3GD1I

Structure of an arrestin/clathrin complex reveals a novel clathrin binding domain that modulates receptor trafficking
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
358
structure length
358
Chain Sequence
b'QILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-arrestin-1
publication title Structure of an arrestin2-clathrin complex reveals a novel clathrin binding domain that modulates receptor trafficking
pubmed doi rcsb
source organism Bos taurus
molecule tags Endocytosis
total genus 63
structure length 358
sequence length 358
ec nomenclature
pdb deposition date 2009-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01394 Clathrin_propel Clathrin propeller repeat
I PF09268 Clathrin-link Clathrin, heavy-chain linker
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.110 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Clathrin heavy-chain terminal domain 3gd1I00
3GD1I 2XZGA 5M61A 1C9IA 5M5SA 1UTCA 5M5VA 5M5RA 5M5TA 4G55A 1BPOA 3GC3B 5M5UA 1C9LA
chains in the Genus database with same CATH superfamily
2VDKA 3ZE0A 4CY2A 3DSMA 3ZDXA 1GOTB 4PBYA 3EI3A 4PC0A 1I2MB 5M61A 5FLXg 3IUQA 1RI6A 1NEXB 2AGXA 3K71A 2P9IC 5FXYA 3PSCB 4NSXA 2VZ1A 3I89A 3SFZA 5AFU3 4H5JA 3SLED 4D6VA 4JHNA 3FCUA 2VDMA 5B4WA 5GXHA 4J78A 2VDQA 3MZKA 2MTAH 3SBQA 3UVMA 4L3GD 3ULEC 4GQ1A 3EI2B 3AL8B 4DNUA 1SQJA 4XYIA 4OZUA 5CXBA 1PGUA 2EIDA 2AGLA 4O1QD 4QAMA 4L1QD 4E54B 4JT5C 4RE6A 3VH0A 2XZGA 1L0QA 1T2XA 1H2XA 3J81g 1TYEA 3ZDZA 4QL1A 5TF2A 4ZOZA 2I3TA 3I8EA 4GM8A 4J84A 4GZ8A 4WK2A 2QXVA 3UVKA 1VYHC 3ZDYA 2CE8A 3VGZA 4O3UB 4JXMA 5K1CC 4JSVC 2H68A 4AN0A 2PM9A 2OIZA 1FWXA 3P4FA 2VC2A 1E8NA 4A09A 4CZXA 4FA1D 1N6DA 3L4OD 3NVQA 4QRJA 3JRPA 3ZWLB 4N14A 3V9FA 4BL0A 3AL9A 2EIBA 1S4UX 2QR5A 1O6GA 5FQDA 4Z7QA 3CFVA 1A0RB 4G56B 4R7AB 4A0BA 3U4YA 3HFQA 1N6FA 1UOPA 5EM2A 2XE4A 1GP2B 4PXWA 5IC7A 3OW8A 3GREA 3UVNA 4FA9D 4LG8A 3IUJA 1B9YA 2B5MA 3EMHA 4A11B 2QZPA 5C2WB 3O4IA 1SHYB 1VZ2A 2XL2A 2WQ8A 1U8CA 3O4JA 3N0DA 3PXTD 4KFMB 4BUJC 