3JB9L

Cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
299
structure length
293
Chain Sequence
PNLQMFGHTAEVLVARFDPSGSYFASGGMDRQILLWNVFDVKNYGVLNGCKGAITDLQWSRDSRVVYCSSSDTHLMSWDAVSGQKIRKHKGHAGVVNALDVLKVSELLTSVSDDCTMKVWDSRSKDCIKTIEEKYPLTAVAIAQQGTQVFIGGIDGAIKIWDLRNNHCSHVLKGHKDIITSLAISKDGSSLLSNSMDNTVRIFDVKAQRQLQIFEGAIHGQEHNLLGVAWSRNSRFVGAGSSDKNVYVWSATGDLRYVLPGHEGSVNHVDFHPHQDIILSCSSDRTIFLGELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor spp42
publication title Structure of a yeast spliceosome at 3.6-angstrom resolution
pubmed doi rcsb
molecule tags Rna binding protein/rna
total genus 46
structure length 293
sequence length 299
ec nomenclature
pdb deposition date 2015-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3jb9L00
4LG8A 2CN3A 3IJ1A 3OL2B 4E5ZA 5GSAA 4Y7RA 3W15A 3RFHA 2H6QA 5I5JA 5GMKn 3EI2A 4JSNC 2B4EA 3GFCA 3AFCA 3C5MA 4PC0A 2IUPA 2O9KA 2Z2PA 2H9LA 4J0WA 1MDAH 3ODTA 4U1EI 4J79A 3RSEC 2OK6A 5AFU3 2XL2A 5K1CC 3I7PA 5FKQA 3I2NA 3AL9A 1MG2A 2HJBA 2H68A 3EMHA 3C99A 1TYQC 2HKRA 3PSLA 4O1QD 1PBYB 4N14A 4CZVA 2TRCB 4A11B 4GQ1A 5H1MA 4J8BA 2OVRB 4J77A 3J81g 3ULEC 4GZ8A 1SQ9A 5H17A 2W18A 3EI1B 4CY1A 3SMRA 3HFQA 2P9KC 4QQEA 3DSMA 2HXCA 3UVNA 2CE9A 4E5ZB 4Y5RD 3EI2B 3OKYA 3JB9L 3SWSD 5CXBA 2H9MA 4I79A 2BCJB 4L3GD 2H13A 4CC9A 1XIPA 5THAA 3JPXA 3C9CA 5FQDA 1S4UX 3MXXA 5EMMB 2IUQA 3MZKA 4A2LA 4L1QD 3RLMD 1SHYB 3SHFA 4ZOVA 1Q47A 3DXMC 3UVOA 2P9NC 3OKTA 4CY2A 1P22A 4ZOZA 4ERYA 4ERZA 4E54A 2G99A 3DXKC 3FRXA 3FM0A 2AGXA 4R7AB 2IAAA 4FB1D 2IUVA 3KRXB 4L9OA 4JT5C 3J80g 3I7NA 3K27A 2QXVA 2AGZA 4GGDA 4GQ2P 5HE3B 1GG2B 3PE7A 4A0AA 3P4FA 1N6DA 3OKYB 5CXBB 4A11A 5SXMA 3I7HA 3F3FA 3NVXA 4JSPC 2XL3A 2P9LC 4FA5D 4CY3A 1U2VC 4K3ID 3F3PA 2CE8A 2I3SA 4CI3A 2OVPB 4X3EA 2I0SA 2Z2OA 2H3XA 4UI9R 3V7DB 4XEIC 2B5LA 2YBAA 2UZXB 2BBKH 4ESGA 5HE1B 4ERQA 2CNXA 3PXTD 2H6NA 1GXRA 4D0KA 2H6KA 2J55H 2IURA 4KFMB 5TF2A 1JOFA 4E54B 5GXIA 3A0FA 5EAMA 5FKTA 2YB8B 3MZLA 4GM9A 5IJ8E 4OZUA 4LG9A 5I5IA 3UKRC 4GQBB 4O3UB 3PXSD 4OWRA 3IJ0A 4GMBA 4JXMA 4CZYA 3SBRA 1GP2B 2P9IC 1VYHC 2PBIB 2QC5A 5C2VB 2YNNA 1TBGA 3UVKA 4O3TB 1OMWB 3SXTD 3JAMg 5IC7A 5IT9g 4A0AB 4U7AA 2AGWA 3OKWA 5GXHA 4YVDA 2XU7A 3SBPA 2J57G 3PVUB 5IJ7E 3C75H 3JRPA 5FKSA 2HKMA 2CO0A 4GGAA 4H5JA 3SJLD 1ERJA 2YMUA 4JT6C 3DWLC 4J86A 5AMSA 1B9XA 3I8EA 2PM9A 4FHLA 4CY5A 2Q7QA 2AH0A 5EMKB 5FA5B 4FAVD 2EBSA 4ES0A 4J87A 4J8GA 2HYEA 3BG1A 4NSXA 3N0EA 5C2WB 4J82A 2PM7B 2HJ4A 4A2MA 3JROA 1XKSA 5EM2A 2B5NA 4X63B 4A08A 5CYKA 4J0XA 2PM6B 3RN0D 3B7FA 5TEFA 1U4CA 2YNPA 4QL1A 3V5WB 2H9PA 2I3TA 3CIKB 2H14A 1B9YA 1PI6A 5EARA 2AQ5A 4HDJA 3FGBA 3PVWB 3L4OD 4D6VA 5FKRA 1A0RB 1XHMA 1K8KC 4ZOYA 3I8CA 4GM8A 3E0CA 4JD2C 3NVQA 3RFGA 4FA4D 3OW8A 4XYHA 4XYIA 2PM9B 4PSXB 4J78A 3VGZA 3RN1D 4BH6A 3N0DA 1MG3A 2H47A 3VA6A 5EMLB 2OIZA 2CN2A 1QNIA 5TEEA 5FXYA 4FA1D 4A0BA 4CI8A 2MTAH 1JMZB 4FWWA 5EMJB 1SQJA 3JZNA 4MK0B 5EM2B 1JJUB 3MKSB 4BL0A 4CI2A 4A08B 5CYKB 5HYNB 3MMYA 5CXCA 2P9PC 4AEZA 3VH0A 2OVQB 1JMXB 3I89A 1N6EA 5IGOA 5TDHB 5EAPA 2IWFA 4X60B 5I5MA 5A2Qg 2G9AA 4ZOXA 3DM0A 4FA9D 2GC7A 4AOWA 3SLED 5EALA 1N6FA 4O9DA 3BG0A 4Z8LA 4A09A 3AH8B 3JZGA 3PXWD 4LGNA 5KDOB 5HQGA 3EI3A 2OJYA 3IIWA 2I0RA 5B4WA 4A0BB 3KRWB 3ORVD 5HE0B 3F3GA 3IIYA 2YNOA 3NVNA 4BUJC 3EWEA 2AGLA 3UVLA 3CFSB 4EWRA 2CO0C 4QRJA 5CXCB 1GOTB 3SFZA 2GC4A 3PSCB 1RI6A 4JSVC 3U4YA 2B5MA 1R5MA 3GREA 4TZ4A 5AJAA 4J81A 2OK4A 3UKUC 1FWXA 5FLXg 