3JB9L

Cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
299
structure length
293
Chain Sequence
PNLQMFGHTAEVLVARFDPSGSYFASGGMDRQILLWNVFDVKNYGVLNGCKGAITDLQWSRDSRVVYCSSSDTHLMSWDAVSGQKIRKHKGHAGVVNALDVLKVSELLTSVSDDCTMKVWDSRSKDCIKTIEEKYPLTAVAIAQQGTQVFIGGIDGAIKIWDLRNNHCSHVLKGHKDIITSLAISKDGSSLLSNSMDNTVRIFDVKAQRQLQIFEGAIHGQEHNLLGVAWSRNSRFVGAGSSDKNVYVWSATGDLRYVLPGHEGSVNHVDFHPHQDIILSCSSDRTIFLGELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a yeast spliceosome at 3.6-angstrom resolution
pubmed doi rcsb
molecule tags Rna binding protein/rna
molecule keywords Pre-mRNA-splicing factor spp42
total genus 46
structure length 293
sequence length 299
ec nomenclature
pdb deposition date 2015-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3jb9L00
2CN2A 4FAND 1XIPA 3V9FA 2OK6A 4O1QD 3IJ1A 5EMLB 3KRXB 4E5ZA 3EI1B 2YNOA 2OVRB 2O9KA 5C2WB 4A0AB 4ESGA 1L0QA 3JROA 1ERJA 2CO0C 2HKRA 3OKYA 4J86A 3EI2B 5GSAA 2XYIA 3ORVD 3C9CA 3MXXA 3UVMA 3VH0A 4ZOZA 2CO0A 4G56B 2AH1A 4XYHA 1B9XA 2H9NA 4CI2A 4PBYA 4CZXA 3OKWA 3AL8A 5EARA 4BL0A 5AJAA 1NEXB 4FHLA 3RLMD 2H14A 5HE0B 1JMXB 3I7OA 5CXCA 5EM2A 2H3XA 4GGDA 2EBSA 5HQGA 1N6EA 4YVDA 1VYHC 1JOFA 2BBKH 3BWSA 4ERYA 3NVXA 4E5ZB 3V5WB 3SFZA 2GC7A 3OL2A 4PBZA 3JZHA 5C9ZB 1TYQC 4CI8A 3SLED 5EAPA 3UKUC 3IIYA 1PBYB 3MMYA 2Z2OA 5CXBA 2Q7QA 2QC5A 2YNNA 4FA9D 4CY1A 3RMZD 1OMWB 4JSNC 1R5MA 4CY3A 3K27A 4FA5D 2PM9A 4A08B 4J77A 3I8CA 2YB8B 3B7FA 2P9PC 4MK0B 3UR4A 1U2VC 4PXWA 4A0BB 4CY2A 4GMBA 5HYNB 4GZ8A 2H6QA 4J8GA 3PSLA 3OW8A 2OIZA 3ULEC 2OVQB 3PXSD 2G99A 3BG0A 3HFQA 4XYIA 3SBRA 1GXRA 4I79A 4QT8A 3RFHA 3JZGA 3I7HA 4GQBB 2CE8A 3IJCA 3SCYA 3AH8B 3I7NA 2P9NC 4JD2C 3PSCB 4PSXB 4CY5A 3PXWD 5IC7A 3SBQA 4HDJA 2HESX 4K3JB 2YMUA 4D0KA 3I8EA 4JSVC 3SJLD 4J73A 4A08A 2PBIB 2I3SA 3C5MA 4PNKB 5TF2A 1NR0A 3JPXA 1GOTB 3OKYB 2PM6B 3FM0A 5FQDA 4IMMA 4CI1A 2J57G 3ZWLB 2UZYB 4FAVD 5GXHA 5CXBB 1K8KC 2AGLA 4BH6A 5C2VB 3PXTD 3PVUB 2P9KC 4J0WA 4J78A 2CN3A 3EI3A 5HE1B 5EMMB 4LGNA 3DXKC 1YFQA 2H9MA 5THAA 2P9UC 5FKTA 3CIKB 4A2LA 2PM9B 5EAMA 2I0TA 3RN1D 3UVNA 4J79A 5FKQA 2I0SA 4AOWA 1PEVA 3GREA 5K19A 3C75H 2CNXA 4J87A 3OKTA 3IKOA 4H5IA 4U7AA 4JT5C 3KRWB 3MKSB 4J0XA 5HE3B 4J82A 2AGYA 2OJYA 3FRXA 1S4UX 4J8BA 4QL1A 4K3ID 5IGOA 3NVNA 4PC0A 3I7KA 5FKSA 4ZOVA 3N0DA 2B5LA 5SXMA 4JT6C 4GM9A 3I7PA 3EG6A 4ZN4A 3DXMC 1XHMA 1MG3A 2AGWA 1K32A 2H13A 1SHYB 2P9LC 5I5JA 2B5NA 2H9PA 2HXCA 1SQJA 3VGZA 4L9OA 2H6NA 4CZVA 3P4FA 1Q47A 1OLZA 1PGUA 4GQ1A 5IGQA 1JMZB 3L4MD 3GFCA 1MDAH 4A09B 3VA6A 5EALA 3UVOA 2OVPB 2HJBA 4ZOXA 2IUVA 5I5IA 5H14A 2H9LA 2XL2A 2J56H 2P9SC 3JRPA 3K26A 4BUJC 2PM7B 3DM0A 4FA4D 3F3PA 3OTTA 1P22A 5KDOB 4GM8A 2AQ5A 3IIWA 4PSWB 5FKRA 3PE7A 4H5JA 5CYKA 3V7DB 4E54B 2B4EA 4NSXA 4A2MA 3W15A 4U1EI 5B4WA 3C99A 4D6VA 3SN6B 2HYEA 5A2Qg 3UVKA 2GNQA 2AGXA 2J55H 5GXIA 1B9YA 2H68A 3SMRA 4GGAA 2IWFA 3F3FA 4CC9A 3EI2A 1XKSA 3SBPA 5K1CC 2XL3A 4J81A 5EM2B 4A0BA 4X3EA 3EI3B 3U4YA 1A0RB 1TBGA 3RN0D 4J84A 3JAMg 5FXYA 3ODTA 3AL8B 4L3GD 3A0FA 3RRMC 4IA9A 3J81g 4JXMA 4UI9R 2I3TA 5HE2B 3JB9L 3J80g 5FA5B 2IURA 4GGCA 2IWKA 5CXCB 4JSPC 5H1MA 4A09A 1FWXA 2W18A 3N0EA 3JZNA 1U4CA 5IJ8E 4GQ2P 3MZLA 3DWLC 4E54A 4A7JA 4O45A 3EU7A 3RFGA 3UVLA 3L4OD 4ZOYA 4Z8LA 4LG8A 5GMKn 5JWZA 3CFVA 1RI6A 4FA1D 5AFU3 4OWRA 4L1QD 2Z2NA 2CE9A 5AMSA 4LG9A 5TEFA 2H47A 4EWRA 3RSEC 2OK4A 5H17A 4X63B 1JJUB 1PI6A 1N6DA 4Y5RD 1SQ9A 2Z2PA 3E0CA 2HJ4A 4XEIC 4ERQA 4QRJA 3NVQA 