4NC4A 1OMWB 3OL2B 1JV2A 5THAA 2AH0A 3QHYB 4FA4D 4AMZA 3EI1A 4Z7OA 3EQ8A 3JPXA 4EWRA 2I0RA 2H13A 4BCBA 4A0AA 2XU7A 2JKXA 5C86A 2IUQA 3GFCA 3C75H 4JSNC 5I5JA 2H6NA 1YR2A 2HKRA 2J56H 3KRWB 4CI2A 2H14A 2IWKA 3OTTA 4G1MA 3BWSA 5EAPA 5EALA 3SBPA 4QQEA 3UVLA 4CI3A 5CXCA 2YNNA 4BCCA 4Z7NA 1E8MA 1JTDB 4WK0A 4DNWA 4AOWA 4ESGA 3IJ1A 1UTCA 4JHPC 2AGZA 4O3TB 2H47A 2YNPA 3W15A 3JAMg 4Y5RD 3CFSB 3JROA 3I2NA 3RFHA 5FKTA 3OF7A 1XKSA 4PSXB 1BPOA 2P9UC 5EARA 4WK4A 5H14A 4ZN4A 1JMZB 2AGYA 2P9NC 3E0CA 5GSAA 4G55A 4Y7RA 2OVQB 3NIGA 5IJ8E 3F3GA 3IJEA 3DXKC 5FFOA 2HXCA 4L9OA 2BKLA 3SWSD 2OK6A 2VDRA 3UR4A 4GGAA 5JWZA 4D0KA 4J8BA 3DDUA 2PM6B 5FKQA 3UKRC 1R5MA 3IURA 3DXMC 2GC4A 5SXMA 4PBZA 5HE0B 4ZOYA 3I7PA 5FKSA 3K6SA 2G99A 4JSXC 4J77A 5C9ZB 2OK4A 4L1MA 1GOGA 2OVRB 4MK0B 5E6UA 5HDBA 4CZYA 4U1EI 2IWFA 3EI3B 3PVUB 2HESX 4IRZA 3O4HA 4A08A 1C9LA 2AGWA 3K27A 2H3XA 5TEEA 5GMKn 2IUPA 4J8GA 3IIWA 3MMYA 3QI0A 4ES0A 1UOOA 4I79A 3PXSD 2H9LA 1H2YA 1JMXB 4X3EA 3J80g 3CIKB 4O45A 5CYKB 4BP9A 1B9XA 2TRCB 3ODTA 3EG6A 3OKYA 5CXBB 2EBSA 4GM3A 3RMZD 4GM9A 4J73A 3EQ7A 4O9DA 4RE5A 3I8CA 2J57G 3NIDA 5IJ7E 3EU7A 3PXWD 4X61B 3FCSA 2BCJB 5E6SA 4ZOVA 5HE2B 5HQGA 1N6EA 4PSWB 2VDPA 3V4PA 5TDHB 3O4GA 4J82A 3EWEA 4CI1A 3EI4B 3ORVD 2UZXB 2CE9A 2PBIB 4FB1D 3ZE1A 3PE7A 3SCYA 3UVOA 4E5ZA 3SHFA 1ERJA 4A09B 4NAAA 2HU8A 1MG3A 2CN3A 2Q7QA 2CO0A 1E5TA 2G9AA 2O9KA 5HE1B 3I7HA 4A2LA 2GC7A 4Z8LA 3FM0A 1VE6A 2B5LA 1GOHA 3RSEC 4A0BB 5EAMA 2HJ4A 1Q47A 5EM2B 1QFMA 1M1XA 4HDJA 2OVPB 3V4VA 1P22A 2IURA 4X63B 4QT8A 2BBKH 4LGNA 3DWLC 5K19A 2B4EA 3FGBA 3I7OA 3N0EA 4GGDA 4J81A 2CNXA 5AMSA 2W18A 3K72A 5AJAA 1PI6A 1JOFA 4MMYA 2I3SA 5C2VB 3SMRA 1TBGA 2Z2PA 3EI1B 3T3MA 3MUNA 4G1EA 2P9KC 2P9PC 2AQ5A 3F3FA 5KDOB 3UKUC 3RN1D 4BCDA 2H6QA 3VI4A 2AH1A 3AL8A 3IUMA 2P9LC 3EI2A 4A0AB 4O02A 1XHMA 4E54A 1GOFA 5H1MA 2PM7B 2J55H 3IIYA 2YBAA 4AX4A 4UM9A 2YNOA 3MZLA 2IAAA 3KCIA 1TYQC 5GXIA 4UM8A 3BG1A 4K3JB 2I0TA 3I7NA 4FAND 2HU5A 4OWRA 5I5MA 3SVWD 2VDNA 4XEIC 3VA6A 5CXCB 3RRMC 3NVNA 2CN2A 2QC5A 