5FA5B

Crystal structure of prmt5:mep50 in complex with mta and h4 peptide
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
308
structure length
301
Chain Sequence
PNAPACMERQLEAARYRSDGALLLGASSLSGRCWAGSLWLFKDPCAAPNEGFCSAGVQTEAGVADLTWVGERGILVASDSGAVELWELDENETLIVSKFCKYEHDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQVVLSSYRAHAAQVTCVAASPHKDSVFLSCSEDNRILLWDTRCPKPASQIGGYLPTSLAWHPQQSEVFVFGDENGTVSLVDTKSVLSSAVHSQCVTGLVFSPHSVPFLASLSEDCSLAVLDSSLSELFRSQAHRDFVRDATWSPLNHSLLTTVGWDHQVVHHVVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Disordered methionine metabolism in MTAP/CDKN2A-deleted cancers leads to dependence on PRMT5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/protein binding
molecule keywords Protein arginine N-methyltransferase 5
total genus 81
structure length 301
sequence length 308
ec nomenclature
pdb deposition date 2015-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5fa5B00
4I79A 4CI8A 3KRWB 3SWSD 3I7HA 2H3XA 3DSMA 3MMYA 3UVLA 4A7JA 5FKTA 4A08B 2J55H 3PSLA 3ULEC 1RI6A 3I8CA 3E0CA 1N6FA 2OVRB 4ERYA 3JPXA 4ZOYA 3V9FA 4J82A 4A09B 2OJYA 3AL8B 3FM0A 2I3SA 4D0KA 3OTTA 2H14A 4BL0A 1U4CA 4H5JA 3MZLA 2CE8A 4O3UB 2I0TA 3C5MA 1PBYB 4ZN4A 3EI4A 2HKRA 4GGDA 5IT9g 5CXCB 3V5WB 2AGYA 5A2Qg 3U4YA 4MK0B 5CXCA 3EI3A 4YVDA 2H9LA 3GREA 5CYKB 2P9NC 2HJBA 3SBPA 5AMSA 4JT6C 3A0FA 3I7PA 4XYHA 5EMKB 4JSVC 3I8EA 4R7AB 5IJ8E 4HDJA 2H6QA 5EARA 4E54A 4CZXA 4PSWB 5HE0B 5HYNB 1OMWB 2B5MA 4FA4D 2IUQA 2AGZA 3SBRA 2QC5A 1B9XA 4X61B 1N6EA 2OVPB 4JSPC 4LGNA 3SVWD 3CFSB 2YNOA 2Z2OA 1MG2A 3OKYA 2HYEA 2HKMA 4GM8A 2P9LC 1XKSA 5K1CC 2PM9A 5FXYA 2QXVA 5H17A 3IJ0A 2I3TA 3DWLC 5AJAA 3UVOA 3FGBA 1GG2B 1MDAH 3L4OD 3BWSA 4FAVD 4XYIA 4FA1D 2AQ5A 3SCYA 3VGZA 3AFCA 4AOWA 4O3TB 1JMZB 1TBGA 2XL2A 2GC4A 2CNXA 4FWWA 3SXTD 4J77A 4PC0A 3DXMC 1JMXB 3PXSD 5EMJB 3MXXA 4X3EA 5IJ7E 2H6KA 4J84A 1U2VC 2UZXB 3BG0A 3DXKC 5JWZA 3IJ1A 5C2VB 5TF2A 2H9MA 4K3JB 2AGWA 4AEZA 4ERZA 2P9KC 4PBYA 1K8KC 2B5LA 3RRMC 2IUVA 3C9CA 5FA5B 4GZ8A 3BG1A 3L4MD 4CZYA 5K19A 2J56H 3EI4B 4TZ4A 3B7FA 4GQ1A 3SLED 3JRPA 4QRJA 5TEFA 3RSEC 4QL1A 1XHMA 2CO0A 3I2NA 2XYIA 3MKSB 4J73A 4O1QD 3IIYA 5THAA 1R5MA 5IGOA 4JSNC 1SQ9A 3EI1A 2GC7A 4OZUA 2AH0A 2XL3A 3AH8B 5FQDA 3ODTA 5EM2B 5FKQA 4X60B 5GSAA 3OKYB 4D6VA 2B5NA 5H1MA 4CY5A 3EWEA 4A08A 3VA6A 4QQEA 4E54B 2CE9A 3I7OA 2J57G 4A09A 4JT5C 4CC9A 2H13A 3KRXB 3UKUC 3OKTA 2PM6B 4X63B 2YNPA 3JZNA 1NR0A 1Q47A 3RN1D 4GGAA 4NSXA 4PXWA 4A2MA 2OK4A 3SFZA 1A0RB 4CY2A 5CYKA 2HESX 4L1QD 3PXWD 1JOFA 2P9IC 3RLMD 2PM7B 2H9PA 2IUPA 3EI3B 3UVKA 2H6NA 2I0SA 3I7KA 4FB1D 5AFU3 3SHFA 4A2LA 1GXRA 3JZGA 3IIWA 4GM3A 3RFGA 5EMLB 3RN0D 4FAND 3NVNA 2AGXA 4U1EI 4L3HD 3PVUB 2CN2A 3CIKB 2H47A 3EU7A 2BBKH 2YNNA 3JAMg 4JSXC 2AH1A 4XEIC 4J87A 2MTAH 5FKSA 4IA9A 3SMRA 4L9OA 5C2WB 3OKWA 4LG9A 4LG8A 5EMMB 3F3PA 5GXHA 1TYQC 3I89A 2O9KA 3OL2A 5IGQA 4CI2A 3C75H 4J81A 1P22A 5EAMA 4ZOZA 4FA9D 1VYHC 5IC7A 4O9DA 4JD2C 5CXBB 4J78A 4U7AA 1N6DA 2TRCB 2G99A 3JZHA 2PBIB 4J8BA 4ZOVA 2OIZA 5EALA 2P9PC 1GOTB 4L3GD 3ORVD 4GMBA 3NVQA 4JXMA 2IURA 3J81g 3I7NA 3N0EA 3JROA 2CN3A 3RMZD 3PE7A 4KFMB 3F3GA 3PXTD 5H14A 4FA5D 4GM9A 4GGCA 3NVXA 3IKOA 5HQGA 2OVQB 1PEVA 4O45A 5EM2A 3MZKA 3RFHA 4ESGA 4G56B 2IWFA 3PVWB 2W18A 5EAPA 2G9AA 1L0QA 5TEEA 4E5ZB 4ZOXA 2PM9B 2IAAA 4CY1A 5GMKn 4Y7RA 1JJUB 4A0AB 4UI9R 1SHYB 5I5JA 4CZVA 4J0XA 4A11B 4BH6A 3K27A 3CFVA 4PSXB 3F3FA 4EWRA 3MKQA 1SQJA 4J79A 4BUJC 3SN6B 4CI1A 