4JSXC

Structure of mtordeltan-mlst8-torin2 complex
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
317
structure length
317
Chain Sequence
VGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title mTOR kinase structure, mechanism and regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase mTOR
total genus 74
structure length 317
sequence length 317
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4jsxC01
5HE2B 3RN0D 3EMHA 2AQ5A 1S4UX 5EM2A 4I79A 3GFCA 2G99A 2I3TA 3DSMA 4CZYA 3N0EA 2P9NC 2PM9A 3EWEA 4A0AB 4AOWA 3EI3A 1PEVA 4J86A 1PI6A 1GOTB 2UZXB 5EAPA 4YVDA 3UKRC 2OK6A 3I8CA 4BL0A 1QNIA 3SFZA 5K19A 3UKUC 1R5MA 1XIPA 5C2WB 3PSCB 5AJAA 5IJ7E 3FRXA 2IWFA 1MDAH 1YFQA 4A09A 3SMRA 2YB8B 3JZGA 1XKSA 5HYNB 2H47A 1ERJA 3JZHA 1B9XA 4U1EI 1SHYB 5EARA 4KFMB 2GNQA 4LG9A 5H1MA 2H13A 3BWSA 1XHMA 2XL2A 4GGAA 1PGUA 1SQJA 2P9UC 4MK0B 3JZNA 4CI8A 5THAA 4IMMA 4O45A 3EG6A 3SBPA 2OVRB 2Q7QA 3OKWA 5KDOB 4JXMA 2IURA 2HXCA 1OLZA 2CO0A 2J57G 4LGNA 4H5IA 3C99A 2I0TA 3EI2B 3F3FA 3EI2A 3OKYA 3L4OD 3UVOA 3IJCA 3MZKA 2XL3A 5I5JA 4ERYA 3I7OA 3PSLA 5EAMA 2W18A 4FB1D 5EM2B 5TDHB 4GQ1A 3N0DA 2B5NA 1JOFA 3IIYA 3VH0A 3OW8A 3RLMD 3SWSD 5EMKB 4CY1A 2HYEA 3I7LA 5EALA 3SCYA 4X60B 2HJ4A 2Z2PA 4Y7RA 3MMYA 3IKOA 3ZWLB 2BBKH 4QQEA 2J55H 1U4CA 3MKSB 1Q47A 1N6FA 5IGQA 2B4EA 4XYIA 5TEEA 4A0BB 2H9LA 4CY3A 5IT9g 4A2LA 4CI3A 1JMXB 4A2MA 4A0AA 3SVWD 2HESX 3OL2B 3JAMg 2B5MA 5A2Qg 3J81g 4PBYA 4PXWA 4GM3A 5H17A 4PBZA 4A7JA 2H14A 2HKMA 2IUQA 4JD2C 4E54A 3JPXA 1TYQC 4A11B 2Z2NA 3KRWB 2OVPB 4CZVA 2H6KA 2O9KA 1A0RB 5CXBA 2CN3A 4O1QD 4X61B 5HE0B 3BG1A 5C9ZB 4GGDA 4A08B 3IIWA 3RMZD 4CI1A 1P22A 4ESGA 2PM7B 5FA5B 3EI3B 3AFCA 2OK4A 5TF2A 3W15A 1TBGA 4FAVD 3ULEC 3DM0A 4PC0A 4FA1D 2YMUA 4J81A 3SBRA 1GP2B 4UI9R 4QRJA 5HE1B 2TRCB 3SLED 4FA5D 4L3GD 4J87A 4ERQA 3OL2A 2AGWA 3I7NA 1RI6A 5FKRA 5AFU3 5GXIA 1PBYB 2PBIB 3RN1D 1NR0A 3RRMC 4FWWA 5CXCA 3CFSB 5FKQA 4U7AA 5FXYA 1K32A 1MG2A 2AGZA 2P9IC 5CXCB 3P4FA 5I5MA 1OMWB 4O9DA 2I0SA 5HQGA 2EBSA 4HDJA 3PXSD 3SXTD 1JJUB 2QC5A 1B9YA 4GM8A 5CYKB 2CE8A 3PVUB 3JRPA 4A08A 4QL1A 2IUVA 4PSWB 4FA9D 2AGXA 2P9SC 4N14A 1U2VC 5JWZA 4A09B 5IJ8E 4X63B 2P9PC 2IWKA 3BG0A 3I7PA 2CE9A 3UVMA 3IJ0A 2H6QA 4E5ZA 5I5IA 2YBAA 3L4MD 3I7KA 4J73A 2PM6B 2CN2A 3OKYB 4J78A 4CY2A 2G9AA 5B4WA 4H5JA 4GQ2P 2AGYA 3EI4A 3FGBA 5IGOA 2B5LA 2UZYB 3RFGA 2H68A 3OTTA 3OKTA 5FKTA 3PXWD 4K3JB 5CYKA 2AH0A 3C9CA 3ORVD 3RFHA 1JMZB 2Z2OA 3VA6A 2YNNA 4CY5A 4J82A 4GGCA 2I3SA 2GC7A 4EWRA 1VYHC 3VGZA 3K27A 4XYHA 2IAAA 4Y5RD 4JT6C 4AEZA 4NSXA 3C75H 4PNKB 4OWRA 3NVXA 4L9OA 4ZOXA 3I8EA 4XEIC 3EI4B 5HE3B 3MKQA 3A0FA 4FA4D 3SJLD 5TEFA 2P9KC 3V5WB 4L1QD 4D6VA 3GREA 2I0RA 1MG3A 3I7HA 4GMBA 3KRXB 4FAND 1SQ9A 1L0QA 4J0WA 2J56H 3PVWB 3F3PA 3AL8A 4J77A 4E54B 2H9NA 3JB9L 3NVNA 4ZOVA 4ZOZA 4BH6A 4A11A 1NEXB 4X3EA 4A0BA 3B7FA 2XU7A 5GMKn 3HFQA 2AGLA 2H3XA 3AL9A 4JSPC 5EMMB 2H6NA 3ODTA 2P9LC 4O3UB 3AH8B 3K26A 3SHFA 4D0KA 5C2VB 5FLXg 3J80g 4ZOYA 4GZ8A 4J8GA 4FHLA 5FKSA 4JSNC 1K8KC 2QXVA 2YNOA 4GQBB 1N6EA 3DWLC 4QT8A 4CI2A 2CNXA 4BUJC 3I2NA 4CC9A 3UVKA 3SN6B 4CZXA 3MZLA 4JSVC 3MXXA 2HKRA 4G56B 2XYIA 2OJYA 3CFVA 5CXBB 4ZN4A 4ES0A 3CIKB 2H9PA 4R7AB 3UVNA 1GG2B 5SXMA 3EI1B 3I89A 3RSEC 3U4YA 2OVQB 2GC4A 5FQDA 3SBQA 4JSXC 3EI1A 2AH1A 4Z8LA 5EMJB 4IA9A 4E5ZB 3UVLA 2PM9B 2YNPA 2MTAH 2OIZA 4TZ4A 5GSAA 2HJBA 3V7DB 3DXKC 5H14A 4O3TB 5K1CC 3V9FA 3AL8B 4K3ID 3FM0A 5IC7A 4ERZA 1N6DA 1GXRA 3UR4A 4L3HD 4GM9A 4J79A 2BCJB 2H9MA 3EU7A 3PE7A 3DXMC 3PXTD 5AMSA 4JT5C 4J0XA 2IUPA 3E0CA 5EMLB 4J84A 3IJ1A 4J8BA 4OZUA 3NVQA 5GXHA 3C5MA 3F3GA 4LG8A 3JROA 1FWXA 4PSXB 2CO0C
