3GD1I

Structure of an arrestin/clathrin complex reveals a novel clathrin binding domain that modulates receptor trafficking
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
358
structure length
358
Chain Sequence
QILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an arrestin2-clathrin complex reveals a novel clathrin binding domain that modulates receptor trafficking
pubmed doi rcsb
source organism Bos taurus
molecule tags Endocytosis
molecule keywords Beta-arrestin-1
total genus 63
structure length 358
sequence length 358
ec nomenclature
pdb deposition date 2009-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01394 Clathrin_propel Clathrin propeller repeat
I PF09268 Clathrin-link Clathrin, heavy-chain linker
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.110 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Clathrin heavy-chain terminal domain 3gd1I00
1C9IA 5M61A 5M5UA 2XZGA 1C9LA 3GC3B 3GD1I 5M5SA 1BPOA 5M5TA 5M5VA 5M5RA 1UTCA 4G55A
chains in the Genus database with same CATH superfamily
4O45A 4A2MA 4CI8A 3OKYA 4FHLA 3MUNA 4G56B 4J0XA 1N6FA 3JZNA 3I7NA 1PI6A 4O9DA 2J56H 1R5MA 3UVLA 3EU7A 2B5LA 4CI1A 3UVKA 3VI4A 4H5IA 2YNNA 3T3PA 5M5UA 5GXHA 4A0AB 4A2LA 2VZ3A 5E6SA 1T2XA 5AMSA 2GC7A 1FWXA 4CY1A 3I7OA 4MMXA 3NVNA 1U8CA 2UZXB 4A11A 4ES0A 5GMKn 3UVNA 1GXRA 3SJLD 4UI9R 1H2WA 4A7JA 3RSEC 2EIEA 3CFSB 2OVPB 4X63B 5EMKB 3RFGA 3RFHA 4WK4A 3ZDZA 1XKSA 5A2Qg 2W18A 3L4OD 3C9CA 4BL0A 4FA4D 4WJKA 3PE7A 5IJ8E 2Z2OA 3KRXB 4A0BB 1TBGA 4FA9D 3O4HA 2YNOA 4D6VA 3F3FA 3PVWB 5H17A 4A0AA 2P9UC 1QNIA 4I79A 3ZE2A 2PBIB 2IUPA 1I2MB 4DNUA 1GP2B 3V4PA 4PNKB 1UOQA 4MMZA 1MG3A 4PC0A 3V7DB 3NIFA 1K8KC 2XL2A 2HKRA 3FRXA 4IRZA 4WK2A 5HDBA 1VYHC 2H6KA 2BKLA 2VC2A 3EI3A 3VH0A 3NVXA 1OMWB 3BWSA 3IUQA 4ERYA 1O6GA 4X61B 4Z7QA 1MDAH 2HJBA 4ERZA 2OIZA 4KFMB 4Y5RD 3I8EA 4K3JB 3O4GA 2EIBA 4MMYA 3DSMA 3NIDA 2XZGA 1NR0A 4AX4A 2YBAA 4ZOYA 3SWSD 3MKSB 3MUOA 4QAMA 2P9SC 3VGZA 3FCUA 3IUMA 4J8BA 1B9YA 5H1MA 3UKUC 3KRWB 