4JSXC

Structure of mtordeltan-mlst8-torin2 complex
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
317
structure length
317
Chain Sequence
b'VGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase mTOR
publication title mTOR kinase structure, mechanism and regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 74
structure length 317
sequence length 317
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4jsxC01
3L4OD 1R5MA 2GC7A 2PM9B 4JSNC 3IJCA 4J0XA 5FA5B 2IURA 4GZ8A 4O3TB 3SJLD 3EI4A 5FXYA 5EM2B 2XL3A 2P9SC 4GM9A 2MTAH 1OLZA 5K1CC 3RFHA 4JSPC 3CIKB 4U1EI 5SXMA 5H1MA 4FA5D 4J77A 4GM8A 4FA9D 4J79A 3EI1B 4PBYA 2IWKA 4GGAA 4CY3A 3UVOA 3RRMC 2AGXA 3SVWD 1TBGA 3MZLA 3UVLA 3AL8B 5GXHA 2EBSA 3VH0A 4PXWA 5FKTA 2IUQA 4YVDA 2AGYA 3OL2A 4X61B 2P9LC 3KRWB 4NSXA 4GQ2P 5CYKA 1U4CA 3I8EA 3ODTA 1B9XA 4X3EA 3SXTD 3JAMg 3I7KA 3JZGA 1N6FA 2AH1A 4JT5C 3JB9L 1XIPA 3OKWA 4FWWA 4OWRA 4ERZA 2P9PC 2HYEA 1MDAH 4ESGA 4K3JB 4L3GD 1K8KC 4EWRA 4PSXB 4O9DA 4BUJC 5FQDA 4MK0B 2UZYB 4L9OA 3EI2A 5GSAA 1JMXB 5FKRA 3PVUB 2H9PA 4PC0A 4ERYA 4A09B 2H68A 4OZUA 2H13A 2UZXB 3ORVD 3PVWB 2CNXA 3P4FA 4IA9A 4FAND 4CI8A 1SQJA 1VYHC 4A08A 2IWFA 3OKYB 4QL1A 1XHMA 3SBPA 2G9AA 2P9UC 3E0CA 2HJBA 5GMKn 1GXRA 4ZOYA 4E5ZA 5IGQA 5CXBB 3UVKA 4U7AA 3V5WB 4PNKB 2BCJB 5HE3B 2QC5A 3EI4B 2HESX 3PSCB 3J80g 3EU7A 3DM0A 5FKQA 1PBYB 5HQGA 5I5MA 5H17A 5TEFA 2IAAA 4H5IA 5EAMA 3A0FA 5EALA 5EMLB 3BWSA 3I7NA 3L4MD 5CXCA 4A0BA 4JSVC 1GOTB 4CI3A 2B5LA 2PM6B 5FKSA 3IKOA 3AL9A 3B7FA 1SQ9A 4J81A 2PM7B 2YNOA 2I0SA 4AOWA 4Y7RA 2H9MA 2OIZA 3C5MA 3RFGA 1PEVA 2O9KA 3EWEA 2J56H 4QRJA 3I89A 1NEXB 4LG9A 3KRXB 2HKRA 2HXCA 3GFCA 4N14A 3I8CA 3MXXA 3I7HA 3NVNA 2Z2PA 3OL2B 2CE9A 4X60B 1OMWB 5CYKB 5EMMB 2P9KC 1N6DA 2YNNA 4A2MA 3JPXA 3OW8A 3RN0D 2H6KA 3N0EA 2OVPB 5IJ8E 5I5JA 4GM3A 1QNIA 1Q47A 3CFVA 3DXMC 2OJYA 3UVMA 3OTTA 4Y5RD 1S4UX 4JT6C 1PGUA 4J8BA 1JJUB 4ZN4A 2CN2A 4GGDA 2YNPA 3RN1D 2YBAA 2J57G 2P9NC 2I3TA 5HYNB 5EMJB 2CO0C 3SWSD 1ERJA 4BH6A 2Q7QA 3JRPA 3EI2B 4CZXA 2P9IC 2H9LA 4J0WA 2PBIB 2IUVA 4X63B 5IT9g 4ZOZA 1MG3A 2I3SA 4O45A 3SMRA 4E54B 3UKUC 2B5MA 1TYQC 2W18A 3FM0A 3V7DB 4O3UB 2I0RA 1SHYB 4H5JA 2J55H 5C2VB 4A7JA 3AH8B 4A08B 2H6QA 3MZKA 4CC9A 2H47A 2H9NA 3F3FA 3NVXA 4ERQA 2AGZA 3K27A 3UVNA 3PSLA 4GQBB 4E5ZB 3ZWLB 3C75H 3PE7A 3SN6B 4J84A 4ZOVA 4QT8A 4CY1A 3UKRC 3ULEC 4A11A 1A0RB 3JZHA 5EARA 4BL0A 3I7PA 1YFQA 2CO0A 2Z2OA 3U4YA 1FWXA 5HE2B 2OVQB 1MG2A 3RLMD 4A0AA 3IJ0A 3SHFA 3F3GA 4JXMA 4FHLA 3DWLC 4TZ4A 4A2LA 2YB8B 1K32A 4FAVD 2I0TA 5CXCB 5K19A 4GQ1A 3C99A 2H6NA 4D6VA 4XEIC 4L3HD 2H3XA 5A2Qg 4CY5A 3EI3A 4O1QD 2YMUA 2G99A 3GREA 5TEEA 3AFCA 5B4WA 2Z2NA 2PM9A 5C2WB 2HKMA 3FRXA 4XYIA 3K26A 4PSWB 1JMZB 5EM2A 2TRCB 3DSMA 4J82A 4GMBA 3JZNA 2XL2A 1GP2B 4LGNA 4CI2A 5I5IA 3RMZD 2BBKH 4HDJA 3PXSD 3IJ1A 1GG2B 2AQ5A 3EI1A 4D0KA 1PI6A 4IMMA 4FB1D 3JROA 1XKSA 1RI6A 4GGCA 3UR4A 3AL8A 5H14A 3SBQA 2XYIA 3CFSB 5IGOA 4XYHA 3MKQA 1JOFA 2OK6A 5C9ZB 3VA6A 5AFU3 4Z8LA 3V9FA 4J8GA 3EG6A 2B4EA 5TF2A 5FLXg 5IC7A 4J86A 5TDHB 3OKTA 2H14A 3MMYA 3I7OA 2QXVA 3VGZA 3IIYA 3SCYA 2AGWA 4J78A 5EAPA 1L0QA 3I7LA 5AJAA 4PBZA 4K3ID 3HFQA 3N0DA 3F3PA 3MKSB 4CZVA 4AEZA 3NVQA 4ZOXA 4JSXC 3IIWA 5KDOB 2CE8A 2OK4A 3W15A 5GXIA 5HE0B 4CY2A 4LG8A 4A11B 2IUPA 4R7AB 4I79A 3DXKC 5IJ7E 3RSEC 3PXTD 5EMKB 4A0AB 3EMHA 4E54A 4A09A 4J73A 2OVRB 1NR0A 1B9YA 4J87A 5HE1B 5JWZA 3SLED 3C9CA 3BG1A 3BG0A 1P22A 3SFZA 3PXWD 1N6EA 3I2NA 4L1QD 4FA4D 4UI9R 3FGBA 4KFMB 4QQEA 4A0BB 2XU7A 2B5NA 3OKYA 2HJ4A 3SBRA 2GC4A 3EI3B 5AMSA 2AH0A 4FA1D 4ES0A 3J81g 4CZYA 2GNQA 2CN3A 5THAA 4G56B 4CI1A 1U2VC 4JD2C 5CXBA 2AGLA
