5SXMA

Wdr5 in complex with mll win motif peptidomimetic
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title Targeted Disruption of the Interaction between WD-40 Repeat Protein 5 (WDR5) and Mixed Lineage Leukemia (MLL)/SET1 Family Proteins Specifically Inhibits MLL1 and SETd1A Methyltransferase Complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 98
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5sxmA00
3U4YA 4H5IA 2PBIB 4K3ID 5HYNB 2CE8A 4XEIC 4HDJA 2H6KA 3C75H 5FQDA 4FA1D 2H9NA 3F3PA 4O45A 3FGBA 1N6FA 4PSWB 5EMMB 3EI2B 4MK0B 1B9YA 4CZXA 3MKQA 3IKOA 3RN1D 3VA6A 2G9AA 3SWSD 2H14A 3VH0A 5AFU3 1OLZA 2IUPA 2P9SC 5C2WB 1XHMA 3JZNA 3UVNA 4CI1A 2Z2NA 3NVQA 3SJLD 4FAVD 2O9KA 5EARA 4J8GA 3BWSA 5CXCA 3SBQA 3SBPA 5JWZA 4L3HD 2HJ4A 5EMLB 4A2LA 3CFSB 3FRXA 3ULEC 4CC9A 3I7NA 3N0EA 5AMSA 4J77A 3K27A 5IGQA 5CXBB 3PSLA 3J80g 3UVKA 4FWWA 4FHLA 4FB1D 5FKQA 3SVWD 2H68A 2AGWA 5EMJB 3OL2A 2AGLA 5FKSA 4A7JA 2I3TA 3MMYA 1U2VC 4CI8A 3I7OA 4E54B 2QXVA 4J86A 5HE3B 5IC7A 4A0BA 5TEEA 4X60B 5GMKn 1RI6A 2PM6B 3IIYA 3EI1B 4IA9A 3GFCA 4A08B 2I0SA 2OJYA 4A0AB 2BCJB 4QL1A 1JMZB 3OKYB 4J82A 2AGYA 4GM3A 2G99A 5IJ8E 4A09B 3PSCB 3JAMg 2HYEA 2PM9B 3EI1A 3AL8A 4J0XA 4GQ2P 4XYHA 2H6NA 2I3SA 5H14A 4CZYA 2H13A 1L0QA 2IURA 3OKYA 4Z8LA 2P9IC 3SN6B 3PVWB 2YMUA 3UR4A 3BG0A 4A09A 4G56B 3IJ1A 2P9UC 5GXHA 3I8EA 4TZ4A 2CE9A 1TBGA 2AGXA 2OIZA 4LGNA 2H6QA 1XIPA 3SLED 3I8CA 3A0FA 1QNIA 2I0RA 2OK4A 3UVLA 2GNQA 1VYHC 4A11A 3JZGA 3NVNA 2HKRA 4QRJA 4CI2A 4J8BA 3IIWA 4E5ZA 2BBKH 1N6EA 2HXCA 3N0DA 2IUVA 3RRMC 3DXKC 3BG1A 4YVDA 2W18A 1N6DA 4CY2A 2Z2PA 1K8KC 3F3FA 5IT9g 4ZOVA 3C99A 2CO0A 5CXCB 5H1MA 4JT6C 1TYQC 2XYIA 5THAA 2YBAA 3SFZA 4J79A 4GM9A 4XYIA 5CYKA 4FA5D 3IJ0A 5EAPA 1GP2B 3IJCA 4AEZA 3MKSB 3UVOA 3AL9A 4FAND 5FKRA 4ES0A 4JT5C 4O3TB 2CNXA 2MTAH 2P9LC 4OWRA 4BUJC 3EG6A 4L3GD 3J81g 5FLXg 3SMRA 1GXRA 1PGUA 4BH6A 4ERZA 4N14A 4JXMA 3OL2B 2YB8B 3ZWLB 4ZOXA 4KFMB 4FA9D 4QT8A 4IMMA 3I7KA 4J0WA 4A0BB 2OVQB 4BL0A 5SXMA 4ESGA 4Y5RD 3AH8B 4LG9A 3MZKA 5HE2B 2HKMA 3EMHA 4O3UB 2TRCB 3ODTA 3EI3B 5EALA 5KDOB 3SBRA 2B5NA 3JROA 5K1CC 4D0KA 4CY5A 1PBYB 4JD2C 1Q47A 1GOTB 4Y7RA 3AL8B 3SCYA 3B7FA 4ERQA 3JB9L 1YFQA 3EI4A 3EI3A 2QC5A 4ZOYA 3CIKB 2H9PA 1OMWB 2CO0C 5GXIA 2IAAA 4PSXB 4PC0A 4EWRA 4J84A 5IJ7E 4ZOZA 2J56H 3DXMC 5B4WA 4GM8A 1JMXB 2HJBA 3OW8A 3RMZD 2AQ5A 1B9XA 1SQ9A 2IUQA 5HE0B 3PVUB 2CN3A 5EM2A 3ORVD 2B5MA 1PEVA 4A11B 4PXWA 4A2MA 4ERYA 4L1QD 4E5ZB 4GGDA 2YNPA 4L9OA 2B5LA 3PE7A 3VGZA 2YNNA 5C2VB 3V5WB 1A0RB 5EMKB 5HE1B 3EWEA 2P9PC 5TEFA 4OZUA 3UKUC 3MZLA 2Q7QA 4X63B 3W15A 4CY3A 2P9KC 4PBZA 5CYKB 5FXYA 3RFGA 2B4EA 4JSPC 4O1QD 4NSXA 4CI3A 4U7AA 4CY1A 3OTTA 3OKTA 2H9LA 4GMBA 3GREA 3RLMD 3SHFA 2PM7B 1K32A 3P4FA 2GC4A 2XL3A 2I0TA 4I79A 2UZYB 4R7AB 4GGCA 3UKRC 1ERJA 5HQGA 3V7DB 3PXTD 4X61B 3RSEC 3DM0A 3NVXA 1NR0A 2XL2A 3JRPA 2OK6A 3OKWA 3I7PA 3EI2A 1MDAH 3KRXB 1P22A 4GGAA 3CFVA 5I5MA 5IGOA 1JOFA 3MXXA 5TDHB 3SXTD 5A2Qg 1R5MA 3K26A 4JSVC 2H9MA 5H17A 5GSAA 1XKSA 3JPXA 2AGZA 4GQBB 3EI4B 2OVPB 1S4UX 4PNKB 4GQ1A 3L4OD 3F3GA 4H5JA 2OVRB 2YNOA 4K3JB 2P9NC 3RFHA 4J73A 3UVMA 5K19A 2J55H 1PI6A 1NEXB 2Z2OA 4GZ8A 5TF2A 5I5IA 3PXSD 4U1EI 3RN0D 4CZVA 2EBSA 5CXBA 1FWXA 2AH0A 5EM2B 3KRWB 5C9ZB 3FM0A 3I7HA 4X3EA 3V9FA 4LG8A 3I7LA 4JSNC 1JJUB 3PXWD 1SQJA 4D6VA 5EAMA 3HFQA 4E54A 2J57G 3I89A 4O9DA 3C5MA 4J87A 4JSXC 3JZHA 3DSMA 4ZN4A 3AFCA 3EU7A 2H47A 2HESX 4J78A 1MG2A 5FA5B 2IWFA 4AOWA 4A08A 1SHYB 2AH1A 3E0CA 2CN2A 4UI9R 5AJAA 2IWKA 4A0AA 2GC7A 1MG3A 4PBYA 4FA4D 2H3XA 1GG2B 3L4MD 5I5JA 4QQEA 2UZXB 5FKTA 2XU7A 1U4CA 3DWLC 3I2NA 2PM9A 3C9CA 4J81A