3SBQA 5TDHB 3JB9L 3I7LA 2Q7QA 3EG6A 3P4FA 3UR4A 2UZYB 1PGUA 2Z2PA 3AL9A 2BCJB 1ERJA 5HE3B 1MG3A 5FLXg 3UVMA 3AL8A 4Y5RD 3EMHA 5HE2B 3SJLD 3W15A 4A0BB 1XIPA 2AGLA 1K32A 3HFQA 4J0WA 4ERQA 5CXBA 3C99A 4ES0A 5C9ZB 3J80g 4QT8A 1GP2B 4PBZA 2YBAA 2GNQA 1OLZA 3VH0A 3ZWLB 4CI3A 2I0RA 2OK6A 2P9UC 2YMUA 5KDOB 1QNIA 5B4WA 3OL2B 3DM0A 4A0AA 2XU7A 4K3ID 2EBSA 3K26A 4H5IA 4A0BA 4CY3A 4OWRA 1B9YA 4Z8LA 5I5MA 5HE1B 2HXCA 3FRXA 2YB8B 3V7DB 5I5IA 3UKRC 2H9NA 4E5ZA 5GXIA 4GQ2P 3EI2A 1FWXA 2P9SC 3N0DA 2H68A 2HJ4A 3UVNA 3EI2B 3IJCA 4A11A 1S4UX 4J8GA 3GFCA 2B4EA 2CO0C 4PNKB 5SXMA 3OW8A 3EI1B 4IMMA 1YFQA 2IWKA 1PI6A 1NEXB 4N14A 4GQBB 2Z2NA 4FHLA 3PSCB 4J86A 5FKRA
chains in the Genus database with same CATH superfamily
2VZ1A 4I79A 3V4PA 4CI8A 3KRWB 3SWSD 3I7HA 2H3XA 1UOQA 3DSMA 3MMYA 3UVLA 4A7JA 5FKTA 4A08B 2J55H 3PSLA 3ULEC 1RI6A 3I8CA 3E0CA 1N6FA 2OVRB 4Z7NA 1QFMA 5M5RA 4AN0A 4ERYA 3JPXA 4ZOYA 1UTCA 3V9FA 4J82A 3IVMA 4A09B 3QI0A 2OJYA 3AL8B 3FM0A 2I3SA 4D0KA 1H2XA 3OTTA 2H14A 4BL0A 1U4CA 4BP8A 3O4GA 2VDNA 3MZLA 2CE8A 4H5JA 4O3UB 2I0TA 3C5MA 1PBYB 4ZN4A 4IRZA 3EI4A 2HKRA 4GGDA 4RE6A 5CXCB 3T3PA 5IT9g 2EIBA 3V5WB 2AGYA 5A2Qg 3U4YA 4MK0B 5CXCA 3EI3A 1O6FA 4YVDA 3V4VA 4DNWA 2H9LA 3GREA 2P9NC 5CYKB 2HJBA 3SBPA 5AMSA 4JT6C 1E8NA 5FFGA 3A0FA 3I7PA 4XYHA 5EMKB 4JSVC 2QR5A 3MUOA 3I8EA 4R7AB 5IJ8E 4HDJA 2H6QA 5EARA 4E54A 4CZXA 5M5UA 2VDOA 4PSWB 4RE5A 5HE0B 3FCUA 5HYNB 1OMWB 2B5MA 4FA4D 4JHNA 2IUQA 4DNUA 2AGZA 3SBRA 3IUQA 2QC5A 1B9XA 4X61B 4AMYA 1T2XA 1N6EA 2HU7A 2OVPB 4JSPC 4LGNA 3SVWD 3ZDZA 3CFSB 3EQ7A 3NIDA 2YNOA 2VDPA 4Z7OA 2XE4A 2Z2OA 1MG2A 3OKYA 2HYEA 2HKMA 3FCSA 4GM8A 2P9LC 1XKSA 5K1CC 2PM9A 5FXYA 2QXVA 5H17A 3IJ0A 2I3TA 3DWLC 5AJAA 3UVOA 3FGBA 1GG2B 1MDAH 1QFSA 3L4OD 1K3IA 3BWSA 3IULA 4FAVD 4XYIA 4FA1D 2AQ5A 4MMYA 1H2YA 3SCYA 3VGZA 3AFCA 4AOWA 4O3TB 1JMZB 1TBGA 2XL2A 2GC4A 2CNXA 4FWWA 3SXTD 4J77A 4PC0A 3DXMC 3VI4A 4AMZA 3PXSD 1JMXB 5EMJB 3MXXA 4X3EA 5IJ7E 2H6KA 4G55A 4J84A 1U2VC 2UZXB 3BG0A 3DXKC 5JWZA 2VDRA 3IJ1A 3ZE2A 5C2VB 1C9LA 5TF2A 2H9MA 2VZ3A 2VDKA 4WK4A 4K3JB 2AGWA 4AEZA 2EIDA 4ERZA 2BKLA 2P9KC 1K8KC 4PBYA 2B5LA 3RRMC 2IUVA 3C9CA 5FA5B 4GZ8A 3K72A 3BG1A 3L4MD 4CZYA 5K19A 2J56H 3EI4B 4TZ4A 3B7FA 4GQ1A 3SLED 3JRPA 4QRJA 5TEFA 3RSEC 4QL1A 1XHMA 2CO0A 3I2NA 2XYIA 3MKSB 4J73A 3IURA 4O1QD 3IIYA 3K71A 5THAA 1R5MA 5IGOA 4JSNC 1SQ9A 3EI1A 2GC7A 4OZUA 2AH0A 3ZE1A 3IUNA 4D9SA 1GOGA 2XL3A 3AH8B 5FQDA 3IJEA 3ODTA 5EM2B 5FKQA 4X60B 5GSAA 3OKYB 4D6VA 2B5NA 4JHPC 5H1MA 4CY5A 3EWEA 4A08A 2XDWA 3VA6A 4QQEA 4E54B 2CE9A 3I7OA 2J57G 4A09A 4JT5C 4CC9A 4NC4A 2HU8A 2WQ8A 2H13A 3KRXB 5E6SA 4MMXA 3UKUC 3OKTA 2PM6B 4X63B 2YNPA 3JZNA 1NR0A 1Q47A 3RN1D 4GGAA 4NSXA 2JKXA 5M5TA 4PXWA 3GD1I 4A2MA 1VE6A 2OK4A 3O4JA 3SFZA 1A0RB 2VDQA 4CY2A 4DNVA 5CYKA 2HESX 4L1QD 2VDLA 1E8MA 3PXWD 1JOFA 2P9IC 3RLMD 2PM7B 2H9PA 2IUPA 3EI3B 3UVKA 2H6NA 2I0SA 3I7KA 4FB1D 2XZGA 5AFU3 3IUJA 3SHFA 4A2LA 1BPOA 1GXRA 3JZGA 3IIWA 4GM3A 3RFGA 5EMLB 3RN0D 3IUMA 4FAND 3KCIA 3NVNA 2AGXA 1H2WA 1TYEA 4U1EI 4L3HD 3PVUB 1VE7A 2CN2A 3CIKB 2H47A 3EU7A 2BBKH 2YNNA 3JAMg 4JSXC 2AH1A 4XEIC 4J87A 2MTAH 5FKSA 4IA9A 3SMRA 4L9OA 4NBMA 5E6RA 2EICA 5C2WB 3OKWA 4BCCA 4LG9A 4LG8A 5E6UA 5EMMB 3F3PA 5GXHA 1TYQC 3I89A 2O9KA 1M1XA 3OL2A 5IGQA 5M5VA 4CI2A 3NIFA 3C75H 4G1EA 4WJKA 4J81A 1I2MB 1P22A 5EAMA 4ZOZA 1C9IA 4FA9D 3T3MA 3DDUA 1VYHC 5IC7A 4O9DA 4JD2C 5CXBB 4L1MA 4J78A 4U7AA 1N6DA 2TRCB 2G99A 4AX4A 3JZHA 2PBIB 4J8BA 