3JB9L

Cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
299
structure length
293
Chain Sequence
PNLQMFGHTAEVLVARFDPSGSYFASGGMDRQILLWNVFDVKNYGVLNGCKGAITDLQWSRDSRVVYCSSSDTHLMSWDAVSGQKIRKHKGHAGVVNALDVLKVSELLTSVSDDCTMKVWDSRSKDCIKTIEEKYPLTAVAIAQQGTQVFIGGIDGAIKIWDLRNNHCSHVLKGHKDIITSLAISKDGSSLLSNSMDNTVRIFDVKAQRQLQIFEGAIHGQEHNLLGVAWSRNSRFVGAGSSDKNVYVWSATGDLRYVLPGHEGSVNHVDFHPHQDIILSCSSDRTIFLGELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords Pre-mRNA-splicing factor spp42
publication title Structure of a yeast spliceosome at 3.6-angstrom resolution
pubmed doi rcsb
total genus 46
structure length 293
sequence length 299
ec nomenclature
pdb deposition date 2015-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3jb9L00
3VGZA 4A2MA 4D6VA 2XYIA 2P9PC 2GNQA 2QC5A 3C5MA 3V7DB 4J8GA 5FKQA 3SXTD 4A0BB 3DXKC 2I0TA 4O3TB 4PC0A 3I89A 4PBZA 3SBQA 5IC7A 3B7FA 4GQBB 3IJCA 4JSXC 4E5ZA 2CN2A 2AH1A 2OJYA 3MXXA 4GQ2P 3RN1D 4K3ID 4JD2C 3IKOA 3MZKA 5THAA 4FAVD 5FKRA 1Q47A 3ORVD 2IWFA 3SHFA 3SVWD 2OIZA 2H14A 3E0CA 1GP2B 2HJ4A 5IGOA 4PSXB 2AGXA 4FA5D 3JB9L 2IAAA 2YBAA 1N6DA 5TF2A 2MTAH 4ERZA 3UKUC 3UVLA 4L3HD 3VH0A 2O9KA 4FA1D 2IUPA 3C99A 5EAPA 4A08B 4O3UB 1A0RB 1N6FA 4JT5C 3I7KA 5AMSA 2OVRB 1P22A 4PSWB 4JSPC 2IUQA 3OL2B 4TZ4A 3I7PA 3EI3A 4LG8A 3ODTA 3NVQA 4GGCA 5EMMB 5IGQA 1MG3A 2H13A 3FRXA 2B4EA 2PM9B 2TRCB 5EARA 1U4CA 4O45A 2J56H 4A08A 2XU7A 5K1CC 2AH0A 4U7AA 4J82A 4LG9A 3OL2A 4ZOZA 5HE1B 3OKYA 4A2LA 2IURA 2PM7B 4ESGA 4A0AB 3UKRC 3IJ0A 4FA4D 2CN3A 4U1EI 4J86A 4J78A 2I0RA 5IJ7E 2B5LA 2PM9A 1RI6A 3EI1A 2I3SA 4I79A 4GGAA 4QT8A 4AEZA 3BG0A 5IJ8E 3EMHA 3JAMg 1SHYB 1JMZB 3K27A 5AFU3 4A11A 5HE2B 4EWRA 4R7AB 4E54A 3AL9A 5FA5B 5HYNB 5I5MA 4CI1A 5CXBA 2YNNA 4IA9A 2CE9A 5I5IA 2HYEA 5C2WB 5HE3B 4XEIC 1JJUB 4X60B 4CY5A 2H68A 4FAND 3IJ1A 5H17A 3UVKA 3JZNA 3I2NA 2QXVA 3UVNA 5EAMA 2OVQB 2AGZA 5K19A 2YNPA 3SBRA 4AOWA 3RRMC 3EI2B 4CI2A 3GFCA 4BH6A 4J0XA 2H9LA 4FB1D 3JPXA 3PXTD 2YMUA 4A0BA 4BL0A 2CO0A 4A09B 2UZYB 5AJAA 2HXCA 3AL8B 3UVMA 1PI6A 4J0WA 4ES0A 2GC7A 4CZVA 4GM9A 3EI2A 3PSCB 3SN6B 4G56B 3RSEC 1B9XA 2UZXB 2HESX 2XL2A 4J8BA 3EU7A 2CO0C 1B9YA 4J84A 2I0SA 4JSVC 4JXMA 4OWRA 5FQDA 4J77A 4O1QD 4QL1A 1L0QA 4ERQA 3F3FA 2J55H 3I7NA 3OKTA 4K3JB 2G9AA 5EMJB 2GC4A 3I8CA 1K32A 1YFQA 3SCYA 3I7LA 4X61B 5TDHB 1QNIA 4ERYA 4X3EA 3FM0A 2Z2PA 1MG2A 3J80g 4QRJA 3J81g 1TYQC 4Y5RD 3PVWB 3BG1A 3DWLC 4YVDA 3FGBA 3PXSD 1GOTB 2P9KC 5CYKB 5FKTA 2Z2NA 3PSLA 2BCJB 3JRPA 4J79A 4JT6C 5FXYA 4O9DA 3C9CA 4ZOVA 5SXMA 3SWSD 5GSAA 2Q7QA 4MK0B 3SFZA 3AFCA 4J87A 3BWSA 3CIKB 3V9FA 3DXMC 5CYKA 4A0AA 2BBKH 3EI4B 4ZN4A 5FLXg 4GMBA 3I8EA 4QQEA 2YB8B 2H9MA 4PNKB 2H9PA 2CE8A 3OTTA 1OLZA 5A2Qg 3JZHA 3PVUB 1VYHC 2HKMA 4X63B 1JOFA 3SJLD 2OVPB 4CI8A 2B5NA 4D0KA 3DM0A 3CFVA 1GG2B 3RMZD 3F3GA 5H1MA 3EI4A 4GQ1A 4L9OA 2AGYA 4ZOXA 4E5ZB 3MZLA 1PBYB 1ERJA 2HJBA 1NEXB 3OKWA 3U4YA 4PBYA 3P4FA 5I5JA 4XYHA 2H6NA 3RFHA 5C9ZB 2OK4A 4XYIA 2Z2OA 3A0FA 3V5WB 1R5MA 2IWKA 4GM3A 2PM6B 4LGNA 3MMYA 5EM2B 2P9SC 3MKSB 1TBGA 4H5JA 1JMXB 1S4UX 2H6QA 3L4OD 5HE0B 4HDJA 4CI3A 3F3PA 4PXWA 4H5IA 2PBIB 4CZYA 2XL3A 3CFSB 2J57G 3I7OA 2EBSA 3SBPA 4NSXA 4A09A 5EMKB 3AL8A 4CY3A 3DSMA 5EM2A 5GXIA 3RLMD 1XIPA 1K8KC 2B5MA 3EI3B 4GM8A 4L1QD 3JROA 5CXCB 2W18A 5GMKn 3IIYA 3N0DA 2CNXA 3UR4A 3KRWB 3EWEA 3OW8A 2P9NC 2P9UC 5C2VB 4OZUA 5KDOB 3ULEC 3W15A 2AQ5A 1PGUA 2H3XA 4KFMB 3UVOA 5FKSA 4CY2A 3PE7A 3MKQA 3SLED 2H47A 4GZ8A 3OKYB 4Y7RA 4ZOYA 5IT9g 2OK6A 2H9NA 5CXCA 5TEFA 4FHLA 4J73A 5EALA 4CY1A 1MDAH 3HFQA 3JZGA 3RFGA 1PEVA 3EI1B 1XKSA 5HQGA 4CC9A 4IMMA 3GREA 2AGLA 1SQ9A 1U2VC 1SQJA 4A11B 5B4WA 4BUJC 4FWWA 1N6EA 2I3TA 3L4MD 5JWZA 3ZWLB 4L3GD 4E54B 1GXRA 4Z8LA 1NR0A 2G99A 4A7JA 2IUVA 3K26A 4GGDA 5CXBB 2HKRA 4N14A 3SMRA 5H14A 1XHMA 3C75H 2H6KA 5EMLB 2AGWA 4UI9R 3I7HA 2P9LC 3NVNA 2YNOA 3N0EA 4JSNC 3AH8B 3PXWD 1OMWB 4CZXA 3NVXA 4J81A 5GXHA 2P9IC 5TEEA 3VA6A 3KRXB 3IIWA 3EG6A 4FA9D 3RN0D 1FWXA