chains in the Genus database with same CATH superfamily
3U4YA 4H5IA 2PBIB 4K3ID 3IVMA 5HYNB 2CE8A 4XEIC 3MUNA 4HDJA 2H6KA 3C75H 5FQDA 1VE7A 4FA1D 2H9NA 5C92A 3F3PA 4O45A 3FGBA 1N6FA 4PSWB 5EMMB 3EI2B 4MK0B 1B9YA 4CZXA 3MKQA 3IKOA 3RN1D 3VA6A 2G9AA 3SWSD 2H14A 3VH0A 5AFU3 1OLZA 2IUPA 2P9SC 3ZDXA 5C2WB 1XHMA 3JZNA 4AX4A 3UVNA 4CI1A 2Z2NA 3NVQA 1U8CA 4NENA 3SJLD 4FAVD 2O9KA 5EARA 4BP9A 4AMYA 4J8GA 3O4JA 2WQ8A 3BWSA 5CXCA 3SBQA 3SBPA 3ZE2A 2VDPA 5JWZA 1H2YA 2VDOA 3T3MA 4L3HD 1YR2A 2HJ4A 5EMLB 4A2LA 3CFSB 3FRXA 4NC4A 3ULEC 4CC9A 4BCCA 1BPOA 3I7NA 3N0EA 5AMSA 1O6GA 3V4VA 4J77A 1C9IA 2HU7A 3K27A 5IGQA 5CXBB 3PSLA 2QR5A 5M5UA 1VZ3A 1QFMA 3J80g 3UVKA 4FWWA 4FHLA 4FB1D 5FKQA 3SVWD 2H68A 2AGWA 5EMJB 3OL2A 2AGLA 5FKSA 4A7JA 2I3TA 3MMYA 1U2VC 4CI8A 3ZDYA 2VDNA 2VZ1A 3I7OA 4E54B 2QXVA 4J86A 5HE3B 5IC7A 4A0BA 5TEEA 4IRZA 4X60B 5GMKn 1RI6A 2PM6B 3IIYA 2JKXA 5E6SA 4Z7QA 3EI1B 4IA9A 3GFCA 4A08B 2I0SA 1A12A 2VDMA 4UM9A 2OJYA 3ZE0A 4A0AB 4G55A 2BCJB 4QL1A 1JMZB 3OKYB 4J82A 1M1XA 2AGYA 4GM3A 3O4GA 2G99A 5IJ8E 4A09B 2VDLA 3PSCB 3JAMg 2HYEA 2PM9B 3EI1A 3AL8A 1C9LA 4D9SA 4J0XA 4GQ2P 4XYHA 2H6NA 2VDRA 2I3SA 5H14A 4CZYA 2H13A 1L0QA 2IURA 3OKYA 1VZ2A 3IJEA 3IURA 4Z8LA 2P9IC 3SN6B 3VI3A 3OF7A 2YMUA 3PVWB 3UR4A 3BG0A 4A09A 4G56B 3IJ1A 4JHPC 2P9UC 5GXHA 3I8EA 4TZ4A 2CE9A 1TBGA 1UOOA 2AGXA 2OIZA 4LGNA 2H6QA 1XIPA 3SLED 2EIDA 3I8CA 3A0FA 1QNIA 2I0RA 2OK4A 3UVLA 2GNQA 4WJKA 5E6RA 1VYHC 4A11A 3JZGA 3NVNA 2HKRA 4QRJA 4RE6A 4CI2A 4J8BA 3IIWA 4E5ZA 2BBKH 1N6EA 3IULA 2HXCA 3N0DA 2IUVA 3RRMC 3DXKC 3BG1A 4YVDA 2W18A 1N6DA 4CY2A 2Z2PA 1K8KC 1O6FA 3F3FA 5IT9g 4MMXA 4ZOVA 3C99A 4WK4A 2CO0A 5CXCB 5H1MA 4JT6C 1TYQC 1GOFA 4WK2A 2XYIA 5THAA 2YBAA 3SFZA 3ZE1A 2HU8A 4J79A 4GM9A 5M5SA 4XYIA 5CYKA 4FA5D 3IJ0A 3NIFA 1GP2B 3IJCA 5EAPA 4AEZA 3MKSB 3UVOA 3AL9A 4FAND 5FKRA 3VI4A 1K3IA 3EQ9A 4ES0A 1GOGA 4JT5C 3MVDK 4O3TB 4NAAA 2CNXA 2MTAH 2P9LC 4OWRA 4BUJC 3EG6A 4L3GD 3J81g 5FLXg 1E8NA 3SMRA 1GXRA 4L1MA 4JHNA 4RE5A 1PGUA 1T2XA 4BH6A 2VC2A 4ERZA 4N14A 4JXMA 3OL2B 4DNVA 3MUOA 2YB8B 3ZWLB 4ZOXA 4KFMB 4FA9D 5M5VA 4QT8A 4IMMA 3I7KA 4J0WA 4A0BB 2OVQB 4BL0A 5SXMA 4ESGA 4Y5RD 3AH8B 4LG9A 3MZKA 5HE2B 1UOQA 4QAMA 2HKMA 3EMHA 4O3UB 2TRCB 3ODTA 3EI3B 5EALA 5KDOB 2QZPA 3SBRA 2B5NA 3JROA 5K1CC 3QHYB 3EQ8A 4D0KA 4CY5A 1PBYB 4JD2C 2VZ3A 1E5TA 1Q47A 5FFOA 1GOTB 4MMYA 4Y7RA 3AL8B 3SCYA 3FCUA 3B7FA 4ERQA 3JB9L 1YFQA 3EI4A 3EI3A 2QC5A 4ZOYA 3CIKB 2H9PA 1OMWB 2CO0C 4G1EA 5GXIA 1UTCA 2IAAA 4PSXB 4PC0A 4EWRA 4J84A 5IJ7E 4ZOZA 3NIGA 4AMZA 2J56H 3DXMC 5B4WA 4GM8A 3QI0A 1JMXB 2HJBA 3OW8A 3RMZD 2AQ5A 1TYEA 4UM8A 1B9XA 1SQ9A 2IUQA 5HE0B 5HDBA 3PVUB 1H2WA 2CN3A 5EM2A 3ORVD 4Z7NA 2B5MA 2EIBA 1PEVA 4A11B 4PXWA 3O4HA 4A2MA 3GD1I 4ERYA 4L1QD 4E5ZB 3ZDZA 4GGDA 2YNPA 4L9OA 4BCBA 2B5LA 3PE7A 3VGZA 2YNNA 5C2VB 3V5WB 1A0RB 5M5RA 5EMKB 5HE1B 3EWEA 2P9PC 5TEFA 1JV2A 4OZUA 3UKUC 5M5TA 3MZLA 2Q7QA 4X63B 3W15A 4CY3A 2P9KC 1VE6A 4PBZA 5CYKB 5FXYA 3RFGA 2B4EA 4JSPC 3IUMA 4O1QD 5C86A 3O4IA 4NSXA 4CI3A 4U7AA 4CY1A 3KCIA 3OTTA 3OKTA 2H9LA 4GMBA 4WK0A 3GREA 1H2XA 3RLMD 5M61A 3SHFA 2PM7B 1K32A 2HU5A 3IUQA 3P4FA 1JTDB 2GC4A 2XL3A 2I0TA 4I79A 2UZYB 4R7AB 