4ZOVA 2OIZA 5EALA 2P9PC 1GOTB 4L3GD 3K6SA 3ORVD 3ZDXA 4GMBA 1GOFA 3NVQA 4JXMA 1VZ3A 2IURA 3J81g 3N0EA 3I7NA 3JROA 2CN3A 3RMZD 3PE7A 4KFMB 5M5SA 1YR2A 3F3GA 3PXTD 5H14A 2QZPA 4BP9A 4FA5D 4GM9A 4GGCA 3EQ9A 3NVXA 3IKOA 5HQGA 2OVQB 1PEVA 4O45A 5EM2A 3MZKA 3RFHA 4ESGA 4NENA 4WK0A 4G56B 4AN1A 2IWFA 4BCDA 3PVWB 2W18A 5EAPA 2G9AA 5M61A 1L0QA 5TEEA 4Z7QA 4E5ZB 4ZOXA 2PM9B 2IAAA 5FFOA 4CY1A 5GMKn 1E5TA 4Y7RA 1JJUB 4A0AB 4UI9R 1SHYB 3MVDK 5I5JA 4CZVA 4J0XA 4A11B 4BH6A 3MUNA 3K27A 3CFVA 3QHYB 4PSXB 3F3FA 4EWRA 3MKQA 1SQJA 4WK2A 4J79A 1L5GA 4BUJC 1JTDB 1VZ2A 3SN6B 4NAAA 4CI1A 3SBQA 5TDHB 3JB9L 3I7LA 2Q7QA 3EG6A 3P4FA 3UR4A 2UZYB 1PGUA 2Z2PA 3AL9A 2BCJB 1ERJA 5HE3B 1MG3A 5FLXg 3UVMA 2VDMA 1O6GA 3AL8A 4Y5RD 3ZDYA 3EMHA 5HE2B 3SJLD 3W15A 3OF7A 5C86A 4A0BB 1XIPA 1GOHA 2AGLA 1K32A 3HFQA 4J0WA 4ERQA 5CXBA 3C99A 1UOPA 4ES0A 5C9ZB 3J80g 4QT8A 1GP2B 4PBZA 2YBAA 2GNQA 1OLZA 3VH0A 3ZWLB 4CI3A 2I0RA 4O02A 2VC2A 2OK6A 2P9UC 2YMUA 5KDOB 1QNIA 5B4WA 4QAMA 3OL2B 3ZE0A 3DM0A 4A0AA 2XU7A 4K3ID 2EBSA 3K26A 3GC3B 4H5IA 3O4IA 4A0BA 3O4HA 2HU5A 4CY3A 4OWRA 1H2ZA 4G1MA 2EIEA 1B9YA 4Z8LA 5I5MA 5HE1B 5C92A 2HXCA 3FRXA 2YB8B 3V7DB 5I5IA 3UKRC 2H9NA 4MMZA 4BCBA 4E5ZA 5GXIA 4GQ2P 3EI2A 3VI3A 1FWXA 1JV2A 3N0DA 1U8CA 2P9SC 2H68A 2HJ4A 3UVNA 4UM9A 3EI2B 3IJCA 1A12A 4A11A 1S4UX 4J8GA 1UOOA 3GFCA 2B4EA 2CO0C 5HDBA 4PNKB 5SXMA 3OW8A 3NIGA 4O2WA 3EI1B 4IMMA 1YFQA 2IWKA 3EQ8A 4UM8A 1PI6A 1NEXB 4N14A 4GQBB 2Z2NA 4FHLA 3PSCB 4J86A 5FKRA
chains in the Genus database with same CATH topology
4I79A 4CI8A 3KRWB 3SWSD 3I7HA 2H3XA 3DSMA 3MMYA 3UVLA 4A7JA 5FKTA 4A08B 2J55H 3PSLA 3ULEC 1RI6A 3I8CA 3E0CA 1N6FA 2OVRB 4ERYA 3JPXA 4ZOYA 3V9FA 4J82A 4A09B 2OJYA 3AL8B 3FM0A 2I3SA 4D0KA 3OTTA 2H14A 4BL0A 1U4CA 4H5JA 3MZLA 2CE8A 4O3UB 2I0TA 3C5MA 1PBYB 4ZN4A 3EI4A 2HKRA 4GGDA 5IT9g 5CXCB 3V5WB 2AGYA 5A2Qg 3U4YA 4MK0B 5CXCA 3EI3A 4YVDA 2H9LA 3GREA 5CYKB 2P9NC 2HJBA 3SBPA 5AMSA 4JT6C 3A0FA 3I7PA 4XYHA 5EMKB 4JSVC 3I8EA 4R7AB 5IJ8E 4HDJA 2H6QA 5EARA 4E54A 4CZXA 4PSWB 5HE0B 5HYNB 1OMWB 2B5MA 4FA4D 2IUQA 2AGZA 3SBRA 2QC5A 1B9XA 4X61B 1N6EA 2OVPB 4JSPC 4LGNA 3SVWD 3CFSB 2YNOA 2Z2OA 1MG2A 3OKYA 2HYEA 2HKMA 4GM8A 2P9LC 1XKSA 5K1CC 2PM9A 5FXYA 2QXVA 5H17A 3IJ0A 2I3TA 3DWLC 5AJAA 3UVOA 3FGBA 1GG2B 1MDAH 3L4OD 3BWSA 4FAVD 4XYIA 4FA1D 2AQ5A 3SCYA 3VGZA 3AFCA 4AOWA 4O3TB 1JMZB 1TBGA 2XL2A 2GC4A 2CNXA 4FWWA 3SXTD 4J77A 4PC0A 3DXMC 1JMXB 3PXSD 5EMJB 3MXXA 4X3EA 5IJ7E 2H6KA 4J84A 1U2VC 2UZXB 3BG0A 3DXKC 5JWZA 3IJ1A 5C2VB 5TF2A 2H9MA 4K3JB 2AGWA 4AEZA 4ERZA 2P9KC 4PBYA 1K8KC 2B5LA 3RRMC 2IUVA 3C9CA 5FA5B 4GZ8A 3BG1A 3L4MD 4CZYA 5K19A 2J56H 3EI4B 4TZ4A 3B7FA 4GQ1A 3SLED 3JRPA 4QRJA 5TEFA 3RSEC 4QL1A 1XHMA 2CO0A 3I2NA 2XYIA 3MKSB 4J73A 4O1QD 3IIYA 5THAA 1R5MA 5IGOA 4JSNC 1SQ9A 3EI1A 2GC7A 4OZUA 2AH0A 2XL3A 3AH8B 5FQDA 3ODTA 5EM2B 5FKQA 4X60B 5GSAA 3OKYB 4D6VA 2B5NA 5H1MA 4CY5A 3EWEA 4A08A 3VA6A 4QQEA 4E54B 2CE9A 3I7OA 2J57G 4A09A 4JT5C 4CC9A 2H13A 3KRXB 3UKUC 3OKTA 2PM6B 4X63B 2YNPA 3JZNA 1NR0A 1Q47A 3RN1D 4GGAA 4NSXA 4PXWA 4A2MA 2OK4A 3SFZA 1A0RB 4CY2A 5CYKA 2HESX 4L1QD 3PXWD 1JOFA 2P9IC 3RLMD 2PM7B 2H9PA 2IUPA 3EI3B 3UVKA 2H6NA 2I0SA 3I7KA 4FB1D 5AFU3 3SHFA 4A2LA 1GXRA 3JZGA 3IIWA 4GM3A 3RFGA 5EMLB 3RN0D 4FAND 3NVNA 2AGXA 4U1EI 4L3HD 3PVUB 2CN2A 3CIKB 2H47A 3EU7A 2BBKH 2YNNA 3JAMg 4JSXC 2AH1A 4XEIC 4J87A 2MTAH 5FKSA 4IA9A 3SMRA 4L9OA 5C2WB 3OKWA 4LG9A 4LG8A 5EMMB 3F3PA 5GXHA 1TYQC 3I89A 2O9KA 3OL2A 5IGQA 