5HE2B 4K3JB 3UVMA 3AL8A 5K19A 4G56B 2HESX 4PNKB 4IA9A 3EG6A 2AGYA 3L4MD 1OLZA 4A7JA 1NR0A 4CI1A 3SCYA 4L3HD 4A09B 5C9ZB 3RMZD 3K26A 3EI3B 3EI4A 1PEVA 4JSXC 3V9FA 3ZWLB 3RRMC 2GNQA 5H14A 3SN6B 4H5IA 3OL2A 4J73A 2P9UC 2Z2NA 1L0QA 1NEXB 4X61B 4GM3A 4CZXA 2I0TA 3JZHA 4IMMA 3OTTA 1K32A 2J56H 5JWZA 4PSWB 3I7LA 3IKOA 3CFVA 2AH1A 2H9NA 1PGUA 3EU7A 3I7OA 2UZYB 4J84A 5IGQA 4PBZA 3MKQA 2IWKA 4GGCA 3AL8B 3SBQA 4QT8A 3BWSA 3I7KA 3SVWD 2P9SC 4FAND 1YFQA 3IJCA 4PXWA 4O45A 4ZN4A 3EI1A 3UR4A 2XYIA 3EI4B 4PBYA
chains in the Genus database with same CATH superfamily
5FFOA 1H2YA 3IULA 4LG8A 2CN3A 3IJ1A 3OL2B 4E5ZA 5GSAA 5M5VA 4Y7RA 3W15A 3RFHA 2H6QA 3IJEA 5I5JA 5GMKn 3EI2A 4JSNC 2B4EA 3GFCA 3AFCA 3C5MA 3EQ7A 4PC0A 4BCDA 2IUPA 2O9KA 2Z2PA 2H9LA 4J0WA 1MDAH 3ODTA 4U1EI 4J79A 3RSEC 2OK6A 2VC2A 5AFU3 2XL2A 4NC4A 5K1CC 2VDPA 3I7PA 3I2NA 5FKQA 3AL9A 1MG2A 2HJBA 2JKXA 2H68A 3EMHA 3NIDA 3C99A 1TYQC 2HKRA 3PSLA 1GOGA 4O1QD 1PBYB 2VDLA 4N14A 4CZVA 2EIEA 4WK4A 2TRCB 4A11B 4GQ1A 5H1MA 4J8BA 2OVRB 4J77A 3J81g 3ULEC 3IUQA 4GZ8A 1SQ9A 3V4PA 5H17A 2W18A 4MMZA 3EI1B 4CY1A 2VDMA 3SMRA 1H2XA 3HFQA 2P9KC 4QQEA 4O02A 3DSMA 2HXCA 4NENA 1A12A 3UVNA 4BP8A 2CE9A 4E5ZB 3O4HA 4Y5RD 3EI2B 3OKYA 3JB9L 3SWSD 5CXBA 4Z7NA 2H9MA 2VDNA 4I79A 2BCJB 4RE6A 5HDBA 1UOPA 1GOHA 4L3GD 2H13A 4CC9A 3MVDK 1XIPA 5THAA 3JPXA 1QFMA 3C9CA 1VZ3A 5FQDA 5M5TA 1S4UX 3EQ9A 1C9LA 3MXXA 5EMMB 2IUQA 3MZKA 4A2LA 4BP9A 4L1QD 3RLMD 1SHYB 3IUJA 3SHFA 4D9SA 4ZOVA 1Q47A 3DXMC 3UVOA 2P9NC 3OKTA 4CY2A 1P22A 4ZOZA 4ERYA 4ERZA 4E54A 3V4VA 2G99A 3DXKC 3FRXA 1E8NA 3FM0A 2AGXA 4R7AB 2IAAA 4FB1D 2IUVA 3KRXB 4JT5C 4L9OA 3J80g 3I7NA 1T2XA 3K27A 2QXVA 4AN0A 2AGZA 4GGDA 4GQ2P 5HE3B 1GG2B 3PE7A 4A0AA 3P4FA 1N6DA 2EIBA 3NIFA 3OKYB 5CXBB 4A11A 5SXMA 3I7HA 3F3FA 4G55A 3NVXA 4JSPC 2XL3A 2P9LC 4FA5D 4CY3A 1U2VC 2HU8A 4JHPC 4K3ID 3K72A 4UM8A 3F3PA 2CE8A 2I3SA 4CI3A 2OVPB 4X3EA 2I0SA 2Z2OA 2H3XA 4UI9R 3V7DB 4AN1A 4XEIC 2B5LA 2YBAA 2UZXB 2BBKH 3ZDXA 4ESGA 5HE1B 4ERQA 2CNXA 3PXTD 2H6NA 1GXRA 4D0KA 2H6KA 2J55H 2IURA 4KFMB 5TF2A 1JOFA 4E54B 4BCBA 5GXIA 3A0FA 5EAMA 5FKTA 2YB8B 3MZLA 4GM9A 5IJ8E 4OZUA 4LG9A 5I5IA 3UKRC 4GQBB 4O3UB 4Z7OA 3IURA 3PXSD 4OWRA 3IJ0A 4GMBA 4JXMA 2VZ1A 4CZYA 3SBRA 1GP2B 2P9IC 3ZE1A 1VYHC 2PBIB 2QC5A 5C2VB 3K71A 2YNNA 1TBGA 3UVKA 4O3TB 1OMWB 3SXTD 3JAMg 5IC7A 5IT9g 4A0AB 4U7AA 2AGWA 3OKWA 5GXHA 4YVDA 5M5UA 2XU7A 3SBPA 2J57G 2HU5A 3PVUB 5IJ7E 3C75H 3JRPA 1I2MB 5FKSA 2HKMA 2CO0A 4GGAA 4H5JA 3SJLD 1ERJA 2YMUA 4JT6C 3DWLC 1JV2A 4J86A 4L1MA 5AMSA 1B9XA 3I8EA 2PM9A 3VI4A 4FHLA 4CY5A 2Q7QA 2AH0A 5EMKB 5E6RA 3T3MA 5FA5B 5E6UA 4FAVD 2EBSA 4ES0A 4J87A 3K6SA 4J8GA 2HYEA 3BG1A 4AX4A 4NSXA 3N0EA 3IUNA 5C2WB 3MUNA 4J82A 1E8MA 2HU7A 3IVMA 1U8CA 3MUOA 2PM7B 2HJ4A 4A2MA 1GOFA 1XKSA 3FCUA 3JROA 5EM2A 2B5NA 4X63B 4A08A 5CYKA 4J0XA 2PM6B 3RN0D 3B7FA 5TEFA 1U4CA 2YNPA 4QL1A 2VZ3A 3V5WB 2H9PA 2I3TA 4AMYA 3CIKB 1H2WA 3T3PA 2H14A 1B9YA 5C92A 1PI6A 5EARA 2AQ5A 4HDJA 3FGBA 3PVWB 3L4OD 4D6VA 5FKRA 1A0RB 2XDWA 1XHMA 1K8KC 4ZOYA 3I8CA 2XZGA 3O4IA 4GM8A 5M61A 3E0CA 4JD2C 3NVQA 3RFGA 4FA4D 3OW8A 4XYHA 4XYIA 1O6GA 2PM9B 4PSXB 4J78A 3KCIA 3DDUA 1YR2A 2VDQA 3VGZA 3RN1D 4BH6A 4WK2A 2EIDA 3N0DA 1MG3A 2H47A 3VA6A 5EMLB 2OIZA 1QNIA 2CN2A 1QFSA 5TEEA 5FXYA 4FA1D 1JTDB 4CI8A 3QI0A 4A0BA 4O2WA 2MTAH 1JMZB 4FWWA 4RE5A 5EMJB 1SQJA 3JZNA 4MK0B 5EM2B 1JJUB 3MKSB 4DNUA 4BL0A 3OF7A 4CI2A 4A08B 2VDRA 5CYKB 5HYNB 3MMYA 5CXCA 2P9PC 