chains in the Genus database with same CATH superfamily
5HE2B 1YR2A 3RN0D 3EMHA 2AQ5A 1S4UX 1BPOA 5EM2A 4I79A 3GFCA 2G99A 2I3TA 3DSMA 4CZYA 3N0EA 2P9NC 2PM9A 3EWEA 3FCSA 4A0AB 4AOWA 1C9IA 3EI3A 1PEVA 1QFMA 4AX4A 2VC2A 4J86A 4O02A 1PI6A 3O4GA 1GOTB 2EIEA 2UZXB 5EAPA 4YVDA 2HU7A 1O6FA 3UKRC 2OK6A 3I8CA 4MMZA 4BL0A 3IURA 1QNIA 4BCDA 3SFZA 5K19A 2VZ1A 3UKUC 1R5MA 1XIPA 5C2WB 3PSCB 5AJAA 5IJ7E 3FRXA 2IWFA 1MDAH 1YFQA 4A09A 3SMRA 2YB8B 3JZGA 1XKSA 5HYNB 2H47A 1ERJA 3JZHA 3O4HA 1B9XA 4U1EI 1SHYB 5EARA 4KFMB 1C9LA 2GNQA 4G1EA 4LG9A 5H1MA 2H13A 3BWSA 5M5UA 2VDRA 1XHMA 4RE6A 3ZDZA 2XL2A 4GGAA 1PGUA 2HU8A 1SQJA 4IRZA 2P9UC 4MK0B 3JZNA 4CI8A 5M61A 4JHNA 5THAA 4IMMA 4O45A 3EG6A 3SBPA 2OVRB 3V4VA 1M1XA 2Q7QA 3OKWA 5KDOB 4JXMA 2IURA 2HXCA 1OLZA 2CO0A 2J57G 4LGNA 4H5IA 3C99A 2I0TA 3EI2B 3F3FA 1I2MB 3MUNA 1E5TA 4BCCA 3T3PA 3EI2A 3ZDXA 1UOPA 2BKLA 5FFGA 3OKYA 2QR5A 3L4OD 3UVOA 3MUOA 3IJCA 3MZKA 1H2XA 2XL3A 5I5JA 4ERYA 3I7OA 3PSLA 5EAMA 2W18A 3EQ8A 4FB1D 3NIDA 5EM2B 5TDHB 4GQ1A 3N0DA 2B5NA 1JOFA 4JHPC 5HDBA 3IIYA 3VH0A 3IVMA 4G55A 4BP9A 3OW8A 3RLMD 4L1MA 3SWSD 5EMKB 1JTDB 4CY1A 5C92A 2HYEA 3I7LA 5EALA 4MMYA 4X60B 3SCYA 2HJ4A 2Z2PA 4Y7RA 3MMYA 3IKOA 3ZWLB 2BBKH 4QQEA 2J55H 1U4CA 3MKSB 4RE5A 1Q47A 2JKXA 1QFSA 1N6FA 5IGQA 2B4EA 4NENA 3VI4A 1K3IA 4XYIA 5TEEA 4A0BB 4G1MA 2H9LA 4CY3A 5IT9g 4A2LA 4CI3A 1JMXB 4A2MA 4A0AA 3SVWD 2HESX 3GD1I 3OL2B 3JAMg 2B5MA 5A2Qg 3J81g 4PBYA 4PXWA 4GM3A 5H17A 2XE4A 4PBZA 3DDUA 4A7JA 2H14A 2HKMA 2IUQA 4JD2C 4E54A 3JPXA 1TYQC 4AMZA 4A11B 2EIDA 2Z2NA 3KRWB 2OVPB 4CZVA 2H6KA 2O9KA 1A0RB 5CXBA 2CN3A 4O1QD 4QAMA 4X61B 5HE0B 3BG1A 4Z7QA 4GGDA 5C9ZB 4WK0A 4DNUA 2HU5A 4A08B 3IIWA 3RMZD 4CI1A 4UM9A 1P22A 4ESGA 3NIFA 2PM7B 5FA5B 3EI3B 3AFCA 2XZGA 2OK4A 1U8CA 5TF2A 3W15A 1TBGA 2VDLA 3ULEC 4FAVD 3DM0A 4PC0A 4FA1D 2YMUA 4J81A 5M5VA 3SBRA 1GP2B 4UI9R 4QRJA 5HE1B 2TRCB 3SLED 4FA5D 4L3GD 4J87A 3IUQA 4ERQA 1UOOA 4DNWA 3OL2A 2AGWA 2EIBA 1RI6A 1TYEA 3I7NA 4BP8A 5FKRA 4NC4A 1UOQA 5AFU3 4Z7NA 3QHYB 5C86A 5GXIA 1PBYB 2PBIB 3RN1D 1NR0A 3RRMC 4FWWA 5CXCA 3CFSB 5FKQA 4U7AA 5FXYA 1K32A 1MG2A 2AGZA 2P9IC 5CXCB 3P4FA 5I5MA 1OMWB 4O9DA 2I0SA 5HQGA 2EBSA 4HDJA 3EQ9A 3PXSD 3SXTD 3V4PA 1JJUB 2QC5A 1B9YA 4GM8A 5CYKB 2CE8A 3PVUB 5M5RA 3JRPA 4D9SA 4QL1A 4A08A 3O4JA 2IUVA 4PSWB 4FA9D 2AGXA 2P9SC 4N14A 1U2VC 5JWZA 1H2ZA 4A09B 4MMXA 5IJ8E 4X63B 2P9PC 2IWKA 3BG0A 3I7PA 2CE9A 3UVMA 3IJ0A 3O4IA 4UM8A 2H6QA 1A12A 4E5ZA 5I5IA 2YBAA 3L4MD 3I7KA 4J73A 2PM6B 2CN2A 3OF7A 3OKYB 4J78A 4CY2A 2G9AA 5B4WA 4GQ2P 2AGYA 3EI4A 4H5JA 3FGBA 5IGOA 5M5TA 2B5LA 2UZYB 3RFGA 2H68A 3OTTA 3OKTA 5FKTA 3PXWD 4K3JB 5CYKA 2AH0A 5E6SA 3IUJA 3C9CA 3ORVD 3IULA 1JMZB 3RFHA 2Z2OA 3FCUA 4WK2A 3VA6A 2YNNA 4CY5A 4J82A 4GGCA 2I3SA 2GC7A 4EWRA 1H2YA 1VYHC 3VGZA 3K27A 4XYHA 2IAAA 3GC3B 5E6RA 1E8MA 4Y5RD 4JT6C 4AEZA 4NSXA 3C75H 4PNKB 4OWRA 3NVXA 4L9OA 4ZOXA 1H2WA 4AN1A 3I8EA 4XEIC 3EI4B 3IJEA 5HE3B 3MKQA 3A0FA 4FA4D 3IUMA 3SJLD 5TEFA 2P9KC 3V5WB 4L1QD 4D6VA 4NAAA 3IUNA 3GREA 2I0RA 1MG3A 3I7HA 4GMBA 3KRXB 3ZE0A 4FAND 1SQ9A 1L0QA 4J0WA 2J56H 3PVWB 1UTCA 3F3PA 3AL8A 3K72A 4J77A 4O2WA 4E54B 2H9NA 3JB9L 3NVNA 4ZOVA 4ZOZA 4Z7OA 