3FGBA 4R7AB 3OL2B 4O3UB 2XU7A 3BG1A 3IJ0A 3I7LA 4TZ4A 4JSXC 2IAAA 1MG2A 2G9AA 3AFCA 5IT9g 4N14A 3DSMA 5EMJB 4Y7RA 3SVWD 2IUQA 4ES0A 4A11A 3SWSD 1GG2B 3I2NA 4O3TB 2TRCB 4X61B 2UZXB 4A0AA 3F3GA 3PVWB 5TDHB 3EI1A 4KFMB 2YNPA 2QXVA 3SHFA 3EI4A 5CYKB 5TEEA 4OZUA 1GP2B 3MKQA 2H6KA 2HKMA 3I89A 5EMKB 5IJ7E 3EMHA 3MZKA 4A11B 1N6FA 3AL9A 3CFSB 4L3HD 4AEZA 2BCJB 2MTAH 2P9IC 2B5MA 1QNIA 4CZYA 4CI3A 2AGZA 3EWEA 5I5MA 2GC4A 4O9DA 2IUPA 5FLXg 2I0RA 4GM3A 2AH0A 4FWWA 4QQEA 3EI4B 3SXTD 4X60B 4FB1D 4ERZA 3UKRC 2YBAA
chains in the Genus database with same CATH superfamily
2CN2A 4FAND 3MUNA 1XIPA 3V9FA 2OK6A 4O1QD 3VI3A 3IJ1A 5EMLB 3KRXB 2XE4A 4E5ZA 3EI1B 2YNOA 2OVRB 3MUOA 2O9KA 5C2WB 4A0AB 4MMYA 1E8NA 1L0QA 3JROA 4ESGA 1ERJA 2CO0C 2HKRA 3OKYA 4J86A 1QFSA 3EI2B 5GSAA 2XYIA 1UOOA 3ORVD 1O6GA 2EIBA 4Z7QA 3C9CA 5M5VA 3MXXA 3UVMA 3VH0A 1JTDB 1YR2A 4ZOZA 1M1XA 2CO0A 3DDUA 4G56B 2AH1A 4XYHA 1B9XA 2H9NA 4CI2A 4PBYA 4CZXA 3OKWA 3T3MA 3AL8A 4G1MA 5EARA 4BL0A 5AJAA 1NEXB 3KCIA 4FHLA 3RLMD 2H14A 1VZ3A 5HE0B 1JMXB 3I7OA 5CXCA 5EM2A 2H3XA 4GGDA 2EBSA 5E6SA 1QFMA 3ZE1A 5HQGA 1N6EA 4YVDA 1VYHC 1JOFA 2BBKH 3BWSA 4ERYA 3NVXA 3V4VA 1H2ZA 4E5ZB 2EICA 3V5WB 3SFZA 5M5TA 2GC7A 1VE6A 3OL2A 4PBZA 2HU8A 3JZHA 4UM9A 5C9ZB 2VDRA 1TYQC 4CI8A 3SLED 5EAPA 3UKUC 2VDOA 3IIYA 1PBYB 3MMYA 2Z2OA 5CXBA 2Q7QA 2QC5A 2YNNA 2EIDA 4AN1A 4FA9D 4CY1A 3RMZD 3ZDYA 1OMWB 3EQ8A 3IVMA 4JSNC 1R5MA 4CY3A 3K27A 4FA5D 2PM9A 4A08B 4J77A 3I8CA 1UTCA 2YB8B 3B7FA 2P9PC 4MK0B 3UR4A 1U2VC 3IURA 4PXWA 4A0BB 4CY2A 4GMBA 5HYNB 2VDPA 4GZ8A 5FFOA 2H6QA 4J8GA 3GC3B 3PSLA 4BCCA 3OW8A 2OIZA 3ULEC 2OVQB 1I2MB 3PXSD 2G99A 3BG0A 3HFQA 3ZE2A 4XYIA 2EIEA 3IJEA 3SBRA 1GXRA 4I79A 4QT8A 3RFHA 3K6SA 3JZGA 3O4IA 3I7HA 4GQBB 2CE8A 3IJCA 3SCYA 3AH8B 1E5TA 2P9NC 2VDNA 3I7NA 3PSCB 4JD2C 4PSXB 3PXWD 4CY5A 5IC7A 3SBQA 4HDJA 2HESX 4K3JB 2YMUA 4D0KA 4IRZA 4G55A 3I8EA 4JSVC 3SJLD 4J73A 4A08A 2PBIB 2I3SA 3C5MA 4PNKB 5TF2A 1NR0A 1VE7A 3JPXA 2VDMA 4Z7NA 1C9LA 4AMZA 1GOTB 1T2XA 3OKYB 2PM6B 3FM0A 5FQDA 4IMMA 4CI1A 2J57G 3ZWLB 2UZYB 2VZ3A 3IUJA 4WK2A 4FAVD 5GXHA 5CXBB 1UOPA 1K8KC 5HDBA 2AGLA 4BH6A 4DNVA 5C2VB 3PXTD 1TYEA 5FFGA 3PVUB 2P9KC 4WJKA 4J0WA 4J78A 2CN3A 4BCDA 2WQ8A 3IULA 3EI3A 4NENA 5HE1B 5EMMB 4LGNA 3DXKC 1YFQA 4RE5A 2H9MA 5THAA 2P9UC 5FKTA 3CIKB 4A2LA 2PM9B 5EAMA 2I0TA 3RN1D 3UVNA 4J79A 3ZDZA 5FKQA 2I0SA 3ZE0A 4AOWA 1PEVA 3GREA 5K19A 3C75H 2CNXA 3FCUA 4J87A 3OKTA 4WK0A 3IKOA 4H5IA 5M61A 4U7AA 2VDLA 4JT5C 3KRWB 3MKSB 1UOQA 4J0XA 5HE3B 4J82A 4RE6A 3O4JA 2AGYA 1VZ2A 2OJYA 3T3PA 3FRXA 1S4UX 5M5RA 4J8BA 4QL1A 4K3ID 5IGOA 4JHNA 3NVNA 4PC0A 2BKLA 3I7KA 3MVDK 5FKSA 4ZOVA 3N0DA 2QR5A 2B5LA 5SXMA 4JT6C 4GM9A 3I7PA 3UKRC 3EG6A 4ZN4A 4Z7OA 3DXMC 1XHMA 3IUNA 1MG3A 4G1EA 4DNUA 2AGWA 1E8MA 1K32A 1H2WA 2H13A 1SHYB 3QHYB 2P9LC 5I5JA 4QAMA 2B5NA 2H9PA 2HXCA 1SQJA 3VGZA 4L9OA 5C92A 2H6NA 4CZVA 3P4FA 4NC4A 5E6UA 1Q47A 1OLZA 2HU7A 1PGUA 3NIFA 4GQ1A 5IGQA 1JMZB 3L4MD 1U8CA 3GFCA 1MDAH 4A09B 3VA6A 5EALA 3UVOA 5M5SA 2OVPB 2HJBA 4ZOXA 1GOGA 2IUVA 4D9SA 1C9IA 5I5IA 5H14A 2H9LA 2XL2A 4L1MA 2J56H 2P9SC 3K26A 3JRPA 4UM8A 2PM7B 3DM0A 4BUJC 5M5UA 4FA4D 2VDQA 3F3PA 3OTTA 1P22A 5KDOB 4GM8A 2AQ5A 3IIWA 4PSWB 5FKRA 3PE7A 4H5JA 5CYKA 3V7DB 4E54B 2B4EA 3O4HA 4NSXA 4A2MA 3W15A 4U1EI 5B4WA 3C99A 4D6VA 3SN6B 2HYEA 5A2Qg 3UVKA 2GNQA 2AGXA 2J55H 4AN0A 5GXIA 1B9YA 2H68A 3SMRA 4GGAA 2HU5A 2IWFA 3F3FA 2VDKA 4CC9A 3EI2A 1XKSA 1BPOA 1A12A 3SBPA 