4CI2A 3C75H 4J81A 1P22A 5EAMA 4ZOZA 4FA9D 1VYHC 5IC7A 4O9DA 4JD2C 5CXBB 4J78A 4U7AA 1N6DA 2TRCB 2G99A 3JZHA 2PBIB 4J8BA 4ZOVA 2OIZA 5EALA 2P9PC 1GOTB 4L3GD 3ORVD 4GMBA 3NVQA 4JXMA 2IURA 3J81g 3I7NA 3N0EA 3JROA 2CN3A 3RMZD 3PE7A 4KFMB 3F3GA 3PXTD 5H14A 4FA5D 4GM9A 4GGCA 3NVXA 3IKOA 5HQGA 2OVQB 1PEVA 4O45A 5EM2A 3MZKA 3RFHA 4ESGA 4G56B 2IWFA 3PVWB 2W18A 5EAPA 2G9AA 1L0QA 5TEEA 4E5ZB 4ZOXA 2PM9B 2IAAA 4CY1A 5GMKn 4Y7RA 1JJUB 4A0AB 4UI9R 1SHYB 5I5JA 4CZVA 4J0XA 4A11B 4BH6A 3K27A 3CFVA 4PSXB 3F3FA 4EWRA 3MKQA 1SQJA 4J79A 4BUJC 3SN6B 4CI1A 3SBQA 5TDHB 3JB9L 3I7LA 2Q7QA 3EG6A 3P4FA 3UR4A 2UZYB 1PGUA 2Z2PA 3AL9A 2BCJB 1ERJA 5HE3B 1MG3A 5FLXg 3UVMA 3AL8A 4Y5RD 3EMHA 5HE2B 3SJLD 3W15A 4A0BB 1XIPA 2AGLA 1K32A 3HFQA 4J0WA 4ERQA 5CXBA 3C99A 4ES0A 5C9ZB 3J80g 4QT8A 1GP2B 4PBZA 2YBAA 2GNQA 1OLZA 3VH0A 3ZWLB 4CI3A 2I0RA 2OK6A 2P9UC 2YMUA 5KDOB 1QNIA 5B4WA 3OL2B 3DM0A 4A0AA 2XU7A 4K3ID 2EBSA 3K26A 4H5IA 4A0BA 4CY3A 4OWRA 1B9YA 4Z8LA 5I5MA 5HE1B 2HXCA 3FRXA 2YB8B 3V7DB 5I5IA 3UKRC 2H9NA 4E5ZA 5GXIA 4GQ2P 3EI2A 1FWXA 2P9SC 3N0DA 2H68A 2HJ4A 3UVNA 3EI2B 3IJCA 4A11A 1S4UX 4J8GA 3GFCA 2B4EA 2CO0C 4PNKB 5SXMA 3OW8A 3EI1B 4IMMA 1YFQA 2IWKA 1PI6A 1NEXB 4N14A 4GQBB 2Z2NA 4FHLA 3PSCB 4J86A 5FKRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I79 A;  4CI8 A;  3KRW B;  3SWS D;  3I7H A;  2H3X A;  3DSM A;  3MMY A;  3UVL A;  4A7J A;  5FKT A;  4A08 B;  2J55 H;  3PSL A;  3ULE C;  1RI6 A;  3I8C A;  3E0C A;  1N6F A;  2OVR B;  4ERY A;  3JPX A;  4ZOY A;  3V9F A;  4J82 A;  4A09 B;  2OJY A;  3AL8 B;  3FM0 A;  2I3S A;  4D0K A;  3OTT A;  2H14 A;  4BL0 A;  1U4C A;  4H5J A;  3MZL A;  2CE8 A;  4O3U B;  2I0T A;  3C5M A;  1PBY B;  4ZN4 A;  3EI4 A;  2HKR A;  4GGD A;  5IT9 g;  5CXC B;  3V5W B;  2AGY A;  5A2Q g;  3U4Y A;  4MK0 B;  5CXC A;  3EI3 A;  4YVD A;  2H9L A;  3GRE A;  5CYK B;  2P9N C;  2HJB A;  3SBP A;  5AMS A;  4JT6 C;  3A0F A;  3I7P A;  4XYH A;  5EMK B;  4JSV C;  3I8E A;  4R7A B;  5IJ8 E;  4HDJ A;  2H6Q A;  5EAR A;  4E54 A;  4CZX A;  4PSW B;  5HE0 B;  5HYN B;  1OMW B;  2B5M A;  4FA4 D;  2IUQ A;  2AGZ A;  3SBR A;  2QC5 A;  1B9X A;  4X61 B;  1N6E A;  2OVP B;  4JSP C;  4LGN A;  3SVW D;  3CFS B;  2YNO A;  2Z2O A;  1MG2 A;  3OKY A;  2HYE A;  2HKM A;  4GM8 A;  2P9L C;  1XKS A;  5K1C C;  2PM9 A;  5FXY A;  2QXV A;  5H17 A;  3IJ0 A;  2I3T A;  3DWL C;  5AJA A;  3UVO A;  3FGB A;  1GG2 B;  1MDA H;  3L4O D;  3BWS A;  4FAV D;  4XYI A;  4FA1 D;  2AQ5 A;  3SCY A;  3VGZ A;  3AFC A;  4AOW A;  4O3T B;  1JMZ B;  1TBG A;  2XL2 A;  2GC4 A;  2CNX A;  4FWW A;  3SXT D;  4J77 A;  4PC0 A;  3DXM C;  1JMX B;  3PXS D;  5EMJ B;  3MXX A;  4X3E A;  5IJ7 E;  2H6K A;  4J84 A;  1U2V C;  2UZX B;  3BG0 A;  3DXK C;  5JWZ A;  3IJ1 A;  5C2V B;  5TF2 A;  2H9M A;  4K3J B;  2AGW A;  4AEZ A;  4ERZ A;  2P9K C;  4PBY A;  1K8K C;  2B5L A;  3RRM C;  2IUV A;  3C9C A;  5FA5 B;  4GZ8 A;  3BG1 A;  3L4M D;  4CZY A;  5K19 A;  2J56 H;  3EI4 B;  4TZ4 A;  3B7F A;  4GQ1 A;  3SLE D;  3JRP A;  4QRJ A;  5TEF A;  3RSE C;  4QL1 A;  1XHM A;  2CO0 A;  3I2N A;  2XYI A;  3MKS B;  4J73 A;  4O1Q D;  3IIY A;  5THA A;  1R5M A;  5IGO A;  4JSN C;  1SQ9 A;  3EI1 A;  2GC7 A;  4OZU A;  2AH0 A;  2XL3 A;  3AH8 B;  5FQD A;  3ODT A;  5EM2 B;  5FKQ A;  4X60 B;  5GSA A;  3OKY B;  4D6V A;  2B5N A;  5H1M A;  4CY5 A;  3EWE A;  4A08 A;  3VA6 A;  4QQE A;  4E54 B;  2CE9 A;  3I7O A;  2J57 G;  4A09 A;  4JT5 C;  4CC9 A;  2H13 A;  3KRX B;  3UKU