  5K1C C;  5GMK n;  2Z2P A;  1TYQ C;  4MK0 B;  4FB1 D;  2PM6 B;  2H6N A;  4PC0 A;  5I5I A;  2P9I C;  5AJA A;  3MXX A;  2J56 H;  5EMK B;  3AH8 B;  4CY3 A;  3FRX A;  4J84 A;  4A09 A;  3PE7 A;  4J79 A;  4CZY A;  2IWF A;  3B7F A;  4GM3 A;  2P9L C;  4U1E I;  2UZX B;  3ODT A;  4L3H D;  5SXM A;  5EAP A;  2AQ5 A;  1MG2 A;  4A7J A;  4TZ4 A;  2OK6 A;  2I3S A;  1QNI A;  3RFG A;  3SHF A;  2OIZ A;  2IUV A;  2OJY A;  4A0B B;  3JZG A;  1XKS A;  3SBP A;  3F3G A;  3J81 g;  2HJB A;  4J81 A;  5CYK B;  4J0X A;  2UZY B;  4ZOX A;  3I7K A;  4A0A A;  4J8G A;  1MG3 A;  2PBI B;  3EU7 A;  3OKT A;  4CY1 A;  4N14 A;  2P9K C;  1R5M A;  1GXR A;  3K26 A;  3IJ0 A;  3SFZ A;  4J8B A;  3UVN A;  1L0Q A;  1GP2 B;  2P9N C;  1SQJ A;  4BH6 A;  2Z2O A;  3DM0 A;  2YB8 B;  3BG1 A;  4ESG A;  3RRM C;  3AL8 A;  3VGZ A;  3I8E A;  5IGO A;  4GM8 A;  4ERZ A;  2Q7Q A;  4GGD A;  4L3G D;  4FA9 D;  4AEZ A;  4E5Z B;  4D6V A;  3J80 g;  4G56 B;  4A09 B;  4ZOV A;  1OMW B;  3AFC A;  2P9S C;  3RN0 D;  3FGB A;  1MDA H;  3C75 H;  5CXC B;  3PXS D;  2H13 A;  3MZK A;  5C2W B;  4BUJ C;  3MMY A;  3KRX B;  4CZV A;  2P9U C;  4JSX C;  3OW8 A;  4CI8 A;  4QQE A;  3JPX A;  2CN3 A;  4X60 B;  5EMM B;  4J73 A;  2CO0 C;  2HYE A;  4PXW A;  4L9O A;  3RN1 D;  2W18 A;  5IT9 g;  4JT6 C;  5A2Q g;  1B9Y A;  3PXW D;  2I3T A;  5FKT A;  4J78 A;  3JZH A;  3JRP A;  4YVD A;  3SLE D;  3ZWL B;  1NEX B;  5GXI A;  3AL9 A;  2QC5 A;  4A0A B;  2IUP A;  1Q47 A;  4NSX A;  3NVQ A;  4LG9 A;  3FM0 A;  2IUR A;  4Z8L A;  3JAM g;  4JSV C;  2G9A A;  2IAA A;  4JD2 C;  5H1M A;  1GG2 B;  5IC7 A;  5TEE A;  3UVM A;  5HE3 B;  3UVL A;  2H6K A;  3SBR A;  3I7H A;  3EI2 A;  4ERY A;  1N6D A;  2H6Q A;  3EI4 A;  3AL8 B;  5FKQ A;  3RFH A;  2CN2 A;  5C2V B;  1N6E A;  4A2L A;  5I5J A;  1GOT B;  2OVP B;  5KDO B;  4A08 A;  2AGW A;  2I0S A;  3GRE A;  3N0D A;  3DSM A;  3ULE C;  2IUQ A;  2XL2 A;  3IIW A;  5EAM A;  4J0W A;  3VA6 A;  4PSW B;  4QL1 A;  2AGY A;  3K27 A;  5I5M A;  5H17 A;  3CFV A;  4L1Q D;  3SCY A;  3C99 A;  4QRJ A;  2HKR A;  2PM9 A;  4CY2 A;  3SXT D;  4GGA A;  3V7D B;  3I7N A;  2B5L A;  3SJL D;  4GQB B;  3JRO A;  4FWW A;  2BCJ B;  1K8K C;  2IWK A;  3I7L A;  5EMJ B;  5FQD A;  3V9F A;  4D0K A;  4CI3 A;  3OL2 A;  3I2N A;  4XEI C;  3DXK C;  1XHM A;  4ZOZ A;  5HE1 