2OVRB 3RMZD 2UZYB 4J8GA 1PBYB 3PXWD 3GC3B 3ZE1A 2HXCA 3EI2A 2XYIA 2QR5A 2HJ4A 4U7AA 2Z2NA 3DM0A 3IVMA 3ORVD 3EI2B 3EI3B 4Z7OA 1B9XA 4AN0A 4L9OA 5HYNB 5E6RA 5GXIA 2XU7A 4ZOXA 1L5GA 2YNPA 3O4IA 3AL8A 3EI4A 4GMBA 2IUVA 4X60B 4J77A 5TEFA 4PSXB 1QFMA 3SBRA 2JKXA 5M5RA 4CZXA 2J57G 3I7KA 4E54A 3OW8A 2H3XA 5FKTA 4GQ2P 4FA5D 4GGDA 3EMHA 1XIPA 3IUJA 4JSXC 5FKSA 2G9AA 4FB1D 1RI6A 2P9NC 3MXXA 4G55A 5THAA 5EALA 4ESGA 2B5MA 5B4WA 5M5SA 5FQDA 4J87A 4X3EA 1S4UX 4A0BA 4NBMA 1O6FA 3T3MA 2B5NA 4CY3A 4MK0B 2MTAH 2CN3A 3EG6A 2HESX 3OL2A 1UTCA 5HQGA 5M5TA 1YFQA 2IWFA 3K72A 4JT5C 5HE0B 5CXBA 1VZ3A 5IJ7E 1K32A 4A09B 3K27A 3HFQA 3OKWA 2VZ1A 2HU5A 3J80g 5M5VA 2HU7A 3AH8B 3I7PA 3MZKA 1M1XA 5CXCA 2CN2A 4OZUA 4Z8LA 4EWRA 1K3IA 4CY5A 5CXCB 1GOTB 1UOPA 4NAAA 1JMZB 4IMMA 5C86A 5FA5B 4RE5A 5KDOB 4ZN4A 3EI1A 2QZPA 3RN1D 4XYHA 4XEIC 4QQEA 1JV2A 2H9PA 3FM0A 4GQ1A 3CFVA 1NEXB 3C5MA 4JHPC 5FKQA 4ZOVA 3AL9A 1MG2A 4JSVC 2EIDA 2P9LC 4TZ4A 1UOOA 3RN0D 4A09A 3FGBA 5HE2B 3OF7A 3ZE0A 4O3UB 2QC5A 4CC9A 2AGWA 2I0TA 2P9KC 3E0CA 5AFU3 1E8NA 1GOFA 4Y7RA 3OTTA 4CY2A 3J81g 3B7FA 4PBZA 2VDLA 4PBYA 1ERJA 4HDJA 5EAMA 2AGXA 2CE8A 4L3HD 5C2VB 3SXTD 3AFCA 3JB9L 4J79A 2VDPA 2AH0A 2CNXA 4AMYA 4AEZA 4UM8A 4IA9A 4RE6A 4CZYA 4L1MA 3O4JA 1E5TA 2IWKA 4J0WA 4LGNA 4PSWB 3UVOA 4G1EA 3GD1I 3PSLA 2G99A 1SQJA 3JAMg 3PXSD 4O1QD 4QRJA 4A11B 3ULEC 4NSXA 2AH1A 3P4FA 4K3ID 5EAPA 1N6EA 2HYEA 1GG2B 4H5JA 4FAND 1PGUA 2XL3A 1OLZA 2OJYA 2B4EA 5IGQA 2EICA 2WQ8A 4AMZA 1C9IA 3IJCA 2H6QA 3SFZA 4LG9A 2IURA 2AGYA 3NIGA 5C2WB 4UM9A 5JWZA 3IKOA 4JSNC 2OVQB 5CXBB 3FCSA 4CZVA 3I7HA 3KCIA 4D0KA 3IIWA 3K71A 3MKQA 2EBSA 5M61A 2GC4A 3IJ1A 5EMJB 4FAVD 3C75H 4U1EI 2H9MA 4GM8A 1YR2A 1H2ZA 1QFSA 3GREA 5C9ZB 4J86A 4GGAA 3DXKC 2H6NA 5AJAA 4O2WA 5HE3B 2PM9A 3IJ0A 3ZWLB 3K26A 2VDNA 1L0QA 3VA6A 5HE1B 3ODTA 2O9KA 3MZLA 2CO0C 2I0SA 4BP8A 1C9LA 3DXMC 3I89A 2I0RA 3JPXA 3UVMA 3QHYB 4QT8A 3RRMC 4G1MA 5FFGA 1BPOA 2VDRA 3EQ8A 2VDQA 1TYQC 3MVDK 4AOWA 3JZHA 1SQ9A 4JSPC 5IGOA 5TEEA 4BCCA 3EI1B 2P9IC 3EI4B 2VDKA 