5M61A

Clathrin heavy chain n-terminal domain bound to an extended amphiphysin clathrin-box motif
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
360
structure length
360
Chain Sequence
ILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGAEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Clathrin heavy chain 1
publication title Cellular and viral peptides bind multiple sites on the N-terminal domain of clathrin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Endocytosis
total genus 84
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01394 Clathrin_propel Clathrin propeller repeat
A PF09268 Clathrin-link Clathrin, heavy-chain linker
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.110 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Clathrin heavy-chain terminal domain 5m61A00
2XZGA 5M5RA 5M5SA 1C9IA 5M5UA 5M5VA 1BPOA 5M5TA 1UTCA 3GD1I 4G55A 1C9LA 3GC3B 5M61A
chains in the Genus database with same CATH superfamily
3ODTA 3SBRA 1QFSA 3IIYA 3J81g 2I0SA 4J73A 5HE2B 5C2WB 3DXMC 3PE7A 2WQ8A 1H2XA 5TEFA 1SQJA 3SBPA 2HU5A 1UTCA 4LG9A 5TF2A 3BWSA 4UM8A 3NIGA 3MXXA 2PM9A 1TYEA 1QFMA 1JMXB 4K3ID 3EMHA 3BG0A 3SN6B 4X63B 4CI1A 3UVOA 1VE6A 2AGZA 5EALA 5K19A 2OVQB 3ULEC 5M5SA 3I2NA 4PNKB 4QL1A 2JKXA 4A2MA 3AH8B 4TZ4A 2XYIA 4Z8LA 3FGBA 4JHPC 2H14A 3MZLA 4MK0B 4LG8A 3DDUA 4QAMA 1GOHA 2EBSA 2IAAA 4GMBA 5AJAA 3JZGA 4L1MA 4LGNA 3JZNA 1E5TA 2P9IC 5IGQA 3SHFA 4ZN4A 2P9PC 4CZXA 4L3HD 3DWLC 3FCSA 1Q47A 4EWRA 2VZ3A 2H6KA 4A09B 4J0XA 4O02A 3UR4A 2I0TA 2OVRB 1GG2B 4N14A 3I7LA 1JOFA 2IURA 1MDAH 3EI4A 1OLZA 4JHNA 2H9MA 2HKRA 3ZDYA 1O6GA 4O3TB 5E6UA 4FA9D 4CY1A 5FKTA 2G99A 1PEVA 5HYNB 4BCCA 2YB8B 3I7OA 2HKMA 2YNPA 3C99A 5I5IA 3MUNA 2UZYB 1XIPA 2OVPB 3W15A 2AGXA 4BCBA 3JRPA 4E54A 1E8NA 3MUOA 4WJKA 3EI1B 2QC5A 4GQ1A 4GQBB 2HESX 4AMYA 1XHMA 3SLED 2HU8A 5HE1B 3RFHA 4ZOYA 4XYHA 5AFU3 4CY5A 2I3SA 4L3GD 5HDBA 3NIFA 5FKSA 4GM9A 2VDRA 3I7HA 2QXVA 3IUMA 2HYEA 4JSXC 4E5ZB 4GM3A 3OF7A 3I89A 5EAPA 1U4CA 2AH1A 3K26A 4CY2A 3K6SA 3ZE2A 4NC4A 4G56B 3SBQA 4ESGA 3PXTD 1NR0A 3ZDZA 4MMZA 5EAMA 