chains in the Genus database with same CATH superfamily
3L4OD 1R5MA 2GC7A 2PM9B 4JSNC 3IJCA 4J0XA 5FA5B 2IURA 4GZ8A 4O3TB 3SJLD 4AX4A 2HU8A 3EI4A 4O02A 3EQ7A 5FXYA 5EM2B 2XL3A 2P9SC 4GM9A 2MTAH 1OLZA 5C92A 5K1CC 3RFHA 4JSPC 3CIKB 4U1EI 1QFMA 5SXMA 5H1MA 4FA5D 4J77A 4GM8A 4FA9D 4J79A 3EI1B 4PBYA 2IWKA 3EQ9A 4GGAA 4CY3A 1T2XA 3UVOA 3RRMC 2AGXA 3SVWD 1TBGA 3MZLA 3UVLA 1E8NA 3AL8B 1TYEA 3O4JA 4JHNA 3ZE0A 5GXHA 2EBSA 3VH0A 5HDBA 4PXWA 5FKTA 3IVMA 2IUQA 5C86A 4YVDA 2AGYA 3OL2A 4X61B 5E6RA 2P9LC 3KRWB 1UOPA 4NSXA 4GQ2P 4BP8A 5CYKA 1U4CA 5M5UA 3I8EA 3ODTA 1B9XA 4X3EA 3SXTD 3JAMg 4QAMA 3I7KA 3JZGA 1N6FA 1YR2A 2AH1A 4JT5C 3JB9L 1XIPA 2VDLA 1UOQA 3OKWA 4FWWA 4O2WA 1C9IA 4OWRA 1VE6A 4ERZA 2P9PC 2HYEA 2JKXA 1MDAH 4MMZA 3MUOA 4ESGA 4RE6A 4K3JB 4DNUA 4BCCA 4L3GD 1K8KC 3V4VA 5FFOA 4EWRA 3FCUA 5M5RA 2HU7A 4PSXB 4O9DA 4BUJC 4NC4A 5FQDA 4RE5A 4MK0B 2UZYB 4L9OA 3EI2A 4AMZA 4L1MA 5GSAA 1JMXB 5FKRA 3PVUB 2H9PA 1VZ3A 1VE7A 2QR5A 4PC0A 4ERYA 4A09B 2H68A 4OZUA 3ZDZA 2H13A 2UZXB 3MUNA 3ORVD 3PVWB 2CNXA 3P4FA 4IA9A 4FAND 4CI8A 5M5TA 3ZDYA 2VDKA 1SQJA 1VYHC 3IULA 4A08A 2XDWA 2IWFA 3OKYB 4QL1A 1XHMA 3SBPA 2G9AA 2P9UC 4MMXA 3E0CA 2HJBA 5GMKn 3DDUA 3NIGA 1GXRA 2XE4A 4ZOYA 4E5ZA 5IGQA 3IUQA 5CXBB 3UVKA 4U7AA 3FCSA 3V5WB 4PNKB 1L5GA 1H2XA 2VDMA 1UTCA 2BCJB 5HE3B 2QC5A 3EI4B 2HESX 3PSCB 3GD1I 3J80g 3EU7A 3DM0A 5FKQA 1PBYB 5HQGA 5I5MA 5H17A 5TEFA 2IAAA 1BPOA 4H5IA 4G1MA 5EAMA 4G1EA 3A0FA 5EALA 5EMLB 3BWSA 3I7NA 3L4MD 5CXCA 4A0BA 4JSVC 1GOTB 3IURA 4CI3A 2B5LA 2PM6B 5FKSA 3IKOA 3AL9A 3B7FA 1SQ9A 2VDOA 4J81A 2PM7B 2YNOA 2I0SA 4AOWA 4Y7RA 2H9MA 2OIZA 3C5MA 3RFGA 1PEVA 1JV2A 2O9KA 3EWEA 3K6SA 2J56H 4QRJA 3I89A 1NEXB 3IUMA 4LG9A 3KRXB 2HKRA 2HXCA 3GFCA 2QZPA 4N14A 4WJKA 3I8CA 3MXXA 1O6GA 4NAAA 3I7HA 3NVNA 3NIDA 2Z2PA 3OL2B 2CE9A 4X60B 2VC2A 1OMWB 5CYKB 5EMMB 2P9KC 1A12A 1N6DA 2YNNA 4A2MA 3JPXA 3OW8A 3RN0D 2H6KA 3N0EA 2OVPB 3VI4A 5IJ8E 5I5JA 4GM3A 1JTDB 1QNIA 1Q47A 3CFVA 3DXMC 2OJYA 3UVMA 3OTTA 4NENA 4Y5RD 1S4UX 4JT6C 1PGUA 4J8BA 1JJUB 4ZN4A 2CN2A 1E5TA 4GGDA 2YNPA 3RN1D 2YBAA 2J57G 2P9NC 2I3TA 4UM9A 5EMJB 2CO0C 3SWSD 5FFGA 5HYNB 1ERJA 4BH6A 3MVDK 2Q7QA 1M1XA 4BCDA 3JRPA 3EI2B 4CZXA 2P9IC 2H9LA 4J0WA 2PBIB 3QHYB 2IUVA 5E6UA 4X63B 5IT9g 4ZOZA 3K72A 1MG3A 2I3SA 4O45A 4NBMA 3SMRA 4D9SA 4E54B 3UKUC 2B5MA 1TYQC 2W18A 3FM0A 3V4PA 3V7DB 4O3UB 2I0RA 1SHYB 4H5JA 2EIEA 2J55H 5C2VB 4A7JA 3AH8B 4A08B 1GOFA 2H6QA 3MZKA 4CC9A 2H47A 4UM8A 2H9NA 3F3FA 3NVXA 4ERQA 2AGZA 3K27A 3UVNA 2XZGA 3PSLA 4GQBB 4E5ZB 3ZWLB 3C75H 3NIFA 3PE7A 3SN6B 3ZDXA 3ZE2A 4J84A 4ZOVA 4QT8A 4MMYA 4IRZA 3UKRC 4CY1A 3ULEC 4A11A 1A0RB 4BCBA 3JZHA 5EARA 4BL0A 2EIDA 3I7PA 4WK4A 4AN1A 5M5SA 1YFQA 2CO0A 2Z2OA 3U4YA 1FWXA 5HE2B 4BP9A 2OVQB 1MG2A 1H2WA 3RLMD 4A0AA 3IJ0A 2EIBA 3SHFA 3F3GA 1UOOA 4JXMA 4FHLA 3DWLC 4TZ4A 4A2LA 2YB8B 1K32A 4FAVD 2I0TA 5CXCB 5K19A 5E6SA 1I2MB 3ZE1A 1QFSA 4GQ1A 3C99A 2H6NA 4D6VA 2VDPA 1H2YA 4XEIC 1VZ2A 4L3HD 2H3XA 4AMYA 4CY5A 2VZ1A 5A2Qg 2WQ8A 3EI3A 4O1QD 2YMUA 2G99A 3GREA 5TEEA 3AFCA 5B4WA 3VI3A 3IUJA 2Z2NA 2PM9A 5C2WB 2HKMA 3FRXA 2EICA 3K26A 4XYIA 2VDQA 4PSWB 1JMZB 5EM2A 2TRCB 3DSMA 1H2ZA 4J82A 4GMBA 3JZNA 2XL2A 