3GD1I

Structure of an arrestin/clathrin complex reveals a novel clathrin binding domain that modulates receptor trafficking
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
358
structure length
358
Chain Sequence
QILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-arrestin-1
publication title Structure of an arrestin2-clathrin complex reveals a novel clathrin binding domain that modulates receptor trafficking
pubmed doi rcsb
source organism Bos taurus
molecule tags Endocytosis
total genus 63
structure length 358
sequence length 358
ec nomenclature
pdb deposition date 2009-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01394 Clathrin_propel Clathrin propeller repeat
I PF09268 Clathrin-link Clathrin, heavy-chain linker
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.110 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Clathrin heavy-chain terminal domain 3gd1I00
5M5SA 5M5UA 1C9LA 4G55A 5M5VA 3GC3B 1C9IA 5M5RA 5M61A 2XZGA 3GD1I 1BPOA 1UTCA 5M5TA
chains in the Genus database with same CATH superfamily
2XE4A 3IJ1A 2OK6A 3L4MD 5EAPA 1GG2B 4FHLA 4FA5D 3V5WB 1PEVA 1YR2A 1XIPA 3NVNA 1RI6A 4XEIC 2IURA 3OKYB 1BPOA 2YNPA 3NIFA 2YMUA 1L0QA 1QFMA 2GNQA 4FA9D 5I5MA 5GSAA 4BCBA 1O6GA 4Z8LA 4PC0A 3IJ0A 3SCYA 1O6FA 3VI3A 4NBMA 5C92A 2HU8A 1GP2B 4HDJA 5I5IA 3SBPA 3O4IA 3K72A 2VDPA 1UOQA 4AMYA 1VE7A 2AGWA 3NVXA 1GOTB 3SBQA 2VZ1A 3V7DB 3SJLD 4AX4A 3EQ7A 2G9AA 3RFHA 2CN3A 5AMSA 3VI4A 4J73A 4J78A 1NR0A 2W18A 1PGUA 4BH6A 5K1CC 3FGBA 3SVWD 1H2XA 4O9DA 4G55A 4J8BA 1C9IA 3UKUC 3I7NA 5M5TA 4UM8A 2XYIA 2VC2A 2AGXA 3W15A 3C99A 1JV2A 2IAAA 4JHPC 1UTCA 2PM9A 2OJYA 1C9LA 4Z7NA 2HKRA 5IJ8E 1MG3A 1FWXA 2TRCB 3PE7A 2VDLA 3F3FA 3OKTA 2BKLA 3AL8A 5HDBA 2IWFA 4L9OA 4BP8A 4X60B 4JSNC 2H14A 3UVOA 4U1EI 3C75H 4JHNA 1S4UX 5GXIA 4CY1A 3BG1A 4Z7QA 2GC7A 3IIYA 3IVMA 3C5MA 2H6KA 4ZOVA 2UZYB 2VDNA 3JPXA 3JZNA 4AN0A 1H2YA 2VDKA 3RMZD 3VA6A 4CZXA 4GQ2P 4D6VA 1JMZB 5EM2A 3OL2A 3I7KA 1K8KC 4PBYA 4O1QD 3PXSD 2CO0C 4O3UB 3QHYB 