5M61A

Clathrin heavy chain n-terminal domain bound to an extended amphiphysin clathrin-box motif
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
360
structure length
360
Chain Sequence
ILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGAEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis
molecule keywords Clathrin heavy chain 1
publication title Cellular and viral peptides bind multiple sites on the N-terminal domain of clathrin.
pubmed doi rcsb
source organism Bos taurus
total genus 84
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01394 Clathrin_propel Clathrin propeller repeat
A PF09268 Clathrin-link Clathrin, heavy-chain linker
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.110 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Clathrin heavy-chain terminal domain 5m61A00
5M5UA 1C9IA 2XZGA 4G55A 1BPOA 5M5SA 5M5VA 5M61A 1C9LA 5M5TA 3GC3B 3GD1I 1UTCA 5M5RA
chains in the Genus database with same CATH superfamily
2OJYA 2H47A 5M5UA 1GXRA 3JAMg 2VDRA 3FCSA 1N6FA 3B7FA 5FLXg 5H1MA 4PNKB 5EARA 2XE4A 4J82A 1PI6A 4FHLA 1PGUA 4G1EA 1QFSA 1TYQC 3BG1A 2QZPA 2G99A 3GD1I 4PSWB 1SQ9A 3PXTD 4A09A 4ERYA 5C92A 2IAAA 4GMBA 3MUOA 3J81g 2B5LA 5HE2B 1N6DA 2VZ3A 2AQ5A 5EMJB 4CC9A 5EAMA 4FAND 2CE8A 3FM0A 4JSVC 3PE7A 1GOHA 4A2LA 1L0QA 5FFGA 2AGLA 4O02A 4AX4A 2BCJB 3EI4A 5HE3B 2HJBA 3L4MD 4O3UB 5IJ8E 1QFMA 5EM2A 4CZVA 2EIDA 5CXBB 3SMRA 3EI2A 3ULEC 4A11A 3T3PA 3QI0A 2P9IC 4UI9R 4ERZA 4J79A 5IJ7E 3RRMC 4XEIC 3VGZA 2P9UC 4A0AB 2B5MA 5M5SA 1R5MA 3NVXA 1U4CA 4CZXA 2H6NA 1P22A 5IGQA 3SVWD 3FGBA 1E5TA 5THAA 4Z7OA 4CI1A 3ZE0A 4RE5A 3NIFA 1TYEA 2IUQA 2OVRB 3U4YA 3UR4A 4CY2A 4N14A 3EG6A 4ERQA 3I7LA 4CZYA 5EMMB 4ES0A 4IRZA 3A0FA 2VC2A 3EI1A 4J81A 4GM8A 1E8NA 3O4JA 2VDQA 4QT8A 4IA9A 3OKYA 4L1MA 4X60B 2AH0A 1O6GA 3SCYA 2IUPA 3MKSB 4CI8A 4A2MA 3EWEA 3AFCA 2VDPA 3JRPA 3SBPA 1A0RB 5KDOB 4QAMA 3O4GA 5HQGA 4K3ID 4D0KA 4L9OA 3NIGA 4G1MA 2YB8B 4O3TB 2OK4A 4X3EA 5TEEA 3PXWD 5HDBA 3PSLA 4O45A 3DWLC 