4JSXC

Structure of mtordeltan-mlst8-torin2 complex
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
317
structure length
317
Chain Sequence
VGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase mTOR
publication title mTOR kinase structure, mechanism and regulation.
pubmed doi rcsb
source organism Homo sapiens
total genus 74
structure length 317
sequence length 317
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4jsxC01
4GM3A 3SJLD 4O3TB 2OK6A 4CI1A 2H6NA 3IKOA 3OW8A 4GQBB 3SWSD 5CXCA 5EALA 3RFHA 4J0WA 3CIKB 3DSMA 4A09A 3OKYB 5TF2A 4BUJC 3KRWB 3MZKA 3SXTD 4L1QD 5FLXg 1JJUB 3SLED 3C5MA 4LGNA 5KDOB 3A0FA 3EWEA 4Y7RA 4QRJA 2XL3A 3VA6A 3E0CA 4J8BA 5SXMA 3RFGA 3JAMg 3MKQA 1XHMA 4A0BA 3SN6B 3N0EA 5K19A 5C2WB 1QNIA 4GGCA 3IIYA 1YFQA 2B4EA 4FA5D 2XYIA 5JWZA 3EI1B 2OVRB 2GNQA 4FA1D 3MMYA 3UR4A 2Z2NA 3DXKC 4A08A 2P9SC 3UKUC 4XYIA 1P22A 4X3EA 2YB8B 3UVOA 4ZOYA 3NVQA 5IGQA 2IUVA 4FHLA 4K3ID 4ESGA 4J82A 5EAPA 1U2VC 2YNNA 1OLZA 1SQJA 3N0DA 3PVWB 2H3XA 1N6DA 5THAA 3MXXA 2PM7B 2HKMA 1PEVA 1PGUA 5AFU3 3NVNA 2PBIB 4ES0A 3JRPA 1R5MA 4PSXB 4CZXA 2AGXA 4FB1D 3DWLC 3IJCA 1ERJA 5EMKB 5FA5B 5CXBB 4CI8A 5FXYA 4KFMB 3OL2B 4BH6A 4A0AB 2H14A 3PXSD 4FA4D 3RMZD 5EMMB 5FKSA 5EMLB 2CN3A 1L0QA 2IUPA 4D0KA 4L3HD 2CN2A 4FWWA 3UVKA 3EI4B 1A0RB 5HYNB 3IIWA 4TZ4A 2IWKA 5GXIA 2B5LA 2P9NC 5HE1B 2H6KA 2OJYA 5IJ8E 2Q7QA 4YVDA 5TEEA 5HQGA 2PM6B 4QT8A 1MG3A 2I3SA 5IJ7E 2YMUA 1GXRA 3I2NA 4JSPC 4A2LA 2AGZA 3JROA 3KRXB 2XU7A 3B7FA 5EM2A 3C99A 5EMJB 4JT6C 5HE2B 3V7DB 3FRXA 2G99A 4PBZA 4X63B 3VGZA 4CY1A 2HESX 4D6VA 5AJAA 3OKWA 3SCYA 2AH1A 2YNOA 3C9CA 4FA9D 2BBKH 4CC9A 2H13A 3UVLA 1NR0A 2EBSA 4K3JB 4ERYA 4J79A 3OKYA 2PM9B 5GMKn 4QQEA 2GC4A 3UVNA 2GC7A 2I0TA 2XL2A 4PBYA 2AGLA 4X61B 1FWXA 2IURA 2CO0C 4JD2C 3UKRC 2IWFA 3GREA 3IJ1A 3J81g 1JOFA 3CFSB 3CFVA 3BG1A 3V5WB 4J8GA 2QXVA 2QC5A 4J86A 5HE3B 1K8KC 3IJ0A 4L3GD 2AGYA 4OZUA 5I5IA 2H9LA 4Y5RD 1MG2A 3OTTA 4AOWA 3P4FA 3I7LA 2OIZA 1TBGA 3PSCB 1SHYB 4GMBA 3EI1A 4CY5A 1B9YA 4PNKB 4JT5C 4PSWB 2H6QA 3UVMA 4E54B 3FGBA 4BL0A 4LG8A 2MTAH 3EI3B 4MK0B 4E5ZB 5TEFA 4J81A 3AL8B 4CZVA 3EI2B 1N6EA 4I79A 4XYHA 3PXWD 3L4OD 1GG2B 5CYKB 4O9DA 3BWSA 2UZXB 3I7NA 1GOTB 5I5MA 5IGOA 4A11B 3VH0A 1JMZB 4J87A 2B5MA 1OMWB 4O45A 3JZHA 4CY3A 1VYHC 2CNXA 2HXCA 2I0SA 3JZNA 5EAMA 2P9KC 2G9AA 2OK4A 3J80g 3EU7A 4Z8LA 2P9LC 5H1MA 5CXBA 5GXHA 4JXMA 2HJBA 4H5JA 4A0AA 3K27A 1SQ9A 4O3UB 3C75H 4J73A 4ZOXA 3K26A 3L4MD 3FM0A 5CXCB 3I89A 5A2Qg 3JPXA 2BCJB 4A09B 3ORVD 5K1CC 5IC7A 5FQDA 3RSEC 2HYEA 3SBRA 1S4UX 1N6FA 3F3PA 1JMXB 3EI4A 3JZGA 4GM9A 2HJ4A 4N14A 2H9PA 4GM8A 3W15A 2J55H 2P9IC 3I8EA 4CY2A 3HFQA 4GZ8A 4U1EI 3BG0A 3PXTD 2I3TA 2AQ5A 4CZYA 5H17A 1Q47A 3OKTA 4A0BB 4UI9R 5TDHB 4ERQA 4GQ2P 2CE9A 4J84A 3SBQA 2P9PC 1K32A 3U4YA 3NVXA 3AFCA 4A7JA 3RRMC 2OVQB 4CI3A 1GP2B 3SBPA 2CO0A 2J57G 5FKQA 2HKRA 4A08B 4CI2A 1B9XA 1PBYB 5C9ZB 3ODTA 4J77A 4JSXC 2Z2PA 4A2MA 3SHFA 2YBAA 4J78A 5H14A 2H68A 3PE7A 3ULEC 5FKTA 4L9OA 2CE8A 1XIPA 2PM9A 2H9MA 3I7HA 4O1QD 3SVWD 4U7AA 3JB9L 4ZN4A 3PVUB 5HE0B 4IA9A 3RN1D 4JSNC 2AH0A 3RLMD 3SMRA 1MDAH 3EMHA 3GFCA 2P9UC 4GGAA 3EG6A 4PC0A 5FKRA 5B4WA 3F3GA 5GSAA 4NSXA 1RI6A 4LG9A 4ZOZA 2B5NA 5C2VB 4AEZA 4J0XA 4FAND 4ERZA 3I8CA 2UZYB 4OWRA 3AL9A 5IT9g 4JSVC 2I0RA 3I7KA 2TRCB 3AH8B 4GQ1A 2H9NA 4E54A 4ZOVA 2OVPB 4H5IA 1U4CA 4HDJA 3DM0A 3EI3A 4E5ZA 2J56H 4IMMA 3PSLA 3SFZA 1XKSA 2IAAA 3I7PA 3AL8A 3MZLA 5EARA 1PI6A 2H47A 3EI2A 3OL2A 5CYKA 2W18A 4QL1A 3ZWLB 4R7AB 4XEIC 2YNPA 1TYQC 4EWRA 4A11A 5AMSA 2Z2OA 2O9KA 1NEXB 2AGWA 4GGDA 4PXWA 4G56B 3DXMC 2IUQA 3V9FA 5EM2B 3MKSB 3F3FA 3RN0D 5I5JA 4FAVD 3I7OA 4X60B