1GOHA 1GP2B 2VDNA 3OF7A 4LGNA 3RMZD 4CI2A 5I5IA 2BBKH 4HDJA 3PXSD 3IJ1A 2AQ5A 1GG2B 3EI1A 4D0KA 1PI6A 4IMMA 4G55A 2VDRA 4FB1D 4WK0A 3JROA 1XKSA 1RI6A 4GGCA 3UR4A 3KCIA 3AL8A 5H14A 3SBQA 2XYIA 3CFSB 5IGOA 4XYHA 3MKQA 5M61A 1JOFA 2OK6A 5C9ZB 3VA6A 5AFU3 4Z8LA 3V9FA 3T3MA 4J8GA 1O6FA 3EG6A 2B4EA 5TF2A 5FLXg 5IC7A 4J86A 5TDHB 3OKTA 2H14A 3MMYA 3I7OA 2QXVA 3EQ8A 3VGZA 3IIYA 3SCYA 4Z7OA 2AGWA 2VZ3A 3IUNA 4J78A 5EAPA 1L0QA 3I7LA 5AJAA 4PBZA 4K3ID 3HFQA 3N0DA 3MKSB 3F3PA 4AN0A 4CZVA 4AEZA 4DNVA 3NVQA 4ZOXA 4JSXC 3IIWA 4Z7QA 5KDOB 2CE8A 4Z7NA 1K3IA 2OK4A 3W15A 5GXIA 5HE0B 4CY2A 1GOGA 4LG8A 1E8MA 4A11B 2IUPA 4R7AB 4I79A 3DXKC 4JHPC 2BKLA 5IJ7E 3RSEC 4DNWA 3PXTD 5EMKB 3O4GA 4A0AB 3T3PA 3EMHA 3K71A 4WK2A 4E54A 4A09A 4J73A 2OVRB 3O4IA 1NR0A 1B9YA 4J87A 3O4HA 5HE1B 5JWZA 3SLED 3C9CA 3BG1A 3BG0A 1P22A 3SFZA 3GC3B 3PXWD 1N6EA 3I2NA 4L1QD 4FA4D 4UI9R 3FGBA 4KFMB 4QQEA 2HU5A 4A0BB 2XU7A 2B5NA 3OKYA 3QI0A 3IJEA 2HJ4A 3SBRA 2GC4A 3EI3B 5AMSA 2AH0A 1C9LA 4FA1D 4ES0A 1U8CA 3J81g 4CZYA 2GNQA 2CN3A 5M5VA 5THAA 4G56B 4CI1A 1U2VC 4JD2C 5CXBA 2AGLA
chains in the Genus database with same CATH topology
3L4OD 1R5MA 2GC7A 2PM9B 4JSNC 3IJCA 4J0XA 5FA5B 2IURA 4GZ8A 4O3TB 3SJLD 3EI4A 5FXYA 5EM2B 2XL3A 2P9SC 4GM9A 2MTAH 1OLZA 5K1CC 3RFHA 4JSPC 3CIKB 4U1EI 5SXMA 5H1MA 4FA5D 4J77A 4GM8A 4FA9D 4J79A 3EI1B 4PBYA 2IWKA 4GGAA 4CY3A 3UVOA 3RRMC 2AGXA 3SVWD 1TBGA 3MZLA 3UVLA 3AL8B 5GXHA 2EBSA 3VH0A 4PXWA 5FKTA 2IUQA 4YVDA 2AGYA 3OL2A 4X61B 2P9LC 3KRWB 4NSXA 4GQ2P 5CYKA 1U4CA 3I8EA 3ODTA 1B9XA 4X3EA 3SXTD 3JAMg 3I7KA 3JZGA 1N6FA 2AH1A 4JT5C 3JB9L 1XIPA 3OKWA 4FWWA 4OWRA 4ERZA 2P9PC 2HYEA 1MDAH 4ESGA 4K3JB 4L3GD 1K8KC 4EWRA 4PSXB 4O9DA 4BUJC 5FQDA 4MK0B 2UZYB 4L9OA 3EI2A 5GSAA 1JMXB 5FKRA 3PVUB 2H9PA 4PC0A 4ERYA 4A09B 2H68A 4OZUA 2H13A 2UZXB 3ORVD 3PVWB 2CNXA 3P4FA 4IA9A 4FAND 4CI8A 1SQJA 1VYHC 4A08A 2IWFA 3OKYB 4QL1A 1XHMA 3SBPA 2G9AA 2P9UC 3E0CA 2HJBA 5GMKn 1GXRA 4ZOYA 4E5ZA 5IGQA 5CXBB 3UVKA 4U7AA 3V5WB 4PNKB 2BCJB 5HE3B 2QC5A 3EI4B 2HESX 3PSCB 3J80g 3EU7A 3DM0A 5FKQA 1PBYB 5HQGA 5I5MA 5H17A 5TEFA 2IAAA 4H5IA 5EAMA 3A0FA 5EALA 5EMLB 3BWSA 3I7NA 3L4MD 5CXCA 4A0BA 4JSVC 1GOTB 4CI3A 2B5LA 2PM6B 5FKSA 3IKOA 3AL9A 3B7FA 1SQ9A 4J81A 2PM7B 2YNOA 2I0SA 4AOWA 4Y7RA 2H9MA 2OIZA 3C5MA 3RFGA 1PEVA 2O9KA 3EWEA 2J56H 4QRJA 3I89A 1NEXB 4LG9A 3KRXB 2HKRA 2HXCA 3GFCA 4N14A 3I8CA 3MXXA 3I7HA 3NVNA 2Z2PA 3OL2B 2CE9A 4X60B 1OMWB 5CYKB 5EMMB 2P9KC 1N6DA 2YNNA 4A2MA 3JPXA 3OW8A 3RN0D 2H6KA 3N0EA 2OVPB 5IJ8E 5I5JA 4GM3A 1QNIA 1Q47A 3CFVA 3DXMC 2OJYA 3UVMA 3OTTA 4Y5RD 1S4UX 4JT6C 1PGUA 4J8BA 1JJUB 4ZN4A 2CN2A 4GGDA 2YNPA 3RN1D 2YBAA 2J57G 2P9NC 2I3TA 5HYNB 5EMJB 2CO0C 3SWSD 1ERJA 4BH6A 2Q7QA 3JRPA 3EI2B 4CZXA 2P9IC 2H9LA 4J0WA 2PBIB 2IUVA 4X63B 5IT9g 4ZOZA 1MG3A 2I3SA 4O45A 3SMRA 4E54B 3UKUC 2B5MA 1TYQC 2W18A 3FM0A 3V7DB 4O3UB 2I0RA 1SHYB 4H5JA 2J55H 5C2VB 4A7JA 3AH8B 4A08B 2H6QA 3MZKA 4CC9A 2H47A 2H9NA 3F3FA 3NVXA 4ERQA 2AGZA 3K27A 3UVNA 3PSLA 4GQBB 4E5ZB 3ZWLB 3C75H 3PE7A 3SN6B 4J84A 4ZOVA 4QT8A 4CY1A 3UKRC 3ULEC 4A11A 1A0RB 3JZHA 5EARA 4BL0A 3I7PA 1YFQA 2CO0A 2Z2OA 3U4YA 1FWXA 5HE2B 2OVQB 1MG2A 3RLMD 4A0AA 3IJ0A 3SHFA 3F3GA 4JXMA 4FHLA 3DWLC 4TZ4A 4A2LA 2YB8B 1K32A 4FAVD 2I0TA 5CXCB 5K19A 4GQ1A 3C99A 2H6NA 4D6VA 4XEIC 4L3HD 2H3XA 5A2Qg 4CY5A 3EI3A 4O1QD 2YMUA 2G99A 3GREA 5TEEA 3AFCA 5B4WA 2Z2NA 2PM9A 5C2WB 2HKMA 3FRXA 