4AEZA 3VH0A 2OVQB 1JMXB 4NBMA 4WJKA 3I89A 1N6EA 2WQ8A 5IGOA 4G1MA 5M5RA 5TDHB 5C86A 5EAPA 5E6SA 2IWFA 4X60B 5I5MA 5A2Qg 2G9AA 4ZOXA 3DM0A 1VZ2A 4FA9D 2GC7A 3NIGA 4AOWA 3IUMA 3SLED 5EALA 4DNWA 1N6FA 4O9DA 4G1EA 2QZPA 3BG0A 1UOOA 4Z8LA 4AMZA 4WK0A 4A09A 3ZE2A 2EICA 3AH8B 3JZGA 3PXWD 4LGNA 5KDOB 4IRZA 5HQGA 3EI3A 1C9IA 2OJYA 2BKLA 3IIWA 1BPOA 3ZE0A 2I0RA 5B4WA 4A0BB 3KRWB 3ORVD 5HE0B 3F3GA 3IIYA 2YNOA 3NVNA 4BUJC 3EWEA 2AGLA 3UVLA 3CFSB 4EWRA 2CO0C 4QRJA 5CXCB 1GOTB 3SFZA 1K3IA 2GC4A 3PSCB 1RI6A 4JSVC 3U4YA 3ZDYA 2B5MA 1TYEA 3ZDZA 1VE6A 1R5MA 3GREA 4TZ4A 5AJAA 4J81A 2OK4A 3QHYB 3UKUC 4DNVA 1FWXA 5FLXg 5HE2B 4K3JB 3UVMA 2QR5A 3AL8A 2XE4A 5K19A 4G56B 2HESX 4PNKB 4IA9A 3EG6A 2AGYA 3L4MD 1OLZA 4A7JA 1NR0A 4CI1A 3SCYA 3VI3A 2VDOA 4L3HD 4A09B 5C9ZB 3RMZD 3K26A 3EI3B 3EI4A 5FFGA 5M5SA 1PEVA 4JSXC 3V9FA 3ZWLB 3RRMC 2GNQA 5H14A 1E5TA 1L5GA 3SN6B 4H5IA 3OL2A 4J73A 2P9UC 2Z2NA 1L0QA 1NEXB 4X61B 1VE7A 4GM3A 4CZXA 2I0TA 3JZHA 4IMMA 3OTTA 2VDKA 1K32A 2J56H 5JWZA 4PSWB 3O4GA 1O6FA 3I7LA 3IKOA 3CFVA 1UTCA 2AH1A 1UOQA 4BCCA 2H9NA 1PGUA 3EU7A 3GC3B 3I7OA 2UZYB 4J84A 4Z7QA 5IGQA 4PBZA 3GD1I 3MKQA 2IWKA 4GGCA 4NAAA 3AL8B 3EQ8A 4JHNA 3O4JA 3SBQA 4QT8A 3BWSA 3I7KA 3SVWD 4MMXA 2P9SC 4FAND 4MMYA 1YFQA 3IJCA 4UM9A 3FCSA 4PXWA 4O45A 4ZN4A 3EI1A 3UR4A 2XYIA 1H2ZA 3EI4B 4QAMA 4PBYA 1M1XA
chains in the Genus database with same CATH topology
4LG8A 2CN3A 3IJ1A 3OL2B 4E5ZA 5GSAA 4Y7RA 3W15A 3RFHA 2H6QA 5I5JA 5GMKn 3EI2A 4JSNC 2B4EA 3GFCA 3AFCA 3C5MA 4PC0A 2IUPA 2O9KA 2Z2PA 2H9LA 4J0WA 1MDAH 3ODTA 4U1EI 4J79A 3RSEC 2OK6A 5AFU3 2XL2A 5K1CC 3I7PA 5FKQA 3I2NA 3AL9A 1MG2A 2HJBA 2H68A 3EMHA 3C99A 1TYQC 2HKRA 3PSLA 4O1QD 1PBYB 4N14A 4CZVA 2TRCB 4A11B 4GQ1A 5H1MA 4J8BA 2OVRB 4J77A 3J81g 3ULEC 4GZ8A 1SQ9A 5H17A 2W18A 3EI1B 4CY1A 3SMRA 3HFQA 2P9KC 4QQEA 3DSMA 2HXCA 3UVNA 2CE9A 4E5ZB 4Y5RD 3EI2B 3OKYA 3JB9L 3SWSD 5CXBA 2H9MA 4I79A 2BCJB 4L3GD 2H13A 4CC9A 1XIPA 5THAA 3JPXA 3C9CA 5FQDA 1S4UX 3MXXA 5EMMB 2IUQA 3MZKA 4A2LA 4L1QD 3RLMD 1SHYB 3SHFA 4ZOVA 1Q47A 3DXMC 3UVOA 2P9NC 3OKTA 4CY2A 1P22A 4ZOZA 4ERYA 4ERZA 4E54A 2G99A 3DXKC 3FRXA 3FM0A 2AGXA 4R7AB 2IAAA 4FB1D 2IUVA 3KRXB 4L9OA 4JT5C 3J80g 3I7NA 3K27A 2QXVA 2AGZA 4GGDA 4GQ2P 5HE3B 1GG2B 3PE7A 4A0AA 3P4FA 1N6DA 3OKYB 5CXBB 4A11A 5SXMA 3I7HA 3F3FA 3NVXA 4JSPC 2XL3A 2P9LC 4FA5D 4CY3A 1U2VC 4K3ID 3F3PA 2CE8A 2I3SA 4CI3A 2OVPB 4X3EA 2I0SA 2Z2OA 2H3XA 4UI9R 3V7DB 4XEIC 2B5LA 2YBAA 2UZXB 2BBKH 4ESGA 5HE1B 4ERQA 2CNXA 3PXTD 2H6NA 1GXRA 4D0KA 2H6KA 2J55H 2IURA 4KFMB 5TF2A 1JOFA 4E54B 5GXIA 3A0FA 5EAMA 5FKTA 2YB8B 3MZLA 4GM9A 5IJ8E 4OZUA 4LG9A 5I5IA 3UKRC 4GQBB 4O3UB 3PXSD 4OWRA 3IJ0A 4GMBA 4JXMA 4CZYA 3SBRA 1GP2B 2P9IC 1VYHC 2PBIB 2QC5A 5C2VB 2YNNA 1TBGA 3UVKA 4O3TB 1OMWB 3SXTD 3JAMg 5IC7A 5IT9g 4A0AB 4U7AA 2AGWA 3OKWA 5GXHA 4YVDA 2XU7A 3SBPA 2J57G 3PVUB 5IJ7E 3C75H 3JRPA 5FKSA 2HKMA 2CO0A 4GGAA 4H5JA 3SJLD 1ERJA 2YMUA 4JT6C 3DWLC 4J86A 5AMSA 1B9XA 3I8EA 2PM9A 4FHLA 4CY5A 2Q7QA 2AH0A 5EMKB 5FA5B 4FAVD 2EBSA 4ES0A 4J87A 4J8GA 2HYEA 3BG1A 4NSXA 3N0EA 5C2WB 4J82A 2PM7B 2HJ4A 4A2MA 3JROA 1XKSA 5EM2A 2B5NA 4X63B 4A08A 5CYKA 4J0XA 2PM6B 3RN0D 3B7FA 5TEFA 1U4CA 2YNPA 4QL1A 3V5WB 2H9PA 2I3TA 3CIKB 2H14A 1B9YA 1PI6A 5EARA 2AQ5A 4HDJA 3FGBA 3PVWB 3L4OD 4D6VA 5FKRA 1A0RB 1XHMA 1K8KC 4ZOYA 3I8CA 4GM8A 3E0CA 4JD2C 3NVQA 3RFGA 4FA4D 3OW8A 4XYHA 4XYIA 2PM9B 4PSXB 4J78A 3VGZA 3RN1D 4BH6A 3N0DA 1MG3A 2H47A 3VA6A 5EMLB 