4BH6A 4FAVD 5A2Qg 1OLZA 3IUNA 3IULA 3F3PA 4L3HD 5IT9g 2VDLA 2YB8B 3C9CA 3JB9L 3MKSB 3AFCA 1GXRA 4MMXA 5M5UA 3MUOA 1K32A 1XIPA 4AMYA 5CYKA 4D9SA 4FWWA 3C99A 4PNKB 3SBRA 1A12A 1QNIA 2HU7A 3ZE2A 5M5VA 3NIFA 3AH8B 1C9IA 4IA9A 4AEZA 1VZ3A 4ERZA 3DM0A 2XYIA 4CI8A 3GD1I 3RN0D 4JSPC 4CC9A 3SXTD 3C5MA 1MG2A 4GQBB 4O2WA 5EMMB 4A11A 5FKRA 1NR0A 1L5GA 1H2ZA 1QFSA 5IGOA 4GMBA 1U2VC 5EMKB 1VE7A 3I7LA 3MKQA 5IGQA 2HYEA 1H2WA 5TEFA 3OL2A 3NVXA 3RFGA 3EI4A 1PEVA 5E6RA 3KRXB 5C92A 5FA5B 3V5WB 1SQ9A 1O6FA 4A08B 3SJLD 4J0XA 4IMMA 1UOQA 4CY5A 3VI3A 4H5IA 4ERQA 3GC3B 5H17A 4U7AA 2EICA 2PM9B 4UI9R 1JJUB 2VZ3A 4CZVA 4DNVA 2H9NA 4CY1A 3FRXA 2CO0C 2H9PA 2IUVA 2OJYA 3OKTA 1GG2B 4GQ2P 3IVMA 4JT6C 5M5SA 4GGCA 2H6KA 4NBMA 2B5NA 2GNQA 4NENA 2VDOA 3L4MD 4TZ4A 4FHLA 3EQ9A 4J0WA 3B7FA 4XYHA 3I7KA 3OKYB 1PBYB 4JD2C 2Z2OA 4J87A 5HYNB 3SN6B 3K26A 4K3ID 4A2MA 3PSLA 5HE3B 5M5RA 2XL3A 4X60B 5EMJB 3PVWB 4CY3A 4ERYA 3A0FA 2HJBA 2H9MA 3MVDK 3IJCA 2XDWA 4A7JA 4J86A 4BP8A 2EIEA 3MXXA 2P9SC 5I5IA 3JZGA 3RLMD 2HKMA 3BG0A 4FA5D 3JZHA 4J79A 4MMZA 2Z2NA 4AN1A 4LG9A 3T3PA 1MDAH 5EMLB 4E5ZB 2I0SA 4ZOXA 5FFGA 3V7DB 3JZNA 3OKWA 1YFQA 1U4CA 2UZYB 1K8KC 4YVDA 5M5TA 4WJKA 2YMUA 1K3IA 3IKOA 3IJ0A
chains in the Genus database with same CATH topology
3GD1I 2XZGA 5M61A 1C9IA 5M5SA 1UTCA 5M5VA 5M5RA 5M5TA 4G55A 1BPOA 3GC3B 5M5UA 1C9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GD1 I;  2XZG A;  5M61 A;  1C9I A;  5M5S A;  1UTC A;  5M5V A;  5M5R A;  5M5T A;  4G55 A;  1BPO A;  3GC3 B;  5M5U A;  1C9L A; 
#chains in the Genus database with same CATH topology
 2VDK A;  3ZE0 A;  4CY2 A;  3DSM A;  3ZDX A;  1GOT B;  4PBY A;  3EI3 A;  4PC0 A;  1I2M B;  5M61 A;  5FLX g;  3IUQ A;  1RI6 A;  1NEX B;  2AGX A;  3K71 A;  2P9I C;  5FXY A;  3PSC B;  4NSX A;  2VZ1 A;  3I89 A;  3SFZ A;  5AFU 3;  4H5J A;  3SLE D;  4D6V A;  4JHN A;  3FCU A;  2VDM A;  5B4W A;  5GXH A;  4J78 A;  2VDQ A;  3MZK A;  2MTA H;  3SBQ A;  3UVM A;  4L3G D;  3ULE C;  4GQ1 A;  3EI2 B;  3AL8 B;  4DNU A;  