3GD1I

Structure of an arrestin/clathrin complex reveals a novel clathrin binding domain that modulates receptor trafficking
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
358
structure length
358
Chain Sequence
QILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis
molecule keywords Beta-arrestin-1
publication title Structure of an arrestin2-clathrin complex reveals a novel clathrin binding domain that modulates receptor trafficking
pubmed doi rcsb
source organism Bos taurus
total genus 63
structure length 358
sequence length 358
ec nomenclature
pdb deposition date 2009-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01394 Clathrin_propel Clathrin propeller repeat
I PF09268 Clathrin-link Clathrin, heavy-chain linker
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.110 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Clathrin heavy-chain terminal domain 3gd1I00
1C9IA 1UTCA 3GD1I 5M5VA 1C9LA 5M5UA 5M5RA 2XZGA 1BPOA 5M5SA 3GC3B 5M5TA 5M61A 4G55A
chains in the Genus database with same CATH superfamily
3ZE2A 5HE3B 1PEVA 4LGNA 2H47A 1E5TA 5FLXg 2HYEA 5CYKA 5I5JA 4GM9A 4QAMA 1QFMA 2XU7A 1TBGA 5EALA 5M5TA 4A7JA 3VGZA 4CY3A 3I8EA 4Z7QA 1M1XA 2HU8A 3NIFA 3I7PA 3OKWA 3ZDZA 3EQ9A 4AEZA 3UVOA 4BL0A 3IJEA 4WK0A 3O4JA 3PSLA 3NVNA 4A0BB 3RRMC 4WK2A 1N6DA 5M5UA 3BWSA 5H14A 5HDBA 5IJ8E 4X61B 2XDWA 2YB8B 4JSVC 5CXBB 3AH8B 3OW8A 2B4EA 5M5VA 1MG2A 2HXCA 2TRCB 5M5SA 4J81A 2YNOA 4BP8A 4J0XA 2PM9B 4O3TB 2EIEA 1K3IA 3OL2B 1A12A 1YFQA 2P9PC 2VC2A 5FFGA 3U4YA 1GXRA 2OVPB 3ZE0A 3UVLA 4BP9A 2VDRA 2I0SA 4J79A 1ERJA 4NC4A 3ZE1A 4XEIC 3IJCA 3UR4A 4NENA 4D9SA 1MG3A 2I0RA 5GXIA 3O4IA 4GQ2P 1U2VC 4RE5A 3V5WB 2AGZA 4MK0B 4AX4A 5EARA 2IAAA 5IC7A 4AMZA 4Z8LA 3JAMg 5H17A 3EG6A 5HE0B 3IULA 3IVMA 1QFSA 4GGCA 4O1QD 4A11A 3BG0A 3JZGA 3T3PA 4WK4A 4PSXB 3ZWLB 3EMHA 3SBPA 2VDMA 4Y7RA 3RMZD 4GGDA 1NR0A 1H2XA 4A09A 2OK4A 3OKTA 3RSEC 2CE8A 4QQEA 3EI1A 2W18A 3EQ8A 3AL9A 3F3GA 3J80g 3K26A 2HU5A 3EI4B 2VDQA 3PXSD 4GQ1A 5KDOB 