3IUJA 2HJ4A 4UI9R 5EMJB 5TEEA 3DM0A 5I5MA 3I7PA 3NVQA 5IT9g 5HE3B 3EI3B 3SWSD 3MKQA 5SXMA 2BBKH 3OKYB 5CXBB 3SJLD 3ZWLB 4DNUA 1E8MA 2EIEA 3K27A 3KRXB 2XZGA 5EMMB 3SCYA 3UKUC 4G55A 4PBYA 4PXWA 4L9OA 4A11A 4Z7NA 3OKTA 4JSPC 1B9XA 4A7JA 3ZE1A 2XU7A 5M61A 3O4JA 2AQ5A 3MVDK 4CI3A 3PVUB 4A0BA 4X60B 2HXCA 4J8GA 4CC9A 4WK4A 4J84A 2CE9A 2H9PA 4JSVC 4J0WA 4BCDA 2CNXA 2PM9B 3FCUA 3RMZD 1SHYB 5H17A 3GFCA 2EIBA 3C5MA 5H1MA 5IGOA 3ZE0A 3DSMA 3ZDXA 4Z7QA 2CN2A 2OIZA 2YMUA 3JAMg 3CIKB 3CFSB 3RFGA 4QQEA 2P9NC 1S4UX 2OK4A 3ORVD 2VDNA 3IUQA 4JT6C 4I79A 5K1CC 5C2VB 3FRXA 2I0RA 2XDWA 3EG6A 5IJ7E 3HFQA 1R5MA 4J81A 4A09A 5FKQA 5H14A 1H2ZA 4X61B 2YBAA 5C9ZB 3OW8A 5CXCB 1VZ2A 2P9UC 3F3GA 5FFOA 4CY3A 3U4YA 3GC3B 3IULA 4PSXB 3PXSD 4G1MA 5M5VA 3EI4B 4FA1D 1L5GA 4L1QD 2EICA 4PBZA 5AMSA 4J87A 3E0CA 1PGUA 4J79A 2GC4A 2IUPA 1BPOA 1L0QA 4R7AB 3B7FA 3O4IA 5EARA 5GSAA 5HQGA 1GXRA 5EMKB 4GM8A 3JPXA 3UVMA 1K8KC 1TBGA 2P9SC 4A0AA 4A08A 3OTTA 4ZOZA 3SFZA 2BCJB 1U8CA 3IIWA 2VDMA 3EQ9A 5JWZA 3SVWD 3RSEC 4AOWA 5C92A 3N0EA 3AL8B 1T2XA 4E54B 2OJYA 2P9LC 2Z2OA 2VDOA 3DXKC 3OL2A 5HE0B 3IJCA 1JJUB 3P4FA 5E6SA 2AH0A 2J56H 3A0FA 3UKRC 5B4WA 4K3JB 4BP8A 3PXWD 5EM2A 1VYHC 4IMMA 4CI8A 5M5TA 2B5MA 1QNIA 2BKLA 2VZ1A 3EWEA 3FM0A 1B9YA 4U1EI 1JV2A 5E6RA 4E5ZA 4BH6A 3V9FA 3CFVA 4AN0A 4MMXA 3V4PA 1H2YA 3I7KA 2P9KC 5A2Qg 3IURA 1NEXB 2AGYA 1N6EA 5M5UA 2HU7A 4MMYA 4OWRA 3OKWA 3MZKA 4ERYA 4AX4A 4XEIC 4AMZA 4FA4D 2H47A 4GQ2P 2AGLA 3IJ1A 3O4GA 3EI2A 3IVMA 4ES0A 4DNVA 2VDQA 4FAND 3RLMD 3EI3A 2H6QA 4ERZA 5CYKA 4KFMB 1VZ3A 3L4MD 5CXBA 2QZPA 3L4OD 4CI2A 2HJBA 5FA5B 3JB9L 2H9NA 1MG2A 3V4VA 1K3IA 2VC2A 2J55H 4Y5RD 4JT5C 4BP9A 4O45A 3V5WB 4IA9A 4D6VA 2I3TA 2VDLA 5I5JA 5KDOB 5C86A 2IWFA 2XL2A 4A11B 1JTDB 4Y7RA 1UOPA 2YNNA 3C75H 3UVLA 4CZYA 4A0BB 1ERJA 4YVDA 3V7DB 2UZXB 4NAAA 3PVWB 5GXHA 4D0KA 1C9LA 2H9LA 3EU7A 2PM6B 2OK6A 4WK0A 2TRCB 3NVXA 3K72A 2CO0A 3F3PA 2CO0C 4J86A 2J57G 4NBMA 3GREA 1MG3A 2O9KA 4NENA 4ZOXA 5IJ8E 3IJ0A 1SQ9A 3PSLA 4J77A 2XL3A 5GMKn 3VA6A 2VDPA 3IUNA 1H2WA 2PM7B 4GGDA 3EQ8A 1PI6A 4BL0A 2Q7QA 1K32A 3I7NA 1PBYB 1YFQA 3UVNA 2IUQA 