5K1CC 2XL3A 3GD1I 4J81A 5EM2B 1H2YA 4A0BA 4X3EA 3EI3B 3U4YA 1A0RB 1TBGA 3RN0D 4J84A 3JAMg 5FXYA 3VI4A 3ODTA 3AL8B 4L3GD 3A0FA 3EQ9A 3RRMC 4IA9A 5C86A 3J81g 4JXMA 4UI9R 2I3TA 5HE2B 3JB9L 3J80g 5FA5B 3K71A 2IURA 4GGCA 4NBMA 2IWKA 1L5GA 5CXCB 4JSPC 5H1MA 4A09A 1FWXA 2W18A 1O6FA 3N0EA 3JZNA 1U4CA 1K3IA 4O02A 5IJ8E 4GQ2P 3MZLA 3DWLC 2VZ1A 4E54A 4A7JA 4O45A 3EU7A 3RFGA 3UVLA 3L4OD 3OF7A 4MMXA 4ZOYA 3O4GA 4Z8LA 4LG8A 5GMKn 5JWZA 3CFVA 2VC2A 3NIGA 1RI6A 4FA1D 5AFU3 4OWRA 4L1QD 2Z2NA 2CE9A 5AMSA 3QI0A 4LG9A 5TEFA 2H47A 4EWRA 3IUQA 3RSEC 2OK4A 5H17A 4X63B 1JJUB 1PI6A 1N6DA 4Y5RD 1SQ9A 1H2XA 2JKXA 2Z2PA 4NAAA 3E0CA 2HJ4A 4XEIC 4ERQA 4QRJA 3NVQA 4WK4A 3V4PA 3FGBA 4R7AB 2XDWA 3OL2B 4JHPC 4O3UB 2XU7A 3BG1A 3IJ0A 1JV2A 3I7LA 4TZ4A 4JSXC 2IAAA 1MG2A 2G9AA 3AFCA 4DNWA 5IT9g 5E6RA 4N14A 3DSMA 5EMJB 4Y7RA 3SVWD 2IUQA 4ES0A 4A11A 3SWSD 1GG2B 3I2NA 4O3TB 2TRCB 4X61B 2UZXB 4BP9A 4A0AA 4AX4A 1GOFA 3F3GA 3PVWB 4O2WA 5TDHB 3EI1A 4KFMB 2YNPA 4BP8A 2QXVA 3SHFA 4BCBA 3EI4A 3ZDXA 5CYKB 5TEEA 4OZUA 1GP2B 3MKQA 2H6KA 2HKMA 3I89A 5EMKB 5IJ7E 3EMHA 3MZKA 3FCSA 4A11B 1N6FA 3AL9A 3CFSB 2QZPA 4L3HD 3NIDA 1GOHA 4AEZA 4AMYA 2BCJB 3K72A 2MTAH 3IUMA 2XZGA 2P9IC 2B5MA 1QNIA 4CZYA 4CI3A 2AGZA 3EQ7A 3EWEA 5I5MA 2GC4A 4O9DA 2IUPA 5FLXg 2I0RA 4GM3A 2AH0A 4FWWA 4QQEA 3EI4B 3SXTD 4X60B 4FB1D 4ERZA 4MMZA 2YBAA
chains in the Genus database with same CATH topology
2CN2A 4FAND 1XIPA 3V9FA 2OK6A 4O1QD 3IJ1A 5EMLB 3KRXB 4E5ZA 3EI1B 2YNOA 2OVRB 2O9KA 5C2WB 4A0AB 4ESGA 1L0QA 3JROA 1ERJA 2CO0C 2HKRA 3OKYA 4J86A 3EI2B 5GSAA 2XYIA 3ORVD 3C9CA 3MXXA 3UVMA 3VH0A 4ZOZA 2CO0A 4G56B 2AH1A 4XYHA 1B9XA 2H9NA 4CI2A 4PBYA 4CZXA 3OKWA 3AL8A 5EARA 4BL0A 5AJAA 1NEXB 4FHLA 3RLMD 2H14A 5HE0B 1JMXB 3I7OA 5CXCA 5EM2A 2H3XA 4GGDA 2EBSA 5HQGA 1N6EA 4YVDA 1VYHC 1JOFA 2BBKH 3BWSA 4ERYA 3NVXA 4E5ZB 3V5WB 3SFZA 2GC7A 3OL2A 4PBZA 3JZHA 5C9ZB 1TYQC 4CI8A 3SLED 5EAPA 3UKUC 3IIYA 1PBYB 3MMYA 2Z2OA 5CXBA 2Q7QA 2QC5A 2YNNA 4FA9D 4CY1A 3RMZD 1OMWB 4JSNC 1R5MA 4CY3A 3K27A 4FA5D 2PM9A 4A08B 4J77A 3I8CA 2YB8B 3B7FA 2P9PC 4MK0B 3UR4A 1U2VC 4PXWA 4A0BB 4CY2A 4GMBA 5HYNB 4GZ8A 2H6QA 4J8GA 3PSLA 3OW8A 2OIZA 3ULEC 2OVQB 3PXSD 2G99A 3BG0A 3HFQA 4XYIA 3SBRA 1GXRA 4I79A 4QT8A 3RFHA 3JZGA 3I7HA 4GQBB 2CE8A 3IJCA 3SCYA 3AH8B 3I7NA 2P9NC 4JD2C 3PSCB 4PSXB 4CY5A 3PXWD 5IC7A 3SBQA 4HDJA 2HESX 4K3JB 2YMUA 4D0KA 3I8EA 4JSVC 3SJLD 4J73A 4A08A 2PBIB 2I3SA 3C5MA 4PNKB 5TF2A 1NR0A 3JPXA 1GOTB 3OKYB 2PM6B 3FM0A 5FQDA 4IMMA 4CI1A 2J57G 3ZWLB 2UZYB 4FAVD 5GXHA 5CXBB 1K8KC 2AGLA 4BH6A 5C2VB 3PXTD 3PVUB 2P9KC 4J0WA 4J78A 2CN3A 3EI3A 5HE1B 5EMMB 4LGNA 3DXKC 1YFQA 2H9MA 5THAA 2P9UC 5FKTA 3CIKB 4A2LA 2PM9B 5EAMA 2I0TA 3RN1D 3UVNA 4J79A 5FKQA 2I0SA 4AOWA 1PEVA 3GREA 5K19A 3C75H 2CNXA 4J87A 3OKTA 3IKOA 4H5IA 4U7AA 4JT5C 3KRWB 3MKSB 4J0XA 5HE3B 4J82A 2AGYA 2OJYA 3FRXA 1S4UX 4J8BA 4QL1A 4K3ID 5IGOA 3NVNA 4PC0A 3I7KA 5FKSA 4ZOVA 3N0DA 2B5LA 5SXMA 4JT6C 4GM9A 3I7PA 3EG6A 4ZN4A 3DXMC 1XHMA 1MG3A 2AGWA 1K32A 2H13A 1SHYB 2P9LC 5I5JA 2B5NA 2H9PA 2HXCA 1SQJA 3VGZA 4L9OA 2H6NA 4CZVA 3P4FA 1Q47A 1OLZA 1PGUA 4GQ1A 5IGQA 1JMZB 3L4MD 3GFCA 1MDAH 4A09B 3VA6A 5EALA 3UVOA 2OVPB 2HJBA 4ZOXA 2IUVA 5I5IA 5H14A 2H9LA 2XL2A 2J56H 2P9SC 3JRPA 3K26A 4BUJC 2PM7B 3DM0A 4FA4D 3F3PA 3OTTA 1P22A 5KDOB 4GM8A 2AQ5A 3IIWA 4PSWB 5FKRA 3PE7A 4H5JA 5CYKA 3V7DB 4E54B 2B4EA 4NSXA 4A2MA 3W15A 4U1EI 5B4WA 3C99A 4D6VA 3SN6B 2HYEA 5A2Qg 3UVKA 2GNQA 2AGXA 2J55H 5GXIA 1B9YA 2H68A 3SMRA 4GGAA 2IWFA 3F3FA 4CC9A 3EI2A 1XKSA 3SBPA 5K1CC 2XL3A 4J81A 5EM2B 4A0BA 4X3EA 3EI3B 3U4YA 1A0RB 1TBGA 3RN0D 4J84A 3JAMg 5FXYA 3ODTA 3AL8B 4L3GD 3A0FA 3RRMC 4IA9A 3J81g 4JXMA 4UI9R 2I3TA 5HE2B 3JB9L 3J80g 5FA5B 2IURA 4GGCA 2IWKA 5CXCB 4JSPC 5H1MA 4A09A 1FWXA 2W18A 3N0EA 3JZNA 1U4CA 5IJ8E 4GQ2P 3MZLA 3DWLC 4E54A 4A7JA 4O45A 3EU7A 3RFGA 3UVLA 3L4OD 4ZOYA 4Z8LA 4LG8A 5GMKn 5JWZA 3CFVA 1RI6A 4FA1D 5AFU3 4OWRA 4L1QD 2Z2NA 2CE9A 5AMSA 4LG9A 5TEFA 2H47A 4EWRA 3RSEC 2OK4A 5H17A 4X63B 1JJUB 1PI6A 1N6DA 4Y5RD 1SQ9A 2Z2PA 3E0CA 2HJ4A 4XEIC 4ERQA 4QRJA 3NVQA 3FGBA 4R7AB 3OL2B 4O3UB 2XU7A 3BG1A 3IJ0A 3I7LA 4TZ4A 4JSXC 2IAAA 1MG2A 2G9AA 3AFCA 5IT9g 4N14A 3DSMA 5EMJB 4Y7RA 3SVWD 2IUQA 4ES0A 4A11A 3SWSD 1GG2B 3I2NA 4O3TB 2TRCB 4X61B 2UZXB 4A0AA 3F3GA 3PVWB 5TDHB 3EI1A 4KFMB 2YNPA 2QXVA 3SHFA 3EI4A 5CYKB 5TEEA 4OZUA 1GP2B 3MKQA 2H6KA 2HKMA 3I89A 5EMKB 5IJ7E 3EMHA 3MZKA 4A11B 1N6FA 3AL9A 3CFSB 4L3HD 4AEZA 2BCJB 2MTAH 2P9IC 2B5MA 1QNIA 4CZYA 4CI3A 2AGZA 3EWEA 5I5MA 2GC4A 4O9DA 2IUPA 5FLXg 2I0RA 4GM3A 2AH0A 4FWWA 4QQEA 3EI4B 3SXTD 4X60B 4FB1D 4ERZA 3UKRC 2YBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CN2 A;  4FAN D;  1XIP A;  3V9F A;  2OK6 A;  4O1Q D;  3IJ1 A;  5EML B;  3KRX B;  4E5Z A;  3EI1 B;  2YNO A;  2OVR B;  2O9K A;  5C2W B;  4A0A B;  4ESG A;  1L0Q A;  3JRO A;  1ERJ A;  2CO0 C;  2HKR A;  3OKY A;  4J86 A;  3EI2 B;  5GSA A;  2XYI A;  3ORV D;  3C9C A;  3MXX A;  3UVM A;  3VH0 A;  4ZOZ A;  2CO0 A;  4G56 B;  2AH1 A;  4XYH A;  1B9X A;  2H9N A;  4CI2 A;  4PBY A;  4CZX A;  3OKW A;  3AL8 A;  5EAR A;  4BL0 A;  5AJA A;  1NEX B;  4FHL A;  3RLM D;  2H14 A;  5HE0 B;  1JMX B;  3I7O A;  5CXC A;  5EM2 A;  2H3X A;  4GGD A;  2EBS A;  5HQG A;  1N6E A;  4YVD A;  1VYH C;  1JOF A;  2BBK H;  3BWS A;  4ERY A;  3NVX A;  4E5Z B;  3V5W B;  3SFZ A;  2GC7 A;  3OL2 A;  4PBZ A;  3JZH A;  5C9Z B;  1TYQ C;  4CI8 A;  3SLE D;  5EAP A;  3UKU C;  3IIY A;  1PBY B;  3MMY A;  2Z2O A;  5CXB A;  2Q7Q A;  2QC5 A;  2YNN A;  4FA9 D;  4CY1 A;  3RMZ D;  1OMW B;  4JSN C;  1R5M A;  4CY3 A;  3K27 A;  4FA5 D;  2PM9 A;  4A08 B;  4J77 A;  3I8C A;  2YB8 B;  3B7F A;  2P9P C;  4MK0 B;  3UR4 A;  1U2V C;  4PXW A;  4A0B B;  4CY2 A;  4GMB A;  5HYN B;  4GZ8 A;  2H6Q A;  4J8G A;  3PSL A;  3OW8 A;  2OIZ A;  3ULE C;  2OVQ B;  3PXS D;  2G99 A;  3BG0 A;  3HFQ A;  4XYI A;  3SBR A;  1GXR A;  4I79 A;  4QT8 A;  3RFH A;  3JZG A;  3I7H A;  4GQB B;  2CE8 A;  3IJC A;  3SCY A;  3AH8 B;  3I7N A;  2P9N C;  4JD2 C;  3PSC B;  4PSX B;  4CY5 A;  3PXW D;  5IC7 A;  3SBQ A;  4HDJ A;  2HES X;  4K3J B;  2YMU A;  4D0K A;  3I8E A;  4JSV C;  3SJL D;  4J73 A;  4A08 A;  2PBI B;  2I3S A;  3C5M A;  4PNK B;  5TF2 A;  1NR0 A;  3JPX A;  1GOT B;  3OKY B;  2PM6 B;  3FM0 A;  5FQD A;  4IMM A;  4CI1 A;  2J57 G;  3ZWL B;  2UZY B;  4FAV D;  5GXH A;  5CXB B;  1K8K C;  2AGL A;  4BH6 A;  5C2V B;  3PXT D;  3PVU B;  2P9K C;  4J0W A;  4J78 A;  2CN3 A;  3EI3 A;  5HE1 B;  5EMM B;  4LGN A;  3DXK C;  1YFQ A;  2H9M A;  5THA A;  2P9U C;  5FKT A;  3CIK B;  4A2L A;  2PM9 B;  5EAM A;  2I0T A;  3RN1 D;  3UVN A;  4J79 A;  5FKQ A;  2I0S A;  4AOW A;  1PEV A;  3GRE A;  5K19 A;  3C75 H;  2CNX A;  4J87 A;  3OKT A;  3IKO A;  4H5I A;  4U7A A;  4JT5 C;  3KRW B;  3MKS B;  4J0X A;  5HE3 B;  4J82 A;  2AGY A;  2OJY A;  3FRX A;  1S4U X;  4J8B A;  4QL1 A;  4K3I D;  5IGO A;  3NVN A;  4PC0 A;  3I7K A;  5FKS A;  