5SXMA

Wdr5 in complex with mll win motif peptidomimetic
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords WD repeat-containing protein 5
publication title Targeted Disruption of the Interaction between WD-40 Repeat Protein 5 (WDR5) and Mixed Lineage Leukemia (MLL)/SET1 Family Proteins Specifically Inhibits MLL1 and SETd1A Methyltransferase Complexes.
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5sxmA00
3OW8A 4O9DA 3VGZA 4FA4D 1S4UX 1N6EA 4J84A 1QNIA 2PM7B 3OKTA 3PSCB 2XYIA 3U4YA 3RN0D 2CNXA 3F3FA 4J86A 2PM9B 4H5JA 4FA1D 2HXCA 3RFHA 2I3TA 3DSMA 2B5LA 4JSNC 2YBAA 5I5IA 2I0TA 4ZOXA 3DXKC 1SQJA 1ERJA 3UKRC 5HE1B 3UKUC 4A08B 4ZOYA 2H68A 1B9XA 5EAMA 3SCYA 4IA9A 1MG2A 1B9YA 4PXWA 2IURA 3AFCA 5IGQA 3SWSD 4YVDA 2B5NA 3IIYA 3OL2B 2YNOA 4JSXC 3SFZA 1JMXB 1PBYB 3JRPA 1TBGA 5TEFA 3HFQA 2UZYB 1K32A 2AH1A 3NVQA 4A2LA 4G56B 3RMZD 5GXHA 3A0FA 3PXSD 5HE3B 3AL9A 2GNQA 1OMWB 5EMMB 3ODTA 3BG0A 4XYHA 4A09A 4JT5C 4QQEA 3SLED 3V5WB 4J0XA 1YFQA 3IKOA 2IAAA 5GSAA 4GM8A 2OJYA 3L4MD 4E54A 3OKWA 4TZ4A 3IIWA 4GM9A 5TEEA 3I7PA 4X61B 4BH6A 4FA5D 5CXCA 4D0KA 5B4WA 2P9PC 2W18A 4IMMA 2P9NC 3N0EA 1XKSA 3UVLA 4U7AA 1GP2B 2OIZA 3JAMg 3EI3B 4O45A 3I8CA 4J8GA 5EMLB 3RN1D 4L9OA 4GZ8A 3I7KA 3SXTD 2AGLA 1N6DA 1JOFA 3VH0A 2YB8B 4JSPC 5GXIA 2TRCB 3UVMA 5FQDA 4ERYA 2P9SC 4R7AB 5EMJB 2H13A 1VYHC 3J80g 4AEZA 3JB9L 4PSXB 3BG1A 4L1QD 3FRXA 4MK0B 3IJCA 2P9UC 2H3XA 4OZUA 3E0CA 5H1MA 3JROA 2MTAH 5C9ZB 3CIKB 4FB1D 4CY5A 4E54B 3I7NA 4OWRA 2PBIB 3MXXA 4Y5RD 4FWWA 3K26A 4HDJA 4LG8A 4NSXA 4J8BA 4K3JB 3J81g 5CXCB 1MG3A 2AGWA 3EG6A 3C99A 3GFCA 4QT8A 3SBRA 4JT6C 5I5MA 5H14A 5IJ8E 5C2VB 2QXVA 4CI2A 1SHYB 3SHFA 4FA9D 4J87A 4LGNA 4EWRA 2BCJB 4ESGA 3EI3A 2IWKA 5FKRA 3GREA 4PNKB 3MMYA 3V7DB 3B7FA 4GGDA 4FAVD 3DWLC 3MKSB 3P4FA 4O1QD 5IJ7E 4XYIA 2B4EA 4N14A 4A0BA 1OLZA 4E5ZA 5AJAA 2CO0A 2CO0C 3SBQA 2Z2OA 2J57G 3SBPA 3CFSB 3N0DA 2AQ5A 4H5IA 4FAND 1JMZB 2H9PA 2PM6B 1U4CA 3SN6B 3C9CA 5IT9g 3MZLA 3JZGA 2P9IC 4A2MA 3CFVA 5EMKB 2XL2A 3I89A 4KFMB 5EARA 5HE2B 3SVWD 3AL8B 4GQ1A 5FKQA 3C5MA 5TDHB 1K8KC 3I8EA 4J78A 3L4OD 2H6QA 1NEXB 2XL3A 2HESX 5K19A 3W15A 4AOWA 2HKMA 5HQGA 2YNPA 2QC5A 5CXBA 2G99A 4J73A 5HYNB 5SXMA 4ERQA 3UVNA 2IUVA 2J56H 4CZXA 2O9KA 4O3TB 3SMRA 3NVNA 4GMBA 4A0BB 4E5ZB 2HJ4A 1TYQC 4LG9A 4QL1A 3JZNA 4BL0A 4XEIC 2XU7A 5IC7A 2GC7A 3C75H 3OKYA 3VA6A 2OVPB 2CE9A 1GG2B 2AGYA 1U2VC 3NVXA 2I0SA 3UVOA 2HKRA 3EMHA 5EM2A 4ZOZA 4CI3A 3PSLA 3RLMD 3RFGA 4X63B 2H6NA 2H9NA 3PE7A 3MZKA 3EWEA 4A0AB 3I2NA 4J77A 3UVKA 5A2Qg 1R5MA 2YMUA 4L3GD 4GGAA 4CZYA 4GQ2P 4J81A 4Y7RA 2OVRB 5C2WB 3PVUB 5FA5B 3AL8A 2H14A 1P22A 5CXBB 3AH8B 3PXTD 5EALA 2CN2A 3JZHA 5I5JA 3EU7A 5AFU3 4GGCA 4PBZA 1GXRA 4CZVA 4GQBB 2AGZA 5H17A 4GM3A 2I0RA 3FM0A 2CE8A 3OKYB 4X3EA 3PXWD 3V9FA 2OK4A 4PSWB 3BWSA 5CYKA 3DM0A 5EM2B 2Z2PA 2EBSA 4D6VA 2Z2NA 2YNNA 4ZOVA 2OK6A 3IJ0A 2OVQB 5GMKn 3FGBA 1NR0A 4PBYA 5THAA 2H9LA 2IWFA 3RRMC 2BBKH 1XHMA 3EI1A 4CY2A 3EI2A 1N6FA 2H6KA 4FHLA 4A0AA 2H47A 3UR4A 3EI4A 3OTTA 2B5MA 4CC9A 2Q7QA 4U1EI 4A11A 1RI6A 1A0RB 2J55H 4UI9R 2I3SA 5FKTA 1L0QA 4JXMA 3RSEC 2GC4A 3F3PA 2CN3A 5HE0B 5FXYA 4J0WA 3DXMC 5EAPA 5KDOB 2PM9A 4PC0A 4I79A 3PVWB 4X60B 4JD2C 1JJUB 1PEVA 2G9AA 4JSVC 3JPXA 4QRJA 4L3HD 4ZN4A 1PI6A 4Z8LA 4J82A 4A08A 1Q47A 3ORVD 3F3GA 5CYKB 3MKQA 3I7LA 1SQ9A 1XIPA 2HJBA 3K27A 3ZWLB 3OL2A 2HYEA 1MDAH 2IUQA 2AH0A 5IGOA 4A7JA 4ERZA 3I7HA 4CI8A 3KRXB 1FWXA 4J79A 4BUJC 4CI1A 4K3ID 3EI1B 4CY3A 2P9LC 5AMSA 3IJ1A 3KRWB 2AGXA 4ES0A 3EI2B 5FKSA 5K1CC 3ULEC 4A09B 3EI4B 5FLXg 5TF2A 2UZXB 1GOTB 2P9KC 3I7OA 2IUPA 4O3UB 4A11B 2H9MA 5JWZA 4CY1A 3SJLD 1PGUA