chains in the Genus database with same CATH superfamily
4WK0A 3VGZA 4A2MA 4RE5A 4D6VA 2XYIA 3K72A 2P9PC 2GNQA 2QC5A 3C5MA 4G1EA 3V7DB 4J8GA 5FKQA 3SXTD 4A0BB 3EQ9A 3DXKC 2I0TA 4O3TB 4PC0A 3EQ7A 3I89A 3MUNA 4PBZA 4AX4A 3K71A 3SBQA 5IC7A 5M5SA 4WK4A 3B7FA 4GQBB 3IJCA 4JSXC 4E5ZA 2CN2A 3VI4A 2AH1A 2OJYA 3MXXA 4GQ2P 3FCSA 3RN1D 4K3ID 4JD2C 3IKOA 3MZKA 2EIBA 5THAA 4FAVD 5FKRA 1Q47A 3ORVD 2IWFA 3IUNA 3SHFA 3SVWD 2OIZA 2H14A 3E0CA 1GP2B 2HJ4A 5IGOA 1BPOA 4PSXB 2BKLA 2AGXA 2QR5A 4FA5D 3JB9L 2IAAA 2YBAA 1N6DA 5TF2A 3IUQA 2MTAH 4ERZA 3UKUC 3UVLA 4L3HD 3VH0A 4AN1A 2XDWA 2O9KA 4FA1D 5M61A 2IUPA 3C99A 5EAPA 4A08B 4O3UB 2VC2A 1A0RB 1N6FA 4JT5C 2WQ8A 3I7KA 3EQ8A 5AMSA 3ZDYA 2OVRB 1P22A 1QFMA 4PSWB 4JSPC 2IUQA 3OL2B 3O4GA 4TZ4A 3I7PA 3EI3A 4LG8A 3IURA 3ODTA 3NVQA 4GGCA 5EMMB 5IGQA 1MG3A 2H13A 3FRXA 5M5UA 2B4EA 2PM9B 2TRCB 5EARA 1U4CA 4O45A 2J56H 4A08A 2XU7A 5K1CC 1VE7A 1VZ2A 2AH0A 4U7AA 4UM9A 5M5TA 4J82A 4LG9A 3OL2A 4ZOZA 5HE1B 4AMYA 3OKYA 4A2LA 2IURA 2PM7B 4ESGA 4A0AB 3UKRC 3T3PA 3IJ0A 4FA4D 2CN3A 3NIDA 4U1EI 4J86A 4J78A 2I0RA 1C9IA 4JHPC 5IJ7E 2B5LA 2PM9A 1RI6A 1L5GA 3EI1A 2I3SA 2HU8A 4I79A 4GGAA 4QT8A 4AEZA 3BG0A 5IJ8E 3EMHA 3ZE2A 1SHYB 1JMZB 3K27A 5AFU3 3JAMg 1UOOA 4A11A 5HE2B 1K3IA 4EWRA 4MMZA 4R7AB 1T2XA 4JHNA 4E54A 3AL9A 5FA5B 5HYNB 2EIDA 5I5MA 4G1MA 4CI1A 5CXBA 2YNNA 4IA9A 2CE9A 3ZE1A 5I5IA 2HYEA 5C2WB 5HE3B 4XEIC 1JJUB 4X60B 4CY5A 2VDOA 5C86A 2H68A 4FAND 3IJ1A 4O2WA 5H17A 3UVKA 4O02A 3JZNA 3MUOA 3I2NA 2QXVA 3UVNA 5EAMA 5FFGA 2OVQB 2AGZA 5K19A 2YNPA 3SBRA 4AOWA 3RRMC 3EI2B 5FFOA 1I2MB 4WK2A 4CI2A 3GFCA 4BH6A 4J0XA 2H9LA 1UOQA 4FB1D 3GC3B 3JPXA 3PXTD 2YMUA 4A0BA 4NAAA 4BL0A 2CO0A 5M5VA 4A09B 2UZYB 2VDPA 5AJAA 4DNWA 2HXCA 3AL8B 3UVMA 1PI6A 4J0WA 4BCBA 4BP9A 3IULA 4ES0A 2GC7A 4CZVA 4GM9A 3EI2A 3PSCB 3SN6B 4G56B 2EICA 3RSEC 1B9XA 1M1XA 2UZXB 2QZPA 4QAMA 2HESX 4D9SA 2XL2A 4J8BA 3EU7A 3OF7A 2CO0C 1C9LA 1B9YA 4J84A 2I0SA 4JSVC 4JXMA 1QFSA 4OWRA 5FQDA 4BP8A 1GOHA 4J77A 4O1QD 4QL1A 1L0QA 4ERQA 3F3FA 2J55H 3I7NA 3OKTA 4K3JB 2G9AA 1GOFA 5EMJB 2GC4A 3I8CA 4NBMA 1K32A 1YFQA 3SCYA 3I7LA 4X61B 1H2ZA 5TDHB 1QNIA 4IRZA 4X3EA 3FM0A 4ERYA 2Z2PA 1MG2A 3J80g 4QRJA 3J81g 1TYQC 4Y5RD 3PVWB 5C92A 3BG1A 3DWLC 3MVDK 4YVDA 3FGBA 3PXSD 4NENA 3K6SA 1GOTB 2P9KC 5CYKB 5FKTA 2Z2NA 3PSLA 2BCJB 3JRPA 4J79A 4JT6C 5FXYA 4O9DA 3C9CA 2VZ1A 4ZOVA 5SXMA 3FCUA 3V4VA 3SWSD 5GSAA 1JV2A 2Q7QA 4MK0B 3IUMA 1O6FA 3SFZA 5M5RA 1H2YA 3AFCA 4J87A 3BWSA 3O4IA 3CIKB 3V9FA 3DXMC 5CYKA 4A0AA 2BBKH 3EI4B 4ZN4A 5FLXg 4GMBA 3I8EA 2VDMA 4QQEA 2YB8B 2H9MA 4PNKB 2H9PA 2CE8A 3OTTA 1OLZA 5A2Qg 3O4HA 1TYEA 3JZHA 3PVUB 1VYHC 2HKMA 4MMYA 4X63B 1JOFA 3SJLD 2OVPB 4CI8A 2B5NA 4D0KA 3DM0A 3CFVA 1GG2B 4AMZA 4L1MA 3RMZD 3F3GA 5H1MA 2JKXA 3EI4A 1UTCA 4GQ1A 4L9OA 2AGYA 4ZOXA 4E5ZB 3MZLA 1PBYB 4AN0A 1ERJA 2HJBA 4Z7OA 1NEXB 4WJKA 3OKWA 3U4YA 4RE6A 2VDNA 3KCIA 4PBYA 3P4FA 5I5JA 4XYHA 1UOPA 2H6NA 4Z7QA 