2OIZA 2CN2A 1QNIA 5TEEA 5FXYA 4FA1D 4A0BA 4CI8A 2MTAH 1JMZB 4FWWA 5EMJB 1SQJA 3JZNA 4MK0B 5EM2B 1JJUB 3MKSB 4BL0A 4CI2A 4A08B 5CYKB 5HYNB 3MMYA 5CXCA 2P9PC 4AEZA 3VH0A 2OVQB 1JMXB 3I89A 1N6EA 5IGOA 5TDHB 5EAPA 2IWFA 4X60B 5I5MA 5A2Qg 2G9AA 4ZOXA 3DM0A 4FA9D 2GC7A 4AOWA 3SLED 5EALA 1N6FA 4O9DA 3BG0A 4Z8LA 4A09A 3AH8B 3JZGA 3PXWD 4LGNA 5KDOB 5HQGA 3EI3A 2OJYA 3IIWA 2I0RA 5B4WA 4A0BB 3KRWB 3ORVD 5HE0B 3F3GA 3IIYA 2YNOA 3NVNA 4BUJC 3EWEA 2AGLA 3UVLA 3CFSB 4EWRA 2CO0C 4QRJA 5CXCB 1GOTB 3SFZA 2GC4A 3PSCB 1RI6A 4JSVC 3U4YA 2B5MA 1R5MA 3GREA 4TZ4A 5AJAA 4J81A 2OK4A 3UKUC 1FWXA 5FLXg 5HE2B 4K3JB 3UVMA 3AL8A 5K19A 4G56B 2HESX 4PNKB 4IA9A 3EG6A 2AGYA 3L4MD 1OLZA 4A7JA 1NR0A 4CI1A 3SCYA 4L3HD 4A09B 5C9ZB 3RMZD 3K26A 3EI3B 3EI4A 1PEVA 4JSXC 3V9FA 3ZWLB 3RRMC 2GNQA 5H14A 3SN6B 4H5IA 3OL2A 4J73A 2P9UC 2Z2NA 1L0QA 1NEXB 4X61B 4GM3A 4CZXA 2I0TA 3JZHA 4IMMA 3OTTA 1K32A 2J56H 5JWZA 4PSWB 3I7LA 3IKOA 3CFVA 2AH1A 2H9NA 1PGUA 3EU7A 3I7OA 2UZYB 4J84A 5IGQA 4PBZA 3MKQA 2IWKA 4GGCA 3AL8B 3SBQA 4QT8A 3BWSA 3I7KA 3SVWD 2P9SC 4FAND 1YFQA 3IJCA 4PXWA 4O45A 4ZN4A 3EI1A 3UR4A 2XYIA 3EI4B 4PBYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LG8 A;  2CN3 A;  3IJ1 A;  3OL2 B;  4E5Z A;  5GSA A;  4Y7R A;  3W15 A;  3RFH A;  2H6Q A;  5I5J A;  5GMK n;  3EI2 A;  4JSN C;  2B4E A;  3GFC A;  3AFC A;  3C5M A;  4PC0 A;  2IUP A;  2O9K A;  2Z2P A;  2H9L A;  4J0W A;  1MDA H;  3ODT A;  4U1E I;  4J79 A;  3RSE C;  2OK6 A;  5AFU 3;  2XL2 A;  5K1C C;  3I7P A;  5FKQ A;  3I2N A;  3AL9 A;  1MG2 A;  2HJB A;  2H68 A;  3EMH A;  3C99 A;  1TYQ C;  2HKR A;  3PSL A;  4O1Q D;  1PBY B;  4N14 A;  4CZV A;  2TRC B;  4A11 B;  4GQ1 A;  5H1M A;  4J8B A;  2OVR B;  4J77 A;  3J81 g;  3ULE C;  4GZ8 A;  1SQ9 A;  5H17 A;  2W18 A;  3EI1 B;  4CY1 A;  3SMR A;  3HFQ A;  2P9K C;  4QQE A;  3DSM A;  2HXC A;  3UVN A;  2CE9 A;  4E5Z B;  4Y5R D;  3EI2 B;  3OKY A;  3JB9 L;  3SWS D;  5CXB A;  2H9M A;  4I79 A;  2BCJ B;  4L3G D;  2H13 A;  4CC9 A;  1XIP A;  5THA A;  3JPX A;  3C9C A;  5FQD A;  1S4U X;  3MXX A;  5EMM B;  2IUQ A;  3MZK A;  4A2L A;  4L1Q D;  3RLM D;  1SHY B;  3SHF A;  4ZOV A;  1Q47 A;  3DXM C;  3UVO A;  2P9N C;  3OKT A;  4CY2 A;  1P22 A;  4ZOZ A;  4ERY A;  4ERZ A;  4E54 A;  2G99 A;  3DXK C;  3FRX A;  3FM0 A;  2AGX A;  4R7A B;  2IAA A;  4FB1 D;  2IUV A;  3KRX B;  4L9O A;  4JT5 C;  3J80 g;  3I7N A;  3K27 A;  2QXV A;  2AGZ A;  4GGD A;  4GQ2 P;  5HE3 B;  1GG2 B;  3PE7 A;  4A0A A;  3P4F A;  1N6D A;  3OKY B;  5CXB B;  4A11 A;  5SXM A;  3I7H A;  3F3F A;  3NVX A;  4JSP C;  2XL3 A;  2P9L C;  4FA5 D;  4CY3 A;  1U2V C;  4K3I D;  3F3P A;  2CE8 A;  2I3S A;  4CI3 A;  2OVP B;  4X3E A;  2I0S A;  2Z2O A;  2H3X A;  4UI9 R;  3V7D B;  4XEI C;  2B5L A;  2YBA A;  2UZX B;  2BBK H;  4ESG A;  5HE1 B;  4ERQ A;  2CNX A;  3PXT D;  2H6N A;  1GXR A;  4D0K A;  2H6K A;  2J55 H;  2IUR A;  4KFM B;  5TF2 A;  1JOF A;  4E54 B;  5GXI A;  3A0F A;  5EAM A;  5FKT A;  2YB8 B;  3MZL A;  4GM9 A;  5IJ8 E;  4OZU A;  4LG9 A;  5I5I A;  3UKR C;  4GQB B;  4O3U B;  3PXS D;  4OWR A;  3IJ0 A;  4GMB A;  4JXM A;  4CZY A;  3SBR A;  1GP2 B;  2P9I C;  1VYH C;  2PBI B;  2QC5 A;  5C2V B;  2YNN A;  1TBG A;  3UVK A;  4O3T B;  1OMW B;  3SXT D;  3JAM g;  5IC7 A;  5IT9 g;  4A0A B;  4U7A A;  2AGW A;  3OKW A;  5GXH A;  4YVD A;  2XU7 A;  3SBP A;  2J57 G;  3PVU B;  5IJ7 E;  3C75 H;  3JRP A;  5FKS A;  2HKM A;  2CO0 A;  4GGA A;  4H5J A;  3SJL