5K1CC 3ZDZA 3P4FA 2VDOA 3MZKA 2XL2A 5FKTA 3VI3A 1VZ3A 1JOFA 5E6UA 5AJAA 3IJCA 4D9SA 4AEZA 1B9XA 1O6FA 3FRXA 4L1QD 3N0EA 4GM9A 1VE7A 4IMMA 4Y7RA 3SHFA 2W18A 1YR2A 2O9KA 3PVWB 2EIEA 1I2MB 4GM3A 3JB9L 4FA4D 4ZOYA 2H9MA 3SXTD 3QHYB 2J56H 1C9LA 5CXCA 1K3IA 2CNXA 5TDHB 5M5TA 2BBKH 3MKQA 4J87A 3IJ0A 3C75H 3IKOA 3I7KA 1JV2A 4PSXB 1YFQA 4BP8A 4GGDA 5C2VB 4H5JA 3RN1D 3JPXA 2H14A 3BWSA 1Q47A 3AH8B 4J8BA 4MMYA 2HKRA 2B5NA 3GFCA 5I5MA 1OMWB 4JXMA 1H2WA 4PBZA 3VH0A 4CY5A 4DNWA 2H6KA 3EMHA 3NIDA 3RFGA 4OZUA 1QNIA 2HESX 1BPOA 4D6VA 1S4UX 1XHMA 2VDNA 4O2WA 3DDUA 4JHPC 2H6QA 5SXMA 1PEVA 4WK4A 5H14A 1B9YA 4XYIA 1ERJA 2XZGA 2AGWA 2YNPA 3JZGA 4X61B 4DNVA 4FA9D 3AL8B 2QR5A 4JHNA 5B4WA 2WQ8A 2UZXB 5FKQA 4NSXA 3AL8A 1UOQA 2IURA 1UTCA 3SBRA 4PC0A 3DSMA 3V4VA 5FFOA 2QXVA 4GQ1A 5CXBA 4AN0A 3E0CA 3I8EA 2GC4A 2I3TA 3RN0D 4J73A 5FQDA 3UKUC 4AN1A 5GMKn 4AMYA 3I89A 3K6SA 2EIBA 2CO0C 1UOPA 3V5WB 5HYNB 2J55H 4QL1A 4QRJA 2YNOA 4BCBA 1UOOA 4EWRA 3C99A 5AMSA 4A0AA 1H2ZA 1OLZA 4A08B 4Z8LA 4E54B 2J57G 3IJEA 1PBYB 5EMLB 4A08A 4J8GA 3RMZD 1H2YA 2H3XA 2CE9A 4QQEA 5EAPA 4FA5D 1GP2B 4GZ8A 5GSAA 4U1EI 3CIKB 4BH6A 2H9NA 2AH1A 4ESGA 5K19A 2QC5A 2CN2A 1JMXB 4R7AB 3IUJA 4J0WA 3RFHA 4YVDA 2I0TA 2YNNA 2P9PC 3I7NA 5FKRA 2PM7B 5HE0B 3IUMA 2OVQB 2Z2NA 4O9DA 2HYEA 2P9LC 5H17A 2HKMA 1XIPA 2B4EA 5IC7A 3NVNA 4A7JA 1M1XA 4J86A 5TEFA 3JZHA 3IIWA 1K8KC 3I7OA 4L3HD 3EQ7A 2OK6A 4NAAA 5IT9g 2YMUA 2HU5A 1VE6A 2OIZA 3IULA 4MMZA 4RE6A 3O4IA 2H9LA 4G55A 3FCUA 2YBAA 2GNQA 4UM9A 1SHYB 4FA1D 4LG8A 2P9KC 1SQJA 2HXCA 4MMXA 3OKTA 3HFQA 4ZN4A 4JT5C 2P9SC 3OW8A 2PM9B 3L4OD 2H13A 3O4HA 4MK0B 4ZOZA 3C9CA 3F3GA 5IGOA 5HE1B 1GOTB 3OL2B 3EI3B 3V9FA 3VI4A 4O1QD 2Q7QA 4ZOVA 2VZ1A 2Z2OA 2VDLA 2BKLA 1JTDB 4OWRA 3I7HA 3SWSD 3I2NA 3DXMC 4PXWA 1NEXB 1FWXA 4BL0A 3RLMD 5I5JA 5GXIA 1TBGA 3N0DA 3DXKC 3MUNA 2PBIB 2IWFA 2IUVA 2I0SA 1NR0A 2VDMA 4E5ZB 3K72A 5EALA 3MVDK 2I3SA 3NVQA 4I79A 4CY1A 2IWKA 4E5ZA 4A09B 3EQ9A 4GQ2P 5M61A 1U2VC 3JZNA 3MXXA 2PM6B 4JSNC 4GGCA 4NBMA 1XKSA 1JJUB 