chains in the Genus database with same CATH superfamily
4GM3A 3SJLD 4O3TB 2OK6A 3K72A 2H6NA 3IKOA 4CI1A 3OW8A 4GQBB 3V4PA 3SWSD 1H2ZA 5CXCA 5EALA 3RFHA 4J0WA 3CIKB 3DSMA 4A09A 3OKYB 5TF2A 4BUJC 1T2XA 3KRWB 3MZKA 3SXTD 4L1QD 5FLXg 1JJUB 3SLED 3C5MA 3OF7A 5FFOA 2XDWA 4MMZA 1QFMA 4LGNA 5KDOB 3A0FA 3EWEA 4Y7RA 5M5UA 4QRJA 1C9IA 2XL3A 4UM8A 3VA6A 3E0CA 4J8BA 2VDPA 5SXMA 1I2MB 3IURA 3RFGA 3JAMg 3MKQA 1XHMA 4A0BA 3SN6B 3N0EA 5K19A 5C2WB 1K3IA 4Z7OA 1QNIA 4GGCA 5HDBA 3IIYA 1YFQA 2B4EA 4FA5D 4AMZA 2XYIA 5JWZA 2WQ8A 3MUOA 2OVRB 3EI1B 2GNQA 4FA1D 3MMYA 3UR4A 2Z2NA 3DXKC 4A08A 2P9SC 3UKUC 4QAMA 1VZ2A 3FCSA 4XYIA 1P22A 4X3EA 2YB8B 3UVOA 4ZOYA 3NVQA 5IGQA 2IUVA 3ZE1A 4FHLA 4K3ID 5M5RA 4ESGA 4J82A 3MUNA 5EAPA 1U2VC 2YNNA 3NIDA 1OLZA 1SQJA 3N0DA 3PVWB 3O4JA 2H3XA 1N6DA 5THAA 3MXXA 2PM7B 2HKMA 3ZE0A 2HU8A 1PEVA 1PGUA 5AFU3 3NVNA 3ZE2A 2PBIB 4ES0A 3JRPA 1R5MA 4PSXB 4CZXA 2AGXA 4FB1D 3DWLC 3IJCA 1ERJA 5EMKB 5FA5B 1UOOA 5CXBB 4CI8A 5FXYA 3NIGA 4KFMB 3OL2B 4DNVA 4BH6A 4A0AB 2H14A 3PXSD 4FA4D 4O02A 3RMZD 5EMMB 5FKSA 5EMLB 2CN3A 3ZDZA 1L0QA 2IUPA 4D0KA 4L3HD 2CN2A 4FWWA 3UVKA 3EI4B 1TYEA 1A0RB 5HYNB 3IIWA 2JKXA 3IJEA 4TZ4A 2IWKA 5GXIA 5E6SA 3IUNA 2B5LA 3T3MA 2P9NC 4DNWA 1UTCA 5HE1B 4NAAA 2H6KA 2OJYA 5IJ8E 2Q7QA 4YVDA 5TEEA 5HQGA 2PM6B 4QT8A 3QHYB 1MG3A 2I3SA 5IJ7E 2YMUA 4Z7QA 1H2WA 1GXRA 3I2NA 4JSPC 4A2LA 1JTDB 2AGZA 3JROA 3KRXB 4JHNA 2XU7A 3B7FA 5EM2A 3C99A 5EMJB 4JT6C 5HE2B 3V7DB 1YR2A 3K6SA 1BPOA 3FRXA 1GOHA 2G99A 4PBZA 4X63B 3VGZA 4CY1A 2HESX 3GD1I 4WJKA 4D6VA 5AJAA 3OKWA 3SCYA 2VDMA 2AH1A 2VDRA 2YNOA 2EIEA 3C9CA 4UM9A 3V4VA 4FA9D 2BBKH 4CC9A 2HU5A 2H13A 3UVLA 1NR0A 2VDQA 2EBSA 5M61A 4K3JB 4ERYA 4J79A 3OKYA 2PM9B 5GMKn 4QQEA 2GC4A 3UVNA 2GC7A 2I0TA 2XL2A 4PBYA 1VE6A 2AGLA 4X61B 1FWXA 2IURA 2CO0C 4JD2C 3UKRC 2IWFA 3GREA 3IJ1A 3J81g 1JOFA 3CFSB 3CFVA 4RE6A 3BG1A 1JV2A 4J8GA 3DDUA 3V5WB 1H2YA 3K71A 2QXVA 2QC5A 4J86A 5HE3B 1K8KC 3IJ0A 4L3GD 2AGYA 4OZUA 5I5IA 2H9LA 4Y5RD 1MG2A 3OTTA 4AOWA 3P4FA 3I7LA 2OIZA 1TBGA 3PSCB 1SHYB 3QI0A 4GMBA 3EI1A 1E8MA 4CY5A 4BCBA 2VDLA 3ZDYA 1B9YA 4PNKB 4JT5C 4PSWB 3EQ8A 2H6QA 3UVMA 4AN1A 4E54B 3FGBA 4BL0A 3EQ7A 4LG8A 2MTAH 3VI3A 3EI3B 4MK0B 4E5ZB 3FCUA 5TEFA 4J81A 3AL8B 2VDNA 4CZVA 3EI2B 1N6EA 4I79A 1QFSA 3PXWD 4WK0A 4XYHA 3L4OD 1GG2B 5CYKB 2BKLA 4BCCA 5C86A 4O2WA 4O9DA 3BWSA 2UZXB 3I7NA 1GOTB 5I5MA 1M1XA 5E6UA 5IGOA 4A11B 3VH0A 1JMZB 4BP8A 4J87A 4MMYA 2B5MA 1GOGA 1OMWB 2VZ1A 3IUMA 3JZHA 4O45A 4CY3A 5C92A 1VYHC 5M5SA 2CNXA 2HXCA 2I0SA 3JZNA 5E6RA 5EAMA 4NC4A 2P9KC 2G9AA 4MMXA 2OK4A 4G55A 3J80g 3EU7A 4AN0A 3IUJA 4Z8LA 2P9LC 5H1MA 5CXBA 5GXHA 3O4HA 4JXMA 2HJBA 4H5JA 4A0AA 3K27A 1SQ9A 4O3UB 3C75H 4J73A 4ZOXA 3K26A 3L4MD 3FM0A 5CXCB 3I89A 5A2Qg 3JPXA 2BCJB 4A09B 1E8NA 3ORVD 3T3PA 5K1CC 5IC7A 5FQDA 3IUQA 3RSEC 2HYEA 4IRZA 1S4UX 1N6FA 4NENA 3SBRA 5M5TA 3F3PA 1JMXB 3EI4A 3JZGA 4GM9A 2HJ4A 2VDOA 4N14A 2H9PA 2QR5A 4GM8A 3W15A 2J55H 2P9IC 3I8EA 4JHPC 4CY2A 3HFQA 4GZ8A 4U1EI 3BG0A 3PXTD 2I3TA 2AQ5A 3NIFA 4CZYA 5H17A 4Z7NA 1Q47A 4L1MA 3OKTA 4A0BB 1O6FA 4UI9R 5TDHB 3IULA 4ERQA 4GQ2P 2CE9A 4J84A 3SBQA 1U8CA 2P9PC 1K32A 3U4YA 2QZPA 1A12A 3NVXA 