4GGCA 3UKRC 1ERJA 5HQGA 3V7DB 3PXTD 4X61B 3T3PA 3RSEC 3DM0A 4AN1A 3NVXA 1H2ZA 1NR0A 2XL2A 3JRPA 1L5GA 4G1MA 2OK6A 3OKWA 2EIEA 2XDWA 3I7PA 3EI2A 3FCSA 1MDAH 3KRXB 1P22A 4O02A 4GGAA 3CFVA 5I5MA 5IGOA 1JOFA 3MXXA 5TDHB 3SXTD 3EQ7A 5A2Qg 3IUJA 1R5MA 3K26A 4JSVC 1QFSA 2H9MA 5H17A 3DDUA 5GSAA 1XKSA 3JPXA 2AGZA 4GQBB 3EI4B 4MMZA 4BP8A 4BCDA 1GOHA 2OVPB 1S4UX 4PNKB 4GQ1A 3L4OD 3F3GA 4H5JA 3V4PA 2OVRB 5FFGA 2BKLA 4DNWA 2YNOA 4K3JB 2EICA 2P9NC 3RFHA 4J73A 3UVMA 5K19A 2J55H 2VDQA 1PI6A 1NEXB 3GC3B 2Z2OA 4GZ8A 5TF2A 5I5IA 3PXSD 1I2MB 4U1EI 4AN0A 3RN0D 1UOPA 4CZVA 2EBSA 5E6UA 5CXBA 1E8MA 1FWXA 2AH0A 2XE4A 4O2WA 3KRWB 5EM2B 5C9ZB 3FM0A 3I7HA 4DNUA 4X3EA 3V9FA 4LG8A 3I7LA 4JSNC 1JJUB 3PXWD 1SQJA 4D6VA 5EAMA 3K72A 2VDKA 3HFQA 4E54A 2J57G 3I89A 3NIDA 4O9DA 3K6SA 3C5MA 3K71A 4J87A 4JSXC 3JZHA 3DSMA 4ZN4A 3AFCA 3EU7A 2H47A 2HESX 4J78A 1MG2A 5FA5B 2IWFA 4AOWA 4A08A 1SHYB 2AH1A 3E0CA 2CN2A 4UI9R 5AJAA 2IWKA 2XZGA 4A0AA 2GC7A 1MG3A 4PBYA 4FA4D 4Z7OA 2H3XA 1GG2B 3IUNA 3L4MD 5I5JA 4QQEA 2UZXB 4NBMA 5FKTA 2XU7A 1U4CA 3DWLC 3I2NA 2PM9A 3C9CA 4J81A
chains in the Genus database with same CATH topology
3U4YA 4H5IA 2PBIB 4K3ID 5HYNB 2CE8A 4XEIC 4HDJA 2H6KA 3C75H 5FQDA 4FA1D 2H9NA 3F3PA 4O45A 3FGBA 1N6FA 4PSWB 5EMMB 3EI2B 4MK0B 1B9YA 4CZXA 3MKQA 3IKOA 3RN1D 3VA6A 2G9AA 3SWSD 2H14A 3VH0A 5AFU3 1OLZA 2IUPA 2P9SC 5C2WB 1XHMA 3JZNA 3UVNA 4CI1A 2Z2NA 3NVQA 3SJLD 4FAVD 2O9KA 5EARA 4J8GA 3BWSA 5CXCA 3SBQA 3SBPA 5JWZA 4L3HD 2HJ4A 5EMLB 4A2LA 3CFSB 3FRXA 3ULEC 4CC9A 3I7NA 3N0EA 5AMSA 4J77A 3K27A 5IGQA 5CXBB 3PSLA 3J80g 3UVKA 4FWWA 4FHLA 4FB1D 5FKQA 3SVWD 2H68A 2AGWA 5EMJB 3OL2A 2AGLA 5FKSA 4A7JA 2I3TA 3MMYA 1U2VC 4CI8A 3I7OA 4E54B 2QXVA 4J86A 5HE3B 5IC7A 4A0BA 5TEEA 4X60B 5GMKn 1RI6A 2PM6B 3IIYA 3EI1B 4IA9A 3GFCA 4A08B 2I0SA 2OJYA 4A0AB 2BCJB 4QL1A 1JMZB 3OKYB 4J82A 2AGYA 4GM3A 2G99A 5IJ8E 4A09B 3PSCB 3JAMg 2HYEA 2PM9B 3EI1A 3AL8A 4J0XA 4GQ2P 4XYHA 2H6NA 2I3SA 5H14A 4CZYA 2H13A 1L0QA 2IURA 3OKYA 4Z8LA 2P9IC 3SN6B 3PVWB 2YMUA 3UR4A 3BG0A 4A09A 4G56B 3IJ1A 2P9UC 5GXHA 3I8EA 4TZ4A 2CE9A 1TBGA 2AGXA 2OIZA 4LGNA 2H6QA 1XIPA 3SLED 3I8CA 3A0FA 1QNIA 2I0RA 2OK4A 3UVLA 2GNQA 1VYHC 4A11A 3JZGA 3NVNA 2HKRA 4QRJA 4CI2A 4J8BA 3IIWA 4E5ZA 2BBKH 1N6EA 2HXCA 3N0DA 2IUVA 3RRMC 3DXKC 3BG1A 4YVDA 2W18A 1N6DA 4CY2A 2Z2PA 1K8KC 3F3FA 5IT9g 4ZOVA 3C99A 2CO0A 5CXCB 5H1MA 4JT6C 1TYQC 2XYIA 5THAA 2YBAA 3SFZA 4J79A 4GM9A 4XYIA 5CYKA 4FA5D 3IJ0A 5EAPA 1GP2B 3IJCA 4AEZA 3MKSB 3UVOA 3AL9A 4FAND 5FKRA 4ES0A 4JT5C 4O3TB 2CNXA 2MTAH 2P9LC 4OWRA 4BUJC 3EG6A 4L3GD 3J81g 5FLXg 3SMRA 1GXRA 1PGUA 4BH6A 4ERZA 4N14A 4JXMA 3OL2B 2YB8B 3ZWLB 4ZOXA 4KFMB 4FA9D 4QT8A 4IMMA 3I7KA 4J0WA 4A0BB 2OVQB 4BL0A 5SXMA 4ESGA 4Y5RD 3AH8B 4LG9A 3MZKA 5HE2B 2HKMA 3EMHA 4O3UB 2TRCB 3ODTA 3EI3B 5EALA 5KDOB 3SBRA 2B5NA 3JROA 5K1CC 4D0KA 4CY5A 1PBYB 4JD2C 1Q47A 1GOTB 4Y7RA 3AL8B 3SCYA 3B7FA 4ERQA 3JB9L 1YFQA 3EI4A 3EI3A 2QC5A 4ZOYA 3CIKB 2H9PA 1OMWB 2CO0C 5GXIA 2IAAA 4PSXB 4PC0A 4EWRA 4J84A 5IJ7E 4ZOZA 2J56H 3DXMC 5B4WA 4GM8A 1JMXB 2HJBA 3OW8A 3RMZD 2AQ5A 1B9XA 1SQ9A 2IUQA 5HE0B 3PVUB 2CN3A 5EM2A 3ORVD 2B5MA 1PEVA 4A11B 4PXWA 4A2MA 4ERYA 4L1QD 4E5ZB 4GGDA 2YNPA 4L9OA 2B5LA 3PE7A 3VGZA 2YNNA 5C2VB 3V5WB 1A0RB 5EMKB 5HE1B 3EWEA 2P9PC 5TEFA 4OZUA 3UKUC 3MZLA 2Q7QA 4X63B 3W15A 4CY3A 2P9KC 4PBZA 5CYKB 5FXYA 3RFGA 2B4EA 4JSPC 4O1QD 4NSXA 4CI3A 4U7AA 4CY1A 3OTTA 