4ZOV A;  3N0D A;  2B5L A;  5SXM A;  4JT6 C;  4GM9 A;  3I7P A;  3EG6 A;  4ZN4 A;  3DXM C;  1XHM A;  1MG3 A;  2AGW A;  1K32 A;  2H13 A;  1SHY B;  2P9L C;  5I5J A;  2B5N A;  2H9P A;  2HXC A;  1SQJ A;  3VGZ A;  4L9O A;  2H6N A;  4CZV A;  3P4F A;  1Q47 A;  1OLZ A;  1PGU A;  4GQ1 A;  5IGQ A;  1JMZ B;  3L4M D;  3GFC A;  1MDA H;  4A09 B;  3VA6 A;  5EAL A;  3UVO A;  2OVP B;  2HJB A;  4ZOX A;  2IUV A;  5I5I A;  5H14 A;  2H9L A;  2XL2 A;  2J56 H;  2P9S C;  3JRP A;  3K26 A;  4BUJ C;  2PM7 B;  3DM0 A;  4FA4 D;  3F3P A;  3OTT A;  1P22 A;  5KDO B;  4GM8 A;  2AQ5 A;  3IIW A;  4PSW B;  5FKR A;  3PE7 A;  4H5J A;  5CYK A;  3V7D B;  4E54 B;  2B4E A;  4NSX A;  4A2M A;  3W15 A;  4U1E I;  5B4W A;  3C99 A;  4D6V A;  3SN6 B;  2HYE A;  5A2Q g;  3UVK A;  2GNQ A;  2AGX A;  2J55 H;  5GXI A;  1B9Y A;  2H68 A;  3SMR A;  4GGA A;  2IWF A;  3F3F A;  4CC9 A;  3EI2 A;  1XKS A;  3SBP A;  5K1C C;  2XL3 A;  4J81 A;  5EM2 B;  4A0B A;  4X3E A;  3EI3 B;  3U4Y A;  1A0R B;  1TBG A;  3RN0 D;  4J84 A;  3JAM g;  5FXY A;  3ODT A;  3AL8 B;  4L3G D;  3A0F A;  3RRM C;  4IA9 A;  3J81 g;  4JXM A;  4UI9 R;  2I3T A;  5HE2 B;  3JB9 L;  3J80 g;  5FA5 B;  2IUR A;  4GGC A;  2IWK A;  5CXC B;  4JSP C;  5H1M A;  4A09 A;  1FWX A;  2W18 A;  3N0E A;  3JZN A;  1U4C A;  5IJ8 E;  4GQ2 P;  3MZL A;  3DWL C;  4E54 A;  4A7J A;  4O45 A;  3EU7 A;  3RFG A;  3UVL A;  3L4O D;  4ZOY A;  4Z8L A;  4LG8 A;  5GMK n;  5JWZ A;  3CFV A;  1RI6 A;  4FA1 D;  5AFU 3;  4OWR A;  4L1Q D;  2Z2N A;  2CE9 A;  5AMS A;  4LG9 A;  5TEF A;  2H47 A;  4EWR A;  3RSE C;  2OK4 A;  5H17 A;  4X63 B;  1JJU B;  1PI6 A;  1N6D A;  4Y5R D;  1SQ9 A;  2Z2P A;  3E0C A;  2HJ4 A;  4XEI C;  4ERQ A;  4QRJ A;  3NVQ A;  3FGB A;  4R7A B;  3OL2 B;  4O3U B;  2XU7 A;  3BG1 A;  3IJ0 A;  3I7L A;  4TZ4 A;  4JSX C;  2IAA A;  1MG2 A;  2G9A A;  3AFC A;  5IT9 g;  4N14 A;  3DSM A;  5EMJ B;  4Y7R A;  3SVW D;  2IUQ A;  4ES0 A;  4A11 A;  3SWS D;  1GG2 B;  3I2N A;  4O3T B;  2TRC B;  4X61 B;  2UZX B;  4A0A A;  3F3G A;  3PVW B;  5TDH B;  3EI1 A;  4KFM B;  2YNP A;  2QXV A;  3SHF A;  3EI4 A;  5CYK B;  5TEE A;  4OZU A;  1GP2 B;  3MKQ A;  2H6K A;  2HKM A;  3I89 A;  5EMK B;  5IJ7 E;  3EMH A;  3MZK A;  4A11 B;  1N6F A;  3AL9 A;  3CFS B;  4L3H D;  4AEZ A;  2BCJ B;  2MTA H;  2P9I C;  2B5M A;  1QNI A;  4CZY A;  4CI3 A;  2AGZ A;  3EWE A;  5I5M A;  2GC4 A;  4O9D A;  2IUP A;  5FLX g;  2I0R A;  4GM3 A;  2AH0 A;  4FWW A;  4QQE A;  3EI4 B;  3SXT D;  4X60 B;  4FB1 D;  4ERZ A;  3UKR C;  2YBA A; 
#chains in the Genus database with same CATH topology
 2CN2 A;  4FAN D;  3MUN A;  1XIP A;  3V9F A;  2OK6 A;  4O1Q D;  3VI3 A;  3IJ1 A;  5EML B;  3KRX B;  2XE4 A;  4E5Z A;  3EI1 B;  2YNO A;  2OVR B;  3MUO A;  2O9K A;  5C2W B;  4A0A B;  4MMY A;  1E8N A;  1L0Q A;  3JRO A;  4ESG A;  1ERJ A;  2CO0 C;  2HKR A;  3OKY A;  4J86 A;  1QFS A;  3EI2 B;  5GSA A;  2XYI A;  1UOO A;  3ORV D;  1O6G A;  2EIB A;  4Z7Q A;  3C9C A;  5M5V A;  3MXX A;  3UVM A;  3VH0 A;  1JTD B;  1YR2 A;  4ZOZ A;  1M1X A;  2CO0 A;  3DDU A;  4G56 B;  2AH1 A;  4XYH A;  1B9X A;  2H9N A;  4CI2 A;  4PBY A;  4CZX A;  3OKW A;  3T3M A;  3AL8 A;  4G1M A;  5EAR A;  4BL0 A;  5AJA A;  1NEX B;  3KCI A;  4FHL A;  3RLM D;  2H14 A;  1VZ3 A;  5HE0 B;  1JMX B;  3I7O A;  5CXC A;  5EM2 A;  2H3X A;  4GGD A;  2EBS A;  5E6S A;  1QFM A;  3ZE1 A;  5HQG A;  1N6E A;  4YVD A;  1VYH C;  1JOF A;  2BBK H;  3BWS A;  4ERY A;  3NVX