1L5GA 4BH6A 4A11A 4DNVA 3KCIA 1NEXB 4X3EA 4A0BA 3B7FA 2XU7A 3ZDYA 5GMKn 3HFQA 2AGLA 3NIGA 3ZE1A 2H3XA 3AL9A 4JSPC 5EMMB 1JV2A 2H6NA 3ODTA 2P9LC 1GOFA 2VDKA 3AH8B 3K26A 4O3UB 3SHFA 4D0KA 5C2VB 5FFOA 5FLXg 3J80g 4ZOYA 3K71A 2QZPA 2VDOA 4GZ8A 4NBMA 4J8GA 4FHLA 5FKSA 4JSNC 4AMYA 4BCBA 2VDQA 1K8KC 2QXVA 2YNOA 4GQBB 4WK4A 1N6EA 2VDPA 3DWLC 3QI0A 4QT8A 4CI2A 3MVDK 2CNXA 1VE6A 4BUJC 3I2NA 4CC9A 3UVKA 3SN6B 3VI3A 4CZXA 3MZLA 4JSVC 1O6GA 3MXXA 2HKRA 3EQ7A 4G56B 2XYIA 1VZ3A 2OJYA 3CFVA 5CXBB 4ZN4A 4ES0A 3CIKB 2H9PA 4R7AB 3UVNA 1GG2B 5SXMA 3EI1B 3I89A 3RSEC 3U4YA 2OVQB 2GC4A 5FQDA 3SBQA 3T3MA 4JSXC 3EI1A 2AH1A 4Z8LA 5EMJB 4IA9A 4E5ZB 1VE7A 2VDNA 3UVLA 2PM9B 2YNPA 2MTAH 2OIZA 4TZ4A 5GSAA 2HJBA 3V7DB 3K6SA 3DXKC 5H14A 4O3TB 5K1CC 2VZ3A 3V9FA 3AL8B 4K3ID 5M5SA 3FM0A 5IC7A 4ERZA 1N6DA 1VZ2A 1GXRA 3UR4A 2XDWA 4L3HD 4GM9A 4J79A 2BCJB 2H9MA 1T2XA 3EU7A 3PE7A 3DXMC 3PXTD 5AMSA 4JT5C 4WJKA 4J0XA 2IUPA 2EICA 3E0CA 5EMLB 2WQ8A 4J84A 1GOHA 3IJ1A 4J8BA 4OZUA 3NVQA 5GXHA 3C5MA 5E6UA 1GOGA 3F3GA 2VDMA 4AN0A 4LG8A 3JROA 1FWXA 4PSXB 2CO0C 1E8NA 3ZE2A
chains in the Genus database with same CATH topology
5HE2B 3RN0D 3EMHA 2AQ5A 1S4UX 5EM2A 4I79A 3GFCA 2G99A 2I3TA 3DSMA 4CZYA 3N0EA 2P9NC 2PM9A 3EWEA 4A0AB 4AOWA 3EI3A 1PEVA 4J86A 1PI6A 1GOTB 2UZXB 5EAPA 4YVDA 3UKRC 2OK6A 3I8CA 4BL0A 1QNIA 3SFZA 5K19A 3UKUC 1R5MA 1XIPA 5C2WB 3PSCB 5AJAA 5IJ7E 3FRXA 2IWFA 1MDAH 1YFQA 4A09A 3SMRA 2YB8B 3JZGA 1XKSA 5HYNB 2H47A 1ERJA 3JZHA 1B9XA 4U1EI 1SHYB 5EARA 4KFMB 2GNQA 4LG9A 5H1MA 2H13A 3BWSA 1XHMA 2XL2A 4GGAA 1PGUA 1SQJA 2P9UC 4MK0B 3JZNA 4CI8A 5THAA 4IMMA 4O45A 3EG6A 3SBPA 2OVRB 2Q7QA 3OKWA 5KDOB 4JXMA 2IURA 2HXCA 1OLZA 2CO0A 2J57G 4LGNA 4H5IA 3C99A 2I0TA 3EI2B 3F3FA 3EI2A 3OKYA 3L4OD 3UVOA 3IJCA 3MZKA 2XL3A 5I5JA 4ERYA 3I7OA 3PSLA 5EAMA 2W18A 4FB1D 5EM2B 5TDHB 4GQ1A 3N0DA 2B5NA 1JOFA 3IIYA 3VH0A 3OW8A 3RLMD 3SWSD 5EMKB 4CY1A 2HYEA 3I7LA 5EALA 3SCYA 4X60B 2HJ4A 2Z2PA 4Y7RA 3MMYA 3IKOA 3ZWLB 2BBKH 4QQEA 2J55H 1U4CA 3MKSB 1Q47A 1N6FA 5IGQA 2B4EA 4XYIA 5TEEA 4A0BB 2H9LA 4CY3A 5IT9g 4A2LA 4CI3A 1JMXB 4A2MA 4A0AA 3SVWD 2HESX 3OL2B 3JAMg 2B5MA 5A2Qg 3J81g 4PBYA 4PXWA 4GM3A 5H17A 4PBZA 4A7JA 2H14A 2HKMA 2IUQA 4JD2C 4E54A 3JPXA 1TYQC 4A11B 2Z2NA 3KRWB 2OVPB 4CZVA 2H6KA 2O9KA 1A0RB 5CXBA 2CN3A 4O1QD 4X61B 5HE0B 3BG1A 5C9ZB 4GGDA 4A08B 3IIWA 3RMZD 4CI1A 1P22A 4ESGA 2PM7B 5FA5B 3EI3B 3AFCA 2OK4A 5TF2A 3W15A 1TBGA 4FAVD 3ULEC 3DM0A 4PC0A 4FA1D 2YMUA 4J81A 3SBRA 1GP2B 4UI9R 4QRJA 5HE1B 2TRCB 3SLED 4FA5D 4L3GD 4J87A 4ERQA 3OL2A 2AGWA 3I7NA 1RI6A 5FKRA 5AFU3 5GXIA 1PBYB 2PBIB 3RN1D 1NR0A 3RRMC 4FWWA 5CXCA 3CFSB 5FKQA 4U7AA 5FXYA 1K32A 1MG2A 2AGZA 2P9IC 5CXCB 3P4FA 5I5MA 1OMWB 4O9DA 2I0SA 5HQGA 2EBSA 4HDJA 3PXSD 3SXTD 1JJUB 2QC5A 1B9YA 4GM8A 5CYKB 2CE8A 3PVUB 3JRPA 4A08A 4QL1A 2IUVA 4PSWB 4FA9D 2AGXA 2P9SC 4N14A 1U2VC 5JWZA 4A09B 5IJ8E 4X63B 2P9PC 2IWKA 3BG0A 3I7PA 2CE9A 3UVMA 3IJ0A 2H6QA 4E5ZA 5I5IA 2YBAA 3L4MD 3I7KA 4J73A 2PM6B 2CN2A 3OKYB 4J78A 4CY2A 2G9AA 5B4WA 4H5JA 4GQ2P 2AGYA 3EI4A 3FGBA 5IGOA 2B5LA 2UZYB 3RFGA 2H68A 3OTTA 3OKTA 5FKTA 3PXWD 4K3JB 5CYKA 2AH0A 3C9CA 3ORVD 3RFHA 1JMZB 2Z2OA 3VA6A 2YNNA 4CY5A 4J82A 4GGCA 2I3SA 2GC7A 4EWRA 1VYHC 3VGZA 3K27A 4XYHA 2IAAA 4Y5RD 4JT6C 4AEZA 4NSXA 3C75H 4PNKB 4OWRA 3NVXA 4L9OA 4ZOXA 3I8EA 4XEIC 3EI4B 5HE3B 3MKQA 3A0FA 4FA4D 3SJLD 5TEFA 2P9KC 3V5WB 4L1QD 4D6VA 3GREA 2I0RA 