3OKTA 2H9LA 4GMBA 3GREA 3RLMD 3SHFA 2PM7B 1K32A 3P4FA 2GC4A 2XL3A 2I0TA 4I79A 2UZYB 4R7AB 4GGCA 3UKRC 1ERJA 5HQGA 3V7DB 3PXTD 4X61B 3RSEC 3DM0A 3NVXA 1NR0A 2XL2A 3JRPA 2OK6A 3OKWA 3I7PA 3EI2A 1MDAH 3KRXB 1P22A 4GGAA 3CFVA 5I5MA 5IGOA 1JOFA 3MXXA 5TDHB 3SXTD 5A2Qg 1R5MA 3K26A 4JSVC 2H9MA 5H17A 5GSAA 1XKSA 3JPXA 2AGZA 4GQBB 3EI4B 2OVPB 1S4UX 4PNKB 4GQ1A 3L4OD 3F3GA 4H5JA 2OVRB 2YNOA 4K3JB 2P9NC 3RFHA 4J73A 3UVMA 5K19A 2J55H 1PI6A 1NEXB 2Z2OA 4GZ8A 5TF2A 5I5IA 3PXSD 4U1EI 3RN0D 4CZVA 2EBSA 5CXBA 1FWXA 2AH0A 5EM2B 3KRWB 5C9ZB 3FM0A 3I7HA 4X3EA 3V9FA 4LG8A 3I7LA 4JSNC 1JJUB 3PXWD 1SQJA 4D6VA 5EAMA 3HFQA 4E54A 2J57G 3I89A 4O9DA 3C5MA 4J87A 4JSXC 3JZHA 3DSMA 4ZN4A 3AFCA 3EU7A 2H47A 2HESX 4J78A 1MG2A 5FA5B 2IWFA 4AOWA 4A08A 1SHYB 2AH1A 3E0CA 2CN2A 4UI9R 5AJAA 2IWKA 4A0AA 2GC7A 1MG3A 4PBYA 4FA4D 2H3XA 1GG2B 3L4MD 5I5JA 4QQEA 2UZXB 5FKTA 2XU7A 1U4CA 3DWLC 3I2NA 2PM9A 3C9CA 4J81A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U4Y A;  4H5I A;  2PBI B;  4K3I D;  5HYN B;  2CE8 A;  4XEI C;  4HDJ A;  2H6K A;  3C75 H;  5FQD A;  4FA1 D;  2H9N A;  3F3P A;  4O45 A;  3FGB A;  1N6F A;  4PSW B;  5EMM B;  3EI2 B;  4MK0 B;  1B9Y A;  4CZX A;  3MKQ A;  3IKO A;  3RN1 D;  3VA6 A;  2G9A A;  3SWS D;  2H14 A;  3VH0 A;  5AFU 3;  1OLZ A;  2IUP A;  2P9S C;  5C2W B;  1XHM A;  3JZN A;  3UVN A;  4CI1 A;  2Z2N A;  3NVQ A;  3SJL D;  4FAV D;  2O9K A;  5EAR A;  4J8G A;  3BWS A;  5CXC A;  3SBQ A;  3SBP A;  5JWZ A;  4L3H D;  2HJ4 A;  5EML B;  4A2L A;  3CFS B;  3FRX A;  3ULE C;  4CC9 A;  3I7N A;  3N0E A;  5AMS A;  4J77 A;  3K27 A;  5IGQ A;  5CXB B;  3PSL A;  3J80 g;  3UVK A;  4FWW A;  4FHL A;  4FB1 D;  5FKQ A;  3SVW D;  2H68 A;  2AGW A;  5EMJ B;  3OL2 A;  2AGL A;  5FKS A;  4A7J A;  2I3T A;  3MMY A;  1U2V C;  4CI8 A;  3I7O A;  4E54 B;  2QXV A;  4J86 A;  5HE3 B;  5IC7 A;  4A0B A;  5TEE A;  4X60 B;  5GMK n;  1RI6 A;  2PM6 B;  3IIY A;  3EI1 B;  4IA9 A;  3GFC A;  4A08 B;  2I0S A;  2OJY A;  4A0A B;  2BCJ B;  4QL1 A;  1JMZ B;  3OKY B;  4J82 A;  2AGY A;  4GM3 A;  2G99 A;  5IJ8 E;  4A09 B;  3PSC B;  3JAM g;  2HYE A;  2PM9 B;  3EI1 A;  3AL8 A;  4J0X A;  4GQ2 P;  4XYH A;  2H6N A;  2I3S A;  5H14 A;  4CZY A;  2H13 A;  1L0Q A;  2IUR A;  3OKY A;  4Z8L A;  2P9I C;  3SN6 B;  3PVW B;  2YMU A;  3UR4 A;  3BG0 A;  4A09 A;  4G56 B;  3IJ1 A;  2P9U C;  5GXH A;  3I8E A;  4TZ4 A;  2CE9 A;  1TBG A;  2AGX A;  2OIZ A;  4LGN A;  2H6Q A;  1XIP A;  3SLE D;  3I8C A;  3A0F A;  1QNI A;  2I0R A;  2OK4 A;  3UVL A;  2GNQ A;  1VYH C;  4A11 A;  3JZG A;  3NVN A;  2HKR A;  4QRJ A;  4CI2 A;  4J8B A;  3IIW A;  4E5Z A;  2BBK H;  1N6E A;  2HXC A;  3N0D A;  2IUV A;  3RRM C;  3DXK C;  3BG1 A;  4YVD A;  2W18 A;  1N6D A;  4CY2 A;  2Z2P A;  1K8K C;  3F3F A;  5IT9 g;  4ZOV A;  3C99 A;  2CO0 A;  5CXC B;  5H1M A;  4JT6 C;  1TYQ C;  2XYI A;  5THA A;  2YBA A;  3SFZ A;  4J79 A;  4GM9 A;  4XYI A;  5CYK A;  4FA5 D;  3IJ0 A;  5EAP A;  1GP2 B;  3IJC A;  4AEZ A;  3MKS B;  3UVO A;  3AL9 A;  4FAN D;  5FKR A;  4ES0 A;  4JT5 C;  4O3T B;  2CNX A;  2MTA H;  2P9L C;  4OWR A;  4BUJ C;  3EG6 A;  4L3G D;  3J81 g;  5FLX g;  3SMR A;  1GXR A;  1PGU A;  4BH6 A;  4ERZ A;  4N14 A;  4JXM A;  3OL2 B;  2YB8 B;  3ZWL B;  4ZOX A;  4KFM B;  4FA9 D;  4QT8 A;  4IMM A;  3I7K A;  4J0W A;  4A0B B;  2OVQ B;  4BL0 A;  5SXM A;  4ESG A;  4Y5R D;  3AH8 B;  4LG9 A;  3MZK A;  5HE2 B;  2HKM A;  