3RFHA 5C9ZB 2OK4A 3T3MA 3QHYB 4XYIA 2Z2OA 3A0FA 3V5WB 1R5MA 1H2WA 2IWKA 4GM3A 2PM6B 4LGNA 5E6RA 1O6GA 4Z7NA 3MMYA 5EM2B 2P9SC 3MKSB 2XE4A 1TBGA 4H5JA 3VI3A 3ZDZA 1JMXB 4UM8A 1S4UX 2H6QA 3L4OD 2VZ3A 5HE0B 4HDJA 4CI3A 3F3PA 4PXWA 1E8NA 4H5IA 1VE6A 1H2XA 2PBIB 4CZYA 2XL3A 3CFSB 1YR2A 2J57G 3I7OA 2EBSA 3SBPA 3IJEA 4NSXA 2VDKA 4A09A 5EMKB 3AL8A 4CY3A 3ZDXA 3DSMA 3V4PA 5EM2A 1VZ3A 5GXIA 3RLMD 1XIPA 1K8KC 1U8CA 2B5MA 3EI3B 4GM8A 4L1QD 3JROA 5CXCB 2W18A 4MMXA 5GMKn 3IIYA 2XZGA 3N0DA 2CNXA 2VDRA 3IUJA 3UR4A 3KRWB 3EWEA 3OW8A 3QI0A 2P9NC 2P9UC 5C2VB 4OZUA 5KDOB 3ULEC 3W15A 2AQ5A 1PGUA 2H3XA 4KFMB 3UVOA 3ZE0A 1E8MA 5FKSA 4CY2A 2VDLA 3PE7A 3O4JA 3MKQA 3SLED 2H47A 4GZ8A 3OKYB 5E6SA 4Y7RA 4ZOYA 5IT9g 2OK6A 2H9NA 5CXCA 5TEFA 4FHLA 4J73A 5EALA 4CY1A 1MDAH 3NIGA 3HFQA 2VDQA 3JZGA 2HU7A 3RFGA 1PEVA 4BCDA 3EI1B 1XKSA 1E5TA 5HQGA 4CC9A 4IMMA 3GREA 2AGLA 1SQ9A 1U2VC 1SQJA 4A11B 5B4WA 1A12A 4BUJC 4FWWA 1N6EA 2I3TA 3L4MD 2EIEA 5JWZA 4G55A 4L3GD 3ZWLB 4E54B 1GXRA 4Z8LA 1NR0A 2G99A 4A7JA 2IUVA 3K26A 4GGDA 5CXBB 3GD1I 2HKRA 4N14A 5E6UA 3SMRA 5H14A 1XHMA 3C75H 4BCCA 2H6KA 5EMLB 2AGWA 1JTDB 4DNVA 4UI9R 3I7HA 2P9LC 3NVNA 2YNOA 3N0EA 4NC4A 3NIFA 4JSNC 3AH8B 3PXWD 1GOGA 1OMWB 4CZXA 3NVXA 4J81A 5GXHA 2P9IC 4DNUA 5TEEA 3VA6A 3KRXB 3IIWA 3EG6A 2HU5A 4FA9D 3DDUA 5HDBA 3RN0D 3IVMA 1FWXA
chains in the Genus database with same CATH topology
3VGZA 4A2MA 4D6VA 2XYIA 2P9PC 2GNQA 2QC5A 3C5MA 3V7DB 4J8GA 5FKQA 3SXTD 4A0BB 3DXKC 2I0TA 4O3TB 4PC0A 3I89A 4PBZA 3SBQA 5IC7A 3B7FA 4GQBB 3IJCA 4JSXC 4E5ZA 2CN2A 2AH1A 2OJYA 3MXXA 4GQ2P 3RN1D 4K3ID 4JD2C 3IKOA 3MZKA 5THAA 4FAVD 5FKRA 1Q47A 3ORVD 2IWFA 3SHFA 3SVWD 2OIZA 2H14A 3E0CA 1GP2B 2HJ4A 5IGOA 4PSXB 2AGXA 4FA5D 3JB9L 2IAAA 2YBAA 1N6DA 5TF2A 2MTAH 4ERZA 3UKUC 3UVLA 4L3HD 3VH0A 2O9KA 4FA1D 2IUPA 3C99A 5EAPA 4A08B 4O3UB 1A0RB 1N6FA 4JT5C 3I7KA 5AMSA 2OVRB 1P22A 4PSWB 4JSPC 2IUQA 3OL2B 4TZ4A 3I7PA 3EI3A 4LG8A 3ODTA 3NVQA 4GGCA 5EMMB 5IGQA 1MG3A 2H13A 3FRXA 2B4EA 2PM9B 2TRCB 5EARA 1U4CA 4O45A 2J56H 4A08A 2XU7A 5K1CC 2AH0A 4U7AA 4J82A 4LG9A 3OL2A 4ZOZA 5HE1B 3OKYA 4A2LA 2IURA 2PM7B 4ESGA 4A0AB 3UKRC 3IJ0A 4FA4D 2CN3A 4U1EI 4J86A 4J78A 2I0RA 5IJ7E 2B5LA 2PM9A 1RI6A 3EI1A 2I3SA 4I79A 4GGAA 4QT8A 4AEZA 3BG0A 5IJ8E 3EMHA 3JAMg 1SHYB 1JMZB 3K27A 5AFU3 4A11A 5HE2B 4EWRA 4R7AB 4E54A 3AL9A 5FA5B 5HYNB 5I5MA 4CI1A 5CXBA 2YNNA 4IA9A 2CE9A 5I5IA 2HYEA 5C2WB 5HE3B 4XEIC 1JJUB 4X60B 4CY5A 2H68A 4FAND 3IJ1A 5H17A 3UVKA 3JZNA 3I2NA 2QXVA 3UVNA 5EAMA 2OVQB 2AGZA 5K19A 2YNPA 3SBRA 4AOWA 3RRMC 3EI2B 4CI2A 3GFCA 4BH6A 4J0XA 2H9LA 4FB1D 3JPXA 3PXTD 2YMUA 4A0BA 4BL0A 2CO0A 4A09B 2UZYB 5AJAA 2HXCA 3AL8B 3UVMA 1PI6A 4J0WA 4ES0A 2GC7A 4CZVA 4GM9A 3EI2A 3PSCB 3SN6B 4G56B 3RSEC 1B9XA 2UZXB 2HESX 2XL2A 4J8BA 3EU7A 2CO0C 1B9YA 4J84A 2I0SA 4JSVC 4JXMA 4OWRA 5FQDA 4J77A 4O1QD 4QL1A 1L0QA 4ERQA 3F3FA 2J55H 3I7NA 3OKTA 4K3JB 2G9AA 5EMJB 2GC4A 3I8CA 1K32A 1YFQA 3SCYA 3I7LA 4X61B 5TDHB 1QNIA 4ERYA 4X3EA 3FM0A 2Z2PA 1MG2A 3J80g 4QRJA 3J81g 1TYQC 4Y5RD 3PVWB 3BG1A 3DWLC 4YVDA 3FGBA 3PXSD 1GOTB 2P9KC 5CYKB 5FKTA 2Z2NA 3PSLA 2BCJB 3JRPA 4J79A 4JT6C 5FXYA 4O9DA 3C9CA 4ZOVA 5SXMA 3SWSD 5GSAA 2Q7QA 4MK0B 3SFZA 3AFCA 4J87A 3BWSA 3CIKB 3V9FA 3DXMC 5CYKA 4A0AA 2BBKH 3EI4B 4ZN4A 5FLXg 4GMBA 3I8EA 4QQEA 2YB8B 2H9MA 4PNKB 2H9PA 2CE8A 3OTTA 1OLZA 5A2Qg 3JZHA 3PVUB 1VYHC 2HKMA 4X63B 1JOFA 3SJLD 2OVPB 4CI8A 2B5NA 4D0KA 3DM0A 3CFVA 1GG2B 3RMZD 3F3GA 