chains in the Genus database with same CATH superfamily
3OW8A 4O9DA 3VGZA 1H2XA 4UM8A 4FA4D 1S4UX 1N6EA 4J84A 1QNIA 2PM7B 3OKTA 3PSCB 1VE7A 2XYIA 3NIGA 3U4YA 2VDNA 3RN0D 2CNXA 3F3FA 4J86A 2PM9B 4H5JA 4FA1D 2HXCA 2HU8A 3RFHA 2I3TA 3DSMA 2B5LA 4JSNC 2YBAA 5I5IA 2I0TA 4ZOXA 1QFMA 3DXKC 1SQJA 1ERJA 3O4GA 3UKRC 5HE1B 3UKUC 4A08B 4ZOYA 2H68A 1B9XA 5EAMA 3SCYA 4IA9A 1B9YA 1MG2A 4PXWA 3O4JA 2IURA 3AFCA 3IVMA 4O02A 5IGQA 3SWSD 4YVDA 2B5NA 5E6UA 3IIYA 3OL2B 2YNOA 4JSXC 5M61A 3SFZA 2VDKA 1JMXB 1PBYB 3JRPA 1TBGA 5TEFA 3HFQA 2UZYB 1K32A 2QR5A 2AH1A 3NVQA 4A2LA 4G56B 2VDLA 3RMZD 2BKLA 5GXHA 3A0FA 3PXSD 5HE3B 3AL9A 3NIFA 4NC4A 2GNQA 3MUNA 1OMWB 2HU7A 1M1XA 3T3PA 2XZGA 1C9IA 5EMMB 3ODTA 3KCIA 5E6SA 3BG0A 4XYHA 4A09A 4JT5C 4QQEA 3SLED 3V5WB 2VDPA 4J0XA 4QAMA 1YFQA 3IKOA 2IAAA 4BP8A 4GM8A 5GSAA 2OJYA 3L4MD 1H2YA 4E54A 5HDBA 3OKWA 2VZ1A 1C9LA 2HU5A 3IIWA 4TZ4A 4GM9A 5TEEA 3I7PA 3EQ7A 4X61B 4BH6A 4FA5D 5CXCA 4D0KA 4WJKA 5B4WA 2P9PC 2W18A 4IMMA 2JKXA 4WK0A 2P9NC 3N0EA 1XKSA 3UVLA 4U7AA 1GP2B 2OIZA 1YR2A 3JAMg 4O2WA 3EI3B 4O45A 3I8CA 1U8CA 4J8GA 5EMLB 3RN1D 4L9OA 4GZ8A 3I7KA 3DDUA 3SXTD 2AGLA 1N6DA 1JOFA 3VH0A 2YB8B 4JSPC 5GXIA 2TRCB 4MMZA 5FQDA 3UVMA 2P9SC 4R7AB 5EMJB 4ERYA 2H13A 1VYHC 4NBMA 3J80g 4AEZA 3JB9L 4PSXB 1VZ2A 2EIBA 3BG1A 4Z7NA 4L1QD 3FRXA 4MK0B 3IJCA 3NIDA 2P9UC 2H3XA 4OZUA 3E0CA 5H1MA 3JROA 1H2ZA 2MTAH 5C9ZB 3CIKB 4FB1D 4CY5A 4E54B 3I7NA 4OWRA 2PBIB 3MXXA 4Y5RD 4FWWA 3V4VA 3K26A 2XE4A 5C86A 4HDJA 4LG8A 3T3MA 4NSXA 4J8BA 4K3JB 3J81g 5M5UA 4RE5A 5CXCB 1MG3A 2AGWA 3EG6A 3C99A 3GFCA 4QT8A 3IURA 3SBRA 1A12A 4JT6C 5I5MA 5H14A 5IJ8E 2EIEA 5C2VB 4Z7QA 2QXVA 3O4HA 4CI2A 1SHYB 3SHFA 4G1MA 4FA9D 4J87A 4BCCA 4RE6A 4DNVA 4LGNA 4EWRA 3OF7A 2BCJB 1BPOA 4ESGA 1UOPA 3EI3A 2IWKA 2VDQA 1UTCA 5FKRA 3GREA 4PNKB 3MMYA 3V7DB 3B7FA 4GGDA 4FAVD 4L1MA 3DWLC 3IUQA 3MKSB 3P4FA 4O1QD 5IJ7E 4XYIA 2B4EA 4N14A 1K3IA 4A0BA 4MMXA 1OLZA 3MVDK 4E5ZA 4BCDA 5AJAA 2CO0A 3MUOA 2CO0C 3SBQA 2Z2OA 2J57G 4NENA 3SBPA 4AN1A 3CFSB 4MMYA 5FFOA 3N0DA 2AQ5A 4H5IA 4FAND 1JMZB 2H9PA 2PM6B 1U4CA 3SN6B 4IRZA 2VZ3A 3C9CA 5IT9g 3IUNA 3MZLA 3JZGA 5JWZA 2P9IC 1O6GA 4A2MA 3CFVA 1I2MB 4JHPC 5EMKB 1GOHA 2VC2A 2XL2A 5E6RA 3I89A 4KFMB 1JTDB 5EARA 5HE2B 4WK2A 3SVWD 3AL8B 4GQ1A 5FKQA 3C5MA 5TDHB 1K8KC 3I8EA 3QHYB 4J78A 3L4OD 4G55A 2H6QA 1NEXB 2XL3A 2HESX 5K19A 3W15A 4AOWA 2HKMA 5HQGA 2YNPA 2QC5A 5CXBA 2G99A 4J73A 1GOGA 3VI3A 5HYNB 5SXMA 4ERQA 1QFSA 3UVNA 2IUVA 2J56H 4CZXA 2O9KA 4O3TB 3SMRA 3NVNA 4GMBA 4A0BB 4E5ZB 2HJ4A 1TYQC 4LG9A 4QL1A 4UM9A 3JZNA 4BL0A 4XEIC 2XU7A 5IC7A 2GC7A 4DNWA 3C75H 3OKYA 3VA6A 2OVPB 2CE9A 1GG2B 2AGYA 1U2VC 3ZE2A 3NVXA 2I0SA 3UVOA 2HKRA 3EMHA 5EM2A 4ZOZA 4CI3A 2VDMA 3PSLA 3RLMD 3RFGA 4X63B 2H6NA 2H9NA 3PE7A 2XDWA 3MZKA 3EWEA 4A0AB 3QI0A 3I2NA 4J77A 3UVKA 5A2Qg 1R5MA 2YMUA 4L3GD 4GGAA 3VI4A 4CZYA 4GQ2P 4J81A 5FFGA 4Y7RA 2OVRB 5C2WB 3PVUB 5FA5B 3AL8A 2QZPA 2EIDA 2H14A 1P22A 5CXBB 3AH8B 3PXTD 5EALA 1UOQA 2CN2A 3JZHA 5I5JA 3EU7A 1T2XA 4AMZA 5AFU3 4GGCA 3K71A 4PBZA 1GXRA 4CZVA 4GQBB 2AGZA 5H17A 4GM3A 4AN0A 2I0RA 5M5VA 3FM0A 2CE8A 1TYEA 3OKYB 4X3EA 3IULA 3PXWD 4Z7OA 3V9FA 3EQ9A 2OK4A 4PSWB 3BWSA 4JHNA 