3AFCA 4WK4A 4A7JA 3KCIA 3RRMC 2OVQB 4CI3A 1GP2B 4G1EA 3SBPA 2CO0A 2J57G 5FKQA 2HKRA 2VDKA 4A08B 4CI2A 1B9XA 3VI4A 1PBYB 1VZ3A 5M5VA 2XZGA 5C9ZB 3ODTA 4J77A 4JSXC 2Z2PA 3O4GA 4G1MA 4A2MA 3SHFA 2YBAA 4J78A 5H14A 2H68A 3PE7A 3ULEC 5FKTA 4L9OA 1GOFA 1XIPA 2CE8A 2PM9A 2H9MA 3I7HA 2VC2A 3MVDK 4O1QD 3SVWD 4U7AA 3JB9L 4ZN4A 3PVUB 5HE0B 3GC3B 4IA9A 3RN1D 4JSNC 4AX4A 2AH0A 4BCDA 3RLMD 3SMRA 1MDAH 3EMHA 3IVMA 3GFCA 3ZDXA 1UOPA 2P9UC 4GGAA 3EG6A 4PC0A 5FKRA 5B4WA 3F3GA 5GSAA 4NSXA 1RI6A 4LG9A 4ZOZA 2B5NA 1H2XA 5C2VB 4AEZA 4J0XA 4FAND 4ERZA 3I8CA 2XE4A 2UZYB 4OWRA 3AL9A 5IT9g 4JSVC 2I0RA 3I7KA 1VE7A 2TRCB 3AH8B 4GQ1A 4AMYA 2H9NA 5FFGA 4E54A 2HU7A 4NBMA 4ZOVA 2OVPB 4H5IA 1U4CA 4HDJA 3DM0A 3EI3A 4E5ZA 2J56H 3EQ9A 4IMMA 3PSLA 3SFZA 1XKSA 2IAAA 3I7PA 3AL8A 3MZLA 5EARA 1PI6A 2H47A 2EIBA 3EI2A 1C9LA 2VZ3A 3OL2A 5CYKA 2W18A 4QL1A 3ZWLB 4R7AB 2EICA 4XEIC 2YNPA 4X60B 4BP9A 1TYQC 4EWRA 4A11A 5AMSA 2Z2OA 2O9KA 1UOQA 1NEXB 2AGWA 4GGDA 4PXWA 4G56B 1L5GA 3DXMC 2IUQA 3V9FA 5EM2B 1O6GA 3MKSB 4RE5A 3F3FA 4WK2A 3RN0D 3O4IA 4DNUA 5I5JA 1E5TA 4FAVD 4D9SA 3I7OA 2EIDA
chains in the Genus database with same CATH topology
4GM3A 3SJLD 4O3TB 2OK6A 4CI1A 2H6NA 3IKOA 3OW8A 4GQBB 3SWSD 5CXCA 5EALA 3RFHA 4J0WA 3CIKB 3DSMA 4A09A 3OKYB 5TF2A 4BUJC 3KRWB 3MZKA 3SXTD 4L1QD 5FLXg 1JJUB 3SLED 3C5MA 4LGNA 5KDOB 3A0FA 3EWEA 4Y7RA 4QRJA 2XL3A 3VA6A 3E0CA 4J8BA 5SXMA 3RFGA 3JAMg 3MKQA 1XHMA 4A0BA 3SN6B 3N0EA 5K19A 5C2WB 1QNIA 4GGCA 3IIYA 1YFQA 2B4EA 4FA5D 2XYIA 5JWZA 3EI1B 2OVRB 2GNQA 4FA1D 3MMYA 3UR4A 2Z2NA 3DXKC 4A08A 2P9SC 3UKUC 4XYIA 1P22A 4X3EA 2YB8B 3UVOA 4ZOYA 3NVQA 5IGQA 2IUVA 4FHLA 4K3ID 4ESGA 4J82A 5EAPA 1U2VC 2YNNA 1OLZA 1SQJA 3N0DA 3PVWB 2H3XA 1N6DA 5THAA 3MXXA 2PM7B 2HKMA 1PEVA 1PGUA 5AFU3 3NVNA 2PBIB 4ES0A 3JRPA 1R5MA 4PSXB 4CZXA 2AGXA 4FB1D 3DWLC 3IJCA 1ERJA 5EMKB 5FA5B 5CXBB 4CI8A 5FXYA 4KFMB 3OL2B 4BH6A 4A0AB 2H14A 3PXSD 4FA4D 3RMZD 5EMMB 5FKSA 5EMLB 2CN3A 1L0QA 2IUPA 4D0KA 4L3HD 2CN2A 4FWWA 3UVKA 3EI4B 1A0RB 5HYNB 3IIWA 4TZ4A 2IWKA 5GXIA 2B5LA 2P9NC 5HE1B 2H6KA 2OJYA 5IJ8E 2Q7QA 4YVDA 5TEEA 5HQGA 2PM6B 4QT8A 1MG3A 2I3SA 5IJ7E 2YMUA 1GXRA 3I2NA 4JSPC 4A2LA 2AGZA 3JROA 3KRXB 2XU7A 3B7FA 5EM2A 3C99A 5EMJB 4JT6C 5HE2B 3V7DB 3FRXA 2G99A 4PBZA 4X63B 3VGZA 4CY1A 2HESX 4D6VA 5AJAA 3OKWA 3SCYA 2AH1A 2YNOA 3C9CA 4FA9D 2BBKH 4CC9A 2H13A 3UVLA 1NR0A 2EBSA 4K3JB 4ERYA 4J79A 3OKYA 2PM9B 5GMKn 4QQEA 2GC4A 3UVNA 2GC7A 2I0TA 2XL2A 4PBYA 2AGLA 4X61B 1FWXA 2IURA 2CO0C 4JD2C 3UKRC 2IWFA 3GREA 3IJ1A 3J81g 1JOFA 3CFSB 3CFVA 3BG1A 3V5WB 4J8GA 2QXVA 2QC5A 4J86A 5HE3B 1K8KC 3IJ0A 4L3GD 2AGYA 4OZUA 5I5IA 2H9LA 4Y5RD 1MG2A 3OTTA 4AOWA 3P4FA 3I7LA 2OIZA 1TBGA 3PSCB 1SHYB 4GMBA 3EI1A 4CY5A 1B9YA 4PNKB 4JT5C 4PSWB 2H6QA 3UVMA 4E54B 3FGBA 4BL0A 4LG8A 2MTAH 3EI3B 4MK0B 4E5ZB 5TEFA 4J81A 3AL8B 4CZVA 3EI2B 1N6EA 4I79A 4XYHA 3PXWD 3L4OD 1GG2B 5CYKB 4O9DA 3BWSA 2UZXB 3I7NA 1GOTB 5I5MA 5IGOA 4A11B 3VH0A 1JMZB 4J87A 2B5MA 1OMWB 4O45A 3JZHA 4CY3A 1VYHC 2CNXA 2HXCA 2I0SA 3JZNA 5EAMA 2P9KC 2G9AA 2OK4A 3J80g 3EU7A 4Z8LA 2P9LC 5H1MA 5CXBA 5GXHA 4JXMA 2HJBA 4H5JA 4A0AA 3K27A 1SQ9A 4O3UB 3C75H 4J73A 4ZOXA 3K26A 3L4MD 3FM0A 5CXCB 3I89A 5A2Qg 3JPXA 2BCJB 4A09B 3ORVD 5K1CC 5IC7A 5FQDA 3RSEC 2HYEA 3SBRA 1S4UX 1N6FA 3F3PA 1JMXB 3EI4A 3JZGA 4GM9A 2HJ4A 4N14A 2H9PA 4GM8A 3W15A 2J55H 2P9IC 3I8EA 4CY2A 3HFQA 4GZ8A 4U1EI 3BG0A 3PXTD 2I3TA 2AQ5A 4CZYA 