2XE4A 4JXMA 1JMXB 3DDUA 4QL1A 2OK4A 5K19A 3RLMD 4JHNA 4BUJC 2PM9B 1JOFA 2P9PC 2YB8B 4R7AB 4XYIA 3V4VA 1GOGA 3SLED 4D9SA 4CI2A 3PXTD 5GSAA 4FA1D 1TYEA 3K6SA 3V5WB 4J73A 4OWRA 3V9FA 4A08A 5EM2B 5FLXg 2PM6B 2H13A 1PEVA 1H2XA 5C92A 4JD2C 4J82A 4L1QD 3PVUB 5EM2A 4J81A 5EMLB 3OKYB 3IJEA 3SCYA 4PXWA 5I5MA 2H9LA 3SHFA 3QI0A 3DWLC 3F3GA 1JJUB 1U2VC 3IUNA 3EQ7A 2HU8A 1XHMA 3N0EA 2IAAA 1VE7A 4E5ZA 3IULA 3JZGA 3BG0A 3EQ9A 3JROA 3PSCB 3CIKB 4BCDA 4O02A 5EMMB 1U4CA 5FFOA 4E5ZB 1A0RB 2VDMA 2BCJB 3SVWD 3U4YA 2Q7QA 3AL8B 3ZDYA 3SN6B 5FKRA 2CE9A 4O3TB 1JTDB 4NENA 3SMRA 4Z7NA 2AQ5A 4E54B 3I8CA 5TDHB 2BBKH 4DNWA 4FWWA 4JT6C 2OK6A 3L4MD 4GM9A 1P22A 1VZ2A 3BG1A 5EARA 4YVDA 5SXMA 1E8MA 3A0FA 4BH6A 2AGLA 3OKTA 4ZOZA 5K1CC 3SBPA 4CI3A 5I5JA 3OL2B 4WK0A 2AGZA 3I2NA 1N6DA 2H14A 5IC7A 2HKMA 5TF2A 4NC4A 4GZ8A 2I3SA 2QXVA 2H9NA 2H47A 1Q47A 3UR4A 2IUQA 3EWEA 3NVQA 3ZDXA 1VE6A 2YMUA 1SHYB 2GNQA 2I3TA 4BCBA 3IURA 2TRCB 5CYKB 5H14A 1GOHA 2J55H 2VDOA 3GFCA 3UKRC 5FXYA 4AN1A 2H68A 1H2YA 3MMYA 3IIYA 5IT9g 3N0DA 5I5IA 3VI3A 3JRPA 2XDWA 2Z2PA 2CO0A 4BP9A 5E6UA 4LG8A 4J84A 4ERQA 3F3PA 3I7LA 4DNVA 3W15A 4GM3A 2PM7B 4L3GD 4GGCA 4N14A 3C99A 4A08B 4J78A 3SBQA 5CYKA 4GQBB 1A12A
chains in the Genus database with same CATH topology
1C9IA 5M61A 5M5UA 2XZGA 1C9LA 3GC3B 3GD1I 5M5SA 1BPOA 5M5TA 5M5VA 5M5RA 1UTCA 4G55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C9I A;  5M61 A;  5M5U A;  2XZG A;  1C9L A;  3GC3 B;  3GD1 I;  5M5S A;  1BPO A;  5M5T A;  5M5V A;  5M5R A;  1UTC A;  4G55 A; 
#chains in the Genus database with same CATH topology
 4O45 A;  4A2M A;  4CI8 A;  3OKY A;  4FHL A;  3MUN A;  4G56 B;  4J0X A;  1N6F A;  3JZN A;  3I7N A;  1PI6 A;  4O9D A;  2J56 H;  1R5M A;  3UVL A;  3EU7 A;  2B5L A;  4CI1 A;  3UVK A;  3VI4 A;  4H5I A;  2YNN A;  3T3P A;  5M5U A;  5GXH A;  4A0A B;  4A2L A;  2VZ3 A;  5E6S A;  1T2X A;  5AMS A;  2GC7 A;  1FWX A;  4CY1 A;  3I7O A;  4MMX A;  3NVN A;  1U8C A;  2UZX B;  4A11 A;  4ES0 A;  5GMK n;  3UVN A;  1GXR A;  3SJL D;  