5CYKA 3DM0A 3ZE0A 5EM2B 2Z2PA 2EBSA 4D6VA 2Z2NA 2YNNA 4ZOVA 2OK6A 3IUJA 1E8NA 5C92A 3IJ0A 2OVQB 5GMKn 3FGBA 1O6FA 1NR0A 4PBYA 5M5RA 5THAA 3ZDXA 2H9LA 2IWFA 3RRMC 2BBKH 1XHMA 1UOOA 3EI1A 4CY2A 4AX4A 4BCBA 4D9SA 3GD1I 5M5SA 3EI2A 1N6FA 2H6KA 4FHLA 4A0AA 2H47A 3UR4A 1H2WA 3ZDYA 3K72A 3EI4A 3OTTA 2B5MA 4CC9A 2Q7QA 4U1EI 4A11A 1RI6A 1A0RB 2J55H 4UI9R 2I3SA 5FKTA 1L0QA 4JXMA 3RSEC 2GC4A 3F3PA 2CN3A 5HE0B 4NAAA 1JV2A 5FXYA 2WQ8A 1L5GA 4J0WA 3DXMC 5EAPA 5KDOB 2PM9A 4PC0A 5M5TA 1VZ3A 4I79A 3PVWB 4X60B 1E5TA 4JD2C 1JJUB 1PEVA 2G9AA 3O4IA 4JSVC 3V4PA 3JPXA 1E8MA 4QRJA 4L3HD 4BP9A 3IUMA 4ZN4A 1PI6A 4Z8LA 4J82A 3ZE1A 4A08A 1Q47A 3ORVD 3FCSA 3F3GA 5CYKB 3MKQA 4DNUA 3I7LA 1SQ9A 4WK4A 1XIPA 2HJBA 3K27A 4G1EA 3ZWLB 3IJEA 3FCUA 3GC3B 3OL2A 2HYEA 1MDAH 2IUQA 2AH0A 5IGOA 4A7JA 4ERZA 3K6SA 3I7HA 4CI8A 3KRXB 1FWXA 4J79A 4BUJC 1GOFA 4CI1A 4K3ID 3EI1B 4CY3A 2P9LC 5AMSA 3IJ1A 3KRWB 2AGXA 4ES0A 3EI2B 5FKSA 5K1CC 3ULEC 4A09B 2VDOA 3EI4B 5TF2A 2UZXB 5FLXg 3EQ8A 3ZDZA 1GOTB 1VE6A 2P9KC 2IUPA 3I7OA 4O3UB 2H9MA 4A11B 4CY1A 3SJLD 2VDRA 1PGUA 4AMYA 2EICA
chains in the Genus database with same CATH topology
3OW8A 4O9DA 3VGZA 4FA4D 1S4UX 1N6EA 4J84A 1QNIA 2PM7B 3OKTA 3PSCB 2XYIA 3U4YA 3RN0D 2CNXA 3F3FA 4J86A 2PM9B 4H5JA 4FA1D 2HXCA 3RFHA 2I3TA 3DSMA 2B5LA 4JSNC 2YBAA 5I5IA 2I0TA 4ZOXA 3DXKC 1SQJA 1ERJA 3UKRC 5HE1B 3UKUC 4A08B 4ZOYA 2H68A 1B9XA 5EAMA 3SCYA 4IA9A 1MG2A 1B9YA 4PXWA 2IURA 3AFCA 5IGQA 3SWSD 4YVDA 2B5NA 3IIYA 3OL2B 2YNOA 4JSXC 3SFZA 1JMXB 1PBYB 3JRPA 1TBGA 5TEFA 3HFQA 2UZYB 1K32A 2AH1A 3NVQA 4A2LA 4G56B 3RMZD 5GXHA 3A0FA 3PXSD 5HE3B 3AL9A 2GNQA 1OMWB 5EMMB 3ODTA 3BG0A 4XYHA 4A09A 4JT5C 4QQEA 3SLED 3V5WB 4J0XA 1YFQA 3IKOA 2IAAA 5GSAA 4GM8A 2OJYA 3L4MD 4E54A 3OKWA 4TZ4A 3IIWA 4GM9A 5TEEA 3I7PA 4X61B 4BH6A 4FA5D 5CXCA 4D0KA 5B4WA 2P9PC 2W18A 4IMMA 2P9NC 3N0EA 1XKSA 3UVLA 4U7AA 1GP2B 2OIZA 3JAMg 3EI3B 4O45A 3I8CA 4J8GA 5EMLB 3RN1D 4L9OA 4GZ8A 3I7KA 3SXTD 2AGLA 1N6DA 1JOFA 3VH0A 2YB8B 4JSPC 5GXIA 2TRCB 3UVMA 5FQDA 4ERYA 2P9SC 4R7AB 5EMJB 2H13A 1VYHC 3J80g 4AEZA 3JB9L 4PSXB 3BG1A 4L1QD 3FRXA 4MK0B 3IJCA 2P9UC 2H3XA 4OZUA 3E0CA 5H1MA 3JROA 2MTAH 5C9ZB 3CIKB 4FB1D 4CY5A 4E54B 3I7NA 4OWRA 2PBIB 3MXXA 4Y5RD 4FWWA 3K26A 4HDJA 4LG8A 4NSXA 4J8BA 4K3JB 3J81g 5CXCB 1MG3A 2AGWA 3EG6A 3C99A 3GFCA 4QT8A 3SBRA 4JT6C 5I5MA 5H14A 5IJ8E 5C2VB 2QXVA 4CI2A 1SHYB 3SHFA 4FA9D 4J87A 4LGNA 4EWRA 2BCJB 4ESGA 3EI3A 2IWKA 5FKRA 3GREA 4PNKB 3MMYA 3V7DB 3B7FA 4GGDA 4FAVD 3DWLC 3MKSB 3P4FA 4O1QD 5IJ7E 4XYIA 2B4EA 4N14A 4A0BA 1OLZA 4E5ZA 5AJAA 2CO0A 2CO0C 3SBQA 2Z2OA 2J57G 3SBPA 3CFSB 3N0DA 2AQ5A 4H5IA 4FAND 1JMZB 2H9PA 2PM6B 1U4CA 3SN6B 3C9CA 5IT9g 3MZLA 3JZGA 2P9IC 4A2MA 3CFVA 5EMKB 2XL2A 3I89A 4KFMB 5EARA 5HE2B 3SVWD 3AL8B 4GQ1A 5FKQA 3C5MA 5TDHB 1K8KC 3I8EA 4J78A 3L4OD 2H6QA 1NEXB 2XL3A 2HESX 5K19A 3W15A 4AOWA 2HKMA 5HQGA 2YNPA 2QC5A 5CXBA 2G99A 4J73A 5HYNB 5SXMA 4ERQA 3UVNA 2IUVA 2J56H 4CZXA 2O9KA 4O3TB 3SMRA 3NVNA 4GMBA 4A0BB 4E5ZB 2HJ4A 1TYQC 4LG9A 4QL1A 3JZNA 4BL0A 4XEIC 2XU7A 5IC7A 2GC7A 3C75H 3OKYA 3VA6A 2OVPB 2CE9A 1GG2B 2AGYA 1U2VC 3NVXA 2I0SA 3UVOA 2HKRA 3EMHA 5EM2A 4ZOZA 4CI3A 3PSLA 3RLMD 3RFGA 4X63B 2H6NA 2H9NA 3PE7A 3MZKA 3EWEA 4A0AB 3I2NA 4J77A 3UVKA 5A2Qg 1R5MA 2YMUA 4L3GD 4GGAA 4CZYA 4GQ2P 4J81A 4Y7RA 2OVRB 5C2WB 3PVUB 5FA5B 3AL8A 2H14A 1P22A 5CXBB 3AH8B 3PXTD 5EALA 2CN2A 3JZHA 5I5JA 3EU7A 5AFU3 4GGCA 