4BH6A 5AFU3 3ZDXA 5FKTA 4MMXA 4DNVA 3SBQA 5CYKB 3UKUC 4IRZA 1UOQA 4CZVA 2XL2A 2H6NA 4BCDA 4ES0A 2P9IC 5TDHB 1H2WA 3QHYB 3IIWA 5EM2A 3FRXA 3MVDK 3SJLD 3DSMA 4JT6C 4L9OA 3V4VA 4CI3A 3E0CA 2IWKA 4JSNC 4JHPC 4ZOXA 1C9IA 5FKSA 4L1QD 3EI3A 1C9LA 2AH1A 2BCJB 2AGYA 1GOGA 3F3FA 1N6FA 2CN3A 3UKRC 1UOPA 3IURA 3C9CA 3OKYA 1JMXB 3V9FA 5IT9g 2VDLA 4RE6A 3MMYA 3SFZA 4GQBB 3PE7A 3I7NA 2VDPA 3MZLA 4O9DA 4CY2A 1JJUB 3SBRA 2VDNA 1B9XA 3MKQA 3RLMD 5FKRA 5EMMB 1O6GA 1NEXB 4YVDA 3QI0A 5AJAA 4LG9A 3P4FA 5TEEA 3AFCA 4PXWA 2OIZA 2PM6B 4XYHA 4CI1A 3DXMC 2Z2NA 4O45A 4ZOYA 5K1CC 1PGUA 1GG2B 2IUPA 1H2YA 3MUOA 4JSPC 3MXXA 1JMZB 2BKLA 3ULEC 2YMUA 2HU7A 4CI2A 1H2ZA 5HE1B 5M61A 2GNQA 3J81g 2YNPA 4CY1A 3DDUA 3FM0A 4X63B 4MMZA 4BCBA 4D6VA 2H6QA 4J82A 4BCCA 1GOTB 2CE9A 3HFQA 4GM8A 4Z7OA 4GMBA 2IUQA 4CY5A 1YR2A 4NAAA 2QC5A 2B5LA 4UM8A 4A11B 1E8NA 4DNWA 4J84A 2AGXA 3FCSA 1L5GA 3CFVA 3GREA 3JPXA 3UVMA 4ESGA 5EMKB 4A09B 4JSXC 4ERYA 4WJKA 3EI1B 1OLZA 4U1EI 2GC7A 4JT5C 3C99A 4GGAA 1VYHC 5HYNB 4X3EA 3BG1A 2O9KA 5FXYA 4AN0A 3IKOA 4NSXA 1BPOA 3NIGA 5C2VB 3MUNA 4QRJA 2G9AA 3I7LA 4PBYA 3SN6B 3EI2A 2VDKA 4FA4D 4J78A 5CXCA 4E54A 2J57G 3IUMA 3KCIA 3V4PA 4O2WA 3VA6A 5EM2B 1K8KC 3K71A 2OVQB 5C9ZB 2VDOA 4U7AA 3PXWD 3EI3B 4TZ4A 3JZHA 2J56H 4Z7NA 3OKYB 5HE2B 4FA9D 4D0KA 2AGWA 2B5NA 1UOOA 4L3HD 2Q7QA 5IGQA 3GD1I 5HQGA 2AGLA 2MTAH 3AL8A 3I89A 4H5IA 4PSWB 4ZOZA 3SLED 3VH0A 3GC3B 3K6SA 2AH0A 5EMJB 3I7HA 4A2LA 3FGBA 2XZGA 2G99A 4H5JA 5FFOA 2VZ3A 3OF7A 3VI4A 5A2Qg 1SQJA 5C2WB 2P9NC 2GC4A 4JXMA 4CI8A 3K27A 3EWEA 4FAND 4I79A 1GOFA 1P22A 1U4CA 5EMLB 4NBMA 4KFMB 2HKRA 2CNXA 5E6RA 2H9MA 5B4WA 5THAA 2BBKH 4PNKB 3RN0D 4A0AA 2H6KA 3DXKC 2WQ8A 4L3GD 3A0FA 4OZUA 2QR5A 4HDJA 1RI6A 3W15A 2P9LC 4ZN4A 4MMYA 3RFHA 5EAPA 1T2XA 4G55A 2VZ1A 4A08A 2Z2OA 2PBIB 4N14A 2CO0A 5E6UA 2HKMA 5IGOA 5GXHA 2EBSA 3I2NA 3NVQA 2I0TA 4BUJC 1TYEA 1L0QA 3L4OD 4AOWA 2Z2PA 5C92A 4ZOVA 2XE4A 4JD2C 3PSCB 5EAMA 2YBAA 3N0DA 4FA5D 4EWRA 3EU7A 2OVRB 3SVWD 2IUVA 3VI3A 5IJ7E 1S4UX 1B9YA 3MKSB 1GOHA 1VE6A 