C;  3OKT A;  2PM6 B;  4X63 B;  2YNP A;  3JZN A;  1NR0 A;  1Q47 A;  3RN1 D;  4GGA A;  4NSX A;  4PXW A;  4A2M A;  2OK4 A;  3SFZ A;  1A0R B;  4CY2 A;  5CYK A;  2HES X;  4L1Q D;  3PXW D;  1JOF A;  2P9I C;  3RLM D;  2PM7 B;  2H9P A;  2IUP A;  3EI3 B;  3UVK A;  2H6N A;  2I0S A;  3I7K A;  4FB1 D;  5AFU 3;  3SHF A;  4A2L A;  1GXR A;  3JZG A;  3IIW A;  4GM3 A;  3RFG A;  5EML B;  3RN0 D;  4FAN D;  3NVN A;  2AGX A;  4U1E I;  4L3H D;  3PVU B;  2CN2 A;  3CIK B;  2H47 A;  3EU7 A;  2BBK H;  2YNN A;  3JAM g;  4JSX C;  2AH1 A;  4XEI C;  4J87 A;  2MTA H;  5FKS A;  4IA9 A;  3SMR A;  4L9O A;  5C2W B;  3OKW A;  4LG9 A;  4LG8 A;  5EMM B;  3F3P A;  5GXH A;  1TYQ C;  3I89 A;  2O9K A;  3OL2 A;  5IGQ A;  4CI2 A;  3C75 H;  4J81 A;  1P22 A;  5EAM A;  4ZOZ A;  4FA9 D;  1VYH C;  5IC7 A;  4O9D A;  4JD2 C;  5CXB B;  4J78 A;  4U7A A;  1N6D A;  2TRC B;  2G99 A;  3JZH A;  2PBI B;  4J8B A;  4ZOV A;  2OIZ A;  5EAL A;  2P9P C;  1GOT B;  4L3G D;  3ORV D;  4GMB A;  3NVQ A;  4JXM A;  2IUR A;  3J81 g;  3I7N A;  3N0E A;  3JRO A;  2CN3 A;  3RMZ D;  3PE7 A;  4KFM B;  3F3G A;  3PXT D;  5H14 A;  4FA5 D;  4GM9 A;  4GGC A;  3NVX A;  3IKO A;  5HQG A;  2OVQ B;  1PEV A;  4O45 A;  5EM2 A;  3MZK A;  3RFH A;  4ESG A;  4G56 B;  2IWF A;  3PVW B;  2W18 A;  5EAP A;  2G9A A;  1L0Q A;  5TEE A;  4E5Z B;  4ZOX A;  2PM9 B;  2IAA A;  4CY1 A;  5GMK n;  4Y7R A;  1JJU B;  4A0A B;  4UI9 R;  1SHY B;  5I5J A;  4CZV A;  4J0X A;  4A11 B;  4BH6 A;  3K27 A;  3CFV A;  4PSX B;  3F3F A;  4EWR A;  3MKQ A;  1SQJ A;  4J79 A;  4BUJ C;  3SN6 B;  4CI1 A;  3SBQ A;  5TDH B;  3JB9 L;  3I7L A;  2Q7Q A;  3EG6 A;  3P4F A;  3UR4 A;  2UZY B;  1PGU A;  2Z2P A;  3AL9 A;  2BCJ B;  1ERJ A;  5HE3 B;  1MG3 A;  5FLX g;  3UVM A;  3AL8 A;  4Y5R D;  3EMH A;  5HE2 B;  3SJL D;  3W15 A;  4A0B B;  1XIP A;  2AGL A;  1K32 A;  3HFQ A;  4J0W A;  4ERQ A;  5CXB A;  3C99 A;  4ES0 A;  5C9Z B;  3J80 g;  4QT8 A;  1GP2 B;  4PBZ A;  2YBA A;  2GNQ A;  1OLZ A;  3VH0 A;  3ZWL B;  4CI3 A;  2I0R A;  2OK6 A;  2P9U C;  2YMU A;  5KDO B;  1QNI A;  5B4W A;  3OL2 B;  3DM0 A;  4A0A A;  2XU7 A;  4K3I D;  2EBS A;  3K26 A;  4H5I A;  4A0B A;  4CY3 A;  4OWR A;  1B9Y A;  4Z8L A;  5I5M A;  5HE1 B;  2HXC A;  3FRX A;  2YB8 B;  3V7D B;  5I5I A;  3UKR C;  2H9N A;  4E5Z A;  5GXI A;  4GQ2 P;  3EI2 A;  1FWX A;  2P9S C;  3N0D A;  2H68 A;  2HJ4 A;  3UVN A;  3EI2 B;  3IJC A;  4A11 A;  1S4U X;  4J8G A;  3GFC A;  2B4E A;  2CO0 C;  4PNK B;  5SXM A;  3OW8 A;  3EI1 B;  4IMM A;  1YFQ A;  2IWK A;  1PI6 A;  1NEX B;  4N14 A;  4GQB B;  2Z2N A;  4FHL A;  3PSC B;  4J86 A;  5FKR A; 
#chains in the Genus database with same CATH topology
 2VZ1 A;  4I79 A;  3V4P A;  4CI8 A;  3KRW B;  3SWS D;  3I7H A;  2H3X A;  1UOQ A;  3DSM A;  3MMY A;  3UVL A;  4A7J A;  5FKT A;  4A08 B;  2J55 H;  3PSL A;  3ULE C;  1RI6 A;  3I8C A;  3E0C A;  1N6F A;  2OVR B;  4Z7N A;  1QFM A;  5M5R A;  4AN0 A;  4ERY A;  3JPX A;  4ZOY A;  1UTC A;  3V9F A;  4J82 A;  3IVM A;  4A09 B;  3QI0 A;  2OJY A;  3AL8 B;  3FM0 A;  2I3S A;  4D0K A;  1H2X A;  3OTT A;  2H14 A;  4BL0 A;  1U4C A;  4BP8 A;  3O4G A;  2VDN A;  3MZL A;  2CE8 A;  4H5J A;  4O3U B;  2I0T A;  3C5M A;  1PBY B;  4ZN4 A;  4IRZ A;  3EI4 A;  2HKR A;  4GGD A;  4RE6 A;  5CXC B;  3T3P A;  5IT9 g;  2EIB A;  3V5W B;  2AGY A;  5A2Q g;  3U4Y A;  4MK0 B;  5CXC A;  3EI3 A;  1O6F A;  4YVD A;  3V4V A;  4DNW A;  2H9L A;  3GRE A;  2P9N C;  5CYK B;  2HJB A;  3SBP A;  5AMS A;  