4PBZA 1GXRA 4CZVA 4GQBB 2AGZA 5H17A 4GM3A 2I0RA 3FM0A 2CE8A 3OKYB 4X3EA 3PXWD 3V9FA 2OK4A 4PSWB 3BWSA 5CYKA 3DM0A 5EM2B 2Z2PA 2EBSA 4D6VA 2Z2NA 2YNNA 4ZOVA 2OK6A 3IJ0A 2OVQB 5GMKn 3FGBA 1NR0A 4PBYA 5THAA 2H9LA 2IWFA 3RRMC 2BBKH 1XHMA 3EI1A 4CY2A 3EI2A 1N6FA 2H6KA 4FHLA 4A0AA 2H47A 3UR4A 3EI4A 3OTTA 2B5MA 4CC9A 2Q7QA 4U1EI 4A11A 1RI6A 1A0RB 2J55H 4UI9R 2I3SA 5FKTA 1L0QA 4JXMA 3RSEC 2GC4A 3F3PA 2CN3A 5HE0B 5FXYA 4J0WA 3DXMC 5EAPA 5KDOB 2PM9A 4PC0A 4I79A 3PVWB 4X60B 4JD2C 1JJUB 1PEVA 2G9AA 4JSVC 3JPXA 4QRJA 4L3HD 4ZN4A 1PI6A 4Z8LA 4J82A 4A08A 1Q47A 3ORVD 3F3GA 5CYKB 3MKQA 3I7LA 1SQ9A 1XIPA 2HJBA 3K27A 3ZWLB 3OL2A 2HYEA 1MDAH 2IUQA 2AH0A 5IGOA 4A7JA 4ERZA 3I7HA 4CI8A 3KRXB 1FWXA 4J79A 4BUJC 4CI1A 4K3ID 3EI1B 4CY3A 2P9LC 5AMSA 3IJ1A 3KRWB 2AGXA 4ES0A 3EI2B 5FKSA 5K1CC 3ULEC 4A09B 3EI4B 5FLXg 5TF2A 2UZXB 1GOTB 2P9KC 3I7OA 2IUPA 4O3UB 4A11B 2H9MA 5JWZA 4CY1A 3SJLD 1PGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OW8 A;  4O9D A;  3VGZ A;  4FA4 D;  1S4U X;  1N6E A;  4J84 A;  1QNI A;  2PM7 B;  3OKT A;  3PSC B;  2XYI A;  3U4Y A;  3RN0 D;  2CNX A;  3F3F A;  4J86 A;  2PM9 B;  4H5J A;  4FA1 D;  2HXC A;  3RFH A;  2I3T A;  3DSM A;  2B5L A;  4JSN C;  2YBA A;  5I5I A;  2I0T A;  4ZOX A;  3DXK C;  1SQJ A;  1ERJ A;  3UKR C;  5HE1 B;  3UKU C;  4A08 B;  4ZOY A;  2H68 A;  1B9X A;  5EAM A;  3SCY A;  4IA9 A;  1MG2 A;  1B9Y A;  4PXW A;  2IUR A;  3AFC A;  5IGQ A;  3SWS D;  4YVD A;  2B5N A;  3IIY A;  3OL2 B;  2YNO A;  4JSX C;  3SFZ A;  1JMX B;  1PBY B;  3JRP A;  1TBG A;  5TEF A;  3HFQ A;  2UZY B;  1K32 A;  2AH1 A;  3NVQ A;  4A2L A;  4G56 B;  3RMZ D;  5GXH A;  3A0F A;  3PXS D;  5HE3 B;  3AL9 A;  2GNQ A;  1OMW B;  5EMM B;  3ODT A;  3BG0 A;  4XYH A;  4A09 A;  4JT5 C;  4QQE A;  3SLE D;  3V5W B;  4J0X A;  1YFQ A;  3IKO A;  2IAA A;  5GSA A;  4GM8 A;  2OJY A;  3L4M D;  4E54 A;  3OKW A;  4TZ4 A;  3IIW A;  4GM9 A;  5TEE A;  3I7P A;  4X61 B;  4BH6 A;  4FA5 D;  5CXC A;  4D0K A;  5B4W A;  2P9P C;  2W18 A;  4IMM A;  2P9N C;  3N0E A;  1XKS A;  3UVL A;  4U7A A;  1GP2 B;  2OIZ A;  3JAM g;  3EI3 B;  4O45 A;  3I8C A;  4J8G A;  5EML B;  3RN1 D;  4L9O A;  4GZ8 A;  3I7K A;  3SXT D;  2AGL A;  1N6D A;  1JOF A;  3VH0 A;  2YB8 B;  4JSP C;  5GXI A;  2TRC B;  3UVM A;  5FQD A;  4ERY A;  2P9S C;  4R7A B;  5EMJ B;  2H13 A;  1VYH C;  3J80 g;  4AEZ A;  3JB9 L;  4PSX B;  3BG1 A;  4L1Q D;  3FRX A;  4MK0 B;  3IJC A;  2P9U C;  2H3X A;  4OZU A;  3E0C A;  5H1M A;  3JRO A;  2MTA H;  5C9Z B;  3CIK B;  4FB1 D;  4CY5 A;  4E54 B;  3I7N A;  4OWR A;  2PBI B;  3MXX A;  4Y5R D;  4FWW A;  3K26 A;  4HDJ A;  4LG8 A;  4NSX A;  4J8B A;  4K3J B;  3J81 g;  5CXC B;  1MG3 A;  2AGW A;  3EG6 A;  3C99 A;  3GFC A;  4QT8 A;  3SBR A;  4JT6 C;  5I5M A;  5H14 A;  5IJ8 E;  5C2V B;  2QXV A;  4CI2 A;  1SHY B;  3SHF A;  4FA9 D;  4J87 A;  4LGN A;  4EWR A;  2BCJ B;  4ESG A;  3EI3 A;  2IWK A;  5FKR A;  3GRE A;  4PNK B;  3MMY A;  3V7D B;  3B7F A;  4GGD A;  4FAV D;  3DWL C;  3MKS B;  3P4F A;  4O1Q D;  5IJ7 E;  4XYI A;  2B4E A;  4N14 A;  4A0B A;  1OLZ A;  4E5Z A;  5AJA A;  2CO0 A;  2CO0 C;  3SBQ A;  2Z2O A;  2J57 G;  3SBP A;  3CFS B;  3N0D A;  2AQ5 A;  4H5I A;  4FAN D;  1JMZ B;  2H9P A;  2PM6 B;  1U4C A;  3SN6 B;  3C9C A;  5IT9 g;  3MZL A;  3JZG A;  2P9I C;  4A2M A;  3CFV A;  5EMK B;  2XL2 A;  3I89 A;  4KFM B;  5EAR A;  5HE2 B;  3SVW D;  3AL8 B;  