5H1MA 3EI4A 4GQ1A 4L9OA 2AGYA 4ZOXA 4E5ZB 3MZLA 1PBYB 1ERJA 2HJBA 1NEXB 3OKWA 3U4YA 4PBYA 3P4FA 5I5JA 4XYHA 2H6NA 3RFHA 5C9ZB 2OK4A 4XYIA 2Z2OA 3A0FA 3V5WB 1R5MA 2IWKA 4GM3A 2PM6B 4LGNA 3MMYA 5EM2B 2P9SC 3MKSB 1TBGA 4H5JA 1JMXB 1S4UX 2H6QA 3L4OD 5HE0B 4HDJA 4CI3A 3F3PA 4PXWA 4H5IA 2PBIB 4CZYA 2XL3A 3CFSB 2J57G 3I7OA 2EBSA 3SBPA 4NSXA 4A09A 5EMKB 3AL8A 4CY3A 3DSMA 5EM2A 5GXIA 3RLMD 1XIPA 1K8KC 2B5MA 3EI3B 4GM8A 4L1QD 3JROA 5CXCB 2W18A 5GMKn 3IIYA 3N0DA 2CNXA 3UR4A 3KRWB 3EWEA 3OW8A 2P9NC 2P9UC 5C2VB 4OZUA 5KDOB 3ULEC 3W15A 2AQ5A 1PGUA 2H3XA 4KFMB 3UVOA 5FKSA 4CY2A 3PE7A 3MKQA 3SLED 2H47A 4GZ8A 3OKYB 4Y7RA 4ZOYA 5IT9g 2OK6A 2H9NA 5CXCA 5TEFA 4FHLA 4J73A 5EALA 4CY1A 1MDAH 3HFQA 3JZGA 3RFGA 1PEVA 3EI1B 1XKSA 5HQGA 4CC9A 4IMMA 3GREA 2AGLA 1SQ9A 1U2VC 1SQJA 4A11B 5B4WA 4BUJC 4FWWA 1N6EA 2I3TA 3L4MD 5JWZA 3ZWLB 4L3GD 4E54B 1GXRA 4Z8LA 1NR0A 2G99A 4A7JA 2IUVA 3K26A 4GGDA 5CXBB 2HKRA 4N14A 3SMRA 5H14A 1XHMA 3C75H 2H6KA 5EMLB 2AGWA 4UI9R 3I7HA 2P9LC 3NVNA 2YNOA 3N0EA 4JSNC 3AH8B 3PXWD 1OMWB 4CZXA 3NVXA 4J81A 5GXHA 2P9IC 5TEEA 3VA6A 3KRXB 3IIWA 3EG6A 4FA9D 3RN0D 1FWXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VGZ A;  4A2M A;  4D6V A;  2XYI A;  2P9P C;  2GNQ A;  2QC5 A;  3C5M A;  3V7D B;  4J8G A;  5FKQ A;  3SXT D;  4A0B B;  3DXK C;  2I0T A;  4O3T B;  4PC0 A;  3I89 A;  4PBZ A;  3SBQ A;  5IC7 A;  3B7F A;  4GQB B;  3IJC A;  4JSX C;  4E5Z A;  2CN2 A;  2AH1 A;  2OJY A;  3MXX A;  4GQ2 P;  3RN1 D;  4K3I D;  4JD2 C;  3IKO A;  3MZK A;  5THA A;  4FAV D;  5FKR A;  1Q47 A;  3ORV D;  2IWF A;  3SHF A;  3SVW D;  2OIZ A;  2H14 A;  3E0C A;  1GP2 B;  2HJ4 A;  5IGO A;  4PSX B;  2AGX A;  4FA5 D;  3JB9 L;  2IAA A;  2YBA A;  1N6D A;  5TF2 A;  2MTA H;  4ERZ A;  3UKU C;  3UVL A;  4L3H D;  3VH0 A;  2O9K A;  4FA1 D;  2IUP A;  3C99 A;  5EAP A;  4A08 B;  4O3U B;  1A0R B;  1N6F A;  4JT5 C;  3I7K A;  5AMS A;  2OVR B;  1P22 A;  4PSW B;  4JSP C;  2IUQ A;  3OL2 B;  4TZ4 A;  3I7P A;  3EI3 A;  4LG8 A;  3ODT A;  3NVQ A;  4GGC A;  5EMM B;  5IGQ A;  1MG3 A;  2H13 A;  3FRX A;  2B4E A;  2PM9 B;  2TRC B;  5EAR A;  1U4C A;  4O45 A;  2J56 H;  4A08 A;  2XU7 A;  5K1C C;  2AH0 A;  4U7A A;  4J82 A;  4LG9 A;  3OL2 A;  4ZOZ A;  5HE1 B;  3OKY A;  4A2L A;  2IUR A;  2PM7 B;  4ESG A;  4A0A B;  3UKR C;  3IJ0 A;  4FA4 D;  2CN3 A;  4U1E I;  4J86 A;  4J78 A;  2I0R A;  5IJ7 E;  2B5L A;  2PM9 A;  1RI6 A;  3EI1 A;  2I3S A;  4I79 A;  4GGA A;  4QT8 A;  4AEZ A;  3BG0 A;  5IJ8 E;  3EMH A;  3JAM g;  1SHY B;  1JMZ B;  3K27 A;  5AFU 3;  4A11 A;  5HE2 B;  4EWR A;  4R7A B;  4E54 A;  3AL9 A;  5FA5 B;  5HYN B;  5I5M A;  4CI1 A;  5CXB A;  2YNN A;  4IA9 A;  2CE9 A;  5I5I A;  2HYE A;  5C2W B;  5HE3 B;  4XEI C;  1JJU B;  4X60 B;  4CY5 A;  2H68 A;  4FAN D;  3IJ1 A;  5H17 A;  3UVK A;  3JZN A;  3I2N A;  2QXV A;  3UVN A;  5EAM A;  2OVQ B;  2AGZ A;  5K19 A;  2YNP A;  3SBR A;  4AOW A;  3RRM C;  3EI2 B;  4CI2 A;  3GFC A;  4BH6 A;  4J0X A;  2H9L A;  4FB1 D;  3JPX A;  3PXT D;  2YMU A;  4A0B A;  4BL0 A;  2CO0 A;  4A09 B;  2UZY B;  5AJA A;  2HXC A;  3AL8 B;  3UVM A;  1PI6 A;  4J0W A;  4ES0 A;  2GC7 A;  4CZV A;  4GM9 A;  3EI2 A;  3PSC B;  3SN6 B;  4G56 B;  3RSE C;  1B9X A;  2UZX B;  2HES X;  2XL2 A;  4J8B A;  3EU7 A;  2CO0 C;  1B9Y A;  4J84 A;  2I0S A;  4JSV C;  4JXM A;  4OWR A;  5FQD A;  4J77 A;  4O1Q D;  4QL1 A;  1L0Q A;  4ERQ A;  3F3F A;  2J55 H;  3I7N A;  3OKT A;  4K3J B;  2G9A A;  