5H17A 1Q47A 3OKTA 4A0BB 4UI9R 5TDHB 4ERQA 4GQ2P 2CE9A 4J84A 3SBQA 2P9PC 1K32A 3U4YA 3NVXA 3AFCA 4A7JA 3RRMC 2OVQB 4CI3A 1GP2B 3SBPA 2CO0A 2J57G 5FKQA 2HKRA 4A08B 4CI2A 1B9XA 1PBYB 5C9ZB 3ODTA 4J77A 4JSXC 2Z2PA 4A2MA 3SHFA 2YBAA 4J78A 5H14A 2H68A 3PE7A 3ULEC 5FKTA 4L9OA 2CE8A 1XIPA 2PM9A 2H9MA 3I7HA 4O1QD 3SVWD 4U7AA 3JB9L 4ZN4A 3PVUB 5HE0B 4IA9A 3RN1D 4JSNC 2AH0A 3RLMD 3SMRA 1MDAH 3EMHA 3GFCA 2P9UC 4GGAA 3EG6A 4PC0A 5FKRA 5B4WA 3F3GA 5GSAA 4NSXA 1RI6A 4LG9A 4ZOZA 2B5NA 5C2VB 4AEZA 4J0XA 4FAND 4ERZA 3I8CA 2UZYB 4OWRA 3AL9A 5IT9g 4JSVC 2I0RA 3I7KA 2TRCB 3AH8B 4GQ1A 2H9NA 4E54A 4ZOVA 2OVPB 4H5IA 1U4CA 4HDJA 3DM0A 3EI3A 4E5ZA 2J56H 4IMMA 3PSLA 3SFZA 1XKSA 2IAAA 3I7PA 3AL8A 3MZLA 5EARA 1PI6A 2H47A 3EI2A 3OL2A 5CYKA 2W18A 4QL1A 3ZWLB 4R7AB 4XEIC 2YNPA 1TYQC 4EWRA 4A11A 5AMSA 2Z2OA 2O9KA 1NEXB 2AGWA 4GGDA 4PXWA 4G56B 3DXMC 2IUQA 3V9FA 5EM2B 3MKSB 3F3FA 3RN0D 5I5JA 4FAVD 3I7OA 4X60B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GM3 A;  3SJL D;  4O3T B;  2OK6 A;  4CI1 A;  2H6N A;  3IKO A;  3OW8 A;  4GQB B;  3SWS D;  5CXC A;  5EAL A;  3RFH A;  4J0W A;  3CIK B;  3DSM A;  4A09 A;  3OKY B;  5TF2 A;  4BUJ C;  3KRW B;  3MZK A;  3SXT D;  4L1Q D;  5FLX g;  1JJU B;  3SLE D;  3C5M A;  4LGN A;  5KDO B;  3A0F A;  3EWE A;  4Y7R A;  4QRJ A;  2XL3 A;  3VA6 A;  3E0C A;  4J8B A;  5SXM A;  3RFG A;  3JAM g;  3MKQ A;  1XHM A;  4A0B A;  3SN6 B;  3N0E A;  5K19 A;  5C2W B;  1QNI A;  4GGC A;  3IIY A;  1YFQ A;  2B4E A;  4FA5 D;  2XYI A;  5JWZ A;  3EI1 B;  2OVR B;  2GNQ A;  4FA1 D;  3MMY A;  3UR4 A;  2Z2N A;  3DXK C;  4A08 A;  2P9S C;  3UKU C;  4XYI A;  1P22 A;  4X3E A;  2YB8 B;  3UVO A;  4ZOY A;  3NVQ A;  5IGQ A;  2IUV A;  4FHL A;  4K3I D;  4ESG A;  4J82 A;  5EAP A;  1U2V C;  2YNN A;  1OLZ A;  1SQJ A;  3N0D A;  3PVW B;  2H3X A;  1N6D A;  5THA A;  3MXX A;  2PM7 B;  2HKM A;  1PEV A;  1PGU A;  5AFU 3;  3NVN A;  2PBI B;  4ES0 A;  3JRP A;  1R5M A;  4PSX B;  4CZX A;  2AGX A;  4FB1 D;  3DWL C;  3IJC A;  1ERJ A;  5EMK B;  5FA5 B;  5CXB B;  4CI8 A;  5FXY A;  4KFM B;  3OL2 B;  4BH6 A;  4A0A B;  2H14 A;  3PXS D;  4FA4 D;  3RMZ D;  5EMM B;  5FKS A;  5EML B;  2CN3 A;  1L0Q A;  2IUP A;  4D0K A;  4L3H D;  2CN2 A;  4FWW A;  3UVK A;  3EI4 B;  1A0R B;  5HYN B;  3IIW A;  4TZ4 A;  2IWK A;  5GXI A;  2B5L A;  2P9N C;  5HE1 B;  2H6K A;  2OJY A;  5IJ8 E;  2Q7Q A;  4YVD A;  5TEE A;  5HQG A;  2PM6 B;  4QT8 A;  1MG3 A;  2I3S A;  5IJ7 E;  2YMU A;  1GXR A;  3I2N A;  4JSP C;  4A2L A;  2AGZ A;  3JRO A;  3KRX B;  2XU7 A;  3B7F A;  5EM2 A;  3C99 A;  5EMJ B;  4JT6 C;  5HE2 B;  3V7D B;  3FRX A;  2G99 A;  4PBZ A;  4X63 B;  3VGZ A;  4CY1 A;  2HES X;  4D6V A;  5AJA A;  3OKW A;  3SCY A;  2AH1 A;  2YNO A;  3C9C A;  4FA9 D;  2BBK H;  4CC9 A;  2H13 A;  3UVL A;  1NR0 A;  2EBS A;  4K3J B;  4ERY A;  4J79 A;  3OKY A;  2PM9 B;  5GMK n;  4QQE A;  2GC4 A;  3UVN A;  2GC7 A;  2I0T A;  2XL2 A;  4PBY A;  2AGL A;  4X61 B;  1FWX A;  2IUR A;  2CO0 C;  4JD2 C;  3UKR C;  2IWF A;  3GRE A;  3IJ1 A;  3J81 g;  1JOF A;  3CFS B;  3CFV A;  3BG1 A;  3V5W B;  4J8G A;  2QXV A;  2QC5 A;  4J86 A;  5HE3 B;  1K8K C;  3IJ0 A;  4L3G D;  2AGY A;  4OZU A;  5I5I A;  2H9L A;  4Y5R D;  1MG2 A;  3OTT A;  4AOW A;  3P4F A;  3I7L A;  2OIZ A;  1TBG A;  3PSC B;  1SHY B;  4GMB A;  3EI1 A;  4CY5 A;  1B9Y A;  4PNK B;  4JT5 C;  4PSW B;  2H6Q A;  3UVM A;  4E54 B;  3FGB A;  4BL0 