4IRZA 1UOOA 5CXCA 3VH0A 3NIDA 4UM9A 3EQ7A 2CE8A 4CZVA 4DNWA 4U7AA 2AGWA 3GD1I 4ERQA 3N0DA 4FAVD 1GP2B 2B5NA 2H13A 3AFCA 1U2VC 3RRMC 4J82A 4JXMA 2IUVA 5EMLB 1N6DA 4Z7OA 4ZOVA 4O2WA 5FXYA 2H68A 3K71A 3I8EA 4GZ8A 3IJEA 3JZHA 3EI1A 4RE5A 2IWKA 4A0AB 4QT8A 2GC7A 4A08B 3J80g 4H5IA 4WK2A 4D9SA 1JMZB 3VI4A 4FWWA 1A0RB 3AL8A 1N6FA 1UOQA 3QI0A 2MTAH 4GGCA 2Z2PA 3KRWB 2B5LA 5TDHB 4FA5D 2EIDA 4JD2C 3OL2B 3C9CA 5GXIA 1P22A 2PBIB 1TYQC 2GNQA 5FKRA 3AL9A 1C9IA 4J8BA 4FHLA 4XYIA 4O3UB 5FQDA 4AN1A 4AEZA 2XE4A 5EM2B 5THAA 1M1XA 4X3EA 3QHYB 5IC7A 1I2MB 3SMRA 4HDJA 2B4EA 3VI3A 1O6FA 4O1QD 2W18A 4O9DA 4RE6A 5M5RA 3T3MA 3MMYA 1A12A 1GOGA 1FWXA 4G1EA 4H5JA 2H6NA 3KCIA 4PC0A 3F3FA 3JROA 4PSWB 1GOFA 3I8CA 4QRJA 5FLXg 3SXTD 3UVKA 1GOTB 2QR5A 4FB1D 2YNOA 3MKSB 5FFGA 4GGAA 3RN1D 3NVNA 4A2LA 2H3XA 3T3PA 3OKYA 3O4HA 3PSCB 2Z2NA 4NSXA 1XKSA 4BUJC 3VGZA 3EI2B 1VE7A 2G9AA 3IKOA 3BG1A 1YR2A 2CN3A 4JSNC 4OZUA 1OMWB 1RI6A 2VDKA 5CYKB 3RN0D 4J78A
chains in the Genus database with same CATH topology
2XZGA 5M5RA 5M5SA 1C9IA 5M5UA 5M5VA 1BPOA 5M5TA 1UTCA 3GD1I 4G55A 1C9LA 3GC3B 5M61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XZG A;  5M5R A;  5M5S A;  1C9I A;  5M5U A;  5M5V A;  1BPO A;  5M5T A;  1UTC A;  3GD1 I;  4G55 A;  1C9L A;  3GC3 B;  5M61 A; 
#chains in the Genus database with same CATH topology
 3ODT A;  3SBR A;  1QFS A;  3IIY A;  3J81 g;  2I0S A;  4J73 A;  5HE2 B;  5C2W B;  3DXM C;  3PE7 A;  2WQ8 A;  1H2X A;  5TEF A;  1SQJ A;  3SBP A;  2HU5 A;  1UTC A;  4LG9 A;  5TF2 A;  3BWS A;  4UM8 A;  3NIG A;  3MXX A;  2PM9 A;  1TYE A;  1QFM A;  1JMX B;  4K3I D;  3EMH A;  3BG0 A;  3SN6 B;  4X63 B;  4CI1 A;  3UVO A;  1VE6 A;  2AGZ A;  5EAL A;  5K19 A;  2OVQ B;  3ULE C;  5M5S A;  3I2N A;  4PNK B;  4QL1 A;  2JKX A;  4A2M A;  3AH8 B;  4TZ4 A;  2XYI A;  4Z8L A;  3FGB A;  4JHP C;  2H14 A;  3MZL A;  4MK0 B;  4LG8 A;  3DDU A;  4QAM A;  1GOH A;  2EBS A;  2IAA A;  4GMB A;  5AJA A;  3JZG A;  4L1M A;  4LGN A;  3JZN A;  1E5T A;  2P9I C;  5IGQ A;  3SHF A;  4ZN4 A;  2P9P C;  4CZX A;  4L3H D;  3DWL C;  3FCS A;  1Q47 A;  