1U2VC 1GOFA 1TYQC 3OKYA 5IGOA 3L4OD 4YVDA 4L1QD 5M61A 4O02A 4DNUA 4A09A 4LGNA 1K32A 3GREA 5H1MA 2EICA 1K3IA 4JSXC 3FCSA 4RE6A 2H47A 2HU5A 2UZXB 1Q47A 4Y7RA 4J82A 1U4CA 5C2VB 3JRPA 2YBAA 4WK4A 5CXBB 1JJUB 1JTDB 2EIEA 3I8CA 3JZGA 4RE5A 4N14A 5EARA 5B4WA 4CZYA 3NVQA 4CZVA 4XYHA 4A0AB 4JXMA 5E6RA 3DXMC 3PXWD 2EBSA 4CY3A 1A12A 2B4EA 3N0EA 4J8GA 4CY2A 4E5ZA 4J86A 2CE9A 4CI1A 5FFOA 3I89A 2B5MA 4QAMA 4NSXA 5CYKA 5H17A 4E54A 4JT6C 3SXTD 2OVPB 4BL0A 3J81g 2OVQB 4A0BA 3SBRA 1H2ZA 2AGLA 3SMRA 2AGYA 1QNIA 1VZ3A 3BG0A 2HU7A 2QZPA 3I8EA 4IMMA 3MUOA 4L3GD 3C9CA 4PSWB 4CI8A 5AJAA 3K27A 5EALA 4D9SA 3PVWB 4ZOZA 5FA5B 2CN2A 2H68A 3N0DA 4QT8A 2HKMA 3UVNA 5JWZA 5CXCA 2VDOA 3A0FA 3EI3B 5EMLB 2H13A 3IKOA 4GM9A 3I7LA 5EMJB 5AFU3 4CY5A 3EMHA 5FQDA 4A2MA 4IA9A 3F3GA 1GXRA 2H6QA 4OWRA 1MDAH 3EWEA 4LG8A 3RN0D 2AH0A 4FA1D 1PBYB 4OZUA 5FLXg 4JSPC 1NEXB 4CI2A 4J77A 4EWRA 3UVKA 3U4YA 3EI4B 4G56B 2OIZA 4H5JA 5C86A 4O3TB 3ZE2A 2J57G 1GOHA 4TZ4A 2G99A 3SWSD 4J0XA 3IJEA 3MXXA 1N6DA 3O4GA 4GMBA 4O2WA 5THAA 5M5VA 3UKRC 4CC9A 2H9LA 2P9UC 3MZKA 3DM0A 3VGZA 5I5JA 4J81A 1E5TA 2Q7QA 2IUPA 1XKSA 3KRXB 5CXBA 2P9PC 3AH8B 4NAAA 3ZDYA 4ZN4A 2QR5A 4Z7OA 2HJ4A 2XL3A 3T3PA 5KDOB 4NENA 1GOGA 3OKWA 4FA4D 1SHYB 4H5IA 3OTTA 4BCCA 3EG6A 5TDHB 2XL2A 2XDWA 3V4VA 3DWLC 3MKQA 2YNNA 4ERQA 4GGCA 3UVMA 5EMMB 3AFCA 4DNWA 4FAND 1U8CA 4GQBB 4ERZA 2EIBA 3PSCB 5HE3B 4UM9A 1E8MA 2BCJB 4J84A 4Y5RD 3ZDXA 3ULEC 3IUMA 4CI3A 3ZE0A 5IGQA 3QI0A 4LG9A 3RSEC 4AMZA 3CFVA 2AQ5A 4MMYA 2OVRB 5M5RA 4A2LA 4X61B 5FFGA 1TYEA 2YNOA 4L3HD 3ORVD 3SLED 1PI6A 2AGZA 2VDRA 4I79A 3J80g 4J79A 2PM9B 3B7FA 1N6FA 2H3XA 4U7AA 4JT5C 5A2Qg 4GM3A 1T2XA 3MUNA 5EMKB 5M5SA 3K6SA 4MMXA 2B5LA 4A11B 2EIDA 3IURA 3I7HA 4GGAA 2H9PA 4GZ8A 3CIKB 2IWKA 3RLMD 5GXHA 3MKSB 1TBGA 1P22A 4BP9A 4AN1A 3ZDZA 2MTAH 4FWWA 1MG2A 2XZGA 3DDUA 5TF2A 2P9LC 3PSLA 2HYEA 3JZHA 2I0SA 3IULA 4G1EA 4G1MA 4PSXB 3I7OA 4PBZA 2H6NA 5EM2B 3OL2B 2QXVA 4ES0A 3ZE1A 3SHFA 3HFQA 4FAVD 4DNVA 3EQ9A 1I2MB 1XHMA 3DXKC 4ZOXA 4NC4A 1UOPA 3EI1B 4WK2A 