3EMH A;  4O3U B;  2TRC B;  3ODT A;  3EI3 B;  5EAL A;  5KDO B;  3SBR A;  2B5N A;  3JRO A;  5K1C C;  4D0K A;  4CY5 A;  1PBY B;  4JD2 C;  1Q47 A;  1GOT B;  4Y7R A;  3AL8 B;  3SCY A;  3B7F A;  4ERQ A;  3JB9 L;  1YFQ A;  3EI4 A;  3EI3 A;  2QC5 A;  4ZOY A;  3CIK B;  2H9P A;  1OMW B;  2CO0 C;  5GXI A;  2IAA A;  4PSX B;  4PC0 A;  4EWR A;  4J84 A;  5IJ7 E;  4ZOZ A;  2J56 H;  3DXM C;  5B4W A;  4GM8 A;  1JMX B;  2HJB A;  3OW8 A;  3RMZ D;  2AQ5 A;  1B9X A;  1SQ9 A;  2IUQ A;  5HE0 B;  3PVU B;  2CN3 A;  5EM2 A;  3ORV D;  2B5M A;  1PEV A;  4A11 B;  4PXW A;  4A2M A;  4ERY A;  4L1Q D;  4E5Z B;  4GGD A;  2YNP A;  4L9O A;  2B5L A;  3PE7 A;  3VGZ A;  2YNN A;  5C2V B;  3V5W B;  1A0R B;  5EMK B;  5HE1 B;  3EWE A;  2P9P C;  5TEF A;  4OZU A;  3UKU C;  3MZL A;  2Q7Q A;  4X63 B;  3W15 A;  4CY3 A;  2P9K C;  4PBZ A;  5CYK B;  5FXY A;  3RFG A;  2B4E A;  4JSP C;  4O1Q D;  4NSX A;  4CI3 A;  4U7A A;  4CY1 A;  3OTT A;  3OKT A;  2H9L A;  4GMB A;  3GRE A;  3RLM D;  3SHF A;  2PM7 B;  1K32 A;  3P4F A;  2GC4 A;  2XL3 A;  2I0T A;  4I79 A;  2UZY B;  4R7A B;  4GGC A;  3UKR C;  1ERJ A;  5HQG A;  3V7D B;  3PXT D;  4X61 B;  3RSE C;  3DM0 A;  3NVX A;  1NR0 A;  2XL2 A;  3JRP A;  2OK6 A;  3OKW A;  3I7P A;  3EI2 A;  1MDA H;  3KRX B;  1P22 A;  4GGA A;  3CFV A;  5I5M A;  5IGO A;  1JOF A;  3MXX A;  5TDH B;  3SXT D;  5A2Q g;  1R5M A;  3K26 A;  4JSV C;  2H9M A;  5H17 A;  5GSA A;  1XKS A;  3JPX A;  2AGZ A;  4GQB B;  3EI4 B;  2OVP B;  1S4U X;  4PNK B;  4GQ1 A;  3L4O D;  3F3G A;  4H5J A;  2OVR B;  2YNO A;  4K3J B;  2P9N C;  3RFH A;  4J73 A;  3UVM A;  5K19 A;  2J55 H;  1PI6 A;  1NEX B;  2Z2O A;  4GZ8 A;  5TF2 A;  5I5I A;  3PXS D;  4U1E I;  3RN0 D;  4CZV A;  2EBS A;  5CXB A;  1FWX A;  2AH0 A;  5EM2 B;  3KRW B;  5C9Z B;  3FM0 A;  3I7H A;  4X3E A;  3V9F A;  4LG8 A;  3I7L A;  4JSN C;  1JJU B;  3PXW D;  1SQJ A;  4D6V A;  5EAM A;  3HFQ A;  4E54 A;  2J57 G;  3I89 A;  4O9D A;  3C5M A;  4J87 A;  4JSX C;  3JZH A;  3DSM A;  4ZN4 A;  3AFC A;  3EU7 A;  2H47 A;  2HES X;  4J78 A;  1MG2 A;  5FA5 B;  2IWF A;  4AOW A;  4A08 A;  1SHY B;  2AH1 A;  3E0C A;  2CN2 A;  4UI9 R;  5AJA A;  2IWK A;  4A0A A;  2GC7 A;  1MG3 A;  4PBY A;  4FA4 D;  2H3X A;  1GG2 B;  3L4M D;  5I5J A;  4QQE A;  2UZX B;  5FKT A;  2XU7 A;  1U4C A;  3DWL C;  3I2N A;  2PM9 A;  3C9C A;  4J81 A; 
#chains in the Genus database with same CATH topology
 3U4Y A;  4H5I A;  2PBI B;  4K3I D;  3IVM A;  5HYN B;  2CE8 A;  4XEI C;  3MUN A;  4HDJ A;  2H6K A;  3C75 H;  5FQD A;  1VE7 A;  4FA1 D;  2H9N A;  5C92 A;  3F3P A;  4O45 A;  3FGB A;  1N6F A;  4PSW B;  5EMM B;  3EI2 B;  4MK0 B;  1B9Y A;  4CZX A;  3MKQ A;  3IKO A;  3RN1 D;  3VA6 A;  2G9A A;  3SWS D;  2H14 A;  3VH0 A;  5AFU 3;  1OLZ A;  2IUP A;  2P9S C;  3ZDX A;  5C2W B;  1XHM A;  3JZN A;  4AX4 A;  3UVN A;  4CI1 A;  2Z2N A;  3NVQ A;  1U8C A;  4NEN A;  3SJL D;  4FAV D;  2O9K A;  5EAR A;  4BP9 A;  4AMY A;  4J8G A;  3O4J A;  2WQ8 A;  3BWS A;  5CXC A;  3SBQ A;  3SBP A;  3ZE2 A;  2VDP A;  5JWZ A;  1H2Y A;  2VDO A;  3T3M A;  4L3H D;  1YR2 A;  2HJ4 A;  5EML B;  4A2L A;  3CFS B;  3FRX A;  4NC4 A;  3ULE C;  4CC9 A;  4BCC A;  1BPO A;  3I7N A;  3N0E A;  5AMS A;  1O6G A;  3V4V A;  4J77 A;  1C9I A;  2HU7 A;  3K27 A;  5IGQ A;  5CXB B;  3PSL A;  2QR5 A;  5M5U A;  1VZ3 A;  1QFM A;  3J80 g;  3UVK A;  4FWW A;  4FHL A;  4FB1 D;  5FKQ A;  3SVW D;  2H68 