A;  4LG8 A;  2MTA H;  3EI3 B;  4MK0 B;  4E5Z B;  5TEF A;  4J81 A;  3AL8 B;  4CZV A;  3EI2 B;  1N6E A;  4I79 A;  4XYH A;  3PXW D;  3L4O D;  1GG2 B;  5CYK B;  4O9D A;  3BWS A;  2UZX B;  3I7N A;  1GOT B;  5I5M A;  5IGO A;  4A11 B;  3VH0 A;  1JMZ B;  4J87 A;  2B5M A;  1OMW B;  4O45 A;  3JZH A;  4CY3 A;  1VYH C;  2CNX A;  2HXC A;  2I0S A;  3JZN A;  5EAM A;  2P9K C;  2G9A A;  2OK4 A;  3J80 g;  3EU7 A;  4Z8L A;  2P9L C;  5H1M A;  5CXB A;  5GXH A;  4JXM A;  2HJB A;  4H5J A;  4A0A A;  3K27 A;  1SQ9 A;  4O3U B;  3C75 H;  4J73 A;  4ZOX A;  3K26 A;  3L4M D;  3FM0 A;  5CXC B;  3I89 A;  5A2Q g;  3JPX A;  2BCJ B;  4A09 B;  3ORV D;  5K1C C;  5IC7 A;  5FQD A;  3RSE C;  2HYE A;  3SBR A;  1S4U X;  1N6F A;  3F3P A;  1JMX B;  3EI4 A;  3JZG A;  4GM9 A;  2HJ4 A;  4N14 A;  2H9P A;  4GM8 A;  3W15 A;  2J55 H;  2P9I C;  3I8E A;  4CY2 A;  3HFQ A;  4GZ8 A;  4U1E I;  3BG0 A;  3PXT D;  2I3T A;  2AQ5 A;  4CZY A;  5H17 A;  1Q47 A;  3OKT A;  4A0B B;  4UI9 R;  5TDH B;  4ERQ A;  4GQ2 P;  2CE9 A;  4J84 A;  3SBQ A;  2P9P C;  1K32 A;  3U4Y A;  3NVX A;  3AFC A;  4A7J A;  3RRM C;  2OVQ B;  4CI3 A;  1GP2 B;  3SBP A;  2CO0 A;  2J57 G;  5FKQ A;  2HKR A;  4A08 B;  4CI2 A;  1B9X A;  1PBY B;  5C9Z B;  3ODT A;  4J77 A;  4JSX C;  2Z2P A;  4A2M A;  3SHF A;  2YBA A;  4J78 A;  5H14 A;  2H68 A;  3PE7 A;  3ULE C;  5FKT A;  4L9O A;  2CE8 A;  1XIP A;  2PM9 A;  2H9M A;  3I7H A;  4O1Q D;  3SVW D;  4U7A A;  3JB9 L;  4ZN4 A;  3PVU B;  5HE0 B;  4IA9 A;  3RN1 D;  4JSN C;  2AH0 A;  3RLM D;  3SMR A;  1MDA H;  3EMH A;  3GFC A;  2P9U C;  4GGA A;  3EG6 A;  4PC0 A;  5FKR A;  5B4W A;  3F3G A;  5GSA A;  4NSX A;  1RI6 A;  4LG9 A;  4ZOZ A;  2B5N A;  5C2V B;  4AEZ A;  4J0X A;  4FAN D;  4ERZ A;  3I8C A;  2UZY B;  4OWR A;  3AL9 A;  5IT9 g;  4JSV C;  2I0R A;  3I7K A;  2TRC B;  3AH8 B;  4GQ1 A;  2H9N A;  4E54 A;  4ZOV A;  2OVP B;  4H5I A;  1U4C A;  4HDJ A;  3DM0 A;  3EI3 A;  4E5Z A;  2J56 H;  4IMM A;  3PSL A;  3SFZ A;  1XKS A;  2IAA A;  3I7P A;  3AL8 A;  3MZL A;  5EAR A;  1PI6 A;  2H47 A;  3EI2 A;  3OL2 A;  5CYK A;  2W18 A;  4QL1 A;  3ZWL B;  4R7A B;  4XEI C;  2YNP A;  1TYQ C;  4EWR A;  4A11 A;  5AMS A;  2Z2O A;  2O9K A;  1NEX B;  2AGW A;  4GGD A;  4PXW A;  4G56 B;  3DXM C;  2IUQ A;  3V9F A;  5EM2 B;  3MKS B;  3F3F A;  3RN0 D;  5I5J A;  4FAV D;  3I7O A;  4X60 B; 
#chains in the Genus database with same CATH topology
 4GM3 A;  3SJL D;  4O3T B;  2OK6 A;  3K72 A;  2H6N A;  3IKO A;  4CI1 A;  3OW8 A;  4GQB B;  3V4P A;  3SWS D;  1H2Z A;  5CXC A;  5EAL A;  3RFH A;  4J0W A;  3CIK B;  3DSM A;  4A09 A;  3OKY B;  5TF2 A;  4BUJ C;  1T2X A;  3KRW B;  3MZK A;  3SXT D;  4L1Q D;  5FLX g;  1JJU B;  3SLE D;  3C5M A;  3OF7 A;  5FFO A;  2XDW A;  4MMZ A;  1QFM A;  4LGN A;  5KDO B;  3A0F A;  3EWE A;  4Y7R A;  5M5U A;  4QRJ A;  1C9I A;  2XL3 A;  4UM8 A;  3VA6 A;  3E0C A;  4J8B A;  2VDP A;  5SXM A;  1I2M B;  3IUR A;  3RFG A;  3JAM g;  3MKQ A;  1XHM A;  4A0B A;  3SN6 B;  3N0E A;  5K19 A;  5C2W B;  1K3I A;  4Z7O A;  1QNI A;  4GGC A;  5HDB A;  3IIY A;  1YFQ A;  2B4E A;  4FA5 D;  4AMZ A;  2XYI A;  5JWZ A;  2WQ8 A;  3MUO A;  2OVR B;  3EI1 B;  2GNQ A;  4FA1 D;  3MMY A;  3UR4 A;  2Z2N A;  3DXK C;  4A08 A;  2P9S C;  3UKU C;  4QAM A;  1VZ2 A;  3FCS A;  4XYI A;  1P22 A;  4X3E A;  2YB8 B;  3UVO A;  4ZOY A;  3NVQ A;  5IGQ A;  2IUV A;  3ZE1 A;  4FHL A;  4K3I D;  5M5R A;  