4UI9 R;  1H2W A;  4A7J A;  3RSE C;  2EIE A;  3CFS B;  2OVP B;  4X63 B;  5EMK B;  3RFG A;  3RFH A;  4WK4 A;  3ZDZ A;  1XKS A;  5A2Q g;  2W18 A;  3L4O D;  3C9C A;  4BL0 A;  4FA4 D;  4WJK A;  3PE7 A;  5IJ8 E;  2Z2O A;  3KRX B;  4A0B B;  1TBG A;  4FA9 D;  3O4H A;  2YNO A;  4D6V A;  3F3F A;  3PVW B;  5H17 A;  4A0A A;  2P9U C;  1QNI A;  4I79 A;  3ZE2 A;  2PBI B;  2IUP A;  1I2M B;  4DNU A;  1GP2 B;  3V4P A;  4PNK B;  1UOQ A;  4MMZ A;  1MG3 A;  4PC0 A;  3V7D B;  3NIF A;  1K8K C;  2XL2 A;  2HKR A;  3FRX A;  4IRZ A;  4WK2 A;  5HDB A;  1VYH C;  2H6K A;  2BKL A;  2VC2 A;  3EI3 A;  3VH0 A;  3NVX A;  1OMW B;  3BWS A;  3IUQ A;  4ERY A;  1O6G A;  4X61 B;  4Z7Q A;  1MDA H;  2HJB A;  4ERZ A;  2OIZ A;  4KFM B;  4Y5R D;  3I8E A;  4K3J B;  3O4G A;  2EIB A;  4MMY A;  3DSM A;  3NID A;  2XZG A;  1NR0 A;  4AX4 A;  2YBA A;  4ZOY A;  3SWS D;  3MKS B;  3MUO A;  4QAM A;  2P9S C;  3VGZ A;  3FCU A;  3IUM A;  4J8B A;  1B9Y A;  5H1M A;  3UKU C;  3KRW B;  2OVR B;  3RMZ D;  2UZY B;  4J8G A;  1PBY B;  3PXW D;  3GC3 B;  3ZE1 A;  2HXC A;  3EI2 A;  2XYI A;  2QR5 A;  2HJ4 A;  4U7A A;  2Z2N A;  3DM0 A;  3IVM A;  3ORV D;  3EI2 B;  3EI3 B;  4Z7O A;  1B9X A;  4AN0 A;  4L9O A;  5HYN B;  5E6R A;  5GXI A;  2XU7 A;  4ZOX A;  1L5G A;  2YNP A;  3O4I A;  3AL8 A;  3EI4 A;  4GMB A;  2IUV A;  4X60 B;  4J77 A;  5TEF A;  4PSX B;  1QFM A;  3SBR A;  2JKX A;  5M5R A;  4CZX A;  2J57 G;  3I7K A;  4E54 A;  3OW8 A;  2H3X A;  5FKT A;  4GQ2 P;  4FA5 D;  4GGD A;  3EMH A;  1XIP A;  3IUJ A;  4JSX C;  5FKS A;  2G9A A;  4FB1 D;  1RI6 A;  2P9N C;  3MXX A;  4G55 A;  5THA A;  5EAL A;  4ESG A;  2B5M A;  5B4W A;  5M5S A;  5FQD A;  4J87 A;  4X3E A;  1S4U X;  4A0B A;  4NBM A;  1O6F A;  3T3M A;  2B5N A;  4CY3 A;  4MK0 B;  2MTA H;  2CN3 A;  3EG6 A;  2HES X;  3OL2 A;  1UTC A;  5HQG A;  5M5T A;  1YFQ A;  2IWF A;  3K72 A;  4JT5 C;  5HE0 B;  5CXB A;  1VZ3 A;  5IJ7 E;  1K32 A;  4A09 B;  3K27 A;  3HFQ A;  3OKW A;  2VZ1 A;  2HU5 A;  3J80 g;  5M5V A;  2HU7 A;  3AH8 B;  3I7P A;  3MZK