A;  2AGW A;  5EMJ B;  3OL2 A;  2AGL A;  5FKS A;  4A7J A;  2I3T A;  3MMY A;  1U2V C;  4CI8 A;  3ZDY A;  2VDN A;  2VZ1 A;  3I7O A;  4E54 B;  2QXV A;  4J86 A;  5HE3 B;  5IC7 A;  4A0B A;  5TEE A;  4IRZ A;  4X60 B;  5GMK n;  1RI6 A;  2PM6 B;  3IIY A;  2JKX A;  5E6S A;  4Z7Q A;  3EI1 B;  4IA9 A;  3GFC A;  4A08 B;  2I0S A;  1A12 A;  2VDM A;  4UM9 A;  2OJY A;  3ZE0 A;  4A0A B;  4G55 A;  2BCJ B;  4QL1 A;  1JMZ B;  3OKY B;  4J82 A;  1M1X A;  2AGY A;  4GM3 A;  3O4G A;  2G99 A;  5IJ8 E;  4A09 B;  2VDL A;  3PSC B;  3JAM g;  2HYE A;  2PM9 B;  3EI1 A;  3AL8 A;  1C9L A;  4D9S A;  4J0X A;  4GQ2 P;  4XYH A;  2H6N A;  2VDR A;  2I3S A;  5H14 A;  4CZY A;  2H13 A;  1L0Q A;  2IUR A;  3OKY A;  1VZ2 A;  3IJE A;  3IUR A;  4Z8L A;  2P9I C;  3SN6 B;  3VI3 A;  3OF7 A;  2YMU A;  3PVW B;  3UR4 A;  3BG0 A;  4A09 A;  4G56 B;  3IJ1 A;  4JHP C;  2P9U C;  5GXH A;  3I8E A;  4TZ4 A;  2CE9 A;  1TBG A;  1UOO A;  2AGX A;  2OIZ A;  4LGN A;  2H6Q A;  1XIP A;  3SLE D;  2EID A;  3I8C A;  3A0F A;  1QNI A;  2I0R A;  2OK4 A;  3UVL A;  2GNQ A;  4WJK A;  5E6R A;  1VYH C;  4A11 A;  3JZG A;  3NVN A;  2HKR A;  4QRJ A;  4RE6 A;  4CI2 A;  4J8B A;  3IIW A;  4E5Z A;  2BBK H;  1N6E A;  3IUL A;  2HXC A;  3N0D A;  2IUV A;  3RRM C;  3DXK C;  3BG1 A;  4YVD A;  2W18 A;  1N6D A;  4CY2 A;  2Z2P A;  1K8K C;  1O6F A;  3F3F A;  5IT9 g;  4MMX A;  4ZOV A;  3C99 A;  4WK4 A;  2CO0 A;  5CXC B;  5H1M A;  4JT6 C;  1TYQ C;  1GOF A;  4WK2 A;  2XYI A;  5THA A;  2YBA A;  3SFZ A;  3ZE1 A;  2HU8 A;  4J79 A;  4GM9 A;  5M5S A;  4XYI A;  5CYK A;  4FA5 D;  3IJ0 A;  3NIF A;  1GP2 B;  3IJC A;  5EAP A;  4AEZ A;  3MKS B;  3UVO A;  3AL9 A;  4FAN D;  5FKR A;  3VI4 A;  1K3I A;  3EQ9 A;  4ES0 A;  1GOG A;  4JT5 C;  3MVD K;  4O3T B;  4NAA A;  2CNX A;  2MTA H;  2P9L C;  4OWR A;  4BUJ C;  3EG6 A;  4L3G D;  3J81 g;  5FLX g;  1E8N A;  3SMR A;  1GXR A;  4L1M A;  4JHN A;  4RE5 A;  1PGU A;  1T2X A;  4BH6 A;  2VC2 A;  4ERZ A;  4N14 A;  4JXM A;  3OL2 B;  4DNV A;  3MUO A;  2YB8 B;  3ZWL B;  4ZOX A;  4KFM B;  4FA9 D;  5M5V A;  4QT8 A;  4IMM A;  3I7K A;  4J0W A;  4A0B B;  2OVQ B;  4BL0 A;  5SXM A;  4ESG A;  4Y5R D;  3AH8 B;  4LG9 A;  3MZK A;  5HE2 B;  1UOQ A;  4QAM A;  2HKM A;  3EMH A;  4O3U B;  2TRC B;  3ODT A;  3EI3 B;  5EAL A;  5KDO B;  2QZP A;  3SBR A;  2B5N A;  3JRO A;  5K1C C;  3QHY B;  3EQ8 A;  4D0K A;  4CY5 A;  1PBY B;  4JD2 C;  2VZ3 A;  1E5T A;  1Q47 A;  5FFO A;  1GOT B;  4MMY A;  4Y7R A;  3AL8 B;  3SCY A;  3FCU A;  3B7F A;  4ERQ A;  3JB9 L;  1YFQ A;  3EI4 A;  3EI3 A;  2QC5 A;  4ZOY A;  3CIK B;  2H9P A;  1OMW B;  2CO0 C;  4G1E A;  5GXI A;  1UTC A;  2IAA A;  4PSX B;  4PC0 A;  4EWR A;  4J84 A;  5IJ7 E;  4ZOZ A;  3NIG A;  4AMZ A;  2J56 H;  3DXM C;  5B4W A;  4GM8 A;  3QI0 A;  1JMX B;  2HJB A;  3OW8 A;  3RMZ D;  2AQ5 A;  1TYE A;  4UM8 A;  1B9X A;  1SQ9 A;  2IUQ A;  5HE0 B;  5HDB A;  3PVU B;  1H2W A;  2CN3 A;  5EM2 A;  3ORV D;  4Z7N A;  2B5M A;  2EIB A;  1PEV A;  4A11 B;  4PXW A;  3O4H A;  4A2M A;  3GD1 I;  4ERY A;  4L1Q D;  4E5Z B;  3ZDZ A;  4GGD A;  2YNP A;  4L9O A;  4BCB A;  2B5L A;  3PE7 A;  3VGZ A;  2YNN A;  5C2V B;  3V5W B;  1A0R B;  5M5R A;  5EMK B;  5HE1 B;  3EWE A;  2P9P C;  5TEF A;  1JV2 A;  4OZU A;  3UKU C;  5M5T A;  3MZL A;  2Q7Q A;  4X63 B;  3W15 A;  4CY3 A;  2P9K C;  1VE6 A;  4PBZ A;  5CYK B;  5FXY A;  3RFG A;  2B4E A;  4JSP C;  3IUM A;  4O1Q D;  