D;  1ERJ A;  2YMU A;  4JT6 C;  3DWL C;  4J86 A;  5AMS A;  1B9X A;  3I8E A;  2PM9 A;  4FHL A;  4CY5 A;  2Q7Q A;  2AH0 A;  5EMK B;  5FA5 B;  4FAV D;  2EBS A;  4ES0 A;  4J87 A;  4J8G A;  2HYE A;  3BG1 A;  4NSX A;  3N0E A;  5C2W B;  4J82 A;  2PM7 B;  2HJ4 A;  4A2M A;  3JRO A;  1XKS A;  5EM2 A;  2B5N A;  4X63 B;  4A08 A;  5CYK A;  4J0X A;  2PM6 B;  3RN0 D;  3B7F A;  5TEF A;  1U4C A;  2YNP A;  4QL1 A;  3V5W B;  2H9P A;  2I3T A;  3CIK B;  2H14 A;  1B9Y A;  1PI6 A;  5EAR A;  2AQ5 A;  4HDJ A;  3FGB A;  3PVW B;  3L4O D;  4D6V A;  5FKR A;  1A0R B;  1XHM A;  1K8K C;  4ZOY A;  3I8C A;  4GM8 A;  3E0C A;  4JD2 C;  3NVQ A;  3RFG A;  4FA4 D;  3OW8 A;  4XYH A;  4XYI A;  2PM9 B;  4PSX B;  4J78 A;  3VGZ A;  3RN1 D;  4BH6 A;  3N0D A;  1MG3 A;  2H47 A;  3VA6 A;  5EML B;  2OIZ A;  2CN2 A;  1QNI A;  5TEE A;  5FXY A;  4FA1 D;  4A0B A;  4CI8 A;  2MTA H;  1JMZ B;  4FWW A;  5EMJ B;  1SQJ A;  3JZN A;  4MK0 B;  5EM2 B;  1JJU B;  3MKS B;  4BL0 A;  4CI2 A;  4A08 B;  5CYK B;  5HYN B;  3MMY A;  5CXC A;  2P9P C;  4AEZ A;  3VH0 A;  2OVQ B;  1JMX B;  3I89 A;  1N6E A;  5IGO A;  5TDH B;  5EAP A;  2IWF A;  4X60 B;  5I5M A;  5A2Q g;  2G9A A;  4ZOX A;  3DM0 A;  4FA9 D;  2GC7 A;  4AOW A;  3SLE D;  5EAL A;  1N6F A;  4O9D A;  3BG0 A;  4Z8L A;  4A09 A;  3AH8 B;  3JZG A;  3PXW D;  4LGN A;  5KDO B;  5HQG A;  3EI3 A;  2OJY A;  3IIW A;  2I0R A;  5B4W A;  4A0B B;  3KRW B;  3ORV D;  5HE0 B;  3F3G A;  3IIY A;  2YNO A;  3NVN A;  4BUJ C;  3EWE A;  2AGL A;  3UVL A;  3CFS B;  4EWR A;  2CO0 C;  4QRJ A;  5CXC B;  1GOT B;  3SFZ A;  2GC4 A;  3PSC B;  1RI6 A;  4JSV C;  3U4Y A;  2B5M A;  1R5M A;  3GRE A;  4TZ4 A;  5AJA A;  4J81 A;  2OK4 A;  3UKU C;  1FWX A;  5FLX g;  5HE2 B;  4K3J B;  3UVM A;  3AL8 A;  5K19 A;  4G56 B;  2HES X;  4PNK B;  4IA9 A;  3EG6 A;  2AGY A;  3L4M D;  1OLZ A;  4A7J A;  1NR0 A;  4CI1 A;  3SCY A;  4L3H D;  4A09 B;  5C9Z B;  3RMZ D;  3K26 A;  3EI3 B;  3EI4 A;  1PEV A;  4JSX C;  3V9F A;  3ZWL B;  3RRM C;  2GNQ A;  5H14 A;  3SN6 B;  4H5I A;  3OL2 A;  4J73 A;  2P9U C;  2Z2N A;  1L0Q A;  1NEX B;  4X61 B;  4GM3 A;  4CZX A;  2I0T A;  3JZH A;  4IMM A;  3OTT A;  1K32 A;  2J56 H;  5JWZ A;  4PSW B;  3I7L A;  3IKO A;  3CFV A;  2AH1 A;  2H9N A;  1PGU A;  3EU7 A;  3I7O A;  2UZY B;  4J84 A;  5IGQ A;  4PBZ A;  3MKQ A;  2IWK A;  4GGC A;  3AL8 B;  3SBQ A;  4QT8 A;  3BWS A;  3I7K A;  3SVW D;  2P9S C;  4FAN D;  1YFQ A;  3IJC A;  4PXW A;  4O45 A;  4ZN4 A;  3EI1 A;  3UR4 A;  2XYI A;  3EI4 B;  4PBY A; 
#chains in the Genus database with same CATH topology
 5FFO A;  1H2Y A;  3IUL A;  4LG8 A;  2CN3 A;  3IJ1 A;  3OL2 B;  4E5Z A;  5GSA A;  5M5V A;  4Y7R A;  3W15 A;  3RFH A;  2H6Q A;  3IJE A;  5I5J A;  5GMK n;  3EI2 A;  4JSN C;  2B4E A;  3GFC A;  3AFC A;  3C5M A;  3EQ7 A;  4PC0 A;  4BCD A;  2IUP A;  2O9K A;  2Z2P A;  2H9L A;  4J0W A;  1MDA H;  3ODT A;  4U1E I;  4J79 A;  3RSE C;  2OK6 A;  2VC2 A;  5AFU 3;  2XL2 A;  4NC4 A;  5K1C C;  2VDP A;  3I7P A;  3I2N A;  5FKQ A;  3AL9 A;  1MG2 A;  2HJB A;  2JKX A;  2H68 A;  3EMH A;  3NID A;  3C99 A;  1TYQ C;  2HKR A;  3PSL A;  1GOG A;  4O1Q D;  1PBY B;  2VDL A;  4N14 A;  4CZV A;  2EIE A;  4WK4 A;  2TRC B;  4A11 B;  4GQ1 A;  5H1M A;  4J8B A;  2OVR B;  4J77 A;  3J81 g;  3ULE C;  3IUQ A;  4GZ8 A;  1SQ9 A;  3V4P A;  5H17 A;  2W18 A;  4MMZ A;  3EI1 B;  4CY1 A;  2VDM A;  3SMR A;  1H2X A;  3HFQ A;  2P9K C;  4QQE A;  4O02 A;  3DSM A;  