4JT6 C;  1E8N A;  5FFG A;  3A0F A;  3I7P A;  4XYH A;  5EMK B;  4JSV C;  2QR5 A;  3MUO A;  3I8E A;  4R7A B;  5IJ8 E;  4HDJ A;  2H6Q A;  5EAR A;  4E54 A;  4CZX A;  5M5U A;  2VDO A;  4PSW B;  4RE5 A;  5HE0 B;  3FCU A;  5HYN B;  1OMW B;  2B5M A;  4FA4 D;  4JHN A;  2IUQ A;  4DNU A;  2AGZ A;  3SBR A;  3IUQ A;  2QC5 A;  1B9X A;  4X61 B;  4AMY A;  1T2X A;  1N6E A;  2HU7 A;  2OVP B;  4JSP C;  4LGN A;  3SVW D;  3ZDZ A;  3CFS B;  3EQ7 A;  3NID A;  2YNO A;  2VDP A;  4Z7O A;  2XE4 A;  2Z2O A;  1MG2 A;  3OKY A;  2HYE A;  2HKM A;  3FCS A;  4GM8 A;  2P9L C;  1XKS A;  5K1C C;  2PM9 A;  5FXY A;  2QXV A;  5H17 A;  3IJ0 A;  2I3T A;  3DWL C;  5AJA A;  3UVO A;  3FGB A;  1GG2 B;  1MDA H;  1QFS A;  3L4O D;  1K3I A;  3BWS A;  3IUL A;  4FAV D;  4XYI A;  4FA1 D;  2AQ5 A;  4MMY A;  1H2Y A;  3SCY A;  3VGZ A;  3AFC A;  4AOW A;  4O3T B;  1JMZ B;  1TBG A;  2XL2 A;  2GC4 A;  2CNX A;  4FWW A;  3SXT D;  4J77 A;  4PC0 A;  3DXM C;  3VI4 A;  4AMZ A;  3PXS D;  1JMX B;  5EMJ B;  3MXX A;  4X3E A;  5IJ7 E;  2H6K A;  4G55 A;  4J84 A;  1U2V C;  2UZX B;  3BG0 A;  3DXK C;  5JWZ A;  2VDR A;  3IJ1 A;  3ZE2 A;  5C2V B;  1C9L A;  5TF2 A;  2H9M A;  2VZ3 A;  2VDK A;  4WK4 A;  4K3J B;  2AGW A;  4AEZ A;  2EID A;  4ERZ A;  2BKL A;  2P9K C;  1K8K C;  4PBY A;  2B5L A;  3RRM C;  2IUV A;  3C9C A;  5FA5 B;  4GZ8 A;  3K72 A;  3BG1 A;  3L4M D;  4CZY A;  5K19 A;  2J56 H;  3EI4 B;  4TZ4 A;  3B7F A;  4GQ1 A;  3SLE D;  3JRP A;  4QRJ A;  5TEF A;  3RSE C;  4QL1 A;  1XHM A;  2CO0 A;  3I2N A;  2XYI A;  3MKS B;  4J73 A;  3IUR A;  4O1Q D;  3IIY A;  3K71 A;  5THA A;  1R5M A;  5IGO A;  4JSN C;  1SQ9 A;  3EI1 A;  2GC7 A;  4OZU A;  2AH0 A;  3ZE1 A;  3IUN A;  4D9S A;  1GOG A;  2XL3 A;  3AH8 B;  5FQD A;  3IJE A;  3ODT A;  5EM2 B;  5FKQ A;  4X60 B;  5GSA A;  3OKY B;  4D6V A;  2B5N A;  4JHP C;  5H1M A;  4CY5 A;  3EWE A;  4A08 A;  2XDW A;  3VA6 A;  4QQE A;  4E54 B;  2CE9 A;  3I7O A;  2J57 G;  4A09 A;  4JT5 C;  4CC9 A;  4NC4 A;  2HU8 A;  2WQ8 A;  2H13 A;  3KRX B;  5E6S A;  4MMX A;  3UKU C;  3OKT A;  2PM6 B;  4X63 B;  2YNP A;  3JZN A;  1NR0 A;  1Q47 A;  3RN1 D;  4GGA A;  4NSX A;  2JKX A;  5M5T A;  4PXW A;  3GD1 I;  4A2M A;  1VE6 A;  2OK4 A;  3O4J A;  3SFZ A;  1A0R B;  2VDQ A;  4CY2 A;  4DNV A;  5CYK A;  2HES X;  4L1Q D;  2VDL A;  1E8M A;  3PXW D;  1JOF A;  2P9I C;  3RLM D;  2PM7 B;  2H9P A;  2IUP A;  3EI3 B;  3UVK A;  2H6N A;  2I0S A;  3I7K A;  4FB1 D;  2XZG A;  5AFU 3;  3IUJ A;  3SHF A;  4A2L A;  1BPO A;  1GXR A;  3JZG A;  3IIW A;  4GM3 A;  3RFG A;  5EML B;  3RN0 D;  3IUM A;  4FAN D;  3KCI A;  3NVN A;  2AGX A;  1H2W A;  1TYE A;  4U1E I;  4L3H D;  3PVU B;  1VE7 A;  2CN2 A;  3CIK B;  2H47 A;  3EU7 A;  2BBK H;  2YNN A;  3JAM g;  4JSX C;  2AH1 A;  4XEI C;  4J87 A;  2MTA H;  5FKS A;  4IA9 A;  3SMR A;  4L9O A;  4NBM A;  5E6R A;  2EIC A;  5C2W B;  3OKW A;  4BCC A;  4LG9 A;  4LG8 A;  5E6U A;  5EMM B;  3F3P A;  5GXH A;  1TYQ C;  3I89 A;  2O9K A;  1M1X A;  3OL2 A;  5IGQ A;  5M5V A;  4CI2 A;  3NIF A;  3C75 H;  4G1E A;  4WJK A;  4J81 A;  1I2M B;  1P22 A;  5EAM A;  4ZOZ A;  1C9I A;  4FA9 D;  3T3M A;  3DDU A;  1VYH C;  5IC7 A;  4O9D A;  4JD2 C;  5CXB B;  4L1M A;  4J78 A;  4U7A A;  1N6D A;  2TRC B;  2G99 A;  4AX4 A;  3JZH A;  2PBI B;  4J8B A;  4ZOV A;  2OIZ A;  5EAL A;  2P9P C;  1GOT B;  4L3G D;  3K6S A;  3ORV D;  3ZDX A;  4GMB A;  1GOF A;  3NVQ A;  4JXM A;  1VZ3 A;  2IUR A;  3J81 g;  3N0E A;  3I7N A;  3JRO A;  