5EMJ B;  2GC4 A;  3I8C A;  1K32 A;  1YFQ A;  3SCY A;  3I7L A;  4X61 B;  5TDH B;  1QNI A;  4ERY A;  4X3E A;  3FM0 A;  2Z2P A;  1MG2 A;  3J80 g;  4QRJ A;  3J81 g;  1TYQ C;  4Y5R D;  3PVW B;  3BG1 A;  3DWL C;  4YVD A;  3FGB A;  3PXS D;  1GOT B;  2P9K C;  5CYK B;  5FKT A;  2Z2N A;  3PSL A;  2BCJ B;  3JRP A;  4J79 A;  4JT6 C;  5FXY A;  4O9D A;  3C9C A;  4ZOV A;  5SXM A;  3SWS D;  5GSA A;  2Q7Q A;  4MK0 B;  3SFZ A;  3AFC A;  4J87 A;  3BWS A;  3CIK B;  3V9F A;  3DXM C;  5CYK A;  4A0A A;  2BBK H;  3EI4 B;  4ZN4 A;  5FLX g;  4GMB A;  3I8E A;  4QQE A;  2YB8 B;  2H9M A;  4PNK B;  2H9P A;  2CE8 A;  3OTT A;  1OLZ A;  5A2Q g;  3JZH A;  3PVU B;  1VYH C;  2HKM A;  4X63 B;  1JOF A;  3SJL D;  2OVP B;  4CI8 A;  2B5N A;  4D0K A;  3DM0 A;  3CFV A;  1GG2 B;  3RMZ D;  3F3G A;  5H1M A;  3EI4 A;  4GQ1 A;  4L9O A;  2AGY A;  4ZOX A;  4E5Z B;  3MZL A;  1PBY B;  1ERJ A;  2HJB A;  1NEX B;  3OKW A;  3U4Y A;  4PBY A;  3P4F A;  5I5J A;  4XYH A;  2H6N A;  3RFH A;  5C9Z B;  2OK4 A;  4XYI A;  2Z2O A;  3A0F A;  3V5W B;  1R5M A;  2IWK A;  4GM3 A;  2PM6 B;  4LGN A;  3MMY A;  5EM2 B;  2P9S C;  3MKS B;  1TBG A;  4H5J A;  1JMX B;  1S4U X;  2H6Q A;  3L4O D;  5HE0 B;  4HDJ A;  4CI3 A;  3F3P A;  4PXW A;  4H5I A;  2PBI B;  4CZY A;  2XL3 A;  3CFS B;  2J57 G;  3I7O A;  2EBS A;  3SBP A;  4NSX A;  4A09 A;  5EMK B;  3AL8 A;  4CY3 A;  3DSM A;  5EM2 A;  5GXI A;  3RLM D;  1XIP A;  1K8K C;  2B5M A;  3EI3 B;  4GM8 A;  4L1Q D;  3JRO A;  5CXC B;  2W18 A;  5GMK n;  3IIY A;  3N0D A;  2CNX A;  3UR4 A;  3KRW B;  3EWE A;  3OW8 A;  2P9N C;  2P9U C;  5C2V B;  4OZU A;  5KDO B;  3ULE C;  3W15 A;  2AQ5 A;  1PGU A;  2H3X A;  4KFM B;  3UVO A;  5FKS A;  4CY2 A;  3PE7 A;  3MKQ A;  3SLE D;  2H47 A;  4GZ8 A;  3OKY B;  4Y7R A;  4ZOY A;  5IT9 g;  2OK6 A;  2H9N A;  5CXC A;  5TEF A;  4FHL A;  4J73 A;  5EAL A;  4CY1 A;  1MDA H;  3HFQ A;  3JZG A;  3RFG A;  1PEV A;  3EI1 B;  1XKS A;  5HQG A;  4CC9 A;  4IMM A;  3GRE A;  2AGL A;  1SQ9 A;  1U2V C;  1SQJ A;  4A11 B;  5B4W A;  4BUJ C;  4FWW A;  1N6E A;  2I3T A;  3L4M D;  5JWZ A;  3ZWL B;  4L3G D;  4E54 B;  1GXR A;  4Z8L A;  1NR0 A;  2G99 A;  4A7J A;  2IUV A;  3K26 A;  4GGD A;  5CXB B;  2HKR A;  4N14 A;  3SMR A;  5H14 A;  1XHM A;  3C75 H;  2H6K A;  5EML B;  2AGW A;  4UI9 R;  3I7H A;  2P9L C;  3NVN A;  2YNO A;  3N0E A;  4JSN C;  3AH8 B;  3PXW D;  1OMW B;  4CZX A;  3NVX A;  4J81 A;  5GXH A;  2P9I C;  5TEE A;  3VA6 A;  3KRX B;  3IIW A;  3EG6 A;  4FA9 D;  3RN0 D;  1FWX A; 
#chains in the Genus database with same CATH topology
 4WK0 A;  3VGZ A;  4A2M A;  4RE5 A;  4D6V A;  2XYI A;  3K72 A;  2P9P C;  2GNQ A;  2QC5 A;  3C5M A;  4G1E A;  3V7D B;  4J8G A;  5FKQ A;  3SXT D;  4A0B B;  3EQ9 A;  3DXK C;  2I0T A;  4O3T B;  4PC0 A;  3EQ7 A;  3I89 A;  3MUN A;  4PBZ A;  4AX4 A;  3K71 A;  3SBQ A;  5IC7 A;  5M5S A;  4WK4 A;  3B7F A;  4GQB B;  3IJC A;  4JSX C;  4E5Z A;  2CN2 A;  3VI4 A;  2AH1 A;  2OJY A;  3MXX A;  4GQ2 P;  3FCS A;  3RN1 D;  4K3I D;  4JD2 C;  3IKO A;  3MZK A;  2EIB A;  5THA A;  4FAV D;  5FKR A;  1Q47 A;  3ORV D;  2IWF A;  3IUN A;  3SHF A;  3SVW D;  2OIZ A;  2H14 A;  3E0C A;  1GP2 B;  2HJ4 A;  5IGO A;  1BPO A;  4PSX B;  2BKL A;  2AGX A;  2QR5 A;  4FA5 D;  3JB9 L;  2IAA A;  2YBA A;  1N6D A;  5TF2 A;  3IUQ A;  2MTA H;  4ERZ A;  3UKU C;  3UVL A;  4L3H D;  3VH0 A;  4AN1 A;  2XDW A;  2O9K A;  4FA1 D;  5M61 A;  2IUP A;  3C99 A;  5EAP A;  4A08 