4EWR A;  2VZ3 A;  2H6K A;  4A09 B;  4J0X A;  4O02 A;  3UR4 A;  2I0T A;  2OVR B;  1GG2 B;  4N14 A;  3I7L A;  1JOF A;  2IUR A;  1MDA H;  3EI4 A;  1OLZ A;  4JHN A;  2H9M A;  2HKR A;  3ZDY A;  1O6G A;  4O3T B;  5E6U A;  4FA9 D;  4CY1 A;  5FKT A;  2G99 A;  1PEV A;  5HYN B;  4BCC A;  2YB8 B;  3I7O A;  2HKM A;  2YNP A;  3C99 A;  5I5I A;  3MUN A;  2UZY B;  1XIP A;  2OVP B;  3W15 A;  2AGX A;  4BCB A;  3JRP A;  4E54 A;  1E8N A;  3MUO A;  4WJK A;  3EI1 B;  2QC5 A;  4GQ1 A;  4GQB B;  2HES X;  4AMY A;  1XHM A;  3SLE D;  2HU8 A;  5HE1 B;  3RFH A;  4ZOY A;  4XYH A;  5AFU 3;  4CY5 A;  2I3S A;  4L3G D;  5HDB A;  3NIF A;  5FKS A;  4GM9 A;  2VDR A;  3I7H A;  2QXV A;  3IUM A;  2HYE A;  4JSX C;  4E5Z B;  4GM3 A;  3OF7 A;  3I89 A;  5EAP A;  1U4C A;  2AH1 A;  3K26 A;  4CY2 A;  3K6S A;  3ZE2 A;  4NC4 A;  4G56 B;  3SBQ A;  4ESG A;  3PXT D;  1NR0 A;  3ZDZ A;  4MMZ A;  5EAM A;  3IUJ A;  2HJ4 A;  4UI9 R;  5EMJ B;  5TEE A;  3DM0 A;  5I5M A;  3I7P A;  3NVQ A;  5IT9 g;  5HE3 B;  3EI3 B;  3SWS D;  3MKQ A;  5SXM A;  2BBK H;  3OKY B;  5CXB B;  3SJL D;  3ZWL B;  4DNU A;  1E8M A;  2EIE A;  3K27 A;  3KRX B;  2XZG A;  5EMM B;  3SCY A;  3UKU C;  4G55 A;  4PBY A;  4PXW A;  4L9O A;  4A11 A;  4Z7N A;  3OKT A;  4JSP C;  1B9X A;  4A7J A;  3ZE1 A;  2XU7 A;  5M61 A;  3O4J A;  2AQ5 A;  3MVD K;  4CI3 A;  3PVU B;  4A0B A;  4X60 B;  2HXC A;  4J8G A;  4CC9 A;  4WK4 A;  4J84 A;  2CE9 A;  2H9P A;  4JSV C;  4J0W A;  4BCD A;  2CNX A;  2PM9 B;  3FCU A;  3RMZ D;  1SHY B;  5H17 A;  3GFC A;  2EIB A;  3C5M A;  5H1M A;  5IGO A;  3ZE0 A;  3DSM A;  3ZDX A;  4Z7Q A;  2CN2 A;  2OIZ A;  2YMU A;  3JAM g;  3CIK B;  3CFS B;  3RFG A;  4QQE A;  2P9N C;  1S4U X;  2OK4 A;  3ORV D;  2VDN A;  3IUQ A;  4JT6 C;  4I79 A;  5K1C C;  5C2V B;  3FRX A;  2I0R A;  2XDW A;  3EG6 A;  5IJ7 E;  3HFQ A;  1R5M A;  4J81 A;  4A09 A;  5FKQ A;  5H14 A;  1H2Z A;  4X61 B;  2YBA A;  5C9Z B;  3OW8 A;  5CXC B;  1VZ2 A;  2P9U C;  3F3G A;  5FFO A;  4CY3 A;  3U4Y A;  3GC3 B;  3IUL A;  4PSX B;  3PXS D;  4G1M A;  5M5V A;  3EI4 B;  4FA1 D;  1L5G A;  4L1Q D;  2EIC A;  4PBZ A;  5AMS