1SQJ A;  4XYI A;  4OZU A;  5CXB A;  1PGU A;  2EID A;  2AGL A;  4O1Q D;  4QAM A;  4L1Q D;  4E54 B;  4JT5 C;  4RE6 A;  3VH0 A;  2XZG A;  1L0Q A;  1T2X A;  1H2X A;  3J81 g;  1TYE A;  3ZDZ A;  4QL1 A;  5TF2 A;  4ZOZ A;  2I3T A;  3I8E A;  4GM8 A;  4J84 A;  4GZ8 A;  4WK2 A;  2QXV A;  3UVK A;  1VYH C;  3ZDY A;  2CE8 A;  3VGZ A;  4O3U B;  4JXM A;  5K1C C;  4JSV C;  2H68 A;  4AN0 A;  2PM9 A;  2OIZ A;  1FWX A;  3P4F A;  2VC2 A;  1E8N A;  4A09 A;  4CZX A;  4FA1 D;  1N6D A;  3L4O D;  3NVQ A;  4QRJ A;  3JRP A;  3ZWL B;  4N14 A;  3V9F A;  4BL0 A;  3AL9 A;  2EIB A;  1S4U X;  2QR5 A;  1O6G A;  5FQD A;  4Z7Q A;  3CFV A;  1A0R B;  4G56 B;  4R7A B;  4A0B A;  3U4Y A;  3HFQ A;  1N6F A;  1UOP A;  5EM2 A;  2XE4 A;  1GP2 B;  4PXW A;  5IC7 A;  3OW8 A;  3GRE A;  3UVN A;  4FA9 D;  4LG8 A;  3IUJ A;  1B9Y A;  2B5M A;  3EMH A;  4A11 B;  2QZP A;  5C2W B;  3O4I A;  1SHY B;  1VZ2 A;  2XL2 A;  2WQ8 A;  1U8C A;  3O4J A;  3N0D A;  3PXT D;  4KFM B;  4BUJ C;  4NC4 A;  1OMW B;  3OL2 B;  1JV2 A;  5THA A;  2AH0 A;  3QHY B;  4FA4 D;  4AMZ A;  3EI1 A;  4Z7O A;  3EQ8 A;  3JPX A;  4EWR A;  2I0R A;  2H13 A;  4BCB A;  4A0A A;  2XU7 A;  2JKX A;  5C86 A;  2IUQ A;  3GFC A;  3C75 H;  4JSN C;  5I5J A;  2H6N A;  1YR2 A;  2HKR A;  2J56 H;  3KRW B;  4CI2 A;  2H14 A;  2IWK A;  3OTT A;  4G1M A;  3BWS A;  5EAP A;  5EAL A;  3SBP A;  4QQE A;  3UVL A;  4CI3 A;  5CXC A;  2YNN A;  4BCC A;  4Z7N A;  1E8M A;  1JTD B;  4WK0 A;  4DNW A;  4AOW A;  4ESG A;  3IJ1 A;  1UTC A;  4JHP C;  2AGZ A;  4O3T B;  2H47 A;  2YNP A;  3W15 A;  3JAM g;  4Y5R D;  3CFS B;  3JRO A;  3I2N A;  3RFH A;  5FKT A;  3OF7 A;  1XKS A;  4PSX B;  1BPO A;  2P9U C;  5EAR A;  4WK4 A;  5H14 A;  4ZN4 A;  1JMZ B;  2AGY A;  2P9N C;  3E0C A;  5GSA A;  4G55 A;  4Y7R A;  2OVQ B;  3NIG A;  5IJ8 E;  3F3G A;  3IJE A;  3DXK C;  5FFO A;  2HXC A;  4L9O A;  2BKL A;  3SWS D;  2OK6 A;  2VDR A;  3UR4 A;  4GGA A;  5JWZ A;  4D0K A;  4J8B A;  3DDU A;  2PM6 B;  5FKQ A;  3UKR C;  1R5M A;  3IUR A;  3DXM C;  2GC4 A;  5SXM A;  