1MG3A 3I7HA 4GMBA 3KRXB 4FAND 1SQ9A 1L0QA 4J0WA 2J56H 3PVWB 3F3PA 3AL8A 4J77A 4E54B 2H9NA 3JB9L 3NVNA 4ZOVA 4ZOZA 4BH6A 4A11A 1NEXB 4X3EA 4A0BA 3B7FA 2XU7A 5GMKn 3HFQA 2AGLA 2H3XA 3AL9A 4JSPC 5EMMB 2H6NA 3ODTA 2P9LC 4O3UB 3AH8B 3K26A 3SHFA 4D0KA 5C2VB 5FLXg 3J80g 4ZOYA 4GZ8A 4J8GA 4FHLA 5FKSA 4JSNC 1K8KC 2QXVA 2YNOA 4GQBB 1N6EA 3DWLC 4QT8A 4CI2A 2CNXA 4BUJC 3I2NA 4CC9A 3UVKA 3SN6B 4CZXA 3MZLA 4JSVC 3MXXA 2HKRA 4G56B 2XYIA 2OJYA 3CFVA 5CXBB 4ZN4A 4ES0A 3CIKB 2H9PA 4R7AB 3UVNA 1GG2B 5SXMA 3EI1B 3I89A 3RSEC 3U4YA 2OVQB 2GC4A 5FQDA 3SBQA 4JSXC 3EI1A 2AH1A 4Z8LA 5EMJB 4IA9A 4E5ZB 3UVLA 2PM9B 2YNPA 2MTAH 2OIZA 4TZ4A 5GSAA 2HJBA 3V7DB 3DXKC 5H14A 4O3TB 5K1CC 3V9FA 3AL8B 4K3ID 3FM0A 5IC7A 4ERZA 1N6DA 1GXRA 3UR4A 4L3HD 4GM9A 4J79A 2BCJB 2H9MA 3EU7A 3PE7A 3DXMC 3PXTD 5AMSA 4JT5C 4J0XA 2IUPA 3E0CA 5EMLB 4J84A 3IJ1A 4J8BA 4OZUA 3NVQA 5GXHA 3C5MA 3F3GA 4LG8A 3JROA 1FWXA 4PSXB 2CO0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HE2 B;  3RN0 D;  3EMH A;  2AQ5 A;  1S4U X;  5EM2 A;  4I79 A;  3GFC A;  2G99 A;  2I3T A;  3DSM A;  4CZY A;  3N0E A;  2P9N C;  2PM9 A;  3EWE A;  4A0A B;  4AOW A;  3EI3 A;  1PEV A;  4J86 A;  1PI6 A;  1GOT B;  2UZX B;  5EAP A;  4YVD A;  3UKR C;  2OK6 A;  3I8C A;  4BL0 A;  1QNI A;  3SFZ A;  5K19 A;  3UKU C;  1R5M A;  1XIP A;  5C2W B;  3PSC B;  5AJA A;  5IJ7 E;  3FRX A;  2IWF A;  1MDA H;  1YFQ A;  4A09 A;  3SMR A;  2YB8 B;  3JZG A;  1XKS A;  5HYN B;  2H47 A;  1ERJ A;  3JZH A;  1B9X A;  4U1E I;  1SHY B;  5EAR A;  4KFM B;  2GNQ A;  4LG9 A;  5H1M A;  2H13 A;  3BWS A;  1XHM A;  2XL2 A;  4GGA A;  1PGU A;  1SQJ A;  2P9U C;  4MK0 B;  3JZN A;  4CI8 A;  5THA A;  4IMM A;  4O45 A;  3EG6 A;  3SBP A;  2OVR B;  2Q7Q A;  3OKW A;  5KDO B;  4JXM A;  2IUR A;  2HXC A;  1OLZ A;  2CO0 A;  2J57 G;  4LGN A;  4H5I A;  3C99 A;  2I0T A;  3EI2 B;  3F3F A;  3EI2 A;  3OKY A;  3L4O D;  3UVO A;  3IJC A;  3MZK A;  2XL3 A;  5I5J A;  4ERY A;  3I7O A;  3PSL A;  5EAM A;  2W18 A;  4FB1 D;  5EM2 B;  5TDH B;  4GQ1 A;  3N0D A;  2B5N A;  1JOF A;  3IIY A;  3VH0 A;  3OW8 A;  3RLM D;  3SWS D;  5EMK B;  4CY1 A;  2HYE A;  3I7L A;  5EAL A;  3SCY A;  4X60 B;  2HJ4 A;  2Z2P A;  4Y7R A;  3MMY A;  3IKO A;  3ZWL B;  2BBK H;  4QQE A;  2J55 H;  1U4C A;  3MKS B;  1Q47 A;  1N6F A;  5IGQ A;  2B4E A;  4XYI A;  5TEE A;  4A0B B;  2H9L A;  4CY3 A;  5IT9 g;  4A2L A;  4CI3 A;  1JMX B;  4A2M A;  4A0A A;  3SVW D;  2HES X;  3OL2 B;  3JAM g;  2B5M A;  5A2Q g;  3J81 g;  4PBY A;  4PXW A;  4GM3 A;  5H17 A;  4PBZ A;  4A7J A;  2H14 A;  2HKM A;  2IUQ A;  4JD2 C;  4E54 A;  3JPX A;  1TYQ C;  4A11 B;  2Z2N A;  3KRW B;  2OVP B;  4CZV A;  2H6K A;  2O9K A;  1A0R B;  5CXB A;  2CN3 A;  4O1Q D;  4X61 B;  5HE0 B;  3BG1 A;  5C9Z B;  4GGD A;  4A08 B;  3IIW A;  3RMZ D;  4CI1 A;  1P22 A;  4ESG A;  2PM7 B;  5FA5 B;  3EI3 B;  3AFC A;  2OK4 A;  5TF2 A;  3W15 A;  1TBG A;  4FAV D;  3ULE C;  3DM0 A;  4PC0 A;  4FA1 D;  2YMU A;  4J81 A;  3SBR A;  1GP2 B;  4UI9 R;  4QRJ A;  5HE1 B;  2TRC B;  3SLE D;  4FA5 D;  4L3G D;  4J87 A;  4ERQ A;  3OL2 A;  2AGW A;  3I7N A;  1RI6 A;  5FKR A;  5AFU 3;  5GXI A;  1PBY B;  2PBI B;  3RN1 D;  1NR0 A;  3RRM C;  4FWW A;  5CXC A;  3CFS B;  5FKQ A;  4U7A A;  5FXY A;  1K32 A;  1MG2 A;  2AGZ A;  2P9I C;  5CXC B;  3P4F A;  5I5M A;  1OMW B;  4O9D A;  2I0S A;  5HQG A;  2EBS A;  4HDJ A;  3PXS D;  3SXT D;  1JJU B;  2QC5 A;  