A;  1M1X A;  5CXC A;  2CN2 A;  4OZU A;  4Z8L A;  4EWR A;  1K3I A;  4CY5 A;  5CXC B;  1GOT B;  1UOP A;  4NAA A;  1JMZ B;  4IMM A;  5C86 A;  5FA5 B;  4RE5 A;  5KDO B;  4ZN4 A;  3EI1 A;  2QZP A;  3RN1 D;  4XYH A;  4XEI C;  4QQE A;  1JV2 A;  2H9P A;  3FM0 A;  4GQ1 A;  3CFV A;  1NEX B;  3C5M A;  4JHP C;  5FKQ A;  4ZOV A;  3AL9 A;  1MG2 A;  4JSV C;  2EID A;  2P9L C;  4TZ4 A;  1UOO A;  3RN0 D;  4A09 A;  3FGB A;  5HE2 B;  3OF7 A;  3ZE0 A;  4O3U B;  2QC5 A;  4CC9 A;  2AGW A;  2I0T A;  2P9K C;  3E0C A;  5AFU 3;  1E8N A;  1GOF A;  4Y7R A;  3OTT A;  4CY2 A;  3J81 g;  3B7F A;  4PBZ A;  2VDL A;  4PBY A;  1ERJ A;  4HDJ A;  5EAM A;  2AGX A;  2CE8 A;  4L3H D;  5C2V B;  3SXT D;  3AFC A;  3JB9 L;  4J79 A;  2VDP A;  2AH0 A;  2CNX A;  4AMY A;  4AEZ A;  4UM8 A;  4IA9 A;  4RE6 A;  4CZY A;  4L1M A;  3O4J A;  1E5T A;  2IWK A;  4J0W A;  4LGN A;  4PSW B;  3UVO A;  4G1E A;  3GD1 I;  3PSL A;  2G99 A;  1SQJ A;  3JAM g;  3PXS D;  4O1Q D;  4QRJ A;  4A11 B;  3ULE C;  4NSX A;  2AH1 A;  3P4F A;  4K3I D;  5EAP A;  1N6E A;  2HYE A;  1GG2 B;  4H5J A;  4FAN D;  1PGU A;  2XL3 A;  1OLZ A;  2OJY A;  2B4E A;  5IGQ A;  2EIC A;  2WQ8 A;  4AMZ A;  1C9I A;  3IJC A;  2H6Q A;  3SFZ A;  4LG9 A;  2IUR A;  2AGY A;  3NIG A;  5C2W B;  4UM9 A;  5JWZ A;  3IKO A;  4JSN C;  2OVQ B;  5CXB B;  3FCS A;  4CZV A;  3I7H A;  3KCI A;  4D0K A;  3IIW A;  3K71 A;  3MKQ A;  2EBS A;  5M61 A;  2GC4 A;  3IJ1 A;  5EMJ B;  4FAV D;  3C75 H;  4U1E I;  2H9M A;  4GM8 A;  1YR2 A;  1H2Z A;  1QFS A;  3GRE A;  5C9Z B;  4J86 A;  4GGA A;  3DXK C;  2H6N A;  5AJA A;  4O2W A;  5HE3 B;  2PM9 A;  3IJ0 A;  3ZWL B;  3K26 A;  2VDN A;  1L0Q A;  3VA6 A;  5HE1 B;  3ODT A;  2O9K A;  3MZL A;  2CO0 C;  2I0S A;  4BP8 A;  1C9L A;  3DXM C;  3I89 A;  2I0R A;  3JPX A;  3UVM A;  3QHY B;  4QT8 A;  3RRM C;  4G1M A;  5FFG A;  1BPO A;  2VDR A;  3EQ8 A;  2VDQ A;  1TYQ C;  3MVD K;  4AOW A;  3JZH A;  1SQ9 A;  4JSP C;  5IGO A;  5TEE A;  4BCC A;  3EI1 B;  2P9I C;  3EI4 B;  2VDK A;  2XE4 A;  4JXM A;  1JMX B;  