4PBZ A;  5HE0 B;  4ZOY A;  3I7P A;  5FKS A;  3K6S A;  2G99 A;  4JSX C;  4J77 A;  5C9Z B;  2OK4 A;  4L1M A;  1GOG A;  2OVR B;  4MK0 B;  5E6U A;  5HDB A;  4CZY A;  4U1E I;  2IWF A;  3EI3 B;  3PVU B;  2HES X;  4IRZ A;  3O4H A;  4A08 A;  1C9L A;  2AGW A;  3K27 A;  2H3X A;  5TEE A;  5GMK n;  2IUP A;  4J8G A;  3IIW A;  3MMY A;  3QI0 A;  4ES0 A;  1UOO A;  4I79 A;  3PXS D;  2H9L A;  1H2Y A;  1JMX B;  4X3E A;  3J80 g;  3CIK B;  4O45 A;  5CYK B;  4BP9 A;  1B9X A;  2TRC B;  3ODT A;  3EG6 A;  3OKY A;  5CXB B;  2EBS A;  4GM3 A;  3RMZ D;  4GM9 A;  4J73 A;  3EQ7 A;  4O9D A;  4RE5 A;  3I8C A;  2J57 G;  3NID A;  5IJ7 E;  3EU7 A;  3PXW D;  4X61 B;  3FCS A;  2BCJ B;  5E6S A;  4ZOV A;  5HE2 B;  5HQG A;  1N6E A;  4PSW B;  2VDP A;  3V4P A;  5TDH B;  3O4G A;  4J82 A;  3EWE A;  4CI1 A;  3EI4 B;  3ORV D;  2UZX B;  2CE9 A;  2PBI B;  4FB1 D;  3ZE1 A;  3PE7 A;  3SCY A;  3UVO A;  4E5Z A;  3SHF A;  1ERJ A;  4A09 B;  4NAA A;  2HU8 A;  1MG3 A;  2CN3 A;  2Q7Q A;  2CO0 A;  1E5T A;  2G9A A;  2O9K A;  5HE1 B;  3I7H A;  4A2L A;  2GC7 A;  4Z8L A;  3FM0 A;  1VE6 A;  2B5L A;  1GOH A;  3RSE C;  4A0B B;  5EAM A;  2HJ4 A;  1Q47 A;  5EM2 B;  1QFM A;  1M1X A;  4HDJ A;  2OVP B;  3V4V A;  1P22 A;  2IUR A;  4X63 B;  4QT8 A;  2BBK H;  4LGN A;  3DWL C;  5K19 A;  2B4E A;  3FGB A;  3I7O A;  3N0E A;  4GGD A;  4J81 A;  2CNX A;  5AMS A;  2W18 A;  3K72 A;  5AJA A;  1PI6 A;  1JOF A;  4MMY A;  2I3S A;  5C2V B;  3SMR A;  1TBG A;  2Z2P A;  3EI1 B;  3T3M A;  3MUN A;  4G1E A;  2P9K C;  2P9P C;  2AQ5 A;  3F3F A;  5KDO B;  3UKU C;  3RN1 D;  4BCD A;  2H6Q A;  3VI4 A;  2AH1 A;  3AL8 A;  3IUM A;  2P9L C;  3EI2 A;  4A0A B;  4O02 A;  1XHM A;  4E54 A;  1GOF A;  5H1M A;  2PM7 B;  2J55 H;  3IIY A;  2YBA A;  4AX4 A;  4UM9 A;  2YNO A;  3MZL A;  2IAA A;  3KCI A;  1TYQ C;  5GXI A;  4UM8 A;  3BG1 A;  4K3J B;  2I0T A;  3I7N A;  4FAN D;  2HU5 A;  4OWR A;  5I5M A;  3SVW D;  2VDN A;  4XEI C;  3VA6 A;  5CXC B;  3RRM C;  3NVN A;  2CN2 A;  2QC5 A;  4BH6 A;  4FAV D;  5A2Q g;  1OLZ A;  