B;  4O3U B;  2VC2 A;  1A0R B;  1N6F A;  4JT5 C;  2WQ8 A;  3I7K A;  3EQ8 A;  5AMS A;  3ZDY A;  2OVR B;  1P22 A;  1QFM A;  4PSW B;  4JSP C;  2IUQ A;  3OL2 B;  3O4G A;  4TZ4 A;  3I7P A;  3EI3 A;  4LG8 A;  3IUR A;  3ODT A;  3NVQ A;  4GGC A;  5EMM B;  5IGQ A;  1MG3 A;  2H13 A;  3FRX A;  5M5U A;  2B4E A;  2PM9 B;  2TRC B;  5EAR A;  1U4C A;  4O45 A;  2J56 H;  4A08 A;  2XU7 A;  5K1C C;  1VE7 A;  1VZ2 A;  2AH0 A;  4U7A A;  4UM9 A;  5M5T A;  4J82 A;  4LG9 A;  3OL2 A;  4ZOZ A;  5HE1 B;  4AMY A;  3OKY A;  4A2L A;  2IUR A;  2PM7 B;  4ESG A;  4A0A B;  3UKR C;  3T3P A;  3IJ0 A;  4FA4 D;  2CN3 A;  3NID A;  4U1E I;  4J86 A;  4J78 A;  2I0R A;  1C9I A;  4JHP C;  5IJ7 E;  2B5L A;  2PM9 A;  1RI6 A;  1L5G A;  3EI1 A;  2I3S A;  2HU8 A;  4I79 A;  4GGA A;  4QT8 A;  4AEZ A;  3BG0 A;  5IJ8 E;  3EMH A;  3ZE2 A;  1SHY B;  1JMZ B;  3K27 A;  5AFU 3;  3JAM g;  1UOO A;  4A11 A;  5HE2 B;  1K3I A;  4EWR A;  4MMZ A;  4R7A B;  1T2X A;  4JHN A;  4E54 A;  3AL9 A;  5FA5 B;  5HYN B;  2EID A;  5I5M A;  4G1M A;  4CI1 A;  5CXB A;  2YNN A;  4IA9 A;  2CE9 A;  3ZE1 A;  5I5I A;  2HYE A;  5C2W B;  5HE3 B;  4XEI C;  1JJU B;  4X60 B;  4CY5 A;  2VDO A;  5C86 A;  2H68 A;  4FAN D;  3IJ1 A;  4O2W A;  5H17 A;  3UVK A;  4O02 A;  3JZN A;  3MUO A;  3I2N A;  2QXV A;  3UVN A;  5EAM A;  5FFG A;  2OVQ B;  2AGZ A;  5K19 A;  2YNP A;  3SBR A;  4AOW A;  3RRM C;  3EI2 B;  5FFO A;  1I2M B;  4WK2 A;  4CI2 A;  3GFC A;  4BH6 A;  4J0X A;  2H9L A;  1UOQ A;  4FB1 D;  3GC3 B;  3JPX A;  3PXT D;  2YMU A;  4A0B A;  4NAA A;  4BL0 A;  2CO0 A;  5M5V A;  4A09 B;  2UZY B;  2VDP A;  5AJA A;  4DNW A;  2HXC A;  3AL8 B;  3UVM A;  1PI6 A;  4J0W A;  4BCB A;  4BP9 A;  3IUL A;  4ES0 A;  2GC7 A;  4CZV A;  4GM9 A;  3EI2 A;  3PSC B;  3SN6 B;  4G56 B;  2EIC A;  3RSE C;  1B9X A;  1M1X A;  2UZX B;  2QZP A;  4QAM A;  2HES X;  4D9S A;  2XL2 A;  4J8B A;  3EU7 A;  3OF7 A;  2CO0 C;  1C9L A;  1B9Y A;  4J84 A;  2I0S A;  4JSV C;  4JXM A;  1QFS A;  4OWR A;  5FQD A;  4BP8 A;  1GOH A;  4J77 A;  4O1Q D;  4QL1 A;  1L0Q A;  4ERQ A;  3F3F A;  2J55 H;  3I7N A;  3OKT A;  4K3J B;  2G9A A;  1GOF A;  5EMJ B;  2GC4 A;  3I8C A;  4NBM A;  1K32 A;  1YFQ A;  3SCY A;  3I7L A;  4X61 B;  1H2Z A;  5TDH B;  1QNI A;  4IRZ A;  4X3E A;  3FM0 A;  4ERY A;  2Z2P A;  1MG2 A;  3J80 g;  4QRJ A;  3J81 g;  1TYQ C;  4Y5R D;  3PVW B;  5C92 A;  3BG1 A;  3DWL C;  3MVD K;  4YVD A;  3FGB A;  3PXS D;  4NEN A;  3K6S A;  1GOT B;  2P9K C;  5CYK B;  5FKT A;  2Z2N A;  3PSL A;  2BCJ B;  3JRP A;  4J79 A;  4JT6 C;  5FXY A;  4O9D A;  3C9C A;  2VZ1 A;  4ZOV A;  5SXM A;  3FCU A;  3V4V A;  3SWS D;  5GSA A;  1JV2 A;  2Q7Q A;  4MK0 B;  3IUM A;  1O6F A;  3SFZ A;  5M5R A;  1H2Y A;  3AFC A;  4J87 A;  3BWS A;  3O4I A;  3CIK B;  3V9F A;  3DXM C;  5CYK A;  4A0A A;  2BBK H;  3EI4 B;  4ZN4 A;  5FLX g;  4GMB A;  3I8E A;  2VDM A;  4QQE A;  2YB8 B;  2H9M A;  4PNK B;  2H9P A;  2CE8 A;  3OTT A;  1OLZ A;  5A2Q g;  3O4H A;  1TYE A;  3JZH A;  3PVU B;  1VYH C;  2HKM A;  4MMY A;  4X63 B;  1JOF A;  3SJL D;  2OVP B;  4CI8 A;  2B5N A;  4D0K A;  3DM0 A;  3CFV A;  1GG2 B;  4AMZ A;  4L1M A;  3RMZ D;  3F3G A;  5H1M A;  2JKX A;  3EI4 A;  1UTC A;  4GQ1 A;  4L9O A;  2AGY A;  4ZOX A;  4E5Z B;  3MZL A;  1PBY B;  4AN0 A;  1ERJ A;  2HJB A;  4Z7O A;  1NEX B;  4WJK A;  3OKW A;  3U4Y A;  4RE6 A;  2VDN A;  3KCI A;  4PBY A;  3P4F A;  5I5J A;  4XYH A;  1UOP A;  2H6N A;  4Z7Q A;  3RFH A;  5C9Z