3DDU A;  4QL1 A;  2OK4 A;  5K19 A;  3RLM D;  4JHN A;  4BUJ C;  2PM9 B;  1JOF A;  2P9P C;  2YB8 B;  4R7A B;  4XYI A;  3V4V A;  1GOG A;  3SLE D;  4D9S A;  4CI2 A;  3PXT D;  5GSA A;  4FA1 D;  1TYE A;  3K6S A;  3V5W B;  4J73 A;  4OWR A;  3V9F A;  4A08 A;  5EM2 B;  5FLX g;  2PM6 B;  2H13 A;  1PEV A;  1H2X A;  5C92 A;  4JD2 C;  4J82 A;  4L1Q D;  3PVU B;  5EM2 A;  4J81 A;  5EML B;  3OKY B;  3IJE A;  3SCY A;  4PXW A;  5I5M A;  2H9L A;  3SHF A;  3QI0 A;  3DWL C;  3F3G A;  1JJU B;  1U2V C;  3IUN A;  3EQ7 A;  2HU8 A;  1XHM A;  3N0E A;  2IAA A;  1VE7 A;  4E5Z A;  3IUL A;  3JZG A;  3BG0 A;  3EQ9 A;  3JRO A;  3PSC B;  3CIK B;  4BCD A;  4O02 A;  5EMM B;  1U4C A;  5FFO A;  4E5Z B;  1A0R B;  2VDM A;  2BCJ B;  3SVW D;  3U4Y A;  2Q7Q A;  3AL8 B;  3ZDY A;  3SN6 B;  5FKR A;  2CE9 A;  4O3T B;  1JTD B;  4NEN A;  3SMR A;  4Z7N A;  2AQ5 A;  4E54 B;  3I8C A;  5TDH B;  2BBK H;  4DNW A;  4FWW A;  4JT6 C;  2OK6 A;  3L4M D;  4GM9 A;  1P22 A;  1VZ2 A;  3BG1 A;  5EAR A;  4YVD A;  5SXM A;  1E8M A;  3A0F A;  4BH6 A;  2AGL A;  3OKT A;  4ZOZ A;  5K1C C;  3SBP A;  4CI3 A;  5I5J A;  3OL2 B;  4WK0 A;  2AGZ A;  3I2N A;  1N6D A;  2H14 A;  5IC7 A;  2HKM A;  5TF2 A;  4NC4 A;  4GZ8 A;  2I3S A;  2QXV A;  2H9N A;  2H47 A;  1Q47 A;  3UR4 A;  2IUQ A;  3EWE A;  3NVQ A;  3ZDX A;  1VE6 A;  2YMU A;  1SHY B;  2GNQ A;  2I3T A;  4BCB A;  3IUR A;  2TRC B;  5CYK B;  5H14 A;  1GOH A;  2J55 H;  2VDO A;  3GFC A;  3UKR C;  5FXY A;  4AN1 A;  2H68 A;  1H2Y A;  3MMY A;  3IIY A;  5IT9 g;  3N0D A;  5I5I A;  3VI3 A;  3JRP A;  2XDW A;  2Z2P A;  2CO0 A;  4BP9 A;  5E6U A;  4LG8 A;  4J84 A;  4ERQ A;  3F3P A;  3I7L A;  4DNV A;  3W15 A;  4GM3 A;  2PM7 B;  4L3G D;  4GGC A;  4N14 A;  3C99 A;  4A08 B;  4J78 A;  3SBQ A;  5CYK A;  4GQB B;  1A12 A; 
#chains in the Genus database with same CATH homology
 1C9I A;  5M61 A;  5M5U A;  2XZG A;  1C9L A;  3GC3 B;  3GD1 I;  5M5S A;  1BPO A;  5M5T A;  5M5V A;  5M5R A;  1UTC A;  4G55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...