4GQ1 A;  5FKQ A;  3C5M A;  5TDH B;  1K8K C;  3I8E A;  4J78 A;  3L4O D;  2H6Q A;  1NEX B;  2XL3 A;  2HES X;  5K19 A;  3W15 A;  4AOW A;  2HKM A;  5HQG A;  2YNP A;  2QC5 A;  5CXB A;  2G99 A;  4J73 A;  5HYN B;  5SXM A;  4ERQ A;  3UVN A;  2IUV A;  2J56 H;  4CZX A;  2O9K A;  4O3T B;  3SMR A;  3NVN A;  4GMB A;  4A0B B;  4E5Z B;  2HJ4 A;  1TYQ C;  4LG9 A;  4QL1 A;  3JZN A;  4BL0 A;  4XEI C;  2XU7 A;  5IC7 A;  2GC7 A;  3C75 H;  3OKY A;  3VA6 A;  2OVP B;  2CE9 A;  1GG2 B;  2AGY A;  1U2V C;  3NVX A;  2I0S A;  3UVO A;  2HKR A;  3EMH A;  5EM2 A;  4ZOZ A;  4CI3 A;  3PSL A;  3RLM D;  3RFG A;  4X63 B;  2H6N A;  2H9N A;  3PE7 A;  3MZK A;  3EWE A;  4A0A B;  3I2N A;  4J77 A;  3UVK A;  5A2Q g;  1R5M A;  2YMU A;  4L3G D;  4GGA A;  4CZY A;  4GQ2 P;  4J81 A;  4Y7R A;  2OVR B;  5C2W B;  3PVU B;  5FA5 B;  3AL8 A;  2H14 A;  1P22 A;  5CXB B;  3AH8 B;  3PXT D;  5EAL A;  2CN2 A;  3JZH A;  5I5J A;  3EU7 A;  5AFU 3;  4GGC A;  4PBZ A;  1GXR A;  4CZV A;  4GQB B;  2AGZ A;  5H17 A;  4GM3 A;  2I0R A;  3FM0 A;  2CE8 A;  3OKY B;  4X3E A;  3PXW D;  3V9F A;  2OK4 A;  4PSW B;  3BWS A;  5CYK A;  3DM0 A;  5EM2 B;  2Z2P A;  2EBS A;  4D6V A;  2Z2N A;  2YNN A;  4ZOV A;  2OK6 A;  3IJ0 A;  2OVQ B;  5GMK n;  3FGB A;  1NR0 A;  4PBY A;  5THA A;  2H9L A;  2IWF A;  3RRM C;  2BBK H;  1XHM A;  3EI1 A;  4CY2 A;  3EI2 A;  1N6F A;  2H6K A;  4FHL A;  4A0A A;  2H47 A;  3UR4 A;  3EI4 A;  3OTT A;  2B5M A;  4CC9 A;  2Q7Q A;  4U1E I;  4A11 A;  1RI6 A;  1A0R B;  2J55 H;  4UI9 R;  2I3S A;  5FKT A;  1L0Q A;  4JXM A;  3RSE C;  2GC4 A;  3F3P A;  2CN3 A;  5HE0 B;  5FXY A;  4J0W A;  3DXM C;  5EAP A;  5KDO B;  2PM9 A;  4PC0 A;  4I79 A;  3PVW B;  4X60 B;  4JD2 C;  1JJU B;  1PEV A;  2G9A A;  4JSV C;  3JPX A;  4QRJ A;  4L3H D;  4ZN4 A;  1PI6 A;  4Z8L A;  4J82 A;  4A08 A;  1Q47 A;  3ORV D;  3F3G A;  5CYK B;  3MKQ A;  3I7L A;  1SQ9 A;  1XIP A;  2HJB A;  3K27 A;  3ZWL B;  3OL2 A;  2HYE A;  1MDA H;  2IUQ A;  2AH0 A;  5IGO A;  4A7J A;  4ERZ A;  3I7H A;  4CI8 A;  3KRX B;  1FWX A;  4J79 A;  4BUJ C;  4CI1 A;  4K3I D;  3EI1 B;  4CY3 A;  2P9L C;  5AMS A;  3IJ1 A;  3KRW B;  2AGX A;  4ES0 A;  3EI2 B;  5FKS A;  5K1C C;  3ULE C;  4A09 B;  3EI4 B;  5FLX g;  5TF2 A;  2UZX B;  1GOT B;  2P9K C;  3I7O A;  2IUP A;  4O3U B;  4A11 B;  2H9M A;  5JWZ A;  4CY1 A;  3SJL D;  1PGU A; 
#chains in the Genus database with same CATH topology
 3OW8 A;  4O9D A;  3VGZ A;  1H2X A;  4UM8 A;  4FA4 D;  1S4U X;  1N6E A;  4J84 A;  1QNI A;  2PM7 B;  3OKT A;  3PSC B;  1VE7 A;  2XYI A;  3NIG A;  3U4Y A;  2VDN A;  3RN0 D;  2CNX A;  3F3F A;  4J86 A;  2PM9 B;  4H5J A;  4FA1 D;  2HXC A;  2HU8 A;  3RFH A;  2I3T A;  3DSM A;  2B5L A;  4JSN C;  2YBA A;  5I5I A;  2I0T A;  4ZOX A;  1QFM A;  3DXK C;  1SQJ A;  1ERJ A;  3O4G A;  3UKR C;  5HE1 B;  3UKU C;  4A08 B;  4ZOY A;  2H68 A;  1B9X A;  5EAM A;  3SCY A;  4IA9 A;  1B9Y A;  1MG2 A;  4PXW A;  3O4J A;  2IUR A;  3AFC A;  3IVM A;  4O02 A;  5IGQ A;  3SWS D;  4YVD A;  2B5N A;  5E6U A;  3IIY A;  3OL2 B;  2YNO A;  4JSX C;  5M61 A;  3SFZ A;  2VDK A;  1JMX B;  1PBY B;  3JRP A;  1TBG A;  5TEF A;  3HFQ A;  2UZY B;  1K32 A;  2QR5 A;  2AH1 A;  3NVQ A;  4A2L A;  4G56 B;  2VDL A;  3RMZ D;  2BKL A;  5GXH A;  3A0F A;  3PXS D;  5HE3 B;  3AL9 A;  3NIF A;  4NC4 A;  2GNQ A;  3MUN A;  1OMW B;  2HU7 A;  1M1X A;  3T3P A;  2XZG A;  1C9I A;  5EMM B;  3ODT A;  3KCI