3GFCA 3O4HA 4A09B 2BBKH 5E6UA 2IUVA 3IUNA 2P9SC 5C2WB 2H9NA 5C9ZB 1L5GA 5HE1B 1E8NA 5FKQA 3VH0A 4ERYA 3RN1D 2WQ8A 3IUJA 3I7PA 4BCDA 4KFMB 2QC5A 1VE6A 2YB8B 3KRWB 3ZWLB 2Z2NA 1B9YA 3MMYA 3K26A 5HE2B 3EI2B 4UI9R 1OMWB 1M1XA 3ODTA 4A08B 4AEZA 4D0KA 5FKSA 2CE8A 2HJBA 4QL1A 1JOFA 1SQJA 3OF7A 4JD2C 2AH1A 3UR4A 4E5ZB 2VDMA 3FRXA 3PXTD 4WK0A 5CYKB 4X3EA 4E54B 1JMXB 5H14A 1R5MA 2VZ3A 4A0BB 4IRZA 5FKRA 5IJ7E 3JAMg 3BWSA 4QRJA 2JKXA 3JROA 5FKTA 3V9FA 3FM0A 4MK0B 5GMKn 2CO0A 3GC3B 5FXYA 4BUJC 1OLZA 4A0AA 3MZLA 1SQ9A 4MMZA 3IUQA 4L1MA 5K19A 2OK4A 3EU7A 3K71A 4A11A 2P9KC 4JSVC 2I0TA 3CFSB 3SN6B 3UVLA 1YFQA 3OW8A 5HE0B 4GM8A 1ERJA 2VDQA 1VZ2A 2IUQA 3DSMA 5CXCB 5E6SA 2P9IC 2HESX 4R7AB 4J87A 2PM7B 2O9KA 4J0WA 2H9MA 5HQGA 5IT9g 3JB9L 5TEFA 3FCUA 3KCIA 1H2WA 3IJCA 4FB1D 1UOOA 3T3MA 2P9NC 4A7JA 1A0RB 4K3JB 5SXMA 1VYHC 3GD1I 3EI3A 3RFGA 3EI1A 3O4JA 4QQEA 4ZOYA 1B9XA 4GQ1A 3V4PA 4PNKB 4AOWA 2I3TA 5TEEA 2PBIB 1QFSA 2Z2OA 3AL8B 4GGDA 3SFZA 3IIWA 2GC4A 4O45A 2CNXA 4WJKA 4K3ID 5M5UA 2J56H 3NIGA 5EAMA 2J55H 3I2NA 1N6EA 3F3PA 3NIDA 4X63B 2HXCA 2I3SA 3EI4A 3MVDK 2B5NA 3EQ8A 3EI2A 3E0CA 4A08A 3PVUB 4XYIA 3AL9A 3RRMC 3P4FA 4PXWA 2XU7A 2I0RA 5HYNB 4ESGA 2PM6B 2Z2PA 5IC7A
chains in the Genus database with same CATH topology
5M5SA 5M5UA 1C9LA 4G55A 5M5VA 3GC3B 1C9IA 5M5RA 5M61A 2XZGA 3GD1I 1BPOA 1UTCA 5M5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M5S A;  5M5U A;  1C9L A;  4G55 A;  5M5V A;  3GC3 B;  1C9I A;  5M5R A;  5M61 A;  2XZG A;  3GD1 I;  1BPO A;  1UTC A;  5M5T A; 
#chains in the Genus database with same CATH topology
 2XE4 A;  3IJ1 A;  2OK6 A;  3L4M D;  5EAP A;  1GG2 B;  4FHL A;  4FA5 D;  3V5W B;  1PEV A;  1YR2 A;  1XIP A;  3NVN A;  1RI6 A;  4XEI C;  2IUR A;  3OKY B;  1BPO A;  2YNP A;  3NIF A;  2YMU A;  1L0Q A;  1QFM A;  2GNQ A;  4FA9 D;  5I5M A;  5GSA A;  4BCB A;  1O6G A;  4Z8L A;  4PC0 A;  3IJ0 A;  3SCY A;  1O6F A;  3VI3 A;  4NBM A;  5C92 A;  2HU8 A;  1GP2 B;  4HDJ A;  5I5I A;  3SBP A;  3O4I A;  3K72 A;  2VDP A;  1UOQ A;  4AMY A;  1VE7 A;  2AGW A;  3NVX A;  1GOT B;  3SBQ A;  2VZ1 A;  3V7D B;  3SJL D;  4AX4 A;  3EQ7 A;  2G9A A;  3RFH A;  2CN3 A;  5AMS A;  3VI4 A;  4J73 A;  4J78 A;  1NR0 A;  2W18 A;  1PGU A;  4BH6 A;  5K1C C;  3FGB A;  3SVW D;  1H2X A;  4O9D A;  4G55 A;  4J8B A;  1C9I A;  3UKU C;  3I7N A;  5M5T A;  4UM8 A;  2XYI A;  2VC2 A;  2AGX A;  3W15 A;  3C99 A;  1JV2 A;  2IAA A;  4JHP C;  1UTC A;  2PM9 A;  2OJY A;  1C9L A;  4Z7N A;  2HKR A;  5IJ8 E;  1MG3 A;  1FWX A;  2TRC B;  3PE7 A;  2VDL A;  3F3F A;  3OKT A;  2BKL A;  3AL8 A;  5HDB A;  2IWF A;  4L9O A;  4BP8 A;  4X60 B;  4JSN C;  2H14 A;  3UVO A;  4U1E I;  3C75 H;  4JHN A;  1S4U X;  5GXI A;  4CY1 A;  3BG1 A;  4Z7Q A;  2GC7 A;  3IIY A;  3IVM A;  3C5M A;  2H6K A;  4ZOV A;  2UZY B;  2VDN A;  3JPX A;  3JZN A;  4AN0 A;  1H2Y A;  2VDK A;  3RMZ D;  3VA6 A;  4CZX A;  4GQ2 P;  4D6V A;  1JMZ B;  5EM2 A;  3OL2 A;  3I7K A;  1K8K C;  4PBY A;  4O1Q D;  3PXS D;  2CO0 C;  4O3U B;  3QHY B;  1U2V C;  1GOF A;  1TYQ C;  3OKY A;  5IGO A;  3L4O D;  4YVD A;  4L1Q D;  5M61 A;  4O02 A;  4DNU A;  4A09 A;  4LGN A;  1K32 A;  3GRE A;  5H1M A;  2EIC A;  1K3I A;  4JSX C;  3FCS A;  4RE6 A;  2H47 A;  2HU5 A;  2UZX B;  1Q47 A;  4Y7R A;  4J82 A;  1U4C A;  5C2V B;  3JRP A;  2YBA A;  4WK4 A;  5CXB B;  1JJU B;  1JTD B;  2EIE A;  3I8C A;  3JZG A;  4RE5 A;  4N14 A;  5EAR A;  5B4W A;  4CZY A;  3NVQ A;  4CZV A;  4XYH A;  4A0A B;  4JXM A;  5E6R A;  3DXM C;  3PXW D;  2EBS A;  4CY3 A;  1A12 A;  2B4E A;  3N0E A;  4J8G A;  4CY2 A;  4E5Z A;  4J86 A;  2CE9 A;  4CI1 A;  5FFO A;  3I89 A;  2B5M A;  4QAM A;  4NSX A;  5CYK A;  5H17 A;  4E54 A;  4JT6 C;  3SXT D;  2OVP B;  4BL0 A;  3J81 g;  2OVQ B;  4A0B A;  3SBR A;  1H2Z A;  2AGL A;  3SMR A;  2AGY A;  1QNI A;  1VZ3 A;  3BG0 A;  2HU7 A;  2QZP A;  3I8E A;  4IMM A;  3MUO A;  4L3G D;  3C9C A;  4PSW B;  4CI8 A;  5AJA A;  3K27 A;  5EAL A;  4D9S A;  3PVW B;  4ZOZ A;  5FA5 B;  2CN2 A;  2H68 A;  3N0D A;  4QT8 A;  2HKM A;  3UVN A;  5JWZ A;  5CXC A;  2VDO A;  3A0F A;  