3PVUB 3NVXA 3EI2B 5I5MA 5I5IA 4X60B 5CXCB 4E54B 1UTCA 1MDAH 3ORVD 3O4GA 2AQ5A 2HJ4A 3IJ1A 4QL1A 3SCYA 4GM3A 3RFGA 3N0EA 1GP2B 4K3JB 4FHLA 2I3TA 2J55H 3JROA 2CO0C 4LG8A 4PC0A 4QT8A 4PBZA 2B5MA 3JB9L 4FA1D 3KRXB 4E5ZA 1PBYB 2H68A 4AN1A 4J77A 5FQDA 1K32A 1XKSA 3OTTA 1TYQC 2P9UC 3UVKA 1SHYB 3AL8B 3IUNA 3MZKA 4O02A 4IMMA 3SXTD 2H9NA 3C75H 1SQ9A 3IJ0A 4ERZA 4J8BA 4XYIA 3NIDA 4JHNA 2H13A 5FA5B 5TEFA 4IA9A 4OWRA 4ERQA 4J8GA 3I7KA 3RN1D 3EQ7A 5K19A 2IWFA 1U8CA 4FAVD 1PI6A 4O3UB 5AMSA 5E6SA 4A0BA 4J73A 3F3PA 3C5MA 1I2MB 1O6FA 2JKXA 3FCUA 4J0WA 3B7FA 5FKQA 1N6EA 5GSAA 4A0AB 3I7OA 4A2MA 4J87A 3T3MA 1QNIA 1FWXA 3KRWB 4Y5RD 3UVNA 5CXBA 1OMWB 4L1MA 2HESX 2CN2A 4CZYA 1VZ2A 1VE7A 2OK6A 4A08B 2PM9A 5TF2A 2EIDA 3CFSB 3OL2A 4G56B 2UZXB 2UZYB 1XIPA 4UM9A 2P9KC 3IUQA 2QZPA 1E8MA 2QXVA 3ZDYA 5SXMA 2EICA 4R7AB 3DWLC 1R5MA 3PXTD 4AMYA 4DNUA 2XYIA 4CC9A 3SWSD 2PM7B 1JOFA 3I8CA 4GZ8A 2OJYA 2HJBA 3K72A 2H9PA 2YNNA 2H9LA 3IUJA 1JV2A 2IURA 3V7DB 4FWWA 3L4MD 5GMKn 3SHFA 4G1EA 3ODTA 3IIYA 5H1MA 5JWZA 3JRPA 1Q47A 3CIKB 2P9SC 5C86A 4UI9R 4FB1D 2EIBA 1XHMA 3O4HA 4J86A 4K3ID 2H14A 2I3SA 4CZXA 3JZNA 3GFCA 1VZ3A 1JTDB 2H3XA 3DM0A 5M5RA 4E5ZB 1A0RB 3SMRA 2XL3A 3EI4A 4G1MA 3PVWB
chains in the Genus database with same CATH topology
1C9IA 1UTCA 3GD1I 5M5VA 1C9LA 5M5UA 5M5RA 2XZGA 1BPOA 5M5SA 3GC3B 5M5TA 5M61A 4G55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C9I A;  1UTC A;  3GD1 I;  5M5V A;  1C9L A;  5M5U A;  5M5R A;  2XZG A;  1BPO A;  5M5S A;  3GC3 B;  5M5T A;  5M61 A;  4G55 A; 
#chains in the Genus database with same CATH topology
 3ZE2 A;  5HE3 B;  1PEV A;  4LGN A;  2H47 A;  1E5T A;  5FLX g;  2HYE A;  5CYK A;  5I5J A;  4GM9 A;  4QAM A;  1QFM A;  2XU7 A;  1TBG A;  5EAL A;  5M5T A;  4A7J A;  3VGZ A;  4CY3 A;  3I8E A;  4Z7Q A;  1M1X A;  2HU8 A;  3NIF A;  3I7P A;  3OKW A;  3ZDZ A;  3EQ9 A;  4AEZ A;  3UVO A;  4BL0 A;  3IJE A;  4WK0 A;  3O4J A;  3PSL A;  3NVN A;  4A0B B;  3RRM C;  4WK2 A;  1N6D A;  5M5U A;  3BWS A;  5H14 A;  5HDB A;  5IJ8 