2CN3 A;  3RMZ D;  3PE7 A;  4KFM B;  5M5S A;  1YR2 A;  3F3G A;  3PXT D;  5H14 A;  2QZP A;  4BP9 A;  4FA5 D;  4GM9 A;  4GGC A;  3EQ9 A;  3NVX A;  3IKO A;  5HQG A;  2OVQ B;  1PEV A;  4O45 A;  5EM2 A;  3MZK A;  3RFH A;  4ESG A;  4NEN A;  4WK0 A;  4G56 B;  4AN1 A;  2IWF A;  4BCD A;  3PVW B;  2W18 A;  5EAP A;  2G9A A;  5M61 A;  1L0Q A;  5TEE A;  4Z7Q A;  4E5Z B;  4ZOX A;  2PM9 B;  2IAA A;  5FFO A;  4CY1 A;  5GMK n;  1E5T A;  4Y7R A;  1JJU B;  4A0A B;  4UI9 R;  1SHY B;  3MVD K;  5I5J A;  4CZV A;  4J0X A;  4A11 B;  4BH6 A;  3MUN A;  3K27 A;  3CFV A;  3QHY B;  4PSX B;  3F3F A;  4EWR A;  3MKQ A;  1SQJ A;  4WK2 A;  4J79 A;  1L5G A;  4BUJ C;  1JTD B;  1VZ2 A;  3SN6 B;  4NAA A;  4CI1 A;  3SBQ A;  5TDH B;  3JB9 L;  3I7L A;  2Q7Q A;  3EG6 A;  3P4F A;  3UR4 A;  2UZY B;  1PGU A;  2Z2P A;  3AL9 A;  2BCJ B;  1ERJ A;  5HE3 B;  1MG3 A;  5FLX g;  3UVM A;  2VDM A;  1O6G A;  3AL8 A;  4Y5R D;  3ZDY A;  3EMH A;  5HE2 B;  3SJL D;  3W15 A;  3OF7 A;  5C86 A;  4A0B B;  1XIP A;  1GOH A;  2AGL A;  1K32 A;  3HFQ A;  4J0W A;  4ERQ A;  5CXB A;  3C99 A;  1UOP A;  4ES0 A;  5C9Z B;  3J80 g;  4QT8 A;  1GP2 B;  4PBZ A;  2YBA A;  2GNQ A;  1OLZ A;  3VH0 A;  3ZWL B;  4CI3 A;  2I0R A;  4O02 A;  2VC2 A;  2OK6 A;  2P9U C;  2YMU A;  5KDO B;  1QNI A;  5B4W A;  4QAM A;  3OL2 B;  3ZE0 A;  3DM0 A;  4A0A A;  2XU7 A;  4K3I D;  2EBS A;  3K26 A;  3GC3 B;  4H5I A;  3O4I A;  4A0B A;  3O4H A;  2HU5 A;  4CY3 A;  4OWR A;  1H2Z A;  4G1M A;  2EIE A;  1B9Y A;  4Z8L A;  5I5M A;  5HE1 B;  5C92 A;  2HXC A;  3FRX A;  2YB8 B;  3V7D B;  5I5I A;  3UKR C;  2H9N A;  4MMZ A;  4BCB A;  4E5Z A;  5GXI A;  4GQ2 P;  3EI2 A;  3VI3 A;  1FWX A;  1JV2 A;  3N0D A;  1U8C A;  2P9S C;  2H68 A;  2HJ4 A;  3UVN A;  4UM9 A;  3EI2 B;  3IJC A;  1A12 A;  4A11 A;  1S4U X;  4J8G A;  1UOO A;  3GFC A;  2B4E A;  2CO0 C;  5HDB A;  4PNK B;  5SXM A;  3OW8 A;  3NIG A;  4O2W A;  3EI1 B;  4IMM A;  1YFQ A;  2IWK A;  3EQ8 A;  4UM8 A;  1PI6 A;  1NEX B;  4N14 A;  4GQB B;  2Z2N A;  4FHL A;  3PSC B;  4J86 A;  5FKR A; 
#chains in the Genus database with same CATH homology
 4I79 A;  4CI8 A;  3KRW B;  3SWS D;  3I7H A;  2H3X A;  3DSM A;  3MMY A;  3UVL A;  4A7J A;  5FKT A;  4A08 B;  2J55 H;  3PSL A;  3ULE C;  1RI6 A;  3I8C A;  3E0C A;  1N6F A;  2OVR B;  4ERY A;  3JPX A;  4ZOY A;  3V9F A;  4J82 A;  4A09 B;  2OJY A;  3AL8 B;  3FM0 A;  2I3S A;  4D0K A;  3OTT A;  2H14 A;  4BL0 A;  1U4C A;  4H5J A;  3MZL A;  2CE8 A;  4O3U B;  2I0T A;  3C5M A;  1PBY B;  4ZN4 A;  3EI4 A;  2HKR A;  4GGD A;  5IT9 g;  5CXC B;  3V5W B;  2AGY A;  5A2Q g;  3U4Y A;  4MK0 B;  5CXC A;  3EI3 A;  4YVD A;  2H9L A;  3GRE A;  5CYK B;  2P9N C;  2HJB A;  3SBP A;  5AMS A;  4JT6 C;  3A0F A;  3I7P A;  4XYH A;  5EMK B;  4JSV C;  3I8E A;  4R7A B;  5IJ8 E;  4HDJ A;  2H6Q A;  5EAR A;  4E54 A;  4CZX A;  4PSW B;  5HE0 B;  5HYN B;  1OMW B;  2B5M A;  4FA4 D;  2IUQ A;  2AGZ A;  3SBR A;  2QC5 A;  1B9X A;  4X61 B;  1N6E A;  2OVP B;  4JSP C;  4LGN A;  3SVW D;  3CFS B;  2YNO A;  2Z2O A;  1MG2 A;  3OKY A;  2HYE A;  2HKM A;  4GM8 A;  2P9L C;  1XKS A;  5K1C C;  2PM9 A;  5FXY A;  2QXV A;  5H17 A;  3IJ0 A;  2I3T A;  3DWL C;  5AJA A;  3UVO A;  3FGB A;  1GG2 B;  1MDA H;  3L4O D;  3BWS A;  4FAV D;  4XYI A;  4FA1 D;  2AQ5 A;  3SCY A;  3VGZ A;  3AFC A;  4AOW A;  4O3T B;  1JMZ B;  1TBG A;  2XL2 A;  2GC4 A;  2CNX A;  4FWW A;  3SXT D;  4J77 A;  4PC0 A;  3DXM C;  1JMX B;  3PXS D;  5EMJ B;  3MXX A;  4X3E