4ESG A;  4J82 A;  3MUN A;  5EAP A;  1U2V C;  2YNN A;  3NID A;  1OLZ A;  1SQJ A;  3N0D A;  3PVW B;  3O4J A;  2H3X A;  1N6D A;  5THA A;  3MXX A;  2PM7 B;  2HKM A;  3ZE0 A;  2HU8 A;  1PEV A;  1PGU A;  5AFU 3;  3NVN A;  3ZE2 A;  2PBI B;  4ES0 A;  3JRP A;  1R5M A;  4PSX B;  4CZX A;  2AGX A;  4FB1 D;  3DWL C;  3IJC A;  1ERJ A;  5EMK B;  5FA5 B;  1UOO A;  5CXB B;  4CI8 A;  5FXY A;  3NIG A;  4KFM B;  3OL2 B;  4DNV A;  4BH6 A;  4A0A B;  2H14 A;  3PXS D;  4FA4 D;  4O02 A;  3RMZ D;  5EMM B;  5FKS A;  5EML B;  2CN3 A;  3ZDZ A;  1L0Q A;  2IUP A;  4D0K A;  4L3H D;  2CN2 A;  4FWW A;  3UVK A;  3EI4 B;  1TYE A;  1A0R B;  5HYN B;  3IIW A;  2JKX A;  3IJE A;  4TZ4 A;  2IWK A;  5GXI A;  5E6S A;  3IUN A;  2B5L A;  3T3M A;  2P9N C;  4DNW A;  1UTC A;  5HE1 B;  4NAA A;  2H6K A;  2OJY A;  5IJ8 E;  2Q7Q A;  4YVD A;  5TEE A;  5HQG A;  2PM6 B;  4QT8 A;  3QHY B;  1MG3 A;  2I3S A;  5IJ7 E;  2YMU A;  4Z7Q A;  1H2W A;  1GXR A;  3I2N A;  4JSP C;  4A2L A;  1JTD B;  2AGZ A;  3JRO A;  3KRX B;  4JHN A;  2XU7 A;  3B7F A;  5EM2 A;  3C99 A;  5EMJ B;  4JT6 C;  5HE2 B;  3V7D B;  1YR2 A;  3K6S A;  1BPO A;  3FRX A;  1GOH A;  2G99 A;  4PBZ A;  4X63 B;  3VGZ A;  4CY1 A;  2HES X;  3GD1 I;  4WJK A;  4D6V A;  5AJA A;  3OKW A;  3SCY A;  2VDM A;  2AH1 A;  2VDR A;  2YNO A;  2EIE A;  3C9C A;  4UM9 A;  3V4V A;  4FA9 D;  2BBK H;  4CC9 A;  2HU5 A;  2H13 A;  3UVL A;  1NR0 A;  2VDQ A;  2EBS A;  5M61 A;  4K3J B;  4ERY A;  4J79 A;  3OKY A;  2PM9 B;  5GMK n;  4QQE A;  2GC4 A;  3UVN A;  2GC7 A;  2I0T A;  2XL2 A;  4PBY A;  1VE6 A;  2AGL A;  4X61 B;  1FWX A;  2IUR A;  2CO0 C;  4JD2 C;  3UKR C;  2IWF A;  3GRE A;  3IJ1 A;  3J81 g;  1JOF A;  3CFS B;  3CFV A;  4RE6 A;  3BG1 A;  1JV2 A;  4J8G A;  3DDU A;  3V5W B;  1H2Y A;  3K71 A;  2QXV A;  2QC5 A;  4J86 A;  5HE3 B;  1K8K C;  3IJ0 A;  4L3G D;  2AGY A;  4OZU A;  5I5I A;  2H9L A;  4Y5R D;  1MG2 A;  3OTT A;  4AOW A;  3P4F A;  3I7L A;  2OIZ A;  1TBG A;  3PSC B;  1SHY B;  3QI0 A;  4GMB A;  3EI1 A;  1E8M A;  4CY5 A;  4BCB A;  2VDL A;  3ZDY A;  1B9Y A;  4PNK B;  4JT5 C;  4PSW B;  3EQ8 A;  2H6Q A;  3UVM A;  4AN1 A;  4E54 B;  3FGB A;  4BL0 A;  3EQ7 A;  4LG8 A;  2MTA H;  3VI3 A;  3EI3 B;  4MK0 B;  4E5Z B;  3FCU A;  5TEF A;  4J81 A;  3AL8 B;  2VDN A;  4CZV A;  3EI2 B;  1N6E A;  4I79 A;  1QFS A;  3PXW D;  4WK0 A;  4XYH A;  3L4O D;  1GG2 B;  5CYK B;  2BKL A;  4BCC A;  5C86 A;  4O2W A;  4O9D A;  3BWS A;  2UZX B;  3I7N A;  1GOT B;  5I5M A;  1M1X A;  5E6U A;  5IGO A;  4A11 B;  3VH0 A;  1JMZ B;  4BP8 A;  4J87 A;  4MMY A;  2B5M A;  1GOG A;  1OMW B;  2VZ1 A;  3IUM A;  3JZH A;  4O45 A;  4CY3 A;  5C92 A;  1VYH C;  5M5S A;  2CNX A;  2HXC A;  2I0S A;  3JZN A;  5E6R A;  5EAM A;  4NC4 A;  2P9K C;  2G9A A;  4MMX A;  2OK4 A;  4G55 A;  3J80 g;  3EU7 A;  4AN0 A;  3IUJ A;  4Z8L A;  2P9L C;  5H1M A;  5CXB A;  5GXH A;  3O4H A;  4JXM A;  2HJB A;  4H5J A;  4A0A A;  3K27 A;  1SQ9 A;  4O3U B;  3C75 H;  4J73 A;  4ZOX A;  3K26 A;  3L4M D;  3FM0 A;  5CXC B;  3I89 A;  5A2Q g;  3JPX A;  2BCJ B;  4A09 B;  1E8N A;  3ORV D;  3T3P A;  5K1C C;  5IC7 A;  5FQD A;  3IUQ A;  3RSE C;  2HYE A;  4IRZ A;  1S4U X;  1N6F A;  4NEN A;  3SBR A;  5M5T A;  3F3P A;  1JMX B;  3EI4 A;  3JZG A;  4GM9 A;  2HJ4 A;  2VDO A;  4N14 A;  2H9P A;  2QR5 A;  4GM8 A;  3W15 A;  2J55 H;  2P9I C;  3I8E A;  4JHP C;  4CY2 A;  3HFQ A;  4GZ8 A;  4U1E I;  3BG0 