4XYIA 3K26A 4PSWB 1JMZB 5EM2A 2TRCB 3DSMA 4J82A 4GMBA 3JZNA 2XL2A 1GP2B 4LGNA 4CI2A 5I5IA 3RMZD 2BBKH 4HDJA 3PXSD 3IJ1A 1GG2B 2AQ5A 3EI1A 4D0KA 1PI6A 4IMMA 4FB1D 3JROA 1XKSA 1RI6A 4GGCA 3UR4A 3AL8A 5H14A 3SBQA 2XYIA 3CFSB 5IGOA 4XYHA 3MKQA 1JOFA 2OK6A 5C9ZB 3VA6A 5AFU3 4Z8LA 3V9FA 4J8GA 3EG6A 2B4EA 5TF2A 5FLXg 5IC7A 4J86A 5TDHB 3OKTA 2H14A 3MMYA 3I7OA 2QXVA 3VGZA 3IIYA 3SCYA 2AGWA 4J78A 5EAPA 1L0QA 3I7LA 5AJAA 4PBZA 4K3ID 3HFQA 3N0DA 3F3PA 3MKSB 4CZVA 4AEZA 3NVQA 4ZOXA 4JSXC 3IIWA 5KDOB 2CE8A 2OK4A 3W15A 5GXIA 5HE0B 4CY2A 4LG8A 4A11B 2IUPA 4R7AB 4I79A 3DXKC 5IJ7E 3RSEC 3PXTD 5EMKB 4A0AB 3EMHA 4E54A 4A09A 4J73A 2OVRB 1NR0A 1B9YA 4J87A 5HE1B 5JWZA 3SLED 3C9CA 3BG1A 3BG0A 1P22A 3SFZA 3PXWD 1N6EA 3I2NA 4L1QD 4FA4D 4UI9R 3FGBA 4KFMB 4QQEA 4A0BB 2XU7A 2B5NA 3OKYA 2HJ4A 3SBRA 2GC4A 3EI3B 5AMSA 2AH0A 4FA1D 4ES0A 3J81g 4CZYA 2GNQA 2CN3A 5THAA 4G56B 4CI1A 1U2VC 4JD2C 5CXBA 2AGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L4O D;  1R5M A;  2GC7 A;  2PM9 B;  4JSN C;  3IJC A;  4J0X A;  5FA5 B;  2IUR A;  4GZ8 A;  4O3T B;  3SJL D;  3EI4 A;  5FXY A;  5EM2 B;  2XL3 A;  2P9S C;  4GM9 A;  2MTA H;  1OLZ A;  5K1C C;  3RFH A;  4JSP C;  3CIK B;  4U1E I;  5SXM A;  5H1M A;  4FA5 D;  4J77 A;  4GM8 A;  4FA9 D;  4J79 A;  3EI1 B;  4PBY A;  2IWK A;  4GGA A;  4CY3 A;  3UVO A;  3RRM C;  2AGX A;  3SVW D;  1TBG A;  3MZL A;  3UVL A;  3AL8 B;  5GXH A;  2EBS A;  3VH0 A;  4PXW A;  5FKT A;  2IUQ A;  4YVD A;  2AGY A;  3OL2 A;  4X61 B;  2P9L C;  3KRW B;  4NSX A;  4GQ2 P;  5CYK A;  1U4C A;  3I8E A;  3ODT A;  1B9X A;  4X3E A;  3SXT D;  3JAM g;  3I7K A;  3JZG A;  1N6F A;  2AH1 A;  4JT5 C;  3JB9 L;  1XIP A;  3OKW A;  4FWW A;  4OWR A;  4ERZ A;  2P9P C;  2HYE A;  1MDA H;  4ESG A;  4K3J B;  4L3G D;  1K8K C;  4EWR A;  4PSX B;  4O9D A;  4BUJ C;  5FQD A;  4MK0 B;  2UZY B;  4L9O A;  3EI2 A;  5GSA A;  1JMX B;  5FKR A;  3PVU B;  2H9P A;  4PC0 A;  4ERY A;  4A09 B;  2H68 A;  4OZU A;  2H13 A;  2UZX B;  3ORV D;  3PVW B;  2CNX A;  3P4F A;  4IA9 A;  4FAN D;  4CI8 A;  1SQJ A;  1VYH C;  4A08 A;  2IWF A;  3OKY B;  4QL1 A;  1XHM A;  3SBP A;  2G9A A;  2P9U C;  3E0C A;  2HJB A;  5GMK n;  1GXR A;  4ZOY A;  4E5Z A;  5IGQ A;  5CXB B;  3UVK A;  4U7A A;  3V5W B;  4PNK B;  2BCJ B;  5HE3 B;  2QC5 A;  3EI4 B;  2HES X;  3PSC B;  3J80 g;  3EU7 A;  3DM0 A;  5FKQ A;  1PBY B;  5HQG A;  5I5M A;  5H17 A;  5TEF A;  2IAA A;  4H5I A;  5EAM A;  3A0F A;  5EAL A;  5EML B;  3BWS A;  3I7N A;  3L4M D;  5CXC A;  4A0B A;  4JSV C;  1GOT B;  4CI3 A;  2B5L A;  2PM6 B;  5FKS A;  3IKO A;  3AL9 A;  3B7F A;  1SQ9 A;  4J81 A;  2PM7 B;  2YNO A;  2I0S A;  4AOW A;  4Y7R A;  2H9M A;  2OIZ A;  3C5M A;  3RFG A;  1PEV A;  2O9K A;  3EWE A;  2J56 H;  4QRJ A;  3I89 A;  1NEX B;  4LG9 A;  3KRX B;  2HKR A;  2HXC A;  3GFC A;  4N14 A;  3I8C A;  3MXX A;  3I7H A;  3NVN A;  2Z2P A;  3OL2 B;  2CE9 A;  4X60 B;  1OMW B;  5CYK B;  5EMM B;  2P9K C;  1N6D A;  2YNN A;  4A2M A;  3JPX A;  3OW8 A;  3RN0 D;  2H6K A;  3N0E A;  2OVP B;  5IJ8 E;  5I5J A;  4GM3 A;  1QNI A;  1Q47 A;  3CFV A;  3DXM C;  2OJY A;  3UVM A;  3OTT A;  4Y5R D;  1S4U X;  4JT6 C;  1PGU A;  4J8B A;  1JJU B;  4ZN4 A;  2CN2 A;  4GGD A;  2YNP A;  3RN1 D;  2YBA A;  2J57 G;  2P9N C;  2I3T A;  5HYN B;  5EMJ B;  2CO0 C;  3SWS D;  1ERJ A;  4BH6 A;  2Q7Q A;  3JRP A;  3EI2 B;  4CZX A;  2P9I C;  2H9L A;  4J0W A;  2PBI B;  