B;  2OK4 A;  3T3M A;  3QHY B;  4XYI A;  2Z2O A;  3A0F A;  3V5W B;  1R5M A;  1H2W A;  2IWK A;  4GM3 A;  2PM6 B;  4LGN A;  5E6R A;  1O6G A;  4Z7N A;  3MMY A;  5EM2 B;  2P9S C;  3MKS B;  2XE4 A;  1TBG A;  4H5J A;  3VI3 A;  3ZDZ A;  1JMX B;  4UM8 A;  1S4U X;  2H6Q A;  3L4O D;  2VZ3 A;  5HE0 B;  4HDJ A;  4CI3 A;  3F3P A;  4PXW A;  1E8N A;  4H5I A;  1VE6 A;  1H2X A;  2PBI B;  4CZY A;  2XL3 A;  3CFS B;  1YR2 A;  2J57 G;  3I7O A;  2EBS A;  3SBP A;  3IJE A;  4NSX A;  2VDK A;  4A09 A;  5EMK B;  3AL8 A;  4CY3 A;  3ZDX A;  3DSM A;  3V4P A;  5EM2 A;  1VZ3 A;  5GXI A;  3RLM D;  1XIP A;  1K8K C;  1U8C A;  2B5M A;  3EI3 B;  4GM8 A;  4L1Q D;  3JRO A;  5CXC B;  2W18 A;  4MMX A;  5GMK n;  3IIY A;  2XZG A;  3N0D A;  2CNX A;  2VDR A;  3IUJ A;  3UR4 A;  3KRW B;  3EWE A;  3OW8 A;  3QI0 A;  2P9N C;  2P9U C;  5C2V B;  4OZU A;  5KDO B;  3ULE C;  3W15 A;  2AQ5 A;  1PGU A;  2H3X A;  4KFM B;  3UVO A;  3ZE0 A;  1E8M A;  5FKS A;  4CY2 A;  2VDL A;  3PE7 A;  3O4J A;  3MKQ A;  3SLE D;  2H47 A;  4GZ8 A;  3OKY B;  5E6S A;  4Y7R A;  4ZOY A;  5IT9 g;  2OK6 A;  2H9N A;  5CXC A;  5TEF A;  4FHL A;  4J73 A;  5EAL A;  4CY1 A;  1MDA H;  3NIG A;  3HFQ A;  2VDQ A;  3JZG A;  2HU7 A;  3RFG A;  1PEV A;  4BCD A;  3EI1 B;  1XKS A;  1E5T A;  5HQG A;  4CC9 A;  4IMM A;  3GRE A;  2AGL A;  1SQ9 A;  1U2V C;  1SQJ A;  4A11 B;  5B4W A;  1A12 A;  4BUJ C;  4FWW A;  1N6E A;  2I3T A;  3L4M D;  2EIE A;  5JWZ A;  4G55 A;  4L3G D;  3ZWL B;  4E54 B;  1GXR A;  4Z8L A;  1NR0 A;  2G99 A;  4A7J A;  2IUV A;  3K26 A;  4GGD A;  5CXB B;  3GD1 I;  2HKR A;  4N14 A;  5E6U A;  3SMR A;  5H14 A;  1XHM A;  3C75 H;  4BCC A;  2H6K A;  5EML B;  2AGW A;  1JTD B;  4DNV A;  4UI9 R;  3I7H A;  2P9L C;  3NVN A;  2YNO A;  3N0E A;  4NC4 A;  3NIF A;  4JSN C;  3AH8 B;  3PXW D;  1GOG A;  1OMW B;  4CZX A;  3NVX A;  4J81 A;  5GXH A;  2P9I C;  4DNU A;  5TEE A;  3VA6 A;  3KRX B;  3IIW A;  3EG6 A;  2HU5 A;  4FA9 D;  3DDU A;  5HDB A;  3RN0 D;  3IVM A;  1FWX A; 
#chains in the Genus database with same CATH homology
 3VGZ A;  4A2M A;  4D6V A;  2XYI A;  2P9P C;  2GNQ A;  2QC5 A;  3C5M A;  3V7D B;  4J8G A;  5FKQ A;  3SXT D;  4A0B B;  3DXK C;  2I0T A;  4O3T B;  4PC0 A;  3I89 A;  4PBZ A;  3SBQ A;  5IC7 A;  3B7F A;  4GQB B;  3IJC A;  4JSX C;  4E5Z A;  2CN2 A;  2AH1 A;  2OJY A;  3MXX A;  4GQ2 P;  3RN1 D;  4K3I D;  4JD2 C;  3IKO A;  3MZK A;  5THA A;  4FAV D;  5FKR A;  1Q47 A;  3ORV D;  2IWF A;  3SHF A;  3SVW D;  2OIZ A;  2H14 A;  3E0C A;  1GP2 B;  2HJ4 A;  5IGO A;  4PSX B;  2AGX A;  4FA5 D;  3JB9 L;  2IAA A;  2YBA A;  1N6D A;  5TF2 A;  2MTA H;  4ERZ A;  3UKU C;  3UVL A;  4L3H D;  3VH0 A;  2O9K A;  4FA1 D;  2IUP A;  3C99 A;  5EAP A;  4A08 B;  4O3U B;  1A0R B;  1N6F A;  4JT5 C;  3I7K A;  5AMS A;  2OVR B;  1P22 A;  4PSW B;  4JSP C;  2IUQ A;  3OL2 B;  4TZ4 A;  3I7P A;  3EI3 A;  4LG8 A;  3ODT A;  3NVQ A;  4GGC A;  5EMM B;  5IGQ A;  1MG3 A;  2H13 A;  3FRX A;  2B4E A;  2PM9 B;  2TRC B;  5EAR A;  1U4C A;  4O45 A;  2J56 H;  4A08 A;  2XU7 A;  5K1C C;  2AH0 A;  4U7A A;  4J82 A;  4LG9 A;  3OL2 A;  4ZOZ A;  5HE1 B;  3OKY A;  4A2L A;  2IUR A;  2PM7 B;  4ESG A;  4A0A B;  3UKR C;  3IJ0 A;  4FA4 D;  2CN3 A;  4U1E I;  4J86 A;  4J78 A;  2I0R A;  5IJ7 E;  2B5L A;  2PM9 A;  1RI6 A;  3EI1 A;  2I3S A;  4I79 A;  4GGA A;  4QT8 A;  4AEZ A;  3BG0 A;  5IJ8 E;  3EMH A;  3JAM g;  1SHY B;  1JMZ B;  3K27 A;  5AFU 3;  4A11 A;  5HE2 B;  