A;  3PXT D;  2I3T A;  2AQ5 A;  3NIF A;  4CZY A;  5H17 A;  4Z7N A;  1Q47 A;  4L1M A;  3OKT A;  4A0B B;  1O6F A;  4UI9 R;  5TDH B;  3IUL A;  4ERQ A;  4GQ2 P;  2CE9 A;  4J84 A;  3SBQ A;  1U8C A;  2P9P C;  1K32 A;  3U4Y A;  2QZP A;  1A12 A;  3NVX A;  3AFC A;  4WK4 A;  4A7J A;  3KCI A;  3RRM C;  2OVQ B;  4CI3 A;  1GP2 B;  4G1E A;  3SBP A;  2CO0 A;  2J57 G;  5FKQ A;  2HKR A;  2VDK A;  4A08 B;  4CI2 A;  1B9X A;  3VI4 A;  1PBY B;  1VZ3 A;  5M5V A;  2XZG A;  5C9Z B;  3ODT A;  4J77 A;  4JSX C;  2Z2P A;  3O4G A;  4G1M A;  4A2M A;  3SHF A;  2YBA A;  4J78 A;  5H14 A;  2H68 A;  3PE7 A;  3ULE C;  5FKT A;  4L9O A;  1GOF A;  1XIP A;  2CE8 A;  2PM9 A;  2H9M A;  3I7H A;  2VC2 A;  3MVD K;  4O1Q D;  3SVW D;  4U7A A;  3JB9 L;  4ZN4 A;  3PVU B;  5HE0 B;  3GC3 B;  4IA9 A;  3RN1 D;  4JSN C;  4AX4 A;  2AH0 A;  4BCD A;  3RLM D;  3SMR A;  1MDA H;  3EMH A;  3IVM A;  3GFC A;  3ZDX A;  1UOP A;  2P9U C;  4GGA A;  3EG6 A;  4PC0 A;  5FKR A;  5B4W A;  3F3G A;  5GSA A;  4NSX A;  1RI6 A;  4LG9 A;  4ZOZ A;  2B5N A;  1H2X A;  5C2V B;  4AEZ A;  4J0X A;  4FAN D;  4ERZ A;  3I8C A;  2XE4 A;  2UZY B;  4OWR A;  3AL9 A;  5IT9 g;  4JSV C;  2I0R A;  3I7K A;  1VE7 A;  2TRC B;  3AH8 B;  4GQ1 A;  4AMY A;  2H9N A;  5FFG A;  4E54 A;  2HU7 A;  4NBM A;  4ZOV A;  2OVP B;  4H5I A;  1U4C A;  4HDJ A;  3DM0 A;  3EI3 A;  4E5Z A;  2J56 H;  3EQ9 A;  4IMM A;  3PSL A;  3SFZ A;  1XKS A;  2IAA A;  3I7P A;  3AL8 A;  3MZL A;  5EAR A;  1PI6 A;  2H47 A;  2EIB A;  3EI2 A;  1C9L A;  2VZ3 A;  3OL2 A;  5CYK A;  2W18 A;  4QL1 A;  3ZWL B;  4R7A B;  2EIC A;  4XEI C;  2YNP A;  4X60 B;  4BP9 A;  1TYQ C;  4EWR A;  4A11 A;  5AMS A;  2Z2O A;  2O9K A;  1UOQ A;  1NEX B;  2AGW A;  4GGD A;  4PXW A;  4G56 B;  1L5G A;  3DXM C;  2IUQ A;  3V9F A;  5EM2 B;  1O6G A;  3MKS B;  4RE5 A;  3F3F A;  4WK2 A;  3RN0 D;  3O4I A;  4DNU A;  5I5J A;  1E5T A;  4FAV D;  4D9S A;  3I7O A;  2EID A; 
#chains in the Genus database with same CATH homology
 4GM3 A;  3SJL D;  4O3T B;  2OK6 A;  4CI1 A;  2H6N A;  3IKO A;  3OW8 A;  4GQB B;  3SWS D;  5CXC A;  5EAL A;  3RFH A;  4J0W A;  3CIK B;  3DSM A;  4A09 A;  3OKY B;  5TF2 A;  4BUJ C;  3KRW B;  3MZK A;  3SXT D;  4L1Q D;  5FLX g;  1JJU B;  3SLE D;  3C5M A;  4LGN A;  5KDO B;  3A0F A;  3EWE A;  4Y7R A;  4QRJ A;  2XL3 A;  3VA6 A;  3E0C A;  4J8B A;  5SXM A;  3RFG A;  3JAM g;  3MKQ A;  1XHM A;  4A0B A;  3SN6 B;  3N0E A;  5K19 A;  5C2W B;  1QNI A;  4GGC A;  3IIY A;  1YFQ A;  2B4E A;  4FA5 D;  2XYI A;  5JWZ A;  3EI1 B;  2OVR B;  2GNQ A;  4FA1 D;  3MMY A;  3UR4 A;  2Z2N A;  3DXK C;  4A08 A;  2P9S C;  3UKU C;  4XYI A;  1P22 A;  4X3E A;  2YB8 B;  3UVO A;  4ZOY A;  3NVQ A;  5IGQ A;  2IUV A;  4FHL A;  4K3I D;  4ESG A;  4J82 A;  5EAP A;  1U2V C;  2YNN A;  1OLZ A;  1SQJ A;  3N0D A;  3PVW B;  2H3X A;  1N6D A;  5THA A;  3MXX A;  2PM7 B;  2HKM A;  1PEV A;  1PGU A;  5AFU 3;  3NVN A;  2PBI B;  4ES0 A;  3JRP A;  1R5M A;  4PSX B;  4CZX A;  2AGX A;  4FB1 D;  3DWL C;  3IJC A;  1ERJ A;  5EMK B;  5FA5 B;  5CXB B;  4CI8 A;  5FXY A;  4KFM B;  3OL2 B;  4BH6 A;  4A0A B;  2H14 A;  3PXS D;  4FA4 D;  3RMZ D;  5EMM B;  5FKS A;  5EML B;  2CN3 A;  1L0Q A;  2IUP A;  4D0K A;  4L3H D;  2CN2 A;  4FWW A;  3UVK A;  3EI4 B;  1A0R B;  5HYN B;  3IIW A;  4TZ4 A;  2IWK A;  5GXI A;  2B5L A;  2P9N C;  5HE1 B;  2H6K A;  2OJY A;  5IJ8 E;  2Q7Q A;  4YVD A;  5TEE A;  5HQG A;  