A;  5E6S A;  3BG0 A;  4XYH A;  4A09 A;  4JT5 C;  4QQE A;  3SLE D;  3V5W B;  2VDP A;  4J0X A;  4QAM A;  1YFQ A;  3IKO A;  2IAA A;  4BP8 A;  4GM8 A;  5GSA A;  2OJY A;  3L4M D;  1H2Y A;  4E54 A;  5HDB A;  3OKW A;  2VZ1 A;  1C9L A;  2HU5 A;  3IIW A;  4TZ4 A;  4GM9 A;  5TEE A;  3I7P A;  3EQ7 A;  4X61 B;  4BH6 A;  4FA5 D;  5CXC A;  4D0K A;  4WJK A;  5B4W A;  2P9P C;  2W18 A;  4IMM A;  2JKX A;  4WK0 A;  2P9N C;  3N0E A;  1XKS A;  3UVL A;  4U7A A;  1GP2 B;  2OIZ A;  1YR2 A;  3JAM g;  4O2W A;  3EI3 B;  4O45 A;  3I8C A;  1U8C A;  4J8G A;  5EML B;  3RN1 D;  4L9O A;  4GZ8 A;  3I7K A;  3DDU A;  3SXT D;  2AGL A;  1N6D A;  1JOF A;  3VH0 A;  2YB8 B;  4JSP C;  5GXI A;  2TRC B;  4MMZ A;  5FQD A;  3UVM A;  2P9S C;  4R7A B;  5EMJ B;  4ERY A;  2H13 A;  1VYH C;  4NBM A;  3J80 g;  4AEZ A;  3JB9 L;  4PSX B;  1VZ2 A;  2EIB A;  3BG1 A;  4Z7N A;  4L1Q D;  3FRX A;  4MK0 B;  3IJC A;  3NID A;  2P9U C;  2H3X A;  4OZU A;  3E0C A;  5H1M A;  3JRO A;  1H2Z A;  2MTA H;  5C9Z B;  3CIK B;  4FB1 D;  4CY5 A;  4E54 B;  3I7N A;  4OWR A;  2PBI B;  3MXX A;  4Y5R D;  4FWW A;  3V4V A;  3K26 A;  2XE4 A;  5C86 A;  4HDJ A;  4LG8 A;  3T3M A;  4NSX A;  4J8B A;  4K3J B;  3J81 g;  5M5U A;  4RE5 A;  5CXC B;  1MG3 A;  2AGW A;  3EG6 A;  3C99 A;  3GFC A;  4QT8 A;  3IUR A;  3SBR A;  1A12 A;  4JT6 C;  5I5M A;  5H14 A;  5IJ8 E;  2EIE A;  5C2V B;  4Z7Q A;  2QXV A;  3O4H A;  4CI2 A;  1SHY B;  3SHF A;  4G1M A;  4FA9 D;  4J87 A;  4BCC A;  4RE6 A;  4DNV A;  4LGN A;  4EWR A;  3OF7 A;  2BCJ B;  1BPO A;  4ESG A;  1UOP A;  3EI3 A;  2IWK A;  2VDQ A;  1UTC A;  5FKR A;  3GRE A;  4PNK B;  3MMY A;  3V7D B;  3B7F A;  4GGD A;  4FAV D;  4L1M A;  3DWL C;  3IUQ A;  3MKS B;  3P4F A;  4O1Q D;  5IJ7 E;  4XYI A;  2B4E A;  4N14 A;  1K3I A;  4A0B A;  4MMX A;  1OLZ A;  3MVD K;  4E5Z A;  4BCD A;  5AJA A;  2CO0 A;  3MUO A;  2CO0 C;  3SBQ A;  2Z2O A;  2J57 G;  4NEN A;  3SBP A;  4AN1 A;  3CFS B;  4MMY A;  5FFO A;  3N0D A;  2AQ5 A;  4H5I A;  4FAN D;  1JMZ B;  2H9P A;  2PM6 B;  1U4C A;  3SN6 B;  4IRZ A;  2VZ3 A;  3C9C A;  5IT9 g;  3IUN A;  3MZL A;  3JZG A;  5JWZ A;  2P9I C;  1O6G A;  4A2M A;  3CFV A;  1I2M B;  4JHP C;  5EMK B;  1GOH A;  2VC2 A;  2XL2 A;  5E6R A;  3I89 A;  4KFM B;  1JTD B;  5EAR A;  5HE2 B;  4WK2 A;  3SVW D;  3AL8 B;  4GQ1 A;  5FKQ A;  3C5M A;  5TDH B;  1K8K C;  3I8E A;  3QHY B;  4J78 A;  3L4O D;  4G55 A;  2H6Q A;  1NEX B;  2XL3 A;  2HES X;  5K19 A;  3W15 A;  4AOW A;  2HKM A;  5HQG A;  2YNP A;  2QC5 A;  5CXB A;  2G99 A;  4J73 A;  1GOG A;  3VI3 A;  5HYN B;  5SXM A;  4ERQ A;  1QFS A;  3UVN A;  2IUV A;  2J56 H;  4CZX A;  2O9K A;  4O3T B;  3SMR A;  3NVN A;  4GMB A;  4A0B B;  4E5Z B;  2HJ4 A;  1TYQ C;  4LG9 A;  4QL1 A;  4UM9 A;  3JZN A;  4BL0 A;  4XEI C;  2XU7 A;  5IC7 A;  2GC7 A;  4DNW A;  3C75 H;  3OKY A;  3VA6 A;  2OVP B;  2CE9 A;  1GG2 B;  2AGY A;  1U2V C;  3ZE2 A;  3NVX A;  2I0S A;  3UVO A;  2HKR A;  3EMH A;  5EM2 A;  4ZOZ A;  4CI3 A;  2VDM A;  3PSL A;  3RLM D;  3RFG A;  4X63 B;  2H6N A;  2H9N A;  3PE7 A;  2XDW A;  3MZK A;  3EWE A;  4A0A B;  3QI0 A;  3I2N A;  4J77 A;  3UVK A;  5A2Q g;  1R5M A;  2YMU A;  4L3G D;  4GGA A;  3VI4 A;  4CZY A;  4GQ2 P;  4J81 A;  5FFG A;  4Y7R A;  2OVR B;  5C2W B;  3PVU B;  5FA5 B;  3AL8 A;  2QZP A;  2EID A;  2H14 A;  1P22 A;  5CXB B;  3AH8 B;  3PXT D;  5EAL A;  1UOQ A;  2CN2 A;  3JZH A;  5I5J A;  3EU7 A;  