E;  4X61 B;  2XDW A;  2YB8 B;  4JSV C;  5CXB B;  3AH8 B;  3OW8 A;  2B4E A;  5M5V A;  1MG2 A;  2HXC A;  2TRC B;  5M5S A;  4J81 A;  2YNO A;  4BP8 A;  4J0X A;  2PM9 B;  4O3T B;  2EIE A;  1K3I A;  3OL2 B;  1A12 A;  1YFQ A;  2P9P C;  2VC2 A;  5FFG A;  3U4Y A;  1GXR A;  2OVP B;  3ZE0 A;  3UVL A;  4BP9 A;  2VDR A;  2I0S A;  4J79 A;  1ERJ A;  4NC4 A;  3ZE1 A;  4XEI C;  3IJC A;  3UR4 A;  4NEN A;  4D9S A;  1MG3 A;  2I0R A;  5GXI A;  3O4I A;  4GQ2 P;  1U2V C;  4RE5 A;  3V5W B;  2AGZ A;  4MK0 B;  4AX4 A;  5EAR A;  2IAA A;  5IC7 A;  4AMZ A;  4Z8L A;  3JAM g;  5H17 A;  3EG6 A;  5HE0 B;  3IUL A;  3IVM A;  1QFS A;  4GGC A;  4O1Q D;  4A11 A;  3BG0 A;  3JZG A;  3T3P A;  4WK4 A;  4PSX B;  3ZWL B;  3EMH A;  3SBP A;  2VDM A;  4Y7R A;  3RMZ D;  4GGD A;  1NR0 A;  1H2X A;  4A09 A;  2OK4 A;  3OKT A;  3RSE C;  2CE8 A;  4QQE A;  3EI1 A;  2W18 A;  3EQ8 A;  3AL9 A;  3F3G A;  3J80 g;  3K26 A;  2HU5 A;  3EI4 B;  2VDQ A;  3PXS D;  4GQ1 A;  5KDO B;  4BH6 A;  5AFU 3;  3ZDX A;  5FKT A;  4MMX A;  4DNV A;  3SBQ A;  5CYK B;  3UKU C;  4IRZ A;  1UOQ A;  4CZV A;  2XL2 A;  2H6N A;  4BCD A;  4ES0 A;  2P9I C;  5TDH B;  1H2W A;  3QHY B;  3IIW A;  5EM2 A;  3FRX A;  3MVD K;  3SJL D;  3DSM A;  4JT6 C;  4L9O A;  3V4V A;  4CI3 A;  3E0C A;  2IWK A;  4JSN C;  4JHP C;  4ZOX A;  1C9I A;  5FKS A;  4L1Q D;  3EI3 A;  1C9L A;  2AH1 A;  2BCJ B;  2AGY A;  1GOG A;  3F3F A;  1N6F A;  2CN3 A;  3UKR C;  1UOP A;  3IUR A;  3C9C A;  3OKY A;  1JMX B;  3V9F A;  5IT9 g;  2VDL A;  4RE6 A;  3MMY A;  3SFZ A;  4GQB B;  3PE7 A;  3I7N A;  2VDP A;  3MZL A;  4O9D A;  4CY2 A;  1JJU B;  3SBR A;  2VDN A;  1B9X A;  3MKQ A;  3RLM D;  5FKR A;  5EMM B;  1O6G A;  1NEX B;  4YVD A;  3QI0 A;  5AJA A;  4LG9 A;  3P4F A;  5TEE A;  3AFC A;  4PXW A;  2OIZ A;  2PM6 B;  4XYH A;  4CI1 A;  3DXM C;  2Z2N A;  4O45 A;  4ZOY A;  5K1C C;  1PGU A;  1GG2 B;  2IUP A;  1H2Y A;  3MUO A;  4JSP C;  3MXX A;  1JMZ B;  2BKL A;  3ULE C;  2YMU A;  2HU7 A;  4CI2 A;  1H2Z A;  5HE1 B;  5M61 A;  2GNQ A;  3J81 g;  