B;  2HES X;  3EI3 A;  1JJU B;  3I8C A;  3I89 A;  1NR0 A;  1PEV A;  1FWX A;  3PSL A;  1K32 A;  1PI6 A;  4CZX A;  3PVW B;  3UR4 A;  5AMS A;  4AOW A;  1TBG A;  3SBQ A;  3C5M A;  2J55 H;  4EWR A;  2TRC B;  5FKR A;  4I79 A;  4ES0 A;  1B9X A;  2XU7 A;  3MKS B;  1YFQ A;  2H68 A;  5THA A;  5GSA A;  3P4F A;  4U7A A;  4E54 A;  2B5N A;  2H9M A;  4O1Q D;  3EI2 B;  4CI1 A;  3EI4 B;  3EWE A;  3GFC A;  2I0T A;  4R7A B;  3VH0 A;  3W15 A;  2CE9 A;  4GGC A;  4J77 A;  4UI9 R;  2OK4 A;  2YBA A;  1S4U X;  2P9P C;  3DXM C;  4A08 B;  3JZN A;  4PNK B;  5FKS A;  4PBZ A;  3RLM D;  3I7O A;  4PSX B;  4A11 A;  1JMZ B;  4Y5R D;  2PM9 B;  3OTT A;  4JSN C;  4ZOY A;  3L4O D;  2J57 G;  3UKU C;  4OZU A;  5FXY A;  3KRW B;  3SN6 B;  3F3P A;  2O9K A;  1JOF A;  4PBY A;  3F3F A;  5FA5 B;  4GZ8 A;  2YNP A;  1PGU A;  5EM2 A;  2BBK H;  2H9N A;  3OKY A;  4ERQ A;  2I0R A;  3A0F A;  3HFQ A;  3DWL C;  2YMU A;  3PXT D;  4BL0 A;  4FA1 D;  4JXM A;  3EI3 B;  5FLX g;  5EML B;  5IJ8 E;  1RI6 A;  2AGX A;  2GC4 A;  2H9L A;  3EI1 A;  5CXB A;  2OVQ B;  4O9D A;  3IJ1 A;  4O3T B;  2PM7 B;  3U4Y A;  4E5Z A;  4CY5 A;  2CNX A;  3L4M D;  2QXV A;  3RMZ D;  2B4E A;  3MKQ A;  5CXC A;  3BWS A;  3CFS B;  4IA9 A;  3C9C A;  3EMH A;  4CC9 A;  5IGQ A;  4E54 B;  2YNN A;  5EAL A;  3I7P A;  1A0R B;  5GXH A;  2H3X A;  3IIY A;  4IMM A;  2EBS A;  3MZL A;  3UVK A;  3CIK B;  2HXC A;  2B5M A;  2G99 A;  3PVU B;  2AH1 A;  4LGN A;  1XIP A;  5HQG A;  4O45 A;  2AGL A;  5HYN B;  4A11 B;  2OVR B;  3SWS D;  2H14 A;  4JSP C;  4ZN4 A;  4XYI A;  5HE2 B;  5JWZ A;  4X63 B;  3OKW A;  2Z2N A;  2HKM A;  1P22 A;  2AH0 A;  2CO0 A;  4FAV D;  2H9P A;  4LG8 A;  4FA5 D;  4GM9 A;  2AGZ A;  2XYI A;  4FA4 D;  1SHY B;  2H47 A;  3UKR C;  2YNO A;  5EM2 B;  4X61 B;  4GQ1 A;  4K3I D;  3UVO A;  3OKY B;  3BG0 A;  1SQ9 A;  4CI2 A;  4OWR A;  3IJC A;  5TDH B;  4QT8 A;  2CE8 A;  4GMB A;  3EI1 B;  5CXB B;  4A2M A;  3RSE C;  1U2V C;  4FAN D;  4J86 A;  4A0B A;  4XYH A;  4H5J A;  4X3E A;  4JT5 C;  3NVN A;  5CYK A;  3V5W B;  2MTA H;  5AFU 3;  5TF2 A;  1VYH C;  3N0E A;  3SVW D;  2HJ4 A;  5C9Z B;  5TEF A;  1ERJ A;  3EG6 A;  4FHL A;  3NVX A;  1N6F A;  4KFM B;  4GQ2 P;  5EAR A;  2GNQ A;  5K19 A;  4HDJ A;  1PBY B;  4Y7R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...