3EI3 B;  5EML B;  2H13 A;  3IKO A;  4GM9 A;  3I7L A;  5EMJ B;  5AFU 3;  4CY5 A;  3EMH A;  5FQD A;  4A2M A;  4IA9 A;  3F3G A;  1GXR A;  2H6Q A;  4OWR A;  1MDA H;  3EWE A;  4LG8 A;  3RN0 D;  2AH0 A;  4FA1 D;  1PBY B;  4OZU A;  5FLX g;  4JSP C;  1NEX B;  4CI2 A;  4J77 A;  4EWR A;  3UVK A;  3U4Y A;  3EI4 B;  4G56 B;  2OIZ A;  4H5J A;  5C86 A;  4O3T B;  3ZE2 A;  2J57 G;  1GOH A;  4TZ4 A;  2G99 A;  3SWS D;  4J0X A;  3IJE A;  3MXX A;  1N6D A;  3O4G A;  4GMB A;  4O2W A;  5THA A;  5M5V A;  3UKR C;  4CC9 A;  2H9L A;  2P9U C;  3MZK A;  3DM0 A;  3VGZ A;  5I5J A;  4J81 A;  1E5T A;  2Q7Q A;  2IUP A;  1XKS A;  3KRX B;  5CXB A;  2P9P C;  3AH8 B;  4NAA A;  3ZDY A;  4ZN4 A;  2QR5 A;  4Z7O A;  2HJ4 A;  2XL3 A;  3T3P A;  5KDO B;  4NEN A;  1GOG A;  3OKW A;  4FA4 D;  1SHY B;  4H5I A;  3OTT A;  4BCC A;  3EG6 A;  5TDH B;  2XL2 A;  2XDW A;  3V4V A;  3DWL C;  3MKQ A;  2YNN A;  4ERQ A;  4GGC A;  3UVM A;  5EMM B;  3AFC A;  4DNW A;  4FAN D;  1U8C A;  4GQB B;  4ERZ A;  2EIB A;  3PSC B;  5HE3 B;  4UM9 A;  1E8M A;  2BCJ B;  4J84 A;  4Y5R D;  3ZDX A;  3ULE C;  3IUM A;  4CI3 A;  3ZE0 A;  5IGQ A;  3QI0 A;  4LG9 A;  3RSE C;  4AMZ A;  3CFV A;  2AQ5 A;  4MMY A;  2OVR B;  5M5R A;  4A2L A;  4X61 B;  5FFG A;  1TYE A;  2YNO A;  4L3H D;  3ORV D;  3SLE D;  1PI6 A;  2AGZ A;  2VDR A;  4I79 A;  3J80 g;  4J79 A;  2PM9 B;  3B7F A;  1N6F A;  2H3X A;  4U7A A;  4JT5 C;  5A2Q g;  4GM3 A;  1T2X A;  3MUN A;  5EMK B;  5M5S A;  3K6S A;  4MMX A;  2B5L A;  4A11 B;  2EID A;  3IUR A;  3I7H A;  4GGA A;  2H9P A;  4GZ8 A;  3CIK B;  2IWK A;  3RLM D;  5GXH A;  3MKS B;  1TBG A;  1P22 A;  4BP9 A;  4AN1 A;  3ZDZ A;  2MTA H;  4FWW A;  1MG2 A;  2XZG A;  3DDU A;  5TF2 A;  2P9L C;  3PSL A;  2HYE A;  3JZH A;  2I0S A;  3IUL A;  4G1E A;  4G1M A;  4PSX B;  3I7O A;  4PBZ A;  2H6N A;  5EM2 B;  3OL2 B;  2QXV A;  4ES0 A;  3ZE1 A;  3SHF A;  3HFQ A;  4FAV D;  4DNV A;  3EQ9 A;  1I2M B;  1XHM A;  3DXK C;  4ZOX A;  4NC4 A;  1UOP A;  3EI1 B;  4WK2 A;  3GFC A;  3O4H A;  4A09 B;  2BBK H;  