2YNP A;  4CY1 A;  3DDU A;  3FM0 A;  4X63 B;  4MMZ A;  4BCB A;  4D6V A;  2H6Q A;  4J82 A;  4BCC A;  1GOT B;  2CE9 A;  3HFQ A;  4GM8 A;  4Z7O A;  4GMB A;  2IUQ A;  4CY5 A;  1YR2 A;  4NAA A;  2QC5 A;  2B5L A;  4UM8 A;  4A11 B;  1E8N A;  4DNW A;  4J84 A;  2AGX A;  3FCS A;  1L5G A;  3CFV A;  3GRE A;  3JPX A;  3UVM A;  4ESG A;  5EMK B;  4A09 B;  4JSX C;  4ERY A;  4WJK A;  3EI1 B;  1OLZ A;  4U1E I;  2GC7 A;  4JT5 C;  3C99 A;  4GGA A;  1VYH C;  5HYN B;  4X3E A;  3BG1 A;  2O9K A;  5FXY A;  4AN0 A;  3IKO A;  4NSX A;  1BPO A;  3NIG A;  5C2V B;  3MUN A;  4QRJ A;  2G9A A;  3I7L A;  4PBY A;  3SN6 B;  3EI2 A;  2VDK A;  4FA4 D;  4J78 A;  5CXC A;  4E54 A;  2J57 G;  3IUM A;  3KCI A;  3V4P A;  4O2W A;  3VA6 A;  5EM2 B;  1K8K C;  3K71 A;  2OVQ B;  5C9Z B;  2VDO A;  4U7A A;  3PXW D;  3EI3 B;  4TZ4 A;  3JZH A;  2J56 H;  4Z7N A;  3OKY B;  5HE2 B;  4FA9 D;  4D0K A;  2AGW A;  2B5N A;  1UOO A;  4L3H D;  2Q7Q A;  5IGQ A;  3GD1 I;  5HQG A;  2AGL A;  2MTA H;  3AL8 A;  3I89 A;  4H5I A;  4PSW B;  4ZOZ A;  3SLE D;  3VH0 A;  3GC3 B;  3K6S A;  2AH0 A;  5EMJ B;  3I7H A;  4A2L A;  3FGB A;  2XZG A;  2G99 A;  4H5J A;  5FFO A;  2VZ3 A;  3OF7 A;  3VI4 A;  5A2Q g;  1SQJ A;  5C2W B;  2P9N C;  2GC4 A;  4JXM A;  4CI8 A;  3K27 A;  3EWE A;  4FAN D;  4I79 A;  1GOF A;  1P22 A;  1U4C A;  5EML B;  4NBM A;  4KFM B;  2HKR A;  2CNX A;  5E6R A;  2H9M A;  5B4W A;  5THA A;  2BBK H;  4PNK B;  3RN0 D;  4A0A A;  2H6K A;  3DXK C;  2WQ8 A;  4L3G D;  3A0F A;  4OZU A;  2QR5 A;  4HDJ A;  1RI6 A;  3W15 A;  2P9L C;  4ZN4 A;  4MMY A;  3RFH A;  5EAP A;  1T2X A;  4G55 A;  2VZ1 A;  4A08 A;  2Z2O A;  2PBI B;  4N14 A;  2CO0 A;  5E6U A;  2HKM A;  5IGO A;  5GXH A;  2EBS A;  3I2N A;  3NVQ A;  2I0T A;  4BUJ C;  1TYE A;  1L0Q A;  3L4O D;  4AOW A;  2Z2P A;  5C92 A;  4ZOV A;  2XE4 A;  4JD2 C;  3PSC B;  5EAM A;  2YBA A;  3N0D A;  4FA5 D;  4EWR A;  3EU7 A;  2OVR B;  3SVW D;  2IUV A;  3VI3 A;  5IJ7 E;  1S4U X;  1B9Y A;  3MKS B;  1GOH A;  1VE6 A;  3PVU B;  3NVX A;  3EI2 B;  5I5M A;  