2HXC A;  4NEN A;  1A12 A;  3UVN A;  4BP8 A;  2CE9 A;  4E5Z B;  3O4H A;  4Y5R D;  3EI2 B;  3OKY A;  3JB9 L;  3SWS D;  5CXB A;  4Z7N A;  2H9M A;  2VDN A;  4I79 A;  2BCJ B;  4RE6 A;  5HDB A;  1UOP A;  1GOH A;  4L3G D;  2H13 A;  4CC9 A;  3MVD K;  1XIP A;  5THA A;  3JPX A;  1QFM A;  3C9C A;  1VZ3 A;  5FQD A;  5M5T A;  1S4U X;  3EQ9 A;  1C9L A;  3MXX A;  5EMM B;  2IUQ A;  3MZK A;  4A2L A;  4BP9 A;  4L1Q D;  3RLM D;  1SHY B;  3IUJ A;  3SHF A;  4D9S A;  4ZOV A;  1Q47 A;  3DXM C;  3UVO A;  2P9N C;  3OKT A;  4CY2 A;  1P22 A;  4ZOZ A;  4ERY A;  4ERZ A;  4E54 A;  3V4V A;  2G99 A;  3DXK C;  3FRX A;  1E8N A;  3FM0 A;  2AGX A;  4R7A B;  2IAA A;  4FB1 D;  2IUV A;  3KRX B;  4JT5 C;  4L9O A;  3J80 g;  3I7N A;  1T2X A;  3K27 A;  2QXV A;  4AN0 A;  2AGZ A;  4GGD A;  4GQ2 P;  5HE3 B;  1GG2 B;  3PE7 A;  4A0A A;  3P4F A;  1N6D A;  2EIB A;  3NIF A;  3OKY B;  5CXB B;  4A11 A;  5SXM A;  3I7H A;  3F3F A;  4G55 A;  3NVX A;  4JSP C;  2XL3 A;  2P9L C;  4FA5 D;  4CY3 A;  1U2V C;  2HU8 A;  4JHP C;  4K3I D;  3K72 A;  4UM8 A;  3F3P A;  2CE8 A;  2I3S A;  4CI3 A;  2OVP B;  4X3E A;  2I0S A;  2Z2O A;  2H3X A;  4UI9 R;  3V7D B;  4AN1 A;  4XEI C;  2B5L A;  2YBA A;  2UZX B;  2BBK H;  3ZDX A;  4ESG A;  5HE1 B;  4ERQ A;  2CNX A;  3PXT D;  2H6N A;  1GXR A;  4D0K A;  2H6K A;  2J55 H;  2IUR A;  4KFM B;  5TF2 A;  1JOF A;  4E54 B;  4BCB A;  5GXI A;  3A0F A;  5EAM A;  5FKT A;  2YB8 B;  3MZL A;  4GM9 A;  5IJ8 E;  4OZU A;  4LG9 A;  5I5I A;  3UKR C;  4GQB B;  4O3U B;  4Z7O A;  3IUR A;  3PXS D;  4OWR A;  3IJ0 A;  4GMB A;  4JXM A;  2VZ1 A;  4CZY A;  3SBR A;  1GP2 B;  2P9I C;  3ZE1 A;  1VYH C;  2PBI B;  2QC5 A;  5C2V B;  3K71 A;  2YNN A;  1TBG A;  3UVK A;  4O3T B;  1OMW B;  3SXT D;  3JAM g;  5IC7 A;  5IT9 g;  4A0A B;  4U7A A;  2AGW A;  3OKW A;  5GXH A;  4YVD A;  5M5U A;  2XU7 A;  3SBP A;  2J57 G;  2HU5 A;  3PVU B;  5IJ7 E;  3C75 H;  3JRP A;  1I2M B;  5FKS A;  2HKM A;  2CO0 A;  4GGA A;  4H5J A;  3SJL D;  1ERJ A;  2YMU A;  4JT6 C;  3DWL C;  1JV2 A;  4J86 A;  4L1M A;  5AMS A;  1B9X A;  3I8E A;  2PM9 A;  3VI4 A;  4FHL A;  4CY5 A;  2Q7Q A;  2AH0 A;  5EMK B;  5E6R A;  3T3M A;  5FA5 B;  5E6U A;  4FAV D;  2EBS A;  4ES0 A;  4J87 A;  3K6S A;  4J8G A;  2HYE A;  3BG1 A;  4AX4 A;  4NSX A;  3N0E A;  3IUN A;  5C2W B;  3MUN A;  4J82 A;  1E8M A;  2HU7 A;  3IVM A;  1U8C A;  3MUO A;  2PM7 B;  2HJ4 A;  4A2M A;  1GOF A;  1XKS A;  3FCU A;  3JRO A;  5EM2 A;  2B5N A;  4X63 B;  4A08 A;  5CYK A;  4J0X A;  2PM6 B;  3RN0 D;  3B7F A;  5TEF A;  1U4C A;  2YNP A;  4QL1 A;  2VZ3 A;  3V5W B;  2H9P A;  2I3T A;  4AMY A;  3CIK B;  1H2W A;  3T3P A;  2H14 A;  1B9Y A;  5C92 A;  1PI6 A;  5EAR A;  2AQ5 A;  4HDJ A;  3FGB A;  3PVW B;  3L4O D;  4D6V A;  5FKR A;  1A0R B;  2XDW A;  1XHM A;  1K8K C;  4ZOY A;  3I8C A;  2XZG A;  3O4I A;  4GM8 A;  5M61 A;  3E0C A;  4JD2 C;  3NVQ A;  3RFG A;  4FA4 D;  3OW8 A;  4XYH A;  4XYI A;  1O6G A;  2PM9 B;  4PSX B;  4J78 A;  3KCI A;  3DDU A;  1YR2 A;  2VDQ A;  3VGZ A;  3RN1 D;  4BH6 A;  4WK2 A;  2EID A;  3N0D A;  1MG3 A;  2H47 A;  3VA6 A;  5EML B;  2OIZ A;  1QNI A;  2CN2 A;  1QFS A;  5TEE A;  5FXY A;  4FA1 D;  1JTD B;  4CI8 A;  3QI0 A;  4A0B A;  4O2W A;  2MTA H;  1JMZ B;  4FWW A;  4RE5 A;  5EMJ B;  1SQJ A;  3JZN A;  4MK0 B;  5EM2 B;  1JJU B;  3MKS B;  4DNU A;  4BL0 A;  3OF7 A;  4CI2 A;  4A08 B;  2VDR A;  5CYK B;  5HYN B;  3MMY A;  5CXC A;  2P9P C;  4AEZ A;  3VH0 A;  