2IUV A;  4X63 B;  5IT9 g;  4ZOZ A;  1MG3 A;  2I3S A;  4O45 A;  3SMR A;  4E54 B;  3UKU C;  2B5M A;  1TYQ C;  2W18 A;  3FM0 A;  3V7D B;  4O3U B;  2I0R A;  1SHY B;  4H5J A;  2J55 H;  5C2V B;  4A7J A;  3AH8 B;  4A08 B;  2H6Q A;  3MZK A;  4CC9 A;  2H47 A;  2H9N A;  3F3F A;  3NVX A;  4ERQ A;  2AGZ A;  3K27 A;  3UVN A;  3PSL A;  4GQB B;  4E5Z B;  3ZWL B;  3C75 H;  3PE7 A;  3SN6 B;  4J84 A;  4ZOV A;  4QT8 A;  4CY1 A;  3UKR C;  3ULE C;  4A11 A;  1A0R B;  3JZH A;  5EAR A;  4BL0 A;  3I7P A;  1YFQ A;  2CO0 A;  2Z2O A;  3U4Y A;  1FWX A;  5HE2 B;  2OVQ B;  1MG2 A;  3RLM D;  4A0A A;  3IJ0 A;  3SHF A;  3F3G A;  4JXM A;  4FHL A;  3DWL C;  4TZ4 A;  4A2L A;  2YB8 B;  1K32 A;  4FAV D;  2I0T A;  5CXC B;  5K19 A;  4GQ1 A;  3C99 A;  2H6N A;  4D6V A;  4XEI C;  4L3H D;  2H3X A;  5A2Q g;  4CY5 A;  3EI3 A;  4O1Q D;  2YMU A;  2G99 A;  3GRE A;  5TEE A;  3AFC A;  5B4W A;  2Z2N A;  2PM9 A;  5C2W B;  2HKM A;  3FRX A;  4XYI A;  3K26 A;  4PSW B;  1JMZ B;  5EM2 A;  2TRC B;  3DSM A;  4J82 A;  4GMB A;  3JZN A;  2XL2 A;  1GP2 B;  4LGN A;  4CI2 A;  5I5I A;  3RMZ D;  2BBK H;  4HDJ A;  3PXS D;  3IJ1 A;  1GG2 B;  2AQ5 A;  3EI1 A;  4D0K A;  1PI6 A;  4IMM A;  4FB1 D;  3JRO A;  1XKS A;  1RI6 A;  4GGC A;  3UR4 A;  3AL8 A;  5H14 A;  3SBQ A;  2XYI A;  3CFS B;  5IGO A;  4XYH A;  3MKQ A;  1JOF A;  2OK6 A;  5C9Z B;  3VA6 A;  5AFU 3;  4Z8L A;  3V9F A;  4J8G A;  3EG6 A;  2B4E A;  5TF2 A;  5FLX g;  5IC7 A;  4J86 A;  5TDH B;  3OKT A;  2H14 A;  3MMY A;  3I7O A;  2QXV A;  3VGZ A;  3IIY A;  3SCY A;  2AGW A;  4J78 A;  5EAP A;  1L0Q A;  3I7L A;  5AJA A;  4PBZ A;  4K3I D;  3HFQ A;  3N0D A;  3F3P A;  3MKS B;  4CZV A;  4AEZ A;  3NVQ A;  4ZOX A;  4JSX C;  3IIW A;  5KDO B;  2CE8 A;  2OK4 A;  3W15 A;  5GXI A;  5HE0 B;  4CY2 A;  4LG8 A;  4A11 B;  2IUP A;  4R7A B;  4I79 A;  3DXK C;  5IJ7 E;  3RSE C;  3PXT D;  5EMK B;  4A0A B;  3EMH A;  4E54 A;  4A09 A;  4J73 A;  2OVR B;  1NR0 A;  1B9Y A;  4J87 A;  5HE1 B;  5JWZ A;  3SLE D;  3C9C A;  3BG1 A;  3BG0 A;  1P22 A;  3SFZ A;  3PXW D;  1N6E A;  3I2N A;  4L1Q D;  4FA4 D;  4UI9 R;  3FGB A;  4KFM B;  4QQE A;  4A0B B;  2XU7 A;  2B5N A;  3OKY A;  2HJ4 A;  3SBR A;  2GC4 A;  3EI3 B;  5AMS A;  2AH0 A;  4FA1 D;  4ES0 A;  3J81 g;  4CZY A;  2GNQ A;  2CN3 A;  5THA A;  4G56 B;  4CI1 A;  1U2V C;  4JD2 C;  5CXB A;  2AGL A; 
#chains in the Genus database with same CATH topology
 3L4O D;  1R5M A;  2GC7 A;  2PM9 B;  4JSN C;  3IJC A;  4J0X A;  5FA5 B;  2IUR A;  4GZ8 A;  4O3T B;  3SJL D;  4AX4 A;  2HU8 A;  3EI4 A;  4O02 A;  3EQ7 A;  5FXY A;  5EM2 B;  2XL3 A;  2P9S C;  4GM9 A;  2MTA H;  1OLZ A;  5C92 A;  5K1C C;  3RFH A;  4JSP C;  3CIK B;  4U1E I;  1QFM A;  5SXM A;  5H1M A;  4FA5 D;  4J77 A;  4GM8 A;  4FA9 D;  4J79 A;  3EI1 B;  4PBY A;  2IWK A;  3EQ9 A;  4GGA A;  4CY3 A;  1T2X A;  3UVO A;  3RRM C;  2AGX A;  3SVW D;  1TBG A;  3MZL A;  3UVL A;  1E8N A;  3AL8 B;  1TYE A;  3O4J A;  4JHN A;  3ZE0 A;  5GXH A;  2EBS A;  3VH0 A;  5HDB A;  4PXW A;  5FKT A;  3IVM A;  2IUQ A;  5C86 A;  4YVD A;  2AGY A;  3OL2 A;  4X61 B;  5E6R A;  2P9L C;  3KRW B;  1UOP A;  4NSX A;  4GQ2 P;  4BP8 A;  5CYK A;  1U4C A;  5M5U A;  3I8E A;  3ODT A;  1B9X A;  4X3E A;  3SXT D;  3JAM g;  4QAM A;  3I7K A;  3JZG A;  1N6F A;  1YR2 A;  2AH1 A;  4JT5 C;  3JB9 L;  1XIP A;  2VDL A;  1UOQ A;  3OKW A;  4FWW A;  4O2W A;  1C9I A;  4OWR A;  1VE6 A;  4ERZ A;  2P9P C;  2HYE A;  2JKX A;  1MDA H;  4MMZ A;  3MUO A;  4ESG A;  4RE6 A;  4K3J B;  4DNU A;  4BCC A;  4L3G D;  1K8K C;  3V4V A;  5FFO A;  4EWR A;  3FCU A;  5M5R A;  2HU7 A;  4PSX B;  4O9D A;  4BUJ C;  4NC4 A;  5FQD A;  4RE5 A;  4MK0 B;  2UZY B;  4L9O A;  3EI2 A;  4AMZ A;  4L1M A;  5GSA A;  1JMX B;  5FKR A;  3PVU B;  2H9P A;  1VZ3 A;  1VE7 A;  2QR5 A;  4PC0 A;  4ERY A;  4A09 B;  2H68 A;  4OZU A;  3ZDZ A;  2H13 A;  2UZX B;  3MUN A;  3ORV D;  3PVW B;  2CNX A;  3P4F A;  4IA9 A;  4FAN D;  4CI8 A;  5M5T A;  3ZDY A;  2VDK A;  1SQJ A;  1VYH C;  3IUL A;  4A08 A;  2XDW A;  2IWF A;  3OKY B;  4QL1 A;  1XHM A;  3SBP A;  2G9A A;  2P9U C;  4MMX A;  3E0C A;  2HJB A;  5GMK n;  3DDU A;  3NIG A;  1GXR A;  2XE4 A;  4ZOY A;  4E5Z A;  5IGQ A;  3IUQ A;  5CXB B;  3UVK A;  4U7A A;  3FCS A;  3V5W B;  4PNK B;  1L5G A;  1H2X A;  2VDM A;  1UTC A;  2BCJ B;  5HE3 B;  2QC5 A;  3EI4 B;  2HES X;  3PSC B;  3GD1 I;  3J80 g;  3EU7 A;  3DM0 A;  5FKQ A;  1PBY B;  5HQG A;  5I5M A;  5H17 A;  5TEF A;  2IAA A;  1BPO A;  4H5I A;  4G1M A;  5EAM A;  4G1E A;  3A0F A;  5EAL A;  5EML B;  3BWS A;  3I7N A;  3L4M D;  5CXC A;  4A0B A;  4JSV C;  1GOT B;  3IUR A;  4CI3 A;  2B5L A;  2PM6 B;  5FKS A;  3IKO A;  3AL9 A;  3B7F A;  1SQ9 A;  2VDO A;  4J81 A;  2PM7 B;  2YNO A;  2I0S A;  4AOW A;  4Y7R A;  2H9M A;  2OIZ A;  3C5M A;  3RFG A;  1PEV A;  1JV2 A;  2O9K A;  3EWE A;  3K6S A;  2J56 H;  4QRJ A;  3I89 A;  1NEX B;  3IUM A;  4LG9 A;  3KRX B;  2HKR A;  2HXC A;  3GFC A;  2QZP A;  4N14 A;  4WJK A;  3I8C A;  3MXX A;  1O6G A;  4NAA A;  3I7H A;  3NVN A;  3NID A;  2Z2P A;  3OL2 B;  2CE9 A;  4X60 B;  2VC2 A;  1OMW B;  5CYK B;  5EMM B;  2P9K C;  1A12 A;  1N6D A;  2YNN A;  4A2M A;  3JPX A;  3OW8 A;  3RN0 D;  2H6K A;  3N0E A;  2OVP B;  3VI4 A;  5IJ8 E;  5I5J A;  4GM3 A;  1JTD B;  1QNI A;  1Q47 A;  3CFV A;  3DXM C;  2OJY A;  3UVM A;  3OTT A;  4NEN A;  4Y5R D;  1S4U X;  4JT6 C;  1PGU A;  4J8B A;  1JJU B;  4ZN4 A;  2CN2 A;  1E5T A;  4GGD A;  2YNP A;  3RN1 D;  2YBA A;  2J57 G;  2P9N C;  2I3T A;  4UM9 A;  5EMJ B;  2CO0 C;  3SWS D;  5FFG A;  5HYN B;  1ERJ A;  4BH6 A;  3MVD K;  2Q7Q A;  1M1X A;  4BCD A;  3JRP A;  3EI2 B;  4CZX A;  2P9I C;  2H9L A;  4J0W A;  2PBI B;  3QHY B;  2IUV A;  5E6U A;  4X63 B;  5IT9 g;  4ZOZ A;  3K72 A;  1MG3 A;  2I3S A;  4O45 A;  4NBM A;  3SMR A;  4D9S A;  4E54 B;  3UKU C;  2B5M A;  1TYQ C;  2W18 A;  3FM0 A;  3V4P A;  3V7D B;  4O3U B;  2I0R A;  1SHY B;  4H5J A;  2EIE A;  2J55 H;  5C2V B;  4A7J A;  3AH8 B;  4A08 B;  1GOF A;  2H6Q A;  3MZK A;  4CC9 A;  2H47 A;  4UM8 A;  2H9N A;  3F3F A;  3NVX A;  4ERQ A;  2AGZ A;  3K27 A;  3UVN A;  2XZG A;  3PSL A;  4GQB B;  4E5Z B;  3ZWL B;  3C75 H;  3NIF A;  3PE7 A;  3SN6 B;  3ZDX A;  3ZE2 A;  4J84 A;  4ZOV A;  4QT8 A;  4MMY A;  4IRZ A;  3UKR C;  4CY1 A;  3ULE C;  4A11 A;  1A0R B;  4BCB A;  3JZH A;  5EAR A;  4BL0 A;  2EID A;  3I7P A;  4WK4 A;  4AN1 A;  5M5S A;  1YFQ A;  2CO0 A;  2Z2O A;  3U4Y A;  1FWX A;  5HE2 B;  4BP9 A;  2OVQ B;  1MG2 A;  1H2W A;  3RLM D;  4A0A A;  3IJ0 A;  2EIB A;  3SHF A;  3F3G A;  1UOO A;  4JXM A;  4FHL A;  3DWL C;  4TZ4 A;  4A2L A;  2YB8 B;  1K32 A;  4FAV D;  2I0T A;  5CXC B;  5K19 A;  5E6S A;  1I2M B;  3ZE1 A;  1QFS A;  4GQ1 A;  3C99 A;  2H6N A;  4D6V A;  2VDP A;  1H2Y A;  4XEI C;  1VZ2 A;  4L3H D;  2H3X A;  4AMY A;  4CY5 A;  2VZ1 A;  5A2Q g;  2WQ8 