2EICA 3AL9A 5AFU3 4CI3A 3ORVD 4JSXC 2P9NC 4BCCA 4U7AA 1N6EA 3EI4B 3K27A 1A12A 4J84A 4X63B 5EM2B 4NENA 3EI2B 3PVUB 5E6RA 4A11B 3OKWA 3ZE2A 2HU7A 4UM8A 2UZYB 1RI6A 4E54A 2XDWA 3ODTA 1JMZB 2JKXA 4ZOXA 4A0BB 3GC3B 3K71A 2H9PA 4FWWA 3W15A 3ZWLB 3J80g 4HDJA 3UVLA 3MMYA 1GOGA 2TRCB 4A0BA 4WK0A 5C86A 4BUJC 4LGNA 5A2Qg 3IURA 2I0RA 4JSPC 3ZDYA 2OVPB 4J78A 1H2XA 2G9AA 3UVKA 3KCIA 4Z7NA 2XYIA 3EQ8A 4BCDA 1E8MA 5GXHA 3F3FA 5C9ZB 5C2WB 2HJ4A 3KRXB 3SLED 3UVMA 2HU8A 2VDKA 1T2XA 4J0XA 3UVOA 5FKSA 5TF2A 3UVNA 2H68A 3EI1B 4WK2A 3ZDXA 3OF7A 3OKYB 3JROA 5FA5B 1U8CA 3IVMA 4Z7QA 3ZE1A 2CN3A 4JD2C 1MG2A 2AGZA 3DM0A 5M5RA 1VYHC 4FAVD 3K26A 1GOFA 4CI2A 2XL3A 3V7DB 3CFVA 3GREA 4G56B 4FB1D 1VZ2A 3UKRC 3SJLD 5E6SA 4TZ4A 2Z2PA 1GG2B 5I5IA 1MDAH 4AMZA 2CO0A 2GC7A 4CY3A 4PBYA 4AOWA 3CFSB 3IJ1A 3V4PA 5FXYA 4XYHA 3C5MA 3RSEC 3F3PA 4DNUA 3IUQA 5M5VA 3I7PA 5CYKB 3VA6A 4BP9A 2EBSA 3PXSD 1L5GA 2PM9A 3KRWB 4GGAA 3T3MA 3BG0A 2XU7A 5JWZA 5CYKA 4GQBB 3MZLA 5CXCB 4LG9A 2AGYA 4Y5RD 4JT6C 1C9IA 3SN6B 4J77A 3SFZA 3OL2A 3OTTA 3EI3A 4L3GD 4WJKA 4KFMB 3I8CA 1K32A 3EU7A 3IIYA 4H5IA 2AGXA 4NC4A 5EMKB 3IUNA 3SBQA 3PSCB 2MTAH 1MG3A 4K3JB
chains in the Genus database with same CATH topology
5M5UA 1C9IA 2XZGA 4G55A 1BPOA 5M5SA 5M5VA 5M61A 1C9LA 5M5TA 3GC3B 3GD1I 1UTCA 5M5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M5U A;  1C9I A;  2XZG A;  4G55 A;  1BPO A;  5M5S A;  5M5V A;  5M61 A;  1C9L A;  5M5T A;  3GC3 B;  3GD1 I;  1UTC A;  5M5R A; 
#chains in the Genus database with same CATH topology
 2OJY A;  2H47 A;  5M5U A;  1GXR A;  3JAM g;  2VDR A;  3FCS A;  1N6F A;  3B7F A;  5FLX g;  5H1M A;  4PNK B;  5EAR A;  2XE4 A;  4J82 A;  1PI6 A;  4FHL A;  1PGU A;  4G1E A;  1QFS A;  1TYQ C;  3BG1 A;  2QZP A;  2G99 A;  3GD1 I;  4PSW B;  1SQ9 A;  3PXT D;  4A09 A;  4ERY A;  5C92 A;  2IAA A;  4GMB A;  3MUO A;  3J81 g;  2B5L A;  5HE2 B;  1N6D A;  2VZ3 A;  2AQ5 A;  5EMJ B;  4CC9 A;  5EAM A;  4FAN D;  2CE8 A;  3FM0 A;  4JSV C;  3PE7 A;  1GOH A;  4A2L A;  1L0Q A;  5FFG A;  2AGL A;  4O02 A;  4AX4 A;  2BCJ B;  3EI4 A;  5HE3 B;  2HJB A;  3L4M D;  4O3U B;  5IJ8 E;  1QFM A;  5EM2 A;  4CZV A;  2EID A;  5CXB B;  3SMR A;  3EI2 A;  3ULE C;  4A11 A;  3T3P A;  3QI0 A;  2P9I C;  4UI9 R;  4ERZ A;  4J79 A;  5IJ7 E;  3RRM C;  4XEI C;  3VGZ A;  2P9U C;  4A0A B;  2B5M A;  5M5S A;  1R5M A;  3NVX A;  1U4C A;  4CZX A;  2H6N A;  1P22 A;  5IGQ A;  3SVW D;  3FGB A;  1E5T A;  5THA A;  4Z7O A;  4CI1 A;  3ZE0 A;  4RE5 A;  3NIF A;  1TYE A;  2IUQ A;  2OVR B;  3U4Y A;  3UR4 A;  4CY2 A;  4N14 A;  3EG6 A;  4ERQ A;  3I7L A;  4CZY A;  5EMM B;  4ES0 A;  4IRZ A;  3A0F A;  2VC2 A;  3EI1 A;  4J81 A;  4GM8 A;  1E8N A;  3O4J A;  2VDQ A;  4QT8 A;  4IA9 A;  3OKY A;  4L1M A;  4X60 B;  2AH0 A;  1O6G A;  3SCY A;  2IUP A;  3MKS B;  4CI8 A;  4A2M A;  3EWE A;  3AFC A;  2VDP A;  3JRP A;  3SBP A;  1A0R B;  5KDO B;  4QAM A;  3O4G A;  5HQG A;  4K3I D;  4D0K A;  4L9O A;  3NIG A;  4G1M A;  2YB8 B;  4O3T B;  2OK4 A;  4X3E A;  5TEE A;  3PXW D;  5HDB A;  3PSL A;  4O45 A;  3DWL C;  5K1C C;  3ZDZ A;  3P4F A;  2VDO A;  3MZK A;  2XL2 A;  5FKT A;  3VI3 A;  1VZ3 A;  1JOF A;  5E6U A;  5AJA A;  3IJC A;  4D9S A;  4AEZ A;  1B9X A;  1O6F A;  3FRX A;  4L1Q D;  3N0E A;  4GM9 A;  1VE7 A;  4IMM A;  4Y7R A;  3SHF A;  2W18 A;  1YR2 A;  2O9K A;  3PVW B;  2EIE A;  1I2M B;  4GM3 A;  3JB9 L;  4FA4 D;  4ZOY A;  2H9M A;  3SXT D;  3QHY B;  2J56 H;  1C9L A;  5CXC A;  1K3I A;  2CNX A;  5TDH B;  5M5T A;  2BBK H;  3MKQ A;  4J87 A;  3IJ0 A;  3C75 H;  3IKO A;  3I7K A;  1JV2 A;  4PSX B;  1YFQ A;  4BP8 A;  4GGD A;  5C2V B;  4H5J A;  3RN1 D;  3JPX A;  2H14 A;  3BWS A;  1Q47 A;  3AH8 B;  4J8B A;  4MMY A;  2HKR A;  2B5N A;  3GFC A;  5I5M A;  1OMW B;  4JXM A;  1H2W A;  4PBZ A;  3VH0 A;  4CY5 A;  4DNW A;  2H6K A;  3EMH A;  3NID A;  3RFG A;  4OZU A;  1QNI A;  2HES X;  1BPO A;  4D6V A;  1S4U X;  1XHM A;  2VDN A;  4O2W A;  3DDU A;  4JHP C;  2H6Q A;  5SXM A;  1PEV A;  4WK4 A;  5H14 A;  1B9Y A;  4XYI A;  1ERJ A;  2XZG A;  2AGW A;  