2OVQ B;  1JMX B;  4NBM A;  4WJK A;  3I89 A;  1N6E A;  2WQ8 A;  5IGO A;  4G1M A;  5M5R A;  5TDH B;  5C86 A;  5EAP A;  5E6S A;  2IWF A;  4X60 B;  5I5M A;  5A2Q g;  2G9A A;  4ZOX A;  3DM0 A;  1VZ2 A;  4FA9 D;  2GC7 A;  3NIG A;  4AOW A;  3IUM A;  3SLE D;  5EAL A;  4DNW A;  1N6F A;  4O9D A;  4G1E A;  2QZP A;  3BG0 A;  1UOO A;  4Z8L A;  4AMZ A;  4WK0 A;  4A09 A;  3ZE2 A;  2EIC A;  3AH8 B;  3JZG A;  3PXW D;  4LGN A;  5KDO B;  4IRZ A;  5HQG A;  3EI3 A;  1C9I A;  2OJY A;  2BKL A;  3IIW A;  1BPO A;  3ZE0 A;  2I0R A;  5B4W A;  4A0B B;  3KRW B;  3ORV D;  5HE0 B;  3F3G A;  3IIY A;  2YNO A;  3NVN A;  4BUJ C;  3EWE A;  2AGL A;  3UVL A;  3CFS B;  4EWR A;  2CO0 C;  4QRJ A;  5CXC B;  1GOT B;  3SFZ A;  1K3I A;  2GC4 A;  3PSC B;  1RI6 A;  4JSV C;  3U4Y A;  3ZDY A;  2B5M A;  1TYE A;  3ZDZ A;  1VE6 A;  1R5M A;  3GRE A;  4TZ4 A;  5AJA A;  4J81 A;  2OK4 A;  3QHY B;  3UKU C;  4DNV A;  1FWX A;  5FLX g;  5HE2 B;  4K3J B;  3UVM A;  2QR5 A;  3AL8 A;  2XE4 A;  5K19 A;  4G56 B;  2HES X;  4PNK B;  4IA9 A;  3EG6 A;  2AGY A;  3L4M D;  1OLZ A;  4A7J A;  1NR0 A;  4CI1 A;  3SCY A;  3VI3 A;  2VDO A;  4L3H D;  4A09 B;  5C9Z B;  3RMZ D;  3K26 A;  3EI3 B;  3EI4 A;  5FFG A;  5M5S A;  1PEV A;  4JSX C;  3V9F A;  3ZWL B;  3RRM C;  2GNQ A;  5H14 A;  1E5T A;  1L5G A;  3SN6 B;  4H5I A;  3OL2 A;  4J73 A;  2P9U C;  2Z2N A;  1L0Q A;  1NEX B;  4X61 B;  1VE7 A;  4GM3 A;  4CZX A;  2I0T A;  3JZH A;  4IMM A;  3OTT A;  2VDK A;  1K32 A;  2J56 H;  5JWZ A;  4PSW B;  3O4G A;  1O6F A;  3I7L A;  3IKO A;  3CFV A;  1UTC A;  2AH1 A;  1UOQ A;  4BCC A;  2H9N A;  1PGU A;  3EU7 A;  3GC3 B;  3I7O A;  2UZY B;  4J84 A;  4Z7Q A;  5IGQ A;  4PBZ A;  3GD1 I;  3MKQ A;  2IWK A;  4GGC A;  4NAA A;  3AL8 B;  3EQ8 A;  4JHN A;  3O4J A;  3SBQ A;  4QT8 A;  3BWS A;  3I7K A;  3SVW D;  4MMX A;  2P9S C;  4FAN D;  4MMY A;  1YFQ A;  3IJC A;  4UM9 A;  3FCS A;  4PXW A;  4O45 A;  4ZN4 A;  3EI1 A;  3UR4 A;  2XYI A;  1H2Z A;  3EI4 B;  4QAM A;  4PBY A;  1M1X A; 
#chains in the Genus database with same CATH homology
 4LG8 A;  2CN3 A;  3IJ1 A;  3OL2 B;  4E5Z A;  5GSA A;  4Y7R A;  3W15 A;  3RFH A;  2H6Q A;  5I5J A;  5GMK n;  3EI2 A;  4JSN C;  2B4E A;  3GFC A;  3AFC A;  3C5M A;  4PC0 A;  2IUP A;  2O9K A;  2Z2P A;  2H9L A;  4J0W A;  1MDA H;  3ODT A;  4U1E I;  4J79 A;  3RSE C;  2OK6 A;  5AFU 3;  2XL2 A;  5K1C C;  3I7P A;  5FKQ A;  3I2N A;  3AL9 A;  1MG2 A;  2HJB A;  2H68 A;  3EMH A;  3C99 A;  1TYQ C;  2HKR A;  3PSL A;  4O1Q D;  1PBY B;  4N14 A;  4CZV A;  2TRC B;  4A11 B;  4GQ1 A;  5H1M A;  4J8B A;  2OVR B;  4J77 A;  3J81 g;  3ULE C;  4GZ8 A;  1SQ9 A;  5H17 A;  2W18 A;  3EI1 B;  4CY1 A;  3SMR A;  3HFQ A;  2P9K C;  4QQE A;  3DSM A;  2HXC A;  3UVN A;  2CE9 A;  4E5Z B;  4Y5R D;  3EI2 B;  3OKY A;  3JB9 L;  3SWS D;  5CXB A;  2H9M A;  4I79 A;  2BCJ B;  4L3G D;  2H13 A;  4CC9 A;  1XIP A;  5THA A;  3JPX A;  3C9C A;  5FQD A;  1S4U X;  3MXX A;  5EMM B;  2IUQ A;  3MZK A;  4A2L A;  4L1Q D;  3RLM D;  1SHY B;  3SHF A;  4ZOV A;  1Q47 A;  3DXM C;  3UVO A;  2P9N C;  3OKT A;  4CY2 A;  1P22 A;  4ZOZ A;  4ERY A;  4ERZ A;  4E54 A;  2G99 A;  3DXK C;  3FRX A;  3FM0 A;  2AGX A;  4R7A B;  2IAA A;  4FB1 D;  2IUV A;  3KRX B;  4L9O A;  4JT5 C;  3J80 g;  3I7N A;  3K27 A;  2QXV A;  2AGZ A;  4GGD A;  4GQ2 P;  5HE3 B;  1GG2 B;  3PE7 A;  4A0A A;  3P4F A;  1N6D A;  3OKY B;  5CXB B;  4A11 A;  5SXM A;  3I7H A;  3F3F A;  3NVX A;  4JSP