A;  3V4V A;  1H2Z A;  4E5Z B;  2EIC A;  3V5W B;  3SFZ A;  5M5T A;  2GC7 A;  1VE6 A;  3OL2 A;  4PBZ A;  2HU8 A;  3JZH A;  4UM9 A;  5C9Z B;  2VDR A;  1TYQ C;  4CI8 A;  3SLE D;  5EAP A;  3UKU C;  2VDO A;  3IIY A;  1PBY B;  3MMY A;  2Z2O A;  5CXB A;  2Q7Q A;  2QC5 A;  2YNN A;  2EID A;  4AN1 A;  4FA9 D;  4CY1 A;  3RMZ D;  3ZDY A;  1OMW B;  3EQ8 A;  3IVM A;  4JSN C;  1R5M A;  4CY3 A;  3K27 A;  4FA5 D;  2PM9 A;  4A08 B;  4J77 A;  3I8C A;  1UTC A;  2YB8 B;  3B7F A;  2P9P C;  4MK0 B;  3UR4 A;  1U2V C;  3IUR A;  4PXW A;  4A0B B;  4CY2 A;  4GMB A;  5HYN B;  2VDP A;  4GZ8 A;  5FFO A;  2H6Q A;  4J8G A;  3GC3 B;  3PSL A;  4BCC A;  3OW8 A;  2OIZ A;  3ULE C;  2OVQ B;  1I2M B;  3PXS D;  2G99 A;  3BG0 A;  3HFQ A;  3ZE2 A;  4XYI A;  2EIE A;  3IJE A;  3SBR A;  1GXR A;  4I79 A;  4QT8 A;  3RFH A;  3K6S A;  3JZG A;  3O4I A;  3I7H A;  4GQB B;  2CE8 A;  3IJC A;  3SCY A;  3AH8 B;  1E5T A;  2P9N C;  2VDN A;  3I7N A;  3PSC B;  4JD2 C;  4PSX B;  3PXW D;  4CY5 A;  5IC7 A;  3SBQ A;  4HDJ A;  2HES X;  4K3J B;  2YMU A;  4D0K A;  4IRZ A;  4G55 A;  3I8E A;  4JSV C;  3SJL D;  4J73 A;  4A08 A;  2PBI B;  2I3S A;  3C5M A;  4PNK B;  5TF2 A;  1NR0 A;  1VE7 A;  3JPX A;  2VDM A;  4Z7N A;  1C9L A;  4AMZ A;  1GOT B;  1T2X A;  3OKY B;  2PM6 B;  3FM0 A;  5FQD A;  4IMM A;  4CI1 A;  2J57 G;  3ZWL B;  2UZY B;  2VZ3 A;  3IUJ A;  4WK2 A;  4FAV D;  5GXH A;  5CXB B;  1UOP A;  1K8K C;  5HDB A;  2AGL A;  4BH6 A;  4DNV A;  5C2V B;  3PXT D;  1TYE A;  5FFG A;  3PVU B;  2P9K C;  4WJK A;  4J0W A;  4J78 A;  2CN3 A;  4BCD A;  2WQ8 A;  3IUL A;  3EI3 A;  4NEN A;  5HE1 B;  5EMM B;  4LGN A;  3DXK C;  1YFQ A;  4RE5 A;  2H9M A;  5THA A;  2P9U C;  5FKT A;  3CIK B;  4A2L A;  2PM9 B;  5EAM A;  2I0T A;  3RN1 D;  3UVN A;  4J79 A;  3ZDZ A;  5FKQ A;  2I0S A;  3ZE0 A;  4AOW A;  1PEV A;  3GRE A;  5K19 A;  3C75 H;  2CNX A;  3FCU A;  4J87 A;  3OKT A;  4WK0 A;  3IKO A;  4H5I A;  5M61 A;  4U7A A;  2VDL A;  4JT5 C;  3KRW B;  3MKS B;  1UOQ A;  4J0X A;  5HE3 B;  4J82 A;  4RE6 A;  3O4J A;  2AGY A;  1VZ2 A;  2OJY A;  3T3P A;  3FRX A;  1S4U X;  5M5R A;  4J8B A;  4QL1 A;  4K3I D;  5IGO A;  4JHN A;  3NVN A;  4PC0 A;  2BKL A;  3I7K A;  3MVD K;  5FKS A;  4ZOV A;  3N0D A;  2QR5 A;  2B5L A;  5SXM A;  4JT6 C;  4GM9 A;  3I7P A;  3UKR C;  3EG6 A;  4ZN4 A;  4Z7O A;  3DXM C;  1XHM A;  3IUN A;  1MG3 A;  4G1E A;  4DNU A;  2AGW A;  1E8M A;  1K32 A;  1H2W A;  2H13 A;  1SHY B;  3QHY B;  2P9L C;  5I5J A;  4QAM A;  2B5N A;  2H9P A;  2HXC A;  1SQJ A;  3VGZ A;  4L9O A;  5C92 A;  2H6N A;  4CZV A;  3P4F A;  4NC4 A;  5E6U A;  1Q47 A;  1OLZ A;  2HU7 A;  1PGU A;  3NIF A;  4GQ1 A;  5IGQ A;  1JMZ B;  3L4M D;  1U8C A;  3GFC A;  1MDA H;  4A09 B;  3VA6 A;  5EAL A;  3UVO A;  5M5S A;  2OVP B;  2HJB A;  4ZOX A;  1GOG A;  2IUV A;  4D9S A;  1C9I A;  5I5I A;  5H14 A;  2H9L A;  2XL2 A;  4L1M A;  2J56 H;  2P9S C;  3K26 A;  3JRP A;  4UM8 A;  2PM7 B;  3DM0 A;  4BUJ C;  5M5U A;  4FA4 D;  2VDQ A;  3F3P A;  3OTT A;  1P22 A;  5KDO B;  4GM8 A;  2AQ5 A;  3IIW A;  4PSW B;  5FKR A;  3PE7 A;  4H5J A;  5CYK A;  3V7D B;  4E54 B;  2B4E A;  3O4H A;  4NSX A;  4A2M A;  3W15 A;  4U1E I;  5B4W A;  3C99 A;  4D6V A;  3SN6 B;  2HYE A;  5A2Q g;  3UVK A;  2GNQ A;  2AGX A;  2J55 H;  4AN0 A;  5GXI A;  1B9Y A;  2H68 A;  3SMR A;  4GGA A;  2HU5 A;  2IWF A;  3F3F A;  2VDK A;  4CC9 A;  3EI2 A;  1XKS A;  1BPO A;  1A12 A;  3SBP A;  5K1C C;  2XL3 A;  3GD1 