1B9Y A;  4GM8 A;  5CYK B;  2CE8 A;  3PVU B;  3JRP A;  4A08 A;  4QL1 A;  2IUV A;  4PSW B;  4FA9 D;  2AGX A;  2P9S C;  4N14 A;  1U2V C;  5JWZ A;  4A09 B;  5IJ8 E;  4X63 B;  2P9P C;  2IWK A;  3BG0 A;  3I7P A;  2CE9 A;  3UVM A;  3IJ0 A;  2H6Q A;  4E5Z A;  5I5I A;  2YBA A;  3L4M D;  3I7K A;  4J73 A;  2PM6 B;  2CN2 A;  3OKY B;  4J78 A;  4CY2 A;  2G9A A;  5B4W A;  4H5J A;  4GQ2 P;  2AGY A;  3EI4 A;  3FGB A;  5IGO A;  2B5L A;  2UZY B;  3RFG A;  2H68 A;  3OTT A;  3OKT A;  5FKT A;  3PXW D;  4K3J B;  5CYK A;  2AH0 A;  3C9C A;  3ORV D;  3RFH A;  1JMZ B;  2Z2O A;  3VA6 A;  2YNN A;  4CY5 A;  4J82 A;  4GGC A;  2I3S A;  2GC7 A;  4EWR A;  1VYH C;  3VGZ A;  3K27 A;  4XYH A;  2IAA A;  4Y5R D;  4JT6 C;  4AEZ A;  4NSX A;  3C75 H;  4PNK B;  4OWR A;  3NVX A;  4L9O A;  4ZOX A;  3I8E A;  4XEI C;  3EI4 B;  5HE3 B;  3MKQ A;  3A0F A;  4FA4 D;  3SJL D;  5TEF A;  2P9K C;  3V5W B;  4L1Q D;  4D6V A;  3GRE A;  2I0R A;  1MG3 A;  3I7H A;  4GMB A;  3KRX B;  4FAN D;  1SQ9 A;  1L0Q A;  4J0W A;  2J56 H;  3PVW B;  3F3P A;  3AL8 A;  4J77 A;  4E54 B;  2H9N A;  3JB9 L;  3NVN A;  4ZOV A;  4ZOZ A;  4BH6 A;  4A11 A;  1NEX B;  4X3E A;  4A0B A;  3B7F A;  2XU7 A;  5GMK n;  3HFQ A;  2AGL A;  2H3X A;  3AL9 A;  4JSP C;  5EMM B;  2H6N A;  3ODT A;  2P9L C;  4O3U B;  3AH8 B;  3K26 A;  3SHF A;  4D0K A;  5C2V B;  5FLX g;  3J80 g;  4ZOY A;  4GZ8 A;  4J8G A;  4FHL A;  5FKS A;  4JSN C;  1K8K C;  2QXV A;  2YNO A;  4GQB B;  1N6E A;  3DWL C;  4QT8 A;  4CI2 A;  2CNX A;  4BUJ C;  3I2N A;  4CC9 A;  3UVK A;  3SN6 B;  4CZX A;  3MZL A;  4JSV C;  3MXX A;  2HKR A;  4G56 B;  2XYI A;  2OJY A;  3CFV A;  5CXB B;  4ZN4 A;  4ES0 A;  3CIK B;  2H9P A;  4R7A B;  3UVN A;  1GG2 B;  5SXM A;  3EI1 B;  3I89 A;  3RSE C;  3U4Y A;  2OVQ B;  2GC4 A;  5FQD A;  3SBQ A;  4JSX C;  3EI1 A;  2AH1 A;  4Z8L A;  5EMJ B;  4IA9 A;  4E5Z B;  3UVL A;  2PM9 B;  2YNP A;  2MTA H;  2OIZ A;  4TZ4 A;  5GSA A;  2HJB A;  3V7D B;  3DXK C;  5H14 A;  4O3T B;  5K1C C;  3V9F A;  3AL8 B;  4K3I D;  3FM0 A;  5IC7 A;  4ERZ A;  1N6D A;  1GXR A;  3UR4 A;  4L3H D;  4GM9 A;  4J79 A;  2BCJ B;  2H9M A;  3EU7 A;  3PE7 A;  3DXM C;  3PXT D;  5AMS A;  4JT5 C;  4J0X A;  2IUP A;  3E0C A;  5EML B;  4J84 A;  3IJ1 A;  4J8B A;  4OZU A;  3NVQ A;  5GXH A;  3C5M A;  3F3G A;  4LG8 A;  3JRO A;  1FWX A;  4PSX B;  2CO0 C; 
#chains in the Genus database with same CATH topology
 5HE2 B;  1YR2 A;  3RN0 D;  3EMH A;  2AQ5 A;  1S4U X;  1BPO A;  5EM2 A;  4I79 A;  3GFC A;  2G99 A;  2I3T A;  3DSM A;  4CZY A;  3N0E A;  2P9N C;  2PM9 A;  3EWE A;  3FCS A;  4A0A B;  4AOW A;  1C9I A;  3EI3 A;  1PEV A;  1QFM A;  4AX4 A;  2VC2 A;  4J86 A;  4O02 A;  1PI6 A;  3O4G A;  1GOT B;  2EIE A;  2UZX B;  5EAP A;  4YVD A;  2HU7 A;  1O6F A;  3UKR C;  2OK6 A;  3I8C A;  4MMZ A;  4BL0 A;  3IUR A;  1QNI A;  4BCD A;  3SFZ A;  5K19 A;  2VZ1 A;  3UKU C;  1R5M A;  1XIP A;  5C2W B;  3PSC B;  5AJA A;  5IJ7 E;  3FRX A;  2IWF A;  1MDA H;  1YFQ A;  4A09 A;  3SMR A;  2YB8 B;  3JZG A;  1XKS A;  5HYN B;  2H47 A;  1ERJ A;  3JZH A;  3O4H A;  1B9X A;  4U1E I;  1SHY B;  5EAR A;  4KFM B;  1C9L A;  2GNQ A;  4G1E A;  4LG9 A;  5H1M A;  2H13 A;  3BWS A;  5M5U A;  2VDR A;  1XHM A;  4RE6 A;  3ZDZ A;  2XL2 A;  4GGA A;  1PGU A;  2HU8 A;  1SQJ A;  4IRZ A;  2P9U C;  4MK0 B;  3JZN A;  4CI8 A;  5M61 A;  4JHN A;  5THA A;  4IMM A;  4O45 A;  3EG6 A;  3SBP A;  2OVR