5C86 A;  3O4I A;  4NSX A;  4CI3 A;  4U7A A;  4CY1 A;  3KCI A;  3OTT A;  3OKT A;  2H9L A;  4GMB A;  4WK0 A;  3GRE A;  1H2X A;  3RLM D;  5M61 A;  3SHF A;  2PM7 B;  1K32 A;  2HU5 A;  3IUQ A;  3P4F A;  1JTD B;  2GC4 A;  2XL3 A;  2I0T A;  4I79 A;  2UZY B;  4R7A B;  4GGC A;  3UKR C;  1ERJ A;  5HQG A;  3V7D B;  3PXT D;  4X61 B;  3T3P A;  3RSE C;  3DM0 A;  4AN1 A;  3NVX A;  1H2Z A;  1NR0 A;  2XL2 A;  3JRP A;  1L5G A;  4G1M A;  2OK6 A;  3OKW A;  2EIE A;  2XDW A;  3I7P A;  3EI2 A;  3FCS A;  1MDA H;  3KRX B;  1P22 A;  4O02 A;  4GGA A;  3CFV A;  5I5M A;  5IGO A;  1JOF A;  3MXX A;  5TDH B;  3SXT D;  3EQ7 A;  5A2Q g;  3IUJ A;  1R5M A;  3K26 A;  4JSV C;  1QFS A;  2H9M A;  5H17 A;  3DDU A;  5GSA A;  1XKS A;  3JPX A;  2AGZ A;  4GQB B;  3EI4 B;  4MMZ A;  4BP8 A;  4BCD A;  1GOH A;  2OVP B;  1S4U X;  4PNK B;  4GQ1 A;  3L4O D;  3F3G A;  4H5J A;  3V4P A;  2OVR B;  5FFG A;  2BKL A;  4DNW A;  2YNO A;  4K3J B;  2EIC A;  2P9N C;  3RFH A;  4J73 A;  3UVM A;  5K19 A;  2J55 H;  2VDQ A;  1PI6 A;  1NEX B;  3GC3 B;  2Z2O A;  4GZ8 A;  5TF2 A;  5I5I A;  3PXS D;  1I2M B;  4U1E I;  4AN0 A;  3RN0 D;  1UOP A;  4CZV A;  2EBS A;  5E6U A;  5CXB A;  1E8M A;  1FWX A;  2AH0 A;  2XE4 A;  4O2W A;  3KRW B;  5EM2 B;  5C9Z B;  3FM0 A;  3I7H A;  4DNU A;  4X3E A;  3V9F A;  4LG8 A;  3I7L A;  4JSN C;  1JJU B;  3PXW D;  1SQJ A;  4D6V A;  5EAM A;  3K72 A;  2VDK A;  3HFQ A;  4E54 A;  2J57 G;  3I89 A;  3NID A;  4O9D A;  3K6S A;  3C5M A;  3K71 A;  4J87 A;  4JSX C;  3JZH A;  3DSM A;  4ZN4 A;  3AFC A;  3EU7 A;  2H47 A;  2HES X;  4J78 A;  1MG2 A;  5FA5 B;  2IWF A;  4AOW A;  4A08 A;  1SHY B;  2AH1 A;  3E0C A;  2CN2 A;  4UI9 R;  5AJA A;  2IWK A;  2XZG A;  4A0A A;  2GC7 A;  1MG3 A;  4PBY A;  4FA4 D;  4Z7O A;  2H3X A;  1GG2 B;  3IUN A;  3L4M D;  5I5J A;  4QQE A;  2UZX B;  4NBM A;  5FKT A;  2XU7 A;  1U4C A;  3DWL C;  3I2N A;  2PM9 A;  3C9C A;  4J81 A; 
#chains in the Genus database with same CATH homology
 3U4Y A;  4H5I A;  2PBI B;  4K3I D;  5HYN B;  2CE8 A;  4XEI C;  4HDJ A;  2H6K A;  3C75 H;  5FQD A;  4FA1 D;  2H9N A;  3F3P A;  4O45 A;  3FGB A;  1N6F A;  4PSW B;  5EMM B;  3EI2 B;  4MK0 B;  1B9Y A;  4CZX A;  3MKQ A;  3IKO A;  3RN1 D;  3VA6 A;  2G9A A;  3SWS D;  2H14 A;  3VH0 A;  5AFU 3;  1OLZ A;  2IUP A;  2P9S C;  5C2W B;  1XHM A;  3JZN A;  3UVN A;  4CI1 A;  2Z2N A;  3NVQ A;  3SJL D;  4FAV D;  2O9K A;  5EAR A;  4J8G A;  3BWS A;  5CXC A;  3SBQ A;  3SBP A;  5JWZ A;  4L3H D;  2HJ4 A;  5EML B;  4A2L A;  3CFS B;  3FRX A;  3ULE C;  4CC9 A;  3I7N A;  3N0E A;  5AMS A;  4J77 A;  3K27 A;  5IGQ A;  5CXB B;  3PSL A;  3J80 g;  3UVK A;  4FWW A;  4FHL A;  4FB1 D;  5FKQ A;  3SVW D;  2H68 A;  2AGW A;  5EMJ B;  3OL2 A;  2AGL A;  5FKS A;  4A7J A;  2I3T A;  3MMY A;  1U2V C;  4CI8 A;  3I7O A;  4E54 B;  2QXV A;  4J86 A;  5HE3 B;  5IC7 A;  4A0B A;  5TEE A;  4X60 B;  5GMK n;  1RI6 A;  2PM6 B;  3IIY A;  3EI1 B;  4IA9 A;  3GFC A;  4A08 B;  2I0S A;  2OJY A;  4A0A B;  2BCJ B;  4QL1 A;  1JMZ B;  3OKY B;  4J82 A;  2AGY A;  4GM3 A;  2G99 A;  5IJ8 E;  4A09 B;  3PSC B;  3JAM g;  2HYE A;  2PM9 B;  3EI1 A;  3AL8 A;  4J0X A;  4GQ2 P;  4XYH A;  2H6N A;  2I3S A;  5H14 A;  4CZY A;  2H13 A;  1L0Q A;  2IUR A;  3OKY A;  4Z8L A;  2P9I C;  3SN6 B;  3PVW B;  2YMU A;  3UR4 A;  3BG0 A;  4A09 A;  4G56 B;  3IJ1 A;  2P9U C;  5GXH A;  3I8E A;  4TZ4 A;  2CE9 A;  1TBG A;  2AGX