I;  4J81 A;  5EM2 B;  1H2Y A;  4A0B A;  4X3E A;  3EI3 B;  3U4Y A;  1A0R B;  1TBG A;  3RN0 D;  4J84 A;  3JAM g;  5FXY A;  3VI4 A;  3ODT A;  3AL8 B;  4L3G D;  3A0F A;  3EQ9 A;  3RRM C;  4IA9 A;  5C86 A;  3J81 g;  4JXM A;  4UI9 R;  2I3T A;  5HE2 B;  3JB9 L;  3J80 g;  5FA5 B;  3K71 A;  2IUR A;  4GGC A;  4NBM A;  2IWK A;  1L5G A;  5CXC B;  4JSP C;  5H1M A;  4A09 A;  1FWX A;  2W18 A;  1O6F A;  3N0E A;  3JZN A;  1U4C A;  1K3I A;  4O02 A;  5IJ8 E;  4GQ2 P;  3MZL A;  3DWL C;  2VZ1 A;  4E54 A;  4A7J A;  4O45 A;  3EU7 A;  3RFG A;  3UVL A;  3L4O D;  3OF7 A;  4MMX A;  4ZOY A;  3O4G A;  4Z8L A;  4LG8 A;  5GMK n;  5JWZ A;  3CFV A;  2VC2 A;  3NIG A;  1RI6 A;  4FA1 D;  5AFU 3;  4OWR A;  4L1Q D;  2Z2N A;  2CE9 A;  5AMS A;  3QI0 A;  4LG9 A;  5TEF A;  2H47 A;  4EWR A;  3IUQ A;  3RSE C;  2OK4 A;  5H17 A;  4X63 B;  1JJU B;  1PI6 A;  1N6D A;  4Y5R D;  1SQ9 A;  1H2X A;  2JKX A;  2Z2P A;  4NAA A;  3E0C A;  2HJ4 A;  4XEI C;  4ERQ A;  4QRJ A;  3NVQ A;  4WK4 A;  3V4P A;  3FGB A;  4R7A B;  2XDW A;  3OL2 B;  4JHP C;  4O3U B;  2XU7 A;  3BG1 A;  3IJ0 A;  1JV2 A;  3I7L A;  4TZ4 A;  4JSX C;  2IAA A;  1MG2 A;  2G9A A;  3AFC A;  4DNW A;  5IT9 g;  5E6R A;  4N14 A;  3DSM A;  5EMJ B;  4Y7R A;  3SVW D;  2IUQ A;  4ES0 A;  4A11 A;  3SWS D;  1GG2 B;  3I2N A;  4O3T B;  2TRC B;  4X61 B;  2UZX B;  4BP9 A;  4A0A A;  4AX4 A;  1GOF A;  3F3G A;  3PVW B;  4O2W A;  5TDH B;  3EI1 A;  4KFM B;  2YNP A;  4BP8 A;  2QXV A;  3SHF A;  4BCB A;  3EI4 A;  3ZDX A;  5CYK B;  5TEE A;  4OZU A;  1GP2 B;  3MKQ A;  2H6K A;  2HKM A;  3I89 A;  5EMK B;  5IJ7 E;  3EMH A;  3MZK A;  3FCS A;  4A11 B;  1N6F A;  3AL9 A;  3CFS B;  2QZP A;  4L3H D;  3NID A;  1GOH A;  4AEZ A;  4AMY A;  2BCJ B;  3K72 A;  2MTA H;  3IUM A;  2XZG A;  2P9I C;  2B5M A;  1QNI A;  4CZY A;  4CI3 A;  2AGZ A;  3EQ7 A;  3EWE A;  5I5M A;  2GC4 A;  4O9D A;  2IUP A;  5FLX g;  2I0R A;  4GM3 A;  2AH0 A;  4FWW A;  4QQE A;  3EI4 B;  3SXT D;  4X60 B;  4FB1 D;  4ERZ A;  4MMZ A;  2YBA A; 
#chains in the Genus database with same CATH homology
 2CN2 A;  4FAN D;  1XIP A;  3V9F A;  2OK6 A;  4O1Q D;  3IJ1 A;  5EML B;  3KRX B;  4E5Z A;  3EI1 B;  2YNO A;  2OVR B;  2O9K A;  5C2W B;  4A0A B;  4ESG A;  1L0Q A;  3JRO A;  1ERJ A;  2CO0 C;  2HKR A;  3OKY A;  4J86 A;  3EI2 B;  5GSA A;  2XYI A;  3ORV D;  3C9C A;  3MXX A;  3UVM A;  3VH0 A;  4ZOZ A;  2CO0 A;  4G56 B;  2AH1 A;  4XYH A;  1B9X A;  2H9N A;  4CI2 A;  4PBY A;  4CZX A;  3OKW A;  3AL8 A;  5EAR A;  4BL0 A;  5AJA A;  1NEX B;  4FHL A;  3RLM D;  2H14 A;  5HE0 B;  1JMX B;  3I7O A;  5CXC A;  5EM2 A;  2H3X A;  4GGD A;  2EBS A;  5HQG A;  1N6E A;  4YVD A;  1VYH C;  1JOF A;  2BBK H;  3BWS A;  4ERY A;  3NVX A;  4E5Z B;  3V5W B;  3SFZ A;  2GC7 A;  3OL2 A;  4PBZ A;  3JZH A;  5C9Z B;  1TYQ C;  4CI8 A;  3SLE D;  5EAP A;  3UKU C;  3IIY A;  1PBY B;  3MMY A;  2Z2O A;  5CXB A;  2Q7Q A;  2QC5 A;  2YNN A;  4FA9 D;  4CY1 A;  3RMZ D;  1OMW B;  4JSN C;  1R5M A;  4CY3 A;  3K27 A;  4FA5 D;  2PM9 A;  4A08 B;  4J77 A;  3I8C A;  2YB8 B;  3B7F A;  2P9P C;  4MK0 B;  3UR4 A;  1U2V C;  4PXW A;  4A0B B;  4CY2 A;  4GMB A;  5HYN B;  4GZ8 A;  2H6Q A;  4J8G A;  3PSL A;  3OW8 A;  2OIZ A;  3ULE C;  2OVQ B;  3PXS D;  2G99 A;  3BG0 A;  3HFQ A;  4XYI A;  3SBR A;  1GXR A;  4I79 A;  4QT8 A;  3RFH A;  3JZG A;  3I7H A;  4GQB B;  2CE8 A;  3IJC A;  3SCY A;  3AH8 B;  3I7N A;  2P9N C;  4JD2 C;  3PSC B;  4PSX B;  4CY5 A;  3PXW