3IUN A;  3IUL A;  3F3P A;  4L3H D;  5IT9 g;  2VDL A;  2YB8 B;  3C9C A;  3JB9 L;  3MKS B;  3AFC A;  1GXR A;  4MMX A;  5M5U A;  3MUO A;  1K32 A;  1XIP A;  4AMY A;  5CYK A;  4D9S A;  4FWW A;  3C99 A;  4PNK B;  3SBR A;  1A12 A;  1QNI A;  2HU7 A;  3ZE2 A;  5M5V A;  3NIF A;  3AH8 B;  1C9I A;  4IA9 A;  4AEZ A;  1VZ3 A;  4ERZ A;  3DM0 A;  2XYI A;  4CI8 A;  3GD1 I;  3RN0 D;  4JSP C;  4CC9 A;  3SXT D;  3C5M A;  1MG2 A;  4GQB B;  4O2W A;  5EMM B;  4A11 A;  5FKR A;  1NR0 A;  1L5G A;  1H2Z A;  1QFS A;  5IGO A;  4GMB A;  1U2V C;  5EMK B;  1VE7 A;  3I7L A;  3MKQ A;  5IGQ A;  2HYE A;  1H2W A;  5TEF A;  3OL2 A;  3NVX A;  3RFG A;  3EI4 A;  1PEV A;  5E6R A;  3KRX B;  5C92 A;  5FA5 B;  3V5W B;  1SQ9 A;  1O6F A;  4A08 B;  3SJL D;  4J0X A;  4IMM A;  1UOQ A;  4CY5 A;  3VI3 A;  4H5I A;  4ERQ A;  3GC3 B;  5H17 A;  4U7A A;  2EIC A;  2PM9 B;  4UI9 R;  1JJU B;  2VZ3 A;  4CZV A;  4DNV A;  2H9N A;  4CY1 A;  3FRX A;  2CO0 C;  2H9P A;  2IUV A;  2OJY A;  3OKT A;  1GG2 B;  4GQ2 P;  3IVM A;  4JT6 C;  5M5S A;  4GGC A;  2H6K A;  4NBM A;  2B5N A;  2GNQ A;  4NEN A;  2VDO A;  3L4M D;  4TZ4 A;  4FHL A;  3EQ9 A;  4J0W A;  3B7F A;  4XYH A;  3I7K A;  3OKY B;  1PBY B;  4JD2 C;  2Z2O A;  4J87 A;  5HYN B;  3SN6 B;  3K26 A;  4K3I D;  4A2M A;  3PSL A;  5HE3 B;  5M5R A;  2XL3 A;  4X60 B;  5EMJ B;  3PVW B;  4CY3 A;  4ERY A;  3A0F A;  2HJB A;  2H9M A;  3MVD K;  3IJC A;  2XDW A;  4A7J A;  4J86 A;  4BP8 A;  2EIE A;  3MXX A;  2P9S C;  5I5I A;  3JZG A;  3RLM D;  2HKM A;  3BG0 A;  4FA5 D;  3JZH A;  4J79 A;  4MMZ A;  2Z2N A;  4AN1 A;  4LG9 A;  3T3P A;  1MDA H;  5EML B;  4E5Z B;  2I0S A;  4ZOX A;  5FFG A;  3V7D B;  3JZN A;  3OKW A;  1YFQ A;  1U4C A;  2UZY B;  1K8K C;  4YVD A;  5M5T A;  4WJK A;  2YMU A;  1K3I A;  3IKO A;  3IJ0 A; 
#chains in the Genus database with same CATH homology
 3GD1 I;  2XZG A;  5M61 A;  1C9I A;  5M5S A;  1UTC A;  5M5V A;  5M5R A;  5M5T A;  4G55 A;  1BPO A;  3GC3 B;  5M5U A;  1C9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...