1T2X A;  4AMZ A;  5AFU 3;  4GGC A;  3K71 A;  4PBZ A;  1GXR A;  4CZV A;  4GQB B;  2AGZ A;  5H17 A;  4GM3 A;  4AN0 A;  2I0R A;  5M5V A;  3FM0 A;  2CE8 A;  1TYE A;  3OKY B;  4X3E A;  3IUL A;  3PXW D;  4Z7O A;  3V9F A;  3EQ9 A;  2OK4 A;  4PSW B;  3BWS A;  4JHN A;  5CYK A;  3DM0 A;  3ZE0 A;  5EM2 B;  2Z2P A;  2EBS A;  4D6V A;  2Z2N A;  2YNN A;  4ZOV A;  2OK6 A;  3IUJ A;  1E8N A;  5C92 A;  3IJ0 A;  2OVQ B;  5GMK n;  3FGB A;  1O6F A;  1NR0 A;  4PBY A;  5M5R A;  5THA A;  3ZDX A;  2H9L A;  2IWF A;  3RRM C;  2BBK H;  1XHM A;  1UOO A;  3EI1 A;  4CY2 A;  4AX4 A;  4BCB A;  4D9S A;  3GD1 I;  5M5S A;  3EI2 A;  1N6F A;  2H6K A;  4FHL A;  4A0A A;  2H47 A;  3UR4 A;  1H2W A;  3ZDY A;  3K72 A;  3EI4 A;  3OTT A;  2B5M A;  4CC9 A;  2Q7Q A;  4U1E I;  4A11 A;  1RI6 A;  1A0R B;  2J55 H;  4UI9 R;  2I3S A;  5FKT A;  1L0Q A;  4JXM A;  3RSE C;  2GC4 A;  3F3P A;  2CN3 A;  5HE0 B;  4NAA A;  1JV2 A;  5FXY A;  2WQ8 A;  1L5G A;  4J0W A;  3DXM C;  5EAP A;  5KDO B;  2PM9 A;  4PC0 A;  5M5T A;  1VZ3 A;  4I79 A;  3PVW B;  4X60 B;  1E5T A;  4JD2 C;  1JJU B;  1PEV A;  2G9A A;  3O4I A;  4JSV C;  3V4P A;  3JPX A;  1E8M A;  4QRJ A;  4L3H D;  4BP9 A;  3IUM A;  4ZN4 A;  1PI6 A;  4Z8L A;  4J82 A;  3ZE1 A;  4A08 A;  1Q47 A;  3ORV D;  3FCS A;  3F3G A;  5CYK B;  3MKQ A;  4DNU A;  3I7L A;  1SQ9 A;  4WK4 A;  1XIP A;  2HJB A;  3K27 A;  4G1E A;  3ZWL B;  3IJE A;  3FCU A;  3GC3 B;  3OL2 A;  2HYE A;  1MDA H;  2IUQ A;  2AH0 A;  5IGO A;  4A7J A;  4ERZ A;  3K6S A;  3I7H A;  4CI8 A;  3KRX B;  1FWX A;  4J79 A;  4BUJ C;  1GOF A;  4CI1 A;  4K3I D;  3EI1 B;  4CY3 A;  2P9L C;  5AMS A;  3IJ1 A;  3KRW B;  2AGX A;  4ES0 A;  3EI2 B;  5FKS A;  5K1C C;  3ULE C;  4A09 B;  2VDO A;  3EI4 B;  5TF2 A;  2UZX B;  5FLX g;  3EQ8 A;  3ZDZ A;  1GOT B;  1VE6 A;  2P9K C;  2IUP A;  3I7O A;  4O3U B;  2H9M A;  4A11 B;  4CY1 A;  3SJL D;  2VDR A;  1PGU A;  4AMY A;  2EIC A; 
#chains in the Genus database with same CATH homology
 3OW8 A;  4O9D A;  3VGZ A;  4FA4 D;  1S4U X;  1N6E A;  4J84 A;  1QNI A;  2PM7 B;  3OKT A;  3PSC B;  2XYI A;  3U4Y A;  3RN0 D;  2CNX A;  3F3F A;  4J86 A;  2PM9 B;  4H5J A;  4FA1 D;  2HXC A;  3RFH A;  2I3T A;  3DSM A;  2B5L A;  4JSN C;  2YBA A;  5I5I A;  2I0T A;  4ZOX A;  3DXK C;  1SQJ A;  1ERJ A;  3UKR C;  5HE1 B;  3UKU C;  4A08 B;  4ZOY A;  2H68 A;  1B9X A;  5EAM A;  3SCY A;  4IA9 A;  1MG2 A;  1B9Y A;  4PXW A;  2IUR A;  3AFC A;  5IGQ A;  3SWS D;  4YVD A;  2B5N A;  3IIY A;  3OL2 B;  2YNO A;  4JSX C;  3SFZ A;  1JMX B;  1PBY B;  3JRP A;  1TBG A;  5TEF A;  3HFQ A;  2UZY B;  1K32 A;  2AH1 A;  3NVQ A;  4A2L A;  4G56 B;  3RMZ D;  5GXH A;  3A0F A;  3PXS D;  5HE3 B;  3AL9 A;  2GNQ A;  1OMW B;  5EMM B;  3ODT A;  3BG0 A;  4XYH A;  4A09 A;  4JT5 C;  4QQE A;  3SLE D;  3V5W B;  4J0X A;  1YFQ A;  3IKO A;  2IAA A;  5GSA A;  4GM8 A;  2OJY A;  3L4M D;  4E54 A;  3OKW A;  4TZ4 A;  3IIW A;  4GM9 A;  5TEE A;  3I7P A;  4X61 B;  4BH6 A;  4FA5 D;  5CXC A;  4D0K A;  5B4W A;  2P9P C;  2W18 A;  4IMM A;  2P9N C;  3N0E A;  1XKS A;  3UVL A;  4U7A A;  1GP2 B;  2OIZ A;  3JAM g;  3EI3 B;  4O45 A;  3I8C A;  4J8G A;  5EML B;  3RN1 D;  4L9O A;  4GZ8 A;  3I7K A;  3SXT D;  2AGL A;  1N6D A;  1JOF A;  3VH0 A;  2YB8 B;  4JSP C;  5GXI A;  2TRC B;  3UVM A;  5FQD A;  4ERY A;  2P9S C;  4R7A B;  5EMJ B;  2H13 A;  1VYH C;  3J80 g;  4AEZ A;  3JB9 L;  4PSX B;  3BG1 A;  