5I5I A;  4X60 B;  5CXC B;  4E54 B;  1UTC A;  1MDA H;  3ORV D;  3O4G A;  2AQ5 A;  2HJ4 A;  3IJ1 A;  4QL1 A;  3SCY A;  4GM3 A;  3RFG A;  3N0E A;  1GP2 B;  4K3J B;  4FHL A;  2I3T A;  2J55 H;  3JRO A;  2CO0 C;  4LG8 A;  4PC0 A;  4QT8 A;  4PBZ A;  2B5M A;  3JB9 L;  4FA1 D;  3KRX B;  4E5Z A;  1PBY B;  2H68 A;  4AN1 A;  4J77 A;  5FQD A;  1K32 A;  1XKS A;  3OTT A;  1TYQ C;  2P9U C;  3UVK A;  1SHY B;  3AL8 B;  3IUN A;  3MZK A;  4O02 A;  4IMM A;  3SXT D;  2H9N A;  3C75 H;  1SQ9 A;  3IJ0 A;  4ERZ A;  4J8B A;  4XYI A;  3NID A;  4JHN A;  2H13 A;  5FA5 B;  5TEF A;  4IA9 A;  4OWR A;  4ERQ A;  4J8G A;  3I7K A;  3RN1 D;  3EQ7 A;  5K19 A;  2IWF A;  1U8C A;  4FAV D;  1PI6 A;  4O3U B;  5AMS A;  5E6S A;  4A0B A;  4J73 A;  3F3P A;  3C5M A;  1I2M B;  1O6F A;  2JKX A;  3FCU A;  4J0W A;  3B7F A;  5FKQ A;  1N6E A;  5GSA A;  4A0A B;  3I7O A;  4A2M A;  4J87 A;  3T3M A;  1QNI A;  1FWX A;  3KRW B;  4Y5R D;  3UVN A;  5CXB A;  1OMW B;  4L1M A;  2HES X;  2CN2 A;  4CZY A;  1VZ2 A;  1VE7 A;  2OK6 A;  4A08 B;  2PM9 A;  5TF2 A;  2EID A;  3CFS B;  3OL2 A;  4G56 B;  2UZX B;  2UZY B;  1XIP A;  4UM9 A;  2P9K C;  3IUQ A;  2QZP A;  1E8M A;  2QXV A;  3ZDY A;  5SXM A;  2EIC A;  4R7A B;  3DWL C;  1R5M A;  3PXT D;  4AMY A;  4DNU A;  2XYI A;  4CC9 A;  3SWS D;  2PM7 B;  1JOF A;  3I8C A;  4GZ8 A;  2OJY A;  2HJB A;  3K72 A;  2H9P A;  2YNN A;  2H9L A;  3IUJ A;  1JV2 A;  2IUR A;  3V7D B;  4FWW A;  3L4M D;  5GMK n;  3SHF A;  4G1E A;  3ODT A;  3IIY A;  5H1M A;  5JWZ A;  3JRP A;  1Q47 A;  3CIK B;  2P9S C;  5C86 A;  4UI9 R;  4FB1 D;  2EIB A;  1XHM A;  3O4H A;  4J86 A;  4K3I D;  2H14 A;  2I3S A;  4CZX A;  3JZN A;  3GFC A;  1VZ3 A;  1JTD B;  2H3X A;  3DM0 A;  5M5R A;  4E5Z B;  1A0R B;  3SMR A;  2XL3 A;  3EI4 A;  4G1M A;  3PVW B; 
#chains in the Genus database with same CATH homology
 1C9I A;  1UTC A;  3GD1 I;  5M5V A;  1C9L A;  5M5U A;  5M5R A;  2XZG A;  1BPO A;  5M5S A;  3GC3 B;  5M5T A;  5M61 A;  4G55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...