B;  3V4V A;  1M1X A;  2Q7Q A;  3OKW A;  5KDO B;  4JXM A;  2IUR A;  2HXC A;  1OLZ A;  2CO0 A;  2J57 G;  4LGN A;  4H5I A;  3C99 A;  2I0T A;  3EI2 B;  3F3F A;  1I2M B;  3MUN A;  1E5T A;  4BCC A;  3T3P A;  3EI2 A;  3ZDX A;  1UOP A;  2BKL A;  5FFG A;  3OKY A;  2QR5 A;  3L4O D;  3UVO A;  3MUO A;  3IJC A;  3MZK A;  1H2X A;  2XL3 A;  5I5J A;  4ERY A;  3I7O A;  3PSL A;  5EAM A;  2W18 A;  3EQ8 A;  4FB1 D;  3NID A;  5EM2 B;  5TDH B;  4GQ1 A;  3N0D A;  2B5N A;  1JOF A;  4JHP C;  5HDB A;  3IIY A;  3VH0 A;  3IVM A;  4G55 A;  4BP9 A;  3OW8 A;  3RLM D;  4L1M A;  3SWS D;  5EMK B;  1JTD B;  4CY1 A;  5C92 A;  2HYE A;  3I7L A;  5EAL A;  4MMY A;  4X60 B;  3SCY A;  2HJ4 A;  2Z2P A;  4Y7R A;  3MMY A;  3IKO A;  3ZWL B;  2BBK H;  4QQE A;  2J55 H;  1U4C A;  3MKS B;  4RE5 A;  1Q47 A;  2JKX A;  1QFS A;  1N6F A;  5IGQ A;  2B4E A;  4NEN A;  3VI4 A;  1K3I A;  4XYI A;  5TEE A;  4A0B B;  4G1M A;  2H9L A;  4CY3 A;  5IT9 g;  4A2L A;  4CI3 A;  1JMX B;  4A2M A;  4A0A A;  3SVW D;  2HES X;  3GD1 I;  3OL2 B;  3JAM g;  2B5M A;  5A2Q g;  3J81 g;  4PBY A;  4PXW A;  4GM3 A;  5H17 A;  2XE4 A;  4PBZ A;  3DDU A;  4A7J A;  2H14 A;  2HKM A;  2IUQ A;  4JD2 C;  4E54 A;  3JPX A;  1TYQ C;  4AMZ A;  4A11 B;  2EID A;  2Z2N A;  3KRW B;  2OVP B;  4CZV A;  2H6K A;  2O9K A;  1A0R B;  5CXB A;  2CN3 A;  4O1Q D;  4QAM A;  4X61 B;  5HE0 B;  3BG1 A;  4Z7Q A;  4GGD A;  5C9Z B;  4WK0 A;  4DNU A;  2HU5 A;  4A08 B;  3IIW A;  3RMZ D;  4CI1 A;  4UM9 A;  1P22 A;  4ESG A;  3NIF A;  2PM7 B;  5FA5 B;  3EI3 B;  3AFC A;  2XZG A;  2OK4 A;  1U8C A;  5TF2 A;  3W15 A;  1TBG A;  2VDL A;  3ULE C;  4FAV D;  3DM0 A;  4PC0 A;  4FA1 D;  2YMU A;  4J81 A;  5M5V A;  3SBR A;  1GP2 B;  4UI9 R;  4QRJ A;  5HE1 B;  2TRC B;  3SLE D;  4FA5 D;  4L3G D;  4J87 A;  3IUQ A;  4ERQ A;  1UOO A;  4DNW A;  3OL2 A;  2AGW A;  2EIB A;  1RI6 A;  1TYE A;  3I7N A;  4BP8 A;  5FKR A;  4NC4 A;  1UOQ A;  5AFU 3;  4Z7N A;  3QHY B;  5C86 A;  5GXI A;  1PBY B;  2PBI B;  3RN1 D;  1NR0 A;  3RRM C;  4FWW A;  5CXC A;  3CFS B;  5FKQ A;  4U7A A;  5FXY A;  1K32 A;  1MG2 A;  2AGZ A;  2P9I C;  5CXC B;  3P4F A;  5I5M A;  1OMW B;  4O9D A;  2I0S A;  5HQG A;  2EBS A;  4HDJ A;  3EQ9 A;  3PXS D;  3SXT D;  3V4P A;  1JJU B;  2QC5 A;  1B9Y A;  4GM8 A;  5CYK B;  2CE8 A;  3PVU B;  5M5R A;  3JRP A;  4D9S A;  4QL1 A;  4A08 A;  3O4J A;  2IUV A;  4PSW B;  4FA9 D;  2AGX A;  2P9S C;  4N14 A;  1U2V C;  5JWZ A;  1H2Z A;  4A09 B;  4MMX A;  5IJ8 E;  4X63 B;  2P9P C;  2IWK A;  3BG0 A;  3I7P A;  2CE9 A;  3UVM A;  3IJ0 A;  3O4I A;  4UM8 A;  2H6Q A;  1A12 A;  4E5Z A;  5I5I A;  2YBA A;  3L4M D;  3I7K A;  4J73 A;  2PM6 B;  2CN2 A;  3OF7 A;  3OKY B;  4J78 A;  4CY2 A;  2G9A A;  5B4W A;  4GQ2 P;  2AGY A;  3EI4 A;  4H5J A;  3FGB A;  5IGO A;  5M5T A;  2B5L A;  2UZY B;  3RFG A;  2H68 A;  3OTT A;  3OKT A;  5FKT A;  3PXW D;  4K3J B;  5CYK A;  2AH0 A;  5E6S A;  3IUJ A;  3C9C A;  3ORV D;  3IUL A;  1JMZ B;  3RFH A;  2Z2O A;  3FCU A;  4WK2 A;  3VA6 A;  2YNN A;  4CY5 A;  4J82 A;  4GGC A;  2I3S A;  2GC7 A;  4EWR A;  1H2Y A;  1VYH C;  3VGZ A;  3K27 A;  4XYH A;  2IAA A;  3GC3 B;  5E6R A;  1E8M A;  4Y5R D;  4JT6 C;  4AEZ A;  4NSX A;  3C75 H;  4PNK B;  4OWR A;  3NVX A;  4L9O A;  4ZOX A;  1H2W A;  4AN1 A;  3I8E A;  4XEI C;  3EI4 B;  3IJE A;  5HE3 B;  3MKQ A;  3A0F A;  4FA4 D;  3IUM A;  3SJL D;  5TEF A;  2P9K C;  3V5W B;  4L1Q D;  