2YNP A;  3JZG A;  4X61 B;  4DNV A;  4FA9 D;  3AL8 B;  2QR5 A;  4JHN A;  5B4W A;  2WQ8 A;  2UZX B;  5FKQ A;  4NSX A;  3AL8 A;  1UOQ A;  2IUR A;  1UTC A;  3SBR A;  4PC0 A;  3DSM A;  3V4V A;  5FFO A;  2QXV A;  4GQ1 A;  5CXB A;  4AN0 A;  3E0C A;  3I8E A;  2GC4 A;  2I3T A;  3RN0 D;  4J73 A;  5FQD A;  3UKU C;  4AN1 A;  5GMK n;  4AMY A;  3I89 A;  3K6S A;  2EIB A;  2CO0 C;  1UOP A;  3V5W B;  5HYN B;  2J55 H;  4QL1 A;  4QRJ A;  2YNO A;  4BCB A;  1UOO A;  4EWR A;  3C99 A;  5AMS A;  4A0A A;  1H2Z A;  1OLZ A;  4A08 B;  4Z8L A;  4E54 B;  2J57 G;  3IJE A;  1PBY B;  5EML B;  4A08 A;  4J8G A;  3RMZ D;  1H2Y A;  2H3X A;  2CE9 A;  4QQE A;  5EAP A;  4FA5 D;  1GP2 B;  4GZ8 A;  5GSA A;  4U1E I;  3CIK B;  4BH6 A;  2H9N A;  2AH1 A;  4ESG A;  5K19 A;  2QC5 A;  2CN2 A;  1JMX B;  4R7A B;  3IUJ A;  4J0W A;  3RFH A;  4YVD A;  2I0T A;  2YNN A;  2P9P C;  3I7N A;  5FKR A;  2PM7 B;  5HE0 B;  3IUM A;  2OVQ B;  2Z2N A;  4O9D A;  2HYE A;  2P9L C;  5H17 A;  2HKM A;  1XIP A;  2B4E A;  5IC7 A;  3NVN A;  4A7J A;  1M1X A;  4J86 A;  5TEF A;  3JZH A;  3IIW A;  1K8K C;  3I7O A;  4L3H D;  3EQ7 A;  2OK6 A;  4NAA A;  5IT9 g;  2YMU A;  2HU5 A;  1VE6 A;  2OIZ A;  3IUL A;  4MMZ A;  4RE6 A;  3O4I A;  2H9L A;  4G55 A;  3FCU A;  2YBA A;  2GNQ A;  4UM9 A;  1SHY B;  4FA1 D;  4LG8 A;  2P9K C;  1SQJ A;  2HXC A;  4MMX A;  3OKT A;  3HFQ A;  4ZN4 A;  4JT5 C;  2P9S C;  3OW8 A;  2PM9 B;  3L4O D;  2H13 A;  3O4H A;  4MK0 B;  4ZOZ A;  3C9C A;  3F3G A;  5IGO A;  5HE1 B;  1GOT B;  3OL2 B;  3EI3 B;  3V9F A;  3VI4 A;  4O1Q D;  2Q7Q A;  4ZOV A;  2VZ1 A;  2Z2O A;  2VDL A;  2BKL A;  1JTD B;  4OWR A;  3I7H A;  3SWS D;  3I2N A;  3DXM C;  4PXW A;  1NEX B;  1FWX A;  4BL0 A;  3RLM D;  5I5J A;  5GXI A;  1TBG A;  3N0D A;  3DXK C;  3MUN A;  2PBI B;  2IWF A;  2IUV A;  2I0S A;  1NR0 A;  2VDM A;  4E5Z B;  3K72 A;  5EAL A;  3MVD K;  2I3S A;  3NVQ A;  4I79 A;  4CY1 A;  2IWK A;  4E5Z A;  4A09 B;  3EQ9 A;  4GQ2 P;  5M61 A;  1U2V C;  3JZN A;  3MXX A;  2PM6 B;  4JSN C;  4GGC