2PM6 B;  4QT8 A;  1MG3 A;  2I3S A;  5IJ7 E;  2YMU A;  1GXR A;  3I2N A;  4JSP C;  4A2L A;  2AGZ A;  3JRO A;  3KRX B;  2XU7 A;  3B7F A;  5EM2 A;  3C99 A;  5EMJ B;  4JT6 C;  5HE2 B;  3V7D B;  3FRX A;  2G99 A;  4PBZ A;  4X63 B;  3VGZ A;  4CY1 A;  2HES X;  4D6V A;  5AJA A;  3OKW A;  3SCY A;  2AH1 A;  2YNO A;  3C9C A;  4FA9 D;  2BBK H;  4CC9 A;  2H13 A;  3UVL A;  1NR0 A;  2EBS A;  4K3J B;  4ERY A;  4J79 A;  3OKY A;  2PM9 B;  5GMK n;  4QQE A;  2GC4 A;  3UVN A;  2GC7 A;  2I0T A;  2XL2 A;  4PBY A;  2AGL A;  4X61 B;  1FWX A;  2IUR A;  2CO0 C;  4JD2 C;  3UKR C;  2IWF A;  3GRE A;  3IJ1 A;  3J81 g;  1JOF A;  3CFS B;  3CFV A;  3BG1 A;  3V5W B;  4J8G A;  2QXV A;  2QC5 A;  4J86 A;  5HE3 B;  1K8K C;  3IJ0 A;  4L3G D;  2AGY A;  4OZU A;  5I5I A;  2H9L A;  4Y5R D;  1MG2 A;  3OTT A;  4AOW A;  3P4F A;  3I7L A;  2OIZ A;  1TBG A;  3PSC B;  1SHY B;  4GMB A;  3EI1 A;  4CY5 A;  1B9Y A;  4PNK B;  4JT5 C;  4PSW B;  2H6Q A;  3UVM A;  4E54 B;  3FGB A;  4BL0 A;  4LG8 A;  2MTA H;  3EI3 B;  4MK0 B;  4E5Z B;  5TEF A;  4J81 A;  3AL8 B;  4CZV A;  3EI2 B;  1N6E A;  4I79 A;  4XYH A;  3PXW D;  3L4O D;  1GG2 B;  5CYK B;  4O9D A;  3BWS A;  2UZX B;  3I7N A;  1GOT B;  5I5M A;  5IGO A;  4A11 B;  3VH0 A;  1JMZ B;  4J87 A;  2B5M A;  1OMW B;  4O45 A;  3JZH A;  4CY3 A;  1VYH C;  2CNX A;  2HXC A;  2I0S A;  3JZN A;  5EAM A;  2P9K C;  2G9A A;  2OK4 A;  3J80 g;  3EU7 A;  4Z8L A;  2P9L C;  5H1M A;  5CXB A;  5GXH A;  4JXM A;  2HJB A;  4H5J A;  4A0A A;  3K27 A;  1SQ9 A;  4O3U B;  3C75 H;  4J73 A;  4ZOX A;  3K26 A;  3L4M D;  3FM0 A;  5CXC B;  3I89 A;  5A2Q g;  3JPX A;  2BCJ B;  4A09 B;  3ORV D;  5K1C C;  5IC7 A;  5FQD A;  3RSE C;  2HYE A;  3SBR A;  1S4U X;  1N6F A;  3F3P A;  1JMX B;  3EI4 A;  3JZG A;  4GM9 A;  2HJ4 A;  4N14 A;  2H9P A;  4GM8 A;  3W15 A;  2J55 H;  2P9I C;  3I8E A;  4CY2 A;  3HFQ A;  4GZ8 A;  4U1E I;  3BG0 A;  3PXT D;  2I3T A;  2AQ5 A;  4CZY A;  5H17 A;  1Q47 A;  3OKT A;  4A0B B;  4UI9 R;  5TDH B;  4ERQ A;  4GQ2 P;  2CE9 A;  4J84 A;  3SBQ A;  2P9P C;  1K32 A;  3U4Y A;  3NVX A;  3AFC A;  4A7J A;  3RRM C;  2OVQ B;  4CI3 A;  1GP2 B;  3SBP A;  2CO0 A;  2J57 G;  5FKQ A;  2HKR A;  4A08 B;  4CI2 A;  1B9X A;  1PBY B;  5C9Z B;  3ODT A;  4J77 A;  4JSX C;  2Z2P A;  4A2M A;  3SHF A;  2YBA A;  4J78 A;  5H14 A;  2H68 A;  3PE7 A;  3ULE C;  5FKT A;  4L9O A;  2CE8 A;  1XIP A;  2PM9 A;  2H9M A;  3I7H A;  4O1Q D;  3SVW D;  4U7A A;  3JB9 L;  4ZN4 A;  3PVU B;  5HE0 B;  4IA9 A;  3RN1 D;  4JSN C;  2AH0 A;  3RLM D;  3SMR A;  1MDA H;  3EMH A;  3GFC A;  2P9U C;  4GGA A;  3EG6 A;  4PC0 A;  5FKR A;  5B4W A;  3F3G A;  5GSA A;  4NSX A;  1RI6 A;  4LG9 A;  4ZOZ A;  2B5N A;  5C2V B;  4AEZ A;  4J0X A;  4FAN D;  4ERZ A;  3I8C A;  2UZY B;  4OWR A;  3AL9 A;  5IT9 g;  4JSV C;  2I0R A;  3I7K A;  2TRC B;  3AH8 B;  4GQ1 A;  2H9N A;  4E54 A;  4ZOV A;  2OVP B;  4H5I A;  1U4C A;  4HDJ A;  3DM0 A;  3EI3 A;  4E5Z A;  2J56 H;  4IMM A;  3PSL A;  3SFZ A;  1XKS A;  2IAA A;  3I7P A;  3AL8 A;  3MZL A;  5EAR A;  1PI6 A;  2H47 A;  3EI2 A;  3OL2 A;  5CYK A;  2W18 A;  4QL1 A;  3ZWL B;  4R7A B;  4XEI C;  2YNP A;  1TYQ C;  4EWR A;  4A11 A;  5AMS A;  2Z2O A;  2O9K A;  1NEX B;  2AGW A;  4GGD A;  4PXW A;  4G56 B;  3DXM C;  2IUQ A;  3V9F A;  5EM2 B;  3MKS B;  3F3F A;  3RN0 D;  5I5J A;  4FAV D;  3I7O A;  4X60 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...