A;  2OIZ A;  4LGN A;  2H6Q A;  1XIP A;  3SLE D;  3I8C A;  3A0F A;  1QNI A;  2I0R A;  2OK4 A;  3UVL A;  2GNQ A;  1VYH C;  4A11 A;  3JZG A;  3NVN A;  2HKR A;  4QRJ A;  4CI2 A;  4J8B A;  3IIW A;  4E5Z A;  2BBK H;  1N6E A;  2HXC A;  3N0D A;  2IUV A;  3RRM C;  3DXK C;  3BG1 A;  4YVD A;  2W18 A;  1N6D A;  4CY2 A;  2Z2P A;  1K8K C;  3F3F A;  5IT9 g;  4ZOV A;  3C99 A;  2CO0 A;  5CXC B;  5H1M A;  4JT6 C;  1TYQ C;  2XYI A;  5THA A;  2YBA A;  3SFZ A;  4J79 A;  4GM9 A;  4XYI A;  5CYK A;  4FA5 D;  3IJ0 A;  5EAP A;  1GP2 B;  3IJC A;  4AEZ A;  3MKS B;  3UVO A;  3AL9 A;  4FAN D;  5FKR A;  4ES0 A;  4JT5 C;  4O3T B;  2CNX A;  2MTA H;  2P9L C;  4OWR A;  4BUJ C;  3EG6 A;  4L3G D;  3J81 g;  5FLX g;  3SMR A;  1GXR A;  1PGU A;  4BH6 A;  4ERZ A;  4N14 A;  4JXM A;  3OL2 B;  2YB8 B;  3ZWL B;  4ZOX A;  4KFM B;  4FA9 D;  4QT8 A;  4IMM A;  3I7K A;  4J0W A;  4A0B B;  2OVQ B;  4BL0 A;  5SXM A;  4ESG A;  4Y5R D;  3AH8 B;  4LG9 A;  3MZK A;  5HE2 B;  2HKM A;  3EMH A;  4O3U B;  2TRC B;  3ODT A;  3EI3 B;  5EAL A;  5KDO B;  3SBR A;  2B5N A;  3JRO A;  5K1C C;  4D0K A;  4CY5 A;  1PBY B;  4JD2 C;  1Q47 A;  1GOT B;  4Y7R A;  3AL8 B;  3SCY A;  3B7F A;  4ERQ A;  3JB9 L;  1YFQ A;  3EI4 A;  3EI3 A;  2QC5 A;  4ZOY A;  3CIK B;  2H9P A;  1OMW B;  2CO0 C;  5GXI A;  2IAA A;  4PSX B;  4PC0 A;  4EWR A;  4J84 A;  5IJ7 E;  4ZOZ A;  2J56 H;  3DXM C;  5B4W A;  4GM8 A;  1JMX B;  2HJB A;  3OW8 A;  3RMZ D;  2AQ5 A;  1B9X A;  1SQ9 A;  2IUQ A;  5HE0 B;  3PVU B;  2CN3 A;  5EM2 A;  3ORV D;  2B5M A;  1PEV A;  4A11 B;  4PXW A;  4A2M A;  4ERY A;  4L1Q D;  4E5Z B;  4GGD A;  2YNP A;  4L9O A;  2B5L A;  3PE7 A;  3VGZ A;  2YNN A;  5C2V B;  3V5W B;  1A0R B;  5EMK B;  5HE1 B;  3EWE A;  2P9P C;  5TEF A;  4OZU A;  3UKU C;  3MZL A;  2Q7Q A;  4X63 B;  3W15 A;  4CY3 A;  2P9K C;  4PBZ A;  5CYK B;  5FXY A;  3RFG A;  2B4E A;  4JSP C;  4O1Q D;  4NSX A;  4CI3 A;  4U7A A;  4CY1 A;  3OTT A;  3OKT A;  2H9L A;  4GMB A;  3GRE A;  3RLM D;  3SHF A;  2PM7 B;  1K32 A;  3P4F A;  2GC4 A;  2XL3 A;  2I0T A;  4I79 A;  2UZY B;  4R7A B;  4GGC A;  3UKR C;  1ERJ A;  5HQG A;  3V7D B;  3PXT D;  4X61 B;  3RSE C;  3DM0 A;  3NVX A;  1NR0 A;  2XL2 A;  3JRP A;  2OK6 A;  3OKW A;  3I7P A;  3EI2 A;  1MDA H;  3KRX B;  1P22 A;  4GGA A;  3CFV A;  5I5M A;  5IGO A;  1JOF A;  3MXX A;  5TDH B;  3SXT D;  5A2Q g;  1R5M A;  3K26 A;  4JSV C;  2H9M A;  5H17 A;  5GSA A;  1XKS A;  3JPX A;  2AGZ A;  4GQB B;  3EI4 B;  2OVP B;  1S4U X;  4PNK B;  4GQ1 A;  3L4O D;  3F3G A;  4H5J A;  2OVR B;  2YNO A;  4K3J B;  2P9N C;  3RFH A;  4J73 A;  3UVM A;  5K19 A;  2J55 H;  1PI6 A;  1NEX B;  2Z2O A;  4GZ8 A;  5TF2 A;  5I5I A;  3PXS D;  4U1E I;  3RN0 D;  4CZV A;  2EBS A;  5CXB A;  1FWX A;  2AH0 A;  5EM2 B;  3KRW B;  5C9Z B;  3FM0 A;  3I7H A;  4X3E A;  3V9F A;  4LG8 A;  3I7L A;  4JSN C;  1JJU B;  3PXW D;  1SQJ A;  4D6V A;  5EAM A;  3HFQ A;  4E54 A;  2J57 G;  3I89 A;  4O9D A;  3C5M A;  4J87 A;  4JSX C;  3JZH A;  3DSM A;  4ZN4 A;  3AFC A;  3EU7 A;  2H47 A;  2HES X;  4J78 A;  1MG2 A;  5FA5 B;  2IWF A;  4AOW A;  4A08 A;  1SHY B;  2AH1 A;  3E0C A;  2CN2 A;  4UI9 R;  5AJA A;  2IWK A;  4A0A A;  2GC7 A;  1MG3 A;  4PBY A;  4FA4 D;  2H3X A;  1GG2 B;  3L4M D;  5I5J A;  4QQE A;  2UZX B;  5FKT A;  2XU7 A;  1U4C A;  3DWL C;  3I2N A;  2PM9 A;  3C9C A;  4J81 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...