A;  5IJ7 E;  2H6K A;  4J84 A;  1U2V C;  2UZX B;  3BG0 A;  3DXK C;  5JWZ A;  3IJ1 A;  5C2V B;  5TF2 A;  2H9M A;  4K3J B;  2AGW A;  4AEZ A;  4ERZ A;  2P9K C;  4PBY A;  1K8K C;  2B5L A;  3RRM C;  2IUV A;  3C9C A;  5FA5 B;  4GZ8 A;  3BG1 A;  3L4M D;  4CZY A;  5K19 A;  2J56 H;  3EI4 B;  4TZ4 A;  3B7F A;  4GQ1 A;  3SLE D;  3JRP A;  4QRJ A;  5TEF A;  3RSE C;  4QL1 A;  1XHM A;  2CO0 A;  3I2N A;  2XYI A;  3MKS B;  4J73 A;  4O1Q D;  3IIY A;  5THA A;  1R5M A;  5IGO A;  4JSN C;  1SQ9 A;  3EI1 A;  2GC7 A;  4OZU A;  2AH0 A;  2XL3 A;  3AH8 B;  5FQD A;  3ODT A;  5EM2 B;  5FKQ A;  4X60 B;  5GSA A;  3OKY B;  4D6V A;  2B5N A;  5H1M A;  4CY5 A;  3EWE A;  4A08 A;  3VA6 A;  4QQE A;  4E54 B;  2CE9 A;  3I7O A;  2J57 G;  4A09 A;  4JT5 C;  4CC9 A;  2H13 A;  3KRX B;  3UKU C;  3OKT A;  2PM6 B;  4X63 B;  2YNP A;  3JZN A;  1NR0 A;  1Q47 A;  3RN1 D;  4GGA A;  4NSX A;  4PXW A;  4A2M A;  2OK4 A;  3SFZ A;  1A0R B;  4CY2 A;  5CYK A;  2HES X;  4L1Q D;  3PXW D;  1JOF A;  2P9I C;  3RLM D;  2PM7 B;  2H9P A;  2IUP A;  3EI3 B;  3UVK A;  2H6N A;  2I0S A;  3I7K A;  4FB1 D;  5AFU 3;  3SHF A;  4A2L A;  1GXR A;  3JZG A;  3IIW A;  4GM3 A;  3RFG A;  5EML B;  3RN0 D;  4FAN D;  3NVN A;  2AGX A;  4U1E I;  4L3H D;  3PVU B;  2CN2 A;  3CIK B;  2H47 A;  3EU7 A;  2BBK H;  2YNN A;  3JAM g;  4JSX C;  2AH1 A;  4XEI C;  4J87 A;  2MTA H;  5FKS A;  4IA9 A;  3SMR A;  4L9O A;  5C2W B;  3OKW A;  4LG9 A;  4LG8 A;  5EMM B;  3F3P A;  5GXH A;  1TYQ C;  3I89 A;  2O9K A;  3OL2 A;  5IGQ A;  4CI2 A;  3C75 H;  4J81 A;  1P22 A;  5EAM A;  4ZOZ A;  4FA9 D;  1VYH C;  5IC7 A;  4O9D A;  4JD2 C;  5CXB B;  4J78 A;  4U7A A;  1N6D A;  2TRC B;  2G99 A;  3JZH A;  2PBI B;  4J8B A;  4ZOV A;  2OIZ A;  5EAL A;  2P9P C;  1GOT B;  4L3G D;  3ORV D;  4GMB A;  3NVQ A;  4JXM A;  2IUR A;  3J81 g;  3I7N A;  3N0E A;  3JRO A;  2CN3 A;  3RMZ D;  3PE7 A;  4KFM B;  3F3G A;  3PXT D;  5H14 A;  4FA5 D;  4GM9 A;  4GGC A;  3NVX A;  3IKO A;  5HQG A;  2OVQ B;  1PEV A;  4O45 A;  5EM2 A;  3MZK A;  3RFH A;  4ESG A;  4G56 B;  2IWF A;  3PVW B;  2W18 A;  5EAP A;  2G9A A;  1L0Q A;  5TEE A;  4E5Z B;  4ZOX A;  2PM9 B;  2IAA A;  4CY1 A;  5GMK n;  4Y7R A;  1JJU B;  4A0A B;  4UI9 R;  1SHY B;  5I5J A;  4CZV A;  4J0X A;  4A11 B;  4BH6 A;  3K27 A;  3CFV A;  4PSX B;  3F3F A;  4EWR A;  3MKQ A;  1SQJ A;  4J79 A;  4BUJ C;  3SN6 B;  4CI1 A;  3SBQ A;  5TDH B;  3JB9 L;  3I7L A;  2Q7Q A;  3EG6 A;  3P4F A;  3UR4 A;  2UZY B;  1PGU A;  2Z2P A;  3AL9 A;  2BCJ B;  1ERJ A;  5HE3 B;  1MG3 A;  5FLX g;  3UVM A;  3AL8 A;  4Y5R D;  3EMH A;  5HE2 B;  3SJL D;  3W15 A;  4A0B B;  1XIP A;  2AGL A;  1K32 A;  3HFQ A;  4J0W A;  4ERQ A;  5CXB A;  3C99 A;  4ES0 A;  5C9Z B;  3J80 g;  4QT8 A;  1GP2 B;  4PBZ A;  2YBA A;  2GNQ A;  1OLZ A;  3VH0 A;  3ZWL B;  4CI3 A;  2I0R A;  2OK6 A;  2P9U C;  2YMU A;  5KDO B;  1QNI A;  5B4W A;  3OL2 B;  3DM0 A;  4A0A A;  2XU7 A;  4K3I D;  2EBS A;  3K26 A;  4H5I A;  4A0B A;  4CY3 A;  4OWR A;  1B9Y A;  4Z8L A;  5I5M A;  5HE1 B;  2HXC A;  3FRX A;  2YB8 B;  3V7D B;  5I5I A;  3UKR C;  2H9N A;  4E5Z A;  5GXI A;  4GQ2 P;  3EI2 A;  1FWX A;  2P9S C;  3N0D A;  2H68 A;  2HJ4 A;  3UVN A;  3EI2 B;  3IJC A;  4A11 A;  1S4U X;  4J8G A;  3GFC A;  2B4E A;  2CO0 C;  4PNK B;  5SXM A;  3OW8 A;  3EI1 B;  4IMM A;  1YFQ A;  2IWK A;  1PI6 A;  1NEX B;  4N14 A;  4GQB B;  2Z2N A;  4FHL A;  3PSC B;  4J86 A;  5FKR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...