A;  3EI3 A;  4O1Q D;  2YMU A;  2G99 A;  3GRE A;  5TEE A;  3AFC A;  5B4W A;  3VI3 A;  3IUJ A;  2Z2N A;  2PM9 A;  5C2W B;  2HKM A;  3FRX A;  2EIC A;  3K26 A;  4XYI A;  2VDQ A;  4PSW B;  1JMZ B;  5EM2 A;  2TRC B;  3DSM A;  1H2Z A;  4J82 A;  4GMB A;  3JZN A;  2XL2 A;  1GOH A;  1GP2 B;  2VDN A;  3OF7 A;  4LGN A;  3RMZ D;  4CI2 A;  5I5I A;  2BBK H;  4HDJ A;  3PXS D;  3IJ1 A;  2AQ5 A;  1GG2 B;  3EI1 A;  4D0K A;  1PI6 A;  4IMM A;  4G55 A;  2VDR A;  4FB1 D;  4WK0 A;  3JRO A;  1XKS A;  1RI6 A;  4GGC A;  3UR4 A;  3KCI A;  3AL8 A;  5H14 A;  3SBQ A;  2XYI A;  3CFS B;  5IGO A;  4XYH A;  3MKQ A;  5M61 A;  1JOF A;  2OK6 A;  5C9Z B;  3VA6 A;  5AFU 3;  4Z8L A;  3V9F A;  3T3M A;  4J8G A;  1O6F A;  3EG6 A;  2B4E A;  5TF2 A;  5FLX g;  5IC7 A;  4J86 A;  5TDH B;  3OKT A;  2H14 A;  3MMY A;  3I7O A;  2QXV A;  3EQ8 A;  3VGZ A;  3IIY A;  3SCY A;  4Z7O A;  2AGW A;  2VZ3 A;  3IUN A;  4J78 A;  5EAP A;  1L0Q A;  3I7L A;  5AJA A;  4PBZ A;  4K3I D;  3HFQ A;  3N0D A;  3MKS B;  3F3P A;  4AN0 A;  4CZV A;  4AEZ A;  4DNV A;  3NVQ A;  4ZOX A;  4JSX C;  3IIW A;  4Z7Q A;  5KDO B;  2CE8 A;  4Z7N A;  1K3I A;  2OK4 A;  3W15 A;  5GXI A;  5HE0 B;  4CY2 A;  1GOG A;  4LG8 A;  1E8M A;  4A11 B;  2IUP A;  4R7A B;  4I79 A;  3DXK C;  4JHP C;  2BKL A;  5IJ7 E;  3RSE C;  4DNW A;  3PXT D;  5EMK B;  3O4G A;  4A0A B;  3T3P A;  3EMH A;  3K71 A;  4WK2 A;  4E54 A;  4A09 A;  4J73 A;  2OVR B;  3O4I A;  1NR0 A;  1B9Y A;  4J87 A;  3O4H A;  5HE1 B;  5JWZ A;  3SLE D;  3C9C A;  3BG1 A;  3BG0 A;  1P22 A;  3SFZ A;  3GC3 B;  3PXW D;  1N6E A;  3I2N A;  4L1Q D;  4FA4 D;  4UI9 R;  3FGB A;  4KFM B;  4QQE A;  2HU5 A;  4A0B B;  2XU7 A;  2B5N A;  3OKY A;  3QI0 A;  3IJE A;  2HJ4 A;  3SBR A;  2GC4 A;  3EI3 B;  5AMS A;  2AH0 A;  1C9L A;  4FA1 D;  4ES0 A;  1U8C A;  3J81 g;  4CZY A;  2GNQ A;  2CN3 A;  5M5V A;  5THA A;  4G56 B;  4CI1 A;  1U2V C;  4JD2 C;  5CXB A;  2AGL A; 
#chains in the Genus database with same CATH homology
 3L4O D;  1R5M A;  2GC7 A;  2PM9 B;  4JSN C;  3IJC A;  4J0X A;  5FA5 B;  2IUR A;  4GZ8 A;  4O3T B;  3SJL D;  3EI4 A;  5FXY A;  5EM2 B;  2XL3 A;  2P9S C;  4GM9 A;  2MTA H;  1OLZ A;  5K1C C;  3RFH A;  4JSP C;  3CIK B;  4U1E I;  5SXM A;  5H1M A;  4FA5 D;  4J77 A;  4GM8 A;  4FA9 D;  4J79 A;  3EI1 B;  4PBY A;  2IWK A;  4GGA A;  4CY3 A;  3UVO A;  3RRM C;  2AGX A;  3SVW D;  1TBG A;  3MZL A;  3UVL A;  3AL8 B;  5GXH A;  2EBS A;  3VH0 A;  4PXW A;  5FKT A;  2IUQ A;  4YVD A;  2AGY A;  3OL2 A;  4X61 B;  2P9L C;  3KRW B;  4NSX A;  4GQ2 P;  5CYK A;  1U4C A;  3I8E A;  3ODT A;  1B9X A;  4X3E A;  3SXT D;  3JAM g;  3I7K A;  3JZG A;  1N6F A;  2AH1 A;  4JT5 C;  3JB9 L;  1XIP A;  3OKW A;  4FWW A;  4OWR A;  4ERZ A;  2P9P C;  2HYE A;  1MDA H;  4ESG A;  4K3J B;  4L3G D;  1K8K C;  4EWR A;  4PSX B;  4O9D A;  4BUJ C;  5FQD A;  4MK0 B;  2UZY B;  4L9O A;  3EI2 A;  5GSA A;  1JMX B;  5FKR A;  3PVU B;  2H9P A;  4PC0 A;  4ERY A;  4A09 B;  2H68 A;  4OZU A;  2H13 A;  2UZX B;  3ORV D;  3PVW B;  2CNX A;  3P4F A;  4IA9 A;  4FAN D;  4CI8 A;  1SQJ A;  1VYH C;  4A08 A;  2IWF A;  3OKY B;  4QL1 A;  1XHM A;  3SBP A;  2G9A A;  2P9U C;  3E0C A;  2HJB A;  5GMK n;  1GXR A;  4ZOY A;  4E5Z A;  5IGQ A;  5CXB B;  3UVK A;  4U7A A;  3V5W B;  4PNK B;  2BCJ B;  5HE3 B;  2QC5 A;  3EI4 B;  2HES X;  3PSC B;  3J80 g;  3EU7 A;  3DM0 A;  5FKQ A;  1PBY B;  5HQG A;  5I5M A;  5H17 A;  