C;  2XL3 A;  2P9L C;  4FA5 D;  4CY3 A;  1U2V C;  4K3I D;  3F3P A;  2CE8 A;  2I3S A;  4CI3 A;  2OVP B;  4X3E A;  2I0S A;  2Z2O A;  2H3X A;  4UI9 R;  3V7D B;  4XEI C;  2B5L A;  2YBA A;  2UZX B;  2BBK H;  4ESG A;  5HE1 B;  4ERQ A;  2CNX A;  3PXT D;  2H6N A;  1GXR A;  4D0K A;  2H6K A;  2J55 H;  2IUR A;  4KFM B;  5TF2 A;  1JOF A;  4E54 B;  5GXI A;  3A0F A;  5EAM A;  5FKT A;  2YB8 B;  3MZL A;  4GM9 A;  5IJ8 E;  4OZU A;  4LG9 A;  5I5I A;  3UKR C;  4GQB B;  4O3U B;  3PXS D;  4OWR A;  3IJ0 A;  4GMB A;  4JXM A;  4CZY A;  3SBR A;  1GP2 B;  2P9I C;  1VYH C;  2PBI B;  2QC5 A;  5C2V B;  2YNN A;  1TBG A;  3UVK A;  4O3T B;  1OMW B;  3SXT D;  3JAM g;  5IC7 A;  5IT9 g;  4A0A B;  4U7A A;  2AGW A;  3OKW A;  5GXH A;  4YVD A;  2XU7 A;  3SBP A;  2J57 G;  3PVU B;  5IJ7 E;  3C75 H;  3JRP A;  5FKS A;  2HKM A;  2CO0 A;  4GGA A;  4H5J A;  3SJL D;  1ERJ A;  2YMU A;  4JT6 C;  3DWL C;  4J86 A;  5AMS A;  1B9X A;  3I8E A;  2PM9 A;  4FHL A;  4CY5 A;  2Q7Q A;  2AH0 A;  5EMK B;  5FA5 B;  4FAV D;  2EBS A;  4ES0 A;  4J87 A;  4J8G A;  2HYE A;  3BG1 A;  4NSX A;  3N0E A;  5C2W B;  4J82 A;  2PM7 B;  2HJ4 A;  4A2M A;  3JRO A;  1XKS A;  5EM2 A;  2B5N A;  4X63 B;  4A08 A;  5CYK A;  4J0X A;  2PM6 B;  3RN0 D;  3B7F A;  5TEF A;  1U4C A;  2YNP A;  4QL1 A;  3V5W B;  2H9P A;  2I3T A;  3CIK B;  2H14 A;  1B9Y A;  1PI6 A;  5EAR A;  2AQ5 A;  4HDJ A;  3FGB A;  3PVW B;  3L4O D;  4D6V A;  5FKR A;  1A0R B;  1XHM A;  1K8K C;  4ZOY A;  3I8C A;  4GM8 A;  3E0C A;  4JD2 C;  3NVQ A;  3RFG A;  4FA4 D;  3OW8 A;  4XYH A;  4XYI A;  2PM9 B;  4PSX B;  4J78 A;  3VGZ A;  3RN1 D;  4BH6 A;  3N0D A;  1MG3 A;  2H47 A;  3VA6 A;  5EML B;  2OIZ A;  2CN2 A;  1QNI A;  5TEE A;  5FXY A;  4FA1 D;  4A0B A;  4CI8 A;  2MTA H;  1JMZ B;  4FWW A;  5EMJ B;  1SQJ A;  3JZN A;  4MK0 B;  5EM2 B;  1JJU B;  3MKS B;  4BL0 A;  4CI2 A;  4A08 B;  5CYK B;  5HYN B;  3MMY A;  5CXC A;  2P9P C;  4AEZ A;  3VH0 A;  2OVQ B;  1JMX B;  3I89 A;  1N6E A;  5IGO A;  5TDH B;  5EAP A;  2IWF A;  4X60 B;  5I5M A;  5A2Q g;  2G9A A;  4ZOX A;  3DM0 A;  4FA9 D;  2GC7 A;  4AOW A;  3SLE D;  5EAL A;  1N6F A;  4O9D A;  3BG0 A;  4Z8L A;  4A09 A;  3AH8 B;  3JZG A;  3PXW D;  4LGN A;  5KDO B;  5HQG A;  3EI3 A;  2OJY A;  3IIW A;  2I0R A;  5B4W A;  4A0B B;  3KRW B;  3ORV D;  5HE0 B;  3F3G A;  3IIY A;  2YNO A;  3NVN A;  4BUJ C;  3EWE A;  2AGL A;  3UVL A;  3CFS B;  4EWR A;  2CO0 C;  4QRJ A;  5CXC B;  1GOT B;  3SFZ A;  2GC4 A;  3PSC B;  1RI6 A;  4JSV C;  3U4Y A;  2B5M A;  1R5M A;  3GRE A;  4TZ4 A;  5AJA A;  4J81 A;  2OK4 A;  3UKU C;  1FWX A;  5FLX g;  5HE2 B;  4K3J B;  3UVM A;  3AL8 A;  5K19 A;  4G56 B;  2HES X;  4PNK B;  4IA9 A;  3EG6 A;  2AGY A;  3L4M D;  1OLZ A;  4A7J A;  1NR0 A;  4CI1 A;  3SCY A;  4L3H D;  4A09 B;  5C9Z B;  3RMZ D;  3K26 A;  3EI3 B;  3EI4 A;  1PEV A;  4JSX C;  3V9F A;  3ZWL B;  3RRM C;  2GNQ A;  5H14 A;  3SN6 B;  4H5I A;  3OL2 A;  4J73 A;  2P9U C;  2Z2N A;  1L0Q A;  1NEX B;  4X61 B;  4GM3 A;  4CZX A;  2I0T A;  3JZH A;  4IMM A;  3OTT A;  1K32 A;  2J56 H;  5JWZ A;  4PSW B;  3I7L A;  3IKO A;  3CFV A;  2AH1 A;  2H9N A;  1PGU A;  3EU7 A;  3I7O A;  2UZY B;  4J84 A;  5IGQ A;  4PBZ A;  3MKQ A;  2IWK A;  4GGC A;  3AL8 B;  3SBQ A;  4QT8 A;  3BWS A;  3I7K A;  3SVW D;  2P9S C;  4FAN D;  1YFQ A;  3IJC A;  4PXW A;  4O45 A;  4ZN4 A;  3EI1 A;  3UR4 A;  2XYI A;  3EI4 B;  4PBY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...