4L1Q D;  3FRX A;  4MK0 B;  3IJC A;  2P9U C;  2H3X A;  4OZU A;  3E0C A;  5H1M A;  3JRO A;  2MTA H;  5C9Z B;  3CIK B;  4FB1 D;  4CY5 A;  4E54 B;  3I7N A;  4OWR A;  2PBI B;  3MXX A;  4Y5R D;  4FWW A;  3K26 A;  4HDJ A;  4LG8 A;  4NSX A;  4J8B A;  4K3J B;  3J81 g;  5CXC B;  1MG3 A;  2AGW A;  3EG6 A;  3C99 A;  3GFC A;  4QT8 A;  3SBR A;  4JT6 C;  5I5M A;  5H14 A;  5IJ8 E;  5C2V B;  2QXV A;  4CI2 A;  1SHY B;  3SHF A;  4FA9 D;  4J87 A;  4LGN A;  4EWR A;  2BCJ B;  4ESG A;  3EI3 A;  2IWK A;  5FKR A;  3GRE A;  4PNK B;  3MMY A;  3V7D B;  3B7F A;  4GGD A;  4FAV D;  3DWL C;  3MKS B;  3P4F A;  4O1Q D;  5IJ7 E;  4XYI A;  2B4E A;  4N14 A;  4A0B A;  1OLZ A;  4E5Z A;  5AJA A;  2CO0 A;  2CO0 C;  3SBQ A;  2Z2O A;  2J57 G;  3SBP A;  3CFS B;  3N0D A;  2AQ5 A;  4H5I A;  4FAN D;  1JMZ B;  2H9P A;  2PM6 B;  1U4C A;  3SN6 B;  3C9C A;  5IT9 g;  3MZL A;  3JZG A;  2P9I C;  4A2M A;  3CFV A;  5EMK B;  2XL2 A;  3I89 A;  4KFM B;  5EAR A;  5HE2 B;  3SVW D;  3AL8 B;  4GQ1 A;  5FKQ A;  3C5M A;  5TDH B;  1K8K C;  3I8E A;  4J78 A;  3L4O D;  2H6Q A;  1NEX B;  2XL3 A;  2HES X;  5K19 A;  3W15 A;  4AOW A;  2HKM A;  5HQG A;  2YNP A;  2QC5 A;  5CXB A;  2G99 A;  4J73 A;  5HYN B;  5SXM A;  4ERQ A;  3UVN A;  2IUV A;  2J56 H;  4CZX A;  2O9K A;  4O3T B;  3SMR A;  3NVN A;  4GMB A;  4A0B B;  4E5Z B;  2HJ4 A;  1TYQ C;  4LG9 A;  4QL1 A;  3JZN A;  4BL0 A;  4XEI C;  2XU7 A;  5IC7 A;  2GC7 A;  3C75 H;  3OKY A;  3VA6 A;  2OVP B;  2CE9 A;  1GG2 B;  2AGY A;  1U2V C;  3NVX A;  2I0S A;  3UVO A;  2HKR A;  3EMH A;  5EM2 A;  4ZOZ A;  4CI3 A;  3PSL A;  3RLM D;  3RFG A;  4X63 B;  2H6N A;  2H9N A;  3PE7 A;  3MZK A;  3EWE A;  4A0A B;  3I2N A;  4J77 A;  3UVK A;  5A2Q g;  1R5M A;  2YMU A;  4L3G D;  4GGA A;  4CZY A;  4GQ2 P;  4J81 A;  4Y7R A;  2OVR B;  5C2W B;  3PVU B;  5FA5 B;  3AL8 A;  2H14 A;  1P22 A;  5CXB B;  3AH8 B;  3PXT D;  5EAL A;  2CN2 A;  3JZH A;  5I5J A;  3EU7 A;  5AFU 3;  4GGC A;  4PBZ A;  1GXR A;  4CZV A;  4GQB B;  2AGZ A;  5H17 A;  4GM3 A;  2I0R A;  3FM0 A;  2CE8 A;  3OKY B;  4X3E A;  3PXW D;  3V9F A;  2OK4 A;  4PSW B;  3BWS A;  5CYK A;  3DM0 A;  5EM2 B;  2Z2P A;  2EBS A;  4D6V A;  2Z2N A;  2YNN A;  4ZOV A;  2OK6 A;  3IJ0 A;  2OVQ B;  5GMK n;  3FGB A;  1NR0 A;  4PBY A;  5THA A;  2H9L A;  2IWF A;  3RRM C;  2BBK H;  1XHM A;  3EI1 A;  4CY2 A;  3EI2 A;  1N6F A;  2H6K A;  4FHL A;  4A0A A;  2H47 A;  3UR4 A;  3EI4 A;  3OTT A;  2B5M A;  4CC9 A;  2Q7Q A;  4U1E I;  4A11 A;  1RI6 A;  1A0R B;  2J55 H;  4UI9 R;  2I3S A;  5FKT A;  1L0Q A;  4JXM A;  3RSE C;  2GC4 A;  3F3P A;  2CN3 A;  5HE0 B;  5FXY A;  4J0W A;  3DXM C;  5EAP A;  5KDO B;  2PM9 A;  4PC0 A;  4I79 A;  3PVW B;  4X60 B;  4JD2 C;  1JJU B;  1PEV A;  2G9A A;  4JSV C;  3JPX A;  4QRJ A;  4L3H D;  4ZN4 A;  1PI6 A;  4Z8L A;  4J82 A;  4A08 A;  1Q47 A;  3ORV D;  3F3G A;  5CYK B;  3MKQ A;  3I7L A;  1SQ9 A;  1XIP A;  2HJB A;  3K27 A;  3ZWL B;  3OL2 A;  2HYE A;  1MDA H;  2IUQ A;  2AH0 A;  5IGO A;  4A7J A;  4ERZ A;  3I7H A;  4CI8 A;  3KRX B;  1FWX A;  4J79 A;  4BUJ C;  4CI1 A;  4K3I D;  3EI1 B;  4CY3 A;  2P9L C;  5AMS A;  3IJ1 A;  3KRW B;  2AGX A;  4ES0 A;  3EI2 B;  5FKS A;  5K1C C;  3ULE C;  4A09 B;  3EI4 B;  5FLX g;  5TF2 A;  2UZX B;  1GOT B;  2P9K C;  3I7O A;  2IUP A;  4O3U B;  4A11 B;  2H9M A;  5JWZ A;  4CY1 A;  3SJL D;  1PGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...