5E6U A;  2IUV A;  3IUN A;  2P9S C;  5C2W B;  2H9N A;  5C9Z B;  1L5G A;  5HE1 B;  1E8N A;  5FKQ A;  3VH0 A;  4ERY A;  3RN1 D;  2WQ8 A;  3IUJ A;  3I7P A;  4BCD A;  4KFM B;  2QC5 A;  1VE6 A;  2YB8 B;  3KRW B;  3ZWL B;  2Z2N A;  1B9Y A;  3MMY A;  3K26 A;  5HE2 B;  3EI2 B;  4UI9 R;  1OMW B;  1M1X A;  3ODT A;  4A08 B;  4AEZ A;  4D0K A;  5FKS A;  2CE8 A;  2HJB A;  4QL1 A;  1JOF A;  1SQJ A;  3OF7 A;  4JD2 C;  2AH1 A;  3UR4 A;  4E5Z B;  2VDM A;  3FRX A;  3PXT D;  4WK0 A;  5CYK B;  4X3E A;  4E54 B;  1JMX B;  5H14 A;  1R5M A;  2VZ3 A;  4A0B B;  4IRZ A;  5FKR A;  5IJ7 E;  3JAM g;  3BWS A;  4QRJ A;  2JKX A;  3JRO A;  5FKT A;  3V9F A;  3FM0 A;  4MK0 B;  5GMK n;  2CO0 A;  3GC3 B;  5FXY A;  4BUJ C;  1OLZ A;  4A0A A;  3MZL A;  1SQ9 A;  4MMZ A;  3IUQ A;  4L1M A;  5K19 A;  2OK4 A;  3EU7 A;  3K71 A;  4A11 A;  2P9K C;  4JSV C;  2I0T A;  3CFS B;  3SN6 B;  3UVL A;  1YFQ A;  3OW8 A;  5HE0 B;  4GM8 A;  1ERJ A;  2VDQ A;  1VZ2 A;  2IUQ A;  3DSM A;  5CXC B;  5E6S A;  2P9I C;  2HES X;  4R7A B;  4J87 A;  2PM7 B;  2O9K A;  4J0W A;  2H9M A;  5HQG A;  5IT9 g;  3JB9 L;  5TEF A;  3FCU A;  3KCI A;  1H2W A;  3IJC A;  4FB1 D;  1UOO A;  3T3M A;  2P9N C;  4A7J A;  1A0R B;  4K3J B;  5SXM A;  1VYH C;  3GD1 I;  3EI3 A;  3RFG A;  3EI1 A;  3O4J A;  4QQE A;  4ZOY A;  1B9X A;  4GQ1 A;  3V4P A;  4PNK B;  4AOW A;  2I3T A;  5TEE A;  2PBI B;  1QFS A;  2Z2O A;  3AL8 B;  4GGD A;  3SFZ A;  3IIW A;  2GC4 A;  4O45 A;  2CNX A;  4WJK A;  4K3I D;  5M5U A;  2J56 H;  3NIG A;  5EAM A;  2J55 H;  3I2N A;  1N6E A;  3F3P A;  3NID A;  4X63 B;  2HXC A;  2I3S A;  3EI4 A;  3MVD K;  2B5N A;  3EQ8 A;  3EI2 A;  3E0C A;  4A08 A;  3PVU B;  4XYI A;  3AL9 A;  3RRM C;  3P4F A;  4PXW A;  2XU7 A;  2I0R A;  5HYN B;  4ESG A;  2PM6 B;  2Z2P A;  5IC7 A; 
#chains in the Genus database with same CATH homology
 5M5S A;  5M5U A;  1C9L A;  4G55 A;  5M5V A;  3GC3 B;  1C9I A;  5M5R A;  5M61 A;  2XZG A;  3GD1 I;  1BPO A;  1UTC A;  5M5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...