5TEF A;  2IAA A;  4H5I A;  5EAM A;  3A0F A;  5EAL A;  5EML B;  3BWS A;  3I7N A;  3L4M D;  5CXC A;  4A0B A;  4JSV C;  1GOT B;  4CI3 A;  2B5L A;  2PM6 B;  5FKS A;  3IKO A;  3AL9 A;  3B7F A;  1SQ9 A;  4J81 A;  2PM7 B;  2YNO A;  2I0S A;  4AOW A;  4Y7R A;  2H9M A;  2OIZ A;  3C5M A;  3RFG A;  1PEV A;  2O9K A;  3EWE A;  2J56 H;  4QRJ A;  3I89 A;  1NEX B;  4LG9 A;  3KRX B;  2HKR A;  2HXC A;  3GFC A;  4N14 A;  3I8C A;  3MXX A;  3I7H A;  3NVN A;  2Z2P A;  3OL2 B;  2CE9 A;  4X60 B;  1OMW B;  5CYK B;  5EMM B;  2P9K C;  1N6D A;  2YNN A;  4A2M A;  3JPX A;  3OW8 A;  3RN0 D;  2H6K A;  3N0E A;  2OVP B;  5IJ8 E;  5I5J A;  4GM3 A;  1QNI A;  1Q47 A;  3CFV A;  3DXM C;  2OJY A;  3UVM A;  3OTT A;  4Y5R D;  1S4U X;  4JT6 C;  1PGU A;  4J8B A;  1JJU B;  4ZN4 A;  2CN2 A;  4GGD A;  2YNP A;  3RN1 D;  2YBA A;  2J57 G;  2P9N C;  2I3T A;  5HYN B;  5EMJ B;  2CO0 C;  3SWS D;  1ERJ A;  4BH6 A;  2Q7Q A;  3JRP A;  3EI2 B;  4CZX A;  2P9I C;  2H9L A;  4J0W A;  2PBI B;  2IUV A;  4X63 B;  5IT9 g;  4ZOZ A;  1MG3 A;  2I3S A;  4O45 A;  3SMR A;  4E54 B;  3UKU C;  2B5M A;  1TYQ C;  2W18 A;  3FM0 A;  3V7D B;  4O3U B;  2I0R A;  1SHY B;  4H5J A;  2J55 H;  5C2V B;  4A7J A;  3AH8 B;  4A08 B;  2H6Q A;  3MZK A;  4CC9 A;  2H47 A;  2H9N A;  3F3F A;  3NVX A;  4ERQ A;  2AGZ A;  3K27 A;  3UVN A;  3PSL A;  4GQB B;  4E5Z B;  3ZWL B;  3C75 H;  3PE7 A;  3SN6 B;  4J84 A;  4ZOV A;  4QT8 A;  4CY1 A;  3UKR C;  3ULE C;  4A11 A;  1A0R B;  3JZH A;  5EAR A;  4BL0 A;  3I7P A;  1YFQ A;  2CO0 A;  2Z2O A;  3U4Y A;  1FWX A;  5HE2 B;  2OVQ B;  1MG2 A;  3RLM D;  4A0A A;  3IJ0 A;  3SHF A;  3F3G A;  4JXM A;  4FHL A;  3DWL C;  4TZ4 A;  4A2L A;  2YB8 B;  1K32 A;  4FAV D;  2I0T A;  5CXC B;  5K19 A;  4GQ1 A;  3C99 A;  2H6N A;  4D6V A;  4XEI C;  4L3H D;  2H3X A;  5A2Q g;  4CY5 A;  3EI3 A;  4O1Q D;  2YMU A;  2G99 A;  3GRE A;  5TEE A;  3AFC A;  5B4W A;  2Z2N A;  2PM9 A;  5C2W B;  2HKM A;  3FRX A;  4XYI A;  3K26 A;  4PSW B;  1JMZ B;  5EM2 A;  2TRC B;  3DSM A;  4J82 A;  4GMB A;  3JZN A;  2XL2 A;  1GP2 B;  4LGN A;  4CI2 A;  5I5I A;  3RMZ D;  2BBK H;  4HDJ A;  3PXS D;  3IJ1 A;  1GG2 B;  2AQ5 A;  3EI1 A;  4D0K A;  1PI6 A;  4IMM A;  4FB1 D;  3JRO A;  1XKS A;  1RI6 A;  4GGC A;  3UR4 A;  3AL8 A;  5H14 A;  3SBQ A;  2XYI A;  3CFS B;  5IGO A;  4XYH A;  3MKQ A;  1JOF A;  2OK6 A;  5C9Z B;  3VA6 A;  5AFU 3;  4Z8L A;  3V9F A;  4J8G A;  3EG6 A;  2B4E A;  5TF2 A;  5FLX g;  5IC7 A;  4J86 A;  5TDH B;  3OKT A;  2H14 A;  3MMY A;  3I7O A;  2QXV A;  3VGZ A;  3IIY A;  3SCY A;  2AGW A;  4J78 A;  5EAP A;  1L0Q A;  3I7L A;  5AJA A;  4PBZ A;  4K3I D;  3HFQ A;  3N0D A;  3F3P A;  3MKS B;  4CZV A;  4AEZ A;  3NVQ A;  4ZOX A;  4JSX C;  3IIW A;  5KDO B;  2CE8 A;  2OK4 A;  3W15 A;  5GXI A;  5HE0 B;  4CY2 A;  4LG8 A;  4A11 B;  2IUP A;  4R7A B;  4I79 A;  3DXK C;  5IJ7 E;  3RSE C;  3PXT D;  5EMK B;  4A0A B;  3EMH A;  4E54 A;  4A09 A;  4J73 A;  2OVR B;  1NR0 A;  1B9Y A;  4J87 A;  5HE1 B;  5JWZ A;  3SLE D;  3C9C A;  3BG1 A;  3BG0 A;  1P22 A;  3SFZ A;  3PXW D;  1N6E A;  3I2N A;  4L1Q D;  4FA4 D;  4UI9 R;  3FGB A;  4KFM B;  4QQE A;  4A0B B;  2XU7 A;  2B5N A;  3OKY A;  2HJ4 A;  3SBR A;  2GC4 A;  3EI3 B;  5AMS A;  2AH0 A;  4FA1 D;  4ES0 A;  3J81 g;  4CZY A;  2GNQ A;  2CN3 A;  5THA A;  4G56 B;  4CI1 A;  1U2V C;  4JD2 C;  5CXB A;  2AGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...