D;  5IC7 A;  3SBQ A;  4HDJ A;  2HES X;  4K3J B;  2YMU A;  4D0K A;  3I8E A;  4JSV C;  3SJL D;  4J73 A;  4A08 A;  2PBI B;  2I3S A;  3C5M A;  4PNK B;  5TF2 A;  1NR0 A;  3JPX A;  1GOT B;  3OKY B;  2PM6 B;  3FM0 A;  5FQD A;  4IMM A;  4CI1 A;  2J57 G;  3ZWL B;  2UZY B;  4FAV D;  5GXH A;  5CXB B;  1K8K C;  2AGL A;  4BH6 A;  5C2V B;  3PXT D;  3PVU B;  2P9K C;  4J0W A;  4J78 A;  2CN3 A;  3EI3 A;  5HE1 B;  5EMM B;  4LGN A;  3DXK C;  1YFQ A;  2H9M A;  5THA A;  2P9U C;  5FKT A;  3CIK B;  4A2L A;  2PM9 B;  5EAM A;  2I0T A;  3RN1 D;  3UVN A;  4J79 A;  5FKQ A;  2I0S A;  4AOW A;  1PEV A;  3GRE A;  5K19 A;  3C75 H;  2CNX A;  4J87 A;  3OKT A;  3IKO A;  4H5I A;  4U7A A;  4JT5 C;  3KRW B;  3MKS B;  4J0X A;  5HE3 B;  4J82 A;  2AGY A;  2OJY A;  3FRX A;  1S4U X;  4J8B A;  4QL1 A;  4K3I D;  5IGO A;  3NVN A;  4PC0 A;  3I7K A;  5FKS A;  4ZOV A;  3N0D A;  2B5L A;  5SXM A;  4JT6 C;  4GM9 A;  3I7P A;  3EG6 A;  4ZN4 A;  3DXM C;  1XHM A;  1MG3 A;  2AGW A;  1K32 A;  2H13 A;  1SHY B;  2P9L C;  5I5J A;  2B5N A;  2H9P A;  2HXC A;  1SQJ A;  3VGZ A;  4L9O A;  2H6N A;  4CZV A;  3P4F A;  1Q47 A;  1OLZ A;  1PGU A;  4GQ1 A;  5IGQ A;  1JMZ B;  3L4M D;  3GFC A;  1MDA H;  4A09 B;  3VA6 A;  5EAL A;  3UVO A;  2OVP B;  2HJB A;  4ZOX A;  2IUV A;  5I5I A;  5H14 A;  2H9L A;  2XL2 A;  2J56 H;  2P9S C;  3JRP A;  3K26 A;  4BUJ C;  2PM7 B;  3DM0 A;  4FA4 D;  3F3P A;  3OTT A;  1P22 A;  5KDO B;  4GM8 A;  2AQ5 A;  3IIW A;  4PSW B;  5FKR A;  3PE7 A;  4H5J A;  5CYK A;  3V7D B;  4E54 B;  2B4E A;  4NSX A;  4A2M A;  3W15 A;  4U1E I;  5B4W A;  3C99 A;  4D6V A;  3SN6 B;  2HYE A;  5A2Q g;  3UVK A;  2GNQ A;  2AGX A;  2J55 H;  5GXI A;  1B9Y A;  2H68 A;  3SMR A;  4GGA A;  2IWF A;  3F3F A;  4CC9 A;  3EI2 A;  1XKS A;  3SBP A;  5K1C C;  2XL3 A;  4J81 A;  5EM2 B;  4A0B A;  4X3E A;  3EI3 B;  3U4Y A;  1A0R B;  1TBG A;  3RN0 D;  4J84 A;  3JAM g;  5FXY A;  3ODT A;  3AL8 B;  4L3G D;  3A0F A;  3RRM C;  4IA9 A;  3J81 g;  4JXM A;  4UI9 R;  2I3T A;  5HE2 B;  3JB9 L;  3J80 g;  5FA5 B;  2IUR A;  4GGC A;  2IWK A;  5CXC B;  4JSP C;  5H1M A;  4A09 A;  1FWX A;  2W18 A;  3N0E A;  3JZN A;  1U4C A;  5IJ8 E;  4GQ2 P;  3MZL A;  3DWL C;  4E54 A;  4A7J A;  4O45 A;  3EU7 A;  3RFG A;  3UVL A;  3L4O D;  4ZOY A;  4Z8L A;  4LG8 A;  5GMK n;  5JWZ A;  3CFV A;  1RI6 A;  4FA1 D;  5AFU 3;  4OWR A;  4L1Q D;  2Z2N A;  2CE9 A;  5AMS A;  4LG9 A;  5TEF A;  2H47 A;  4EWR A;  3RSE C;  2OK4 A;  5H17 A;  4X63 B;  1JJU B;  1PI6 A;  1N6D A;  4Y5R D;  1SQ9 A;  2Z2P A;  3E0C A;  2HJ4 A;  4XEI C;  4ERQ A;  4QRJ A;  3NVQ A;  3FGB A;  4R7A B;  3OL2 B;  4O3U B;  2XU7 A;  3BG1 A;  3IJ0 A;  3I7L A;  4TZ4 A;  4JSX C;  2IAA A;  1MG2 A;  2G9A A;  3AFC A;  5IT9 g;  4N14 A;  3DSM A;  5EMJ B;  4Y7R A;  3SVW D;  2IUQ A;  4ES0 A;  4A11 A;  3SWS D;  1GG2 B;  3I2N A;  4O3T B;  2TRC B;  4X61 B;  2UZX B;  4A0A A;  3F3G A;  3PVW B;  5TDH B;  3EI1 A;  4KFM B;  2YNP A;  2QXV A;  3SHF A;  3EI4 A;  5CYK B;  5TEE A;  4OZU A;  1GP2 B;  3MKQ A;  2H6K A;  2HKM A;  3I89 A;  5EMK B;  5IJ7 E;  3EMH A;  3MZK A;  4A11 B;  1N6F A;  3AL9 A;  3CFS B;  4L3H D;  4AEZ A;  2BCJ B;  2MTA H;  2P9I C;  2B5M A;  1QNI A;  4CZY A;  4CI3 A;  2AGZ A;  3EWE A;  5I5M A;  2GC4 A;  4O9D A;  2IUP A;  5FLX g;  2I0R A;  4GM3 A;  2AH0 A;  4FWW A;  4QQE A;  3EI4 B;  3SXT D;  4X60 B;  4FB1 D;  4ERZ A;  3UKR C;  2YBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...