4D6V A;  4NAA A;  3IUN A;  3GRE A;  2I0R A;  1MG3 A;  3I7H A;  4GMB A;  3KRX B;  3ZE0 A;  4FAN D;  1SQ9 A;  1L0Q A;  4J0W A;  2J56 H;  3PVW B;  1UTC A;  3F3P A;  3AL8 A;  3K72 A;  4J77 A;  4O2W A;  4E54 B;  2H9N A;  3JB9 L;  3NVN A;  4ZOV A;  4ZOZ A;  4Z7O A;  1L5G A;  4BH6 A;  4A11 A;  4DNV A;  3KCI A;  1NEX B;  4X3E A;  4A0B A;  3B7F A;  2XU7 A;  3ZDY A;  5GMK n;  3HFQ A;  2AGL A;  3NIG A;  3ZE1 A;  2H3X A;  3AL9 A;  4JSP C;  5EMM B;  1JV2 A;  2H6N A;  3ODT A;  2P9L C;  1GOF A;  2VDK A;  3AH8 B;  3K26 A;  4O3U B;  3SHF A;  4D0K A;  5C2V B;  5FFO A;  5FLX g;  3J80 g;  4ZOY A;  3K71 A;  2QZP A;  2VDO A;  4GZ8 A;  4NBM A;  4J8G A;  4FHL A;  5FKS A;  4JSN C;  4AMY A;  4BCB A;  2VDQ A;  1K8K C;  2QXV A;  2YNO A;  4GQB B;  4WK4 A;  1N6E A;  2VDP A;  3DWL C;  3QI0 A;  4QT8 A;  4CI2 A;  3MVD K;  2CNX A;  1VE6 A;  4BUJ C;  3I2N A;  4CC9 A;  3UVK A;  3SN6 B;  3VI3 A;  4CZX A;  3MZL A;  4JSV C;  1O6G A;  3MXX A;  2HKR A;  3EQ7 A;  4G56 B;  2XYI A;  1VZ3 A;  2OJY A;  3CFV A;  5CXB B;  4ZN4 A;  4ES0 A;  3CIK B;  2H9P A;  4R7A B;  3UVN A;  1GG2 B;  5SXM A;  3EI1 B;  3I89 A;  3RSE C;  3U4Y A;  2OVQ B;  2GC4 A;  5FQD A;  3SBQ A;  3T3M A;  4JSX C;  3EI1 A;  2AH1 A;  4Z8L A;  5EMJ B;  4IA9 A;  4E5Z B;  1VE7 A;  2VDN A;  3UVL A;  2PM9 B;  2YNP A;  2MTA H;  2OIZ A;  4TZ4 A;  5GSA A;  2HJB A;  3V7D B;  3K6S A;  3DXK C;  5H14 A;  4O3T B;  5K1C C;  2VZ3 A;  3V9F A;  3AL8 B;  4K3I D;  5M5S A;  3FM0 A;  5IC7 A;  4ERZ A;  1N6D A;  1VZ2 A;  1GXR A;  3UR4 A;  2XDW A;  4L3H D;  4GM9 A;  4J79 A;  2BCJ B;  2H9M A;  1T2X A;  3EU7 A;  3PE7 A;  3DXM C;  3PXT D;  5AMS A;  4JT5 C;  4WJK A;  4J0X A;  2IUP A;  2EIC A;  3E0C A;  5EML B;  2WQ8 A;  4J84 A;  1GOH A;  3IJ1 A;  4J8B A;  4OZU A;  3NVQ A;  5GXH A;  3C5M A;  5E6U A;  1GOG A;  3F3G A;  2VDM A;  4AN0 A;  4LG8 A;  3JRO A;  1FWX A;  4PSX B;  2CO0 C;  1E8N A;  3ZE2 A; 
#chains in the Genus database with same CATH homology
 5HE2 B;  3RN0 D;  3EMH A;  2AQ5 A;  1S4U X;  5EM2 A;  4I79 A;  3GFC A;  2G99 A;  2I3T A;  3DSM A;  4CZY A;  3N0E A;  2P9N C;  2PM9 A;  3EWE A;  4A0A B;  4AOW A;  3EI3 A;  1PEV A;  4J86 A;  1PI6 A;  1GOT B;  2UZX B;  5EAP A;  4YVD A;  3UKR C;  2OK6 A;  3I8C A;  4BL0 A;  1QNI A;  3SFZ A;  5K19 A;  3UKU C;  1R5M A;  1XIP A;  5C2W B;  3PSC B;  5AJA A;  5IJ7 E;  3FRX A;  2IWF A;  1MDA H;  1YFQ A;  4A09 A;  3SMR A;  2YB8 B;  3JZG A;  1XKS A;  5HYN B;  2H47 A;  1ERJ A;  3JZH A;  1B9X A;  4U1E I;  1SHY B;  5EAR A;  4KFM B;  2GNQ A;  4LG9 A;  5H1M A;  2H13 A;  3BWS A;  1XHM A;  2XL2 A;  4GGA A;  1PGU A;  1SQJ A;  2P9U C;  4MK0 B;  3JZN A;  4CI8 A;  5THA A;  4IMM A;  4O45 A;  3EG6 A;  3SBP A;  2OVR B;  2Q7Q A;  3OKW A;  5KDO B;  4JXM A;  2IUR A;  2HXC A;  1OLZ A;  2CO0 A;  2J57 G;  4LGN A;  4H5I A;  3C99 A;  2I0T A;  3EI2 B;  3F3F A;  3EI2 A;  3OKY A;  3L4O D;  3UVO A;  3IJC A;  3MZK A;  2XL3 A;  5I5J A;  4ERY A;  3I7O A;  3PSL A;  5EAM A;  2W18 A;  4FB1 D;  5EM2 B;  5TDH B;  4GQ1 A;  3N0D A;  2B5N A;  1JOF A;  3IIY A;  3VH0 A;  3OW8 A;  3RLM D;  3SWS D;  5EMK B;  4CY1 A;  2HYE A;  3I7L A;  5EAL A;  3SCY A;  4X60 B;  2HJ4 A;  2Z2P A;  4Y7R A;  3MMY A;  3IKO A;  3ZWL B;  2BBK H;  4QQE A;  2J55 H;  1U4C A;  3MKS B;  1Q47 A;  1N6F A;  5IGQ A;  2B4E A;  4XYI A;  5TEE A;  4A0B B;  2H9L A;  4CY3 A;  5IT9 g;  4A2L A;  4CI3 A;  1JMX B;  