4EWR A;  4R7A B;  4E54 A;  3AL9 A;  5FA5 B;  5HYN B;  5I5M A;  4CI1 A;  5CXB A;  2YNN A;  4IA9 A;  2CE9 A;  5I5I A;  2HYE A;  5C2W B;  5HE3 B;  4XEI C;  1JJU B;  4X60 B;  4CY5 A;  2H68 A;  4FAN D;  3IJ1 A;  5H17 A;  3UVK A;  3JZN A;  3I2N A;  2QXV A;  3UVN A;  5EAM A;  2OVQ B;  2AGZ A;  5K19 A;  2YNP A;  3SBR A;  4AOW A;  3RRM C;  3EI2 B;  4CI2 A;  3GFC A;  4BH6 A;  4J0X A;  2H9L A;  4FB1 D;  3JPX A;  3PXT D;  2YMU A;  4A0B A;  4BL0 A;  2CO0 A;  4A09 B;  2UZY B;  5AJA A;  2HXC A;  3AL8 B;  3UVM A;  1PI6 A;  4J0W A;  4ES0 A;  2GC7 A;  4CZV A;  4GM9 A;  3EI2 A;  3PSC B;  3SN6 B;  4G56 B;  3RSE C;  1B9X A;  2UZX B;  2HES X;  2XL2 A;  4J8B A;  3EU7 A;  2CO0 C;  1B9Y A;  4J84 A;  2I0S A;  4JSV C;  4JXM A;  4OWR A;  5FQD A;  4J77 A;  4O1Q D;  4QL1 A;  1L0Q A;  4ERQ A;  3F3F A;  2J55 H;  3I7N A;  3OKT A;  4K3J B;  2G9A A;  5EMJ B;  2GC4 A;  3I8C A;  1K32 A;  1YFQ A;  3SCY A;  3I7L A;  4X61 B;  5TDH B;  1QNI A;  4ERY A;  4X3E A;  3FM0 A;  2Z2P A;  1MG2 A;  3J80 g;  4QRJ A;  3J81 g;  1TYQ C;  4Y5R D;  3PVW B;  3BG1 A;  3DWL C;  4YVD A;  3FGB A;  3PXS D;  1GOT B;  2P9K C;  5CYK B;  5FKT A;  2Z2N A;  3PSL A;  2BCJ B;  3JRP A;  4J79 A;  4JT6 C;  5FXY A;  4O9D A;  3C9C A;  4ZOV A;  5SXM A;  3SWS D;  5GSA A;  2Q7Q A;  4MK0 B;  3SFZ A;  3AFC A;  4J87 A;  3BWS A;  3CIK B;  3V9F A;  3DXM C;  5CYK A;  4A0A A;  2BBK H;  3EI4 B;  4ZN4 A;  5FLX g;  4GMB A;  3I8E A;  4QQE A;  2YB8 B;  2H9M A;  4PNK B;  2H9P A;  2CE8 A;  3OTT A;  1OLZ A;  5A2Q g;  3JZH A;  3PVU B;  1VYH C;  2HKM A;  4X63 B;  1JOF A;  3SJL D;  2OVP B;  4CI8 A;  2B5N A;  4D0K A;  3DM0 A;  3CFV A;  1GG2 B;  3RMZ D;  3F3G A;  5H1M A;  3EI4 A;  4GQ1 A;  4L9O A;  2AGY A;  4ZOX A;  4E5Z B;  3MZL A;  1PBY B;  1ERJ A;  2HJB A;  1NEX B;  3OKW A;  3U4Y A;  4PBY A;  3P4F A;  5I5J A;  4XYH A;  2H6N A;  3RFH A;  5C9Z B;  2OK4 A;  4XYI A;  2Z2O A;  3A0F A;  3V5W B;  1R5M A;  2IWK A;  4GM3 A;  2PM6 B;  4LGN A;  3MMY A;  5EM2 B;  2P9S C;  3MKS B;  1TBG A;  4H5J A;  1JMX B;  1S4U X;  2H6Q A;  3L4O D;  5HE0 B;  4HDJ A;  4CI3 A;  3F3P A;  4PXW A;  4H5I A;  2PBI B;  4CZY A;  2XL3 A;  3CFS B;  2J57 G;  3I7O A;  2EBS A;  3SBP A;  4NSX A;  4A09 A;  5EMK B;  3AL8 A;  4CY3 A;  3DSM A;  5EM2 A;  5GXI A;  3RLM D;  1XIP A;  1K8K C;  2B5M A;  3EI3 B;  4GM8 A;  4L1Q D;  3JRO A;  5CXC B;  2W18 A;  5GMK n;  3IIY A;  3N0D A;  2CNX A;  3UR4 A;  3KRW B;  3EWE A;  3OW8 A;  2P9N C;  2P9U C;  5C2V B;  4OZU A;  5KDO B;  3ULE C;  3W15 A;  2AQ5 A;  1PGU A;  2H3X A;  4KFM B;  3UVO A;  5FKS A;  4CY2 A;  3PE7 A;  3MKQ A;  3SLE D;  2H47 A;  4GZ8 A;  3OKY B;  4Y7R A;  4ZOY A;  5IT9 g;  2OK6 A;  2H9N A;  5CXC A;  5TEF A;  4FHL A;  4J73 A;  5EAL A;  4CY1 A;  1MDA H;  3HFQ A;  3JZG A;  3RFG A;  1PEV A;  3EI1 B;  1XKS A;  5HQG A;  4CC9 A;  4IMM A;  3GRE A;  2AGL A;  1SQ9 A;  1U2V C;  1SQJ A;  4A11 B;  5B4W A;  4BUJ C;  4FWW A;  1N6E A;  2I3T A;  3L4M D;  5JWZ A;  3ZWL B;  4L3G D;  4E54 B;  1GXR A;  4Z8L A;  1NR0 A;  2G99 A;  4A7J A;  2IUV A;  3K26 A;  4GGD A;  5CXB B;  2HKR A;  4N14 A;  3SMR A;  5H14 A;  1XHM A;  3C75 H;  2H6K A;  5EML B;  2AGW A;  4UI9 R;  3I7H A;  2P9L C;  3NVN A;  2YNO A;  3N0E A;  4JSN C;  3AH8 B;  3PXW D;  1OMW B;  4CZX A;  3NVX A;  4J81 A;  5GXH A;  2P9I C;  5TEE A;  3VA6 A;  3KRX B;  3IIW A;  3EG6 A;  4FA9 D;  3RN0 D;  1FWX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...