A;  4NBM A;  1XKS A;  1JJU B;  2EIC A;  3AL9 A;  5AFU 3;  4CI3 A;  3ORV D;  4JSX C;  2P9N C;  4BCC A;  4U7A A;  1N6E A;  3EI4 B;  3K27 A;  1A12 A;  4J84 A;  4X63 B;  5EM2 B;  4NEN A;  3EI2 B;  3PVU B;  5E6R A;  4A11 B;  3OKW A;  3ZE2 A;  2HU7 A;  4UM8 A;  2UZY B;  1RI6 A;  4E54 A;  2XDW A;  3ODT A;  1JMZ B;  2JKX A;  4ZOX A;  4A0B B;  3GC3 B;  3K71 A;  2H9P A;  4FWW A;  3W15 A;  3ZWL B;  3J80 g;  4HDJ A;  3UVL A;  3MMY A;  1GOG A;  2TRC B;  4A0B A;  4WK0 A;  5C86 A;  4BUJ C;  4LGN A;  5A2Q g;  3IUR A;  2I0R A;  4JSP C;  3ZDY A;  2OVP B;  4J78 A;  1H2X A;  2G9A A;  3UVK A;  3KCI A;  4Z7N A;  2XYI A;  3EQ8 A;  4BCD A;  1E8M A;  5GXH A;  3F3F A;  5C9Z B;  5C2W B;  2HJ4 A;  3KRX B;  3SLE D;  3UVM A;  2HU8 A;  2VDK A;  1T2X A;  4J0X A;  3UVO A;  5FKS A;  5TF2 A;  3UVN A;  2H68 A;  3EI1 B;  4WK2 A;  3ZDX A;  3OF7 A;  3OKY B;  3JRO A;  5FA5 B;  1U8C A;  3IVM A;  4Z7Q A;  3ZE1 A;  2CN3 A;  4JD2 C;  1MG2 A;  2AGZ A;  3DM0 A;  5M5R A;  1VYH C;  4FAV D;  3K26 A;  1GOF A;  4CI2 A;  2XL3 A;  3V7D B;  3CFV A;  3GRE A;  4G56 B;  4FB1 D;  1VZ2 A;  3UKR C;  3SJL D;  5E6S A;  4TZ4 A;  2Z2P A;  1GG2 B;  5I5I A;  1MDA H;  4AMZ A;  2CO0 A;  2GC7 A;  4CY3 A;  4PBY A;  4AOW A;  3CFS B;  3IJ1 A;  3V4P A;  5FXY A;  4XYH A;  3C5M A;  3RSE C;  3F3P A;  4DNU A;  3IUQ A;  5M5V A;  3I7P A;  5CYK B;  3VA6 A;  4BP9 A;  2EBS A;  3PXS D;  1L5G A;  2PM9 A;  3KRW B;  4GGA A;  3T3M A;  3BG0 A;  2XU7 A;  5JWZ A;  5CYK A;  4GQB B;  3MZL A;  5CXC B;  4LG9 A;  2AGY A;  4Y5R D;  4JT6 C;  1C9I A;  3SN6 B;  4J77 A;  3SFZ A;  3OL2 A;  3OTT A;  3EI3 A;  4L3G D;  4WJK A;  4KFM B;  3I8C A;  1K32 A;  3EU7 A;  3IIY A;  4H5I A;  2AGX A;  4NC4 A;  5EMK B;  3IUN A;  3SBQ A;  3PSC B;  2MTA H;  1MG3 A;  4K3J B; 
#chains in the Genus database with same CATH homology
 5M5U A;  1C9I A;  2XZG A;  4G55 A;  1BPO A;  5M5S A;  5M5V A;  5M61 A;  1C9L A;  5M5T A;  3GC3 B;  3GD1 I;  1UTC A;  5M5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...