4A2M A;  4A0A A;  3SVW D;  2HES X;  3OL2 B;  3JAM g;  2B5M A;  5A2Q g;  3J81 g;  4PBY A;  4PXW A;  4GM3 A;  5H17 A;  4PBZ A;  4A7J A;  2H14 A;  2HKM A;  2IUQ A;  4JD2 C;  4E54 A;  3JPX A;  1TYQ C;  4A11 B;  2Z2N A;  3KRW B;  2OVP B;  4CZV A;  2H6K A;  2O9K A;  1A0R B;  5CXB A;  2CN3 A;  4O1Q D;  4X61 B;  5HE0 B;  3BG1 A;  5C9Z B;  4GGD A;  4A08 B;  3IIW A;  3RMZ D;  4CI1 A;  1P22 A;  4ESG A;  2PM7 B;  5FA5 B;  3EI3 B;  3AFC A;  2OK4 A;  5TF2 A;  3W15 A;  1TBG A;  4FAV D;  3ULE C;  3DM0 A;  4PC0 A;  4FA1 D;  2YMU A;  4J81 A;  3SBR A;  1GP2 B;  4UI9 R;  4QRJ A;  5HE1 B;  2TRC B;  3SLE D;  4FA5 D;  4L3G D;  4J87 A;  4ERQ A;  3OL2 A;  2AGW A;  3I7N A;  1RI6 A;  5FKR A;  5AFU 3;  5GXI A;  1PBY B;  2PBI B;  3RN1 D;  1NR0 A;  3RRM C;  4FWW A;  5CXC A;  3CFS B;  5FKQ A;  4U7A A;  5FXY A;  1K32 A;  1MG2 A;  2AGZ A;  2P9I C;  5CXC B;  3P4F A;  5I5M A;  1OMW B;  4O9D A;  2I0S A;  5HQG A;  2EBS A;  4HDJ A;  3PXS D;  3SXT D;  1JJU B;  2QC5 A;  1B9Y A;  4GM8 A;  5CYK B;  2CE8 A;  3PVU B;  3JRP A;  4A08 A;  4QL1 A;  2IUV A;  4PSW B;  4FA9 D;  2AGX A;  2P9S C;  4N14 A;  1U2V C;  5JWZ A;  4A09 B;  5IJ8 E;  4X63 B;  2P9P C;  2IWK A;  3BG0 A;  3I7P A;  2CE9 A;  3UVM A;  3IJ0 A;  2H6Q A;  4E5Z A;  5I5I A;  2YBA A;  3L4M D;  3I7K A;  4J73 A;  2PM6 B;  2CN2 A;  3OKY B;  4J78 A;  4CY2 A;  2G9A A;  5B4W A;  4H5J A;  4GQ2 P;  2AGY A;  3EI4 A;  3FGB A;  5IGO A;  2B5L A;  2UZY B;  3RFG A;  2H68 A;  3OTT A;  3OKT A;  5FKT A;  3PXW D;  4K3J B;  5CYK A;  2AH0 A;  3C9C A;  3ORV D;  3RFH A;  1JMZ B;  2Z2O A;  3VA6 A;  2YNN A;  4CY5 A;  4J82 A;  4GGC A;  2I3S A;  2GC7 A;  4EWR A;  1VYH C;  3VGZ A;  3K27 A;  4XYH A;  2IAA A;  4Y5R D;  4JT6 C;  4AEZ A;  4NSX A;  3C75 H;  4PNK B;  4OWR A;  3NVX A;  4L9O A;  4ZOX A;  3I8E A;  4XEI C;  3EI4 B;  5HE3 B;  3MKQ A;  3A0F A;  4FA4 D;  3SJL D;  5TEF A;  2P9K C;  3V5W B;  4L1Q D;  4D6V A;  3GRE A;  2I0R A;  1MG3 A;  3I7H A;  4GMB A;  3KRX B;  4FAN D;  1SQ9 A;  1L0Q A;  4J0W A;  2J56 H;  3PVW B;  3F3P A;  3AL8 A;  4J77 A;  4E54 B;  2H9N A;  3JB9 L;  3NVN A;  4ZOV A;  4ZOZ A;  4BH6 A;  4A11 A;  1NEX B;  4X3E A;  4A0B A;  3B7F A;  2XU7 A;  5GMK n;  3HFQ A;  2AGL A;  2H3X A;  3AL9 A;  4JSP C;  5EMM B;  2H6N A;  3ODT A;  2P9L C;  4O3U B;  3AH8 B;  3K26 A;  3SHF A;  4D0K A;  5C2V B;  5FLX g;  3J80 g;  4ZOY A;  4GZ8 A;  4J8G A;  4FHL A;  5FKS A;  4JSN C;  1K8K C;  2QXV A;  2YNO A;  4GQB B;  1N6E A;  3DWL C;  4QT8 A;  4CI2 A;  2CNX A;  4BUJ C;  3I2N A;  4CC9 A;  3UVK A;  3SN6 B;  4CZX A;  3MZL A;  4JSV C;  3MXX A;  2HKR A;  4G56 B;  2XYI A;  2OJY A;  3CFV A;  5CXB B;  4ZN4 A;  4ES0 A;  3CIK B;  2H9P A;  4R7A B;  3UVN A;  1GG2 B;  5SXM A;  3EI1 B;  3I89 A;  3RSE C;  3U4Y A;  2OVQ B;  2GC4 A;  5FQD A;  3SBQ A;  4JSX C;  3EI1 A;  2AH1 A;  4Z8L A;  5EMJ B;  4IA9 A;  4E5Z B;  3UVL A;  2PM9 B;  2YNP A;  2MTA H;  2OIZ A;  4TZ4 A;  5GSA A;  2HJB A;  3V7D B;  3DXK C;  5H14 A;  4O3T B;  5K1C C;  3V9F A;  3AL8 B;  4K3I D;  3FM0 A;  5IC7 A;  4ERZ A;  1N6D A;  1GXR A;  3UR4 A;  4L3H D;  4GM9 A;  4J79 A;  2BCJ B;  2H9M A;  3EU7 A;  3PE7 A;  3DXM C;  3PXT D;  5AMS A;  4JT5 C;  4J0X A;  2IUP A;  3E0C A;  5EML B;  4J84 A;  3IJ1 A;  4J8B A;  4OZU A;  3NVQ A;  5GXH A;  3C5M A;  3F3G A;  4LG8 A;  3JRO A;  1FWX A;  4PSX B;  2CO0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...