A;  4J87 A;  3E0C A;  1PGU A;  4J79 A;  2GC4 A;  2IUP A;  1BPO A;  1L0Q A;  4R7A B;  3B7F A;  3O4I A;  5EAR A;  5GSA A;  5HQG A;  1GXR A;  5EMK B;  4GM8 A;  3JPX A;  3UVM A;  1K8K C;  1TBG A;  2P9S C;  4A0A A;  4A08 A;  3OTT A;  4ZOZ A;  3SFZ A;  2BCJ B;  1U8C A;  3IIW A;  2VDM A;  3EQ9 A;  5JWZ A;  3SVW D;  3RSE C;  4AOW A;  5C92 A;  3N0E A;  3AL8 B;  1T2X A;  4E54 B;  2OJY A;  2P9L C;  2Z2O A;  2VDO A;  3DXK C;  3OL2 A;  5HE0 B;  3IJC A;  1JJU B;  3P4F A;  5E6S A;  2AH0 A;  2J56 H;  3A0F A;  3UKR C;  5B4W A;  4K3J B;  4BP8 A;  3PXW D;  5EM2 A;  1VYH C;  4IMM A;  4CI8 A;  5M5T A;  2B5M A;  1QNI A;  2BKL A;  2VZ1 A;  3EWE A;  3FM0 A;  1B9Y A;  4U1E I;  1JV2 A;  5E6R A;  4E5Z A;  4BH6 A;  3V9F A;  3CFV A;  4AN0 A;  4MMX A;  3V4P A;  1H2Y A;  3I7K A;  2P9K C;  5A2Q g;  3IUR A;  1NEX B;  2AGY A;  1N6E A;  5M5U A;  2HU7 A;  4MMY A;  4OWR A;  3OKW A;  3MZK A;  4ERY A;  4AX4 A;  4XEI C;  4AMZ A;  4FA4 D;  2H47 A;  4GQ2 P;  2AGL A;  3IJ1 A;  3O4G A;  3EI2 A;  3IVM A;  4ES0 A;  4DNV A;  2VDQ A;  4FAN D;  3RLM D;  3EI3 A;  2H6Q A;  4ERZ A;  5CYK A;  4KFM B;  1VZ3 A;  3L4M D;  5CXB A;  2QZP A;  3L4O D;  4CI2 A;  2HJB A;  5FA5 B;  3JB9 L;  2H9N A;  1MG2 A;  3V4V A;  1K3I A;  2VC2 A;  2J55 H;  4Y5R D;  4JT5 C;  4BP9 A;  4O45 A;  3V5W B;  4IA9 A;  4D6V A;  2I3T A;  2VDL A;  5I5J A;  5KDO B;  5C86 A;  2IWF A;  2XL2 A;  4A11 B;  1JTD B;  4Y7R A;  1UOP A;  2YNN A;  3C75 H;  3UVL A;  4CZY A;  4A0B B;  1ERJ A;  4YVD A;  3V7D B;  2UZX B;  4NAA A;  3PVW B;  5GXH A;  4D0K A;  1C9L A;  2H9L A;  3EU7 A;  2PM6 B;  2OK6 A;  4WK0 A;  2TRC B;  3NVX A;  3K72 A;  2CO0 A;  3F3P A;  2CO0 C;  4J86 A;  2J57 G;  4NBM A;  3GRE A;  1MG3 A;  2O9K A;  4NEN A;  4ZOX A;  5IJ8 E;  3IJ0 A;  1SQ9 A;  3PSL A;  4J77 A;  2XL3 A;  5GMK n;  3VA6 A;  2VDP A;  3IUN A;  1H2W A;  2PM7 B;  4GGD A;  3EQ8 A;  1PI6 A;  4BL0 A;  2Q7Q A;  1K32 A;  3I7N A;  1PBY B;  1YFQ A;  3UVN A;  2IUQ A;  4IRZ A;  1UOO A;  5CXC A;  3VH0 A;  3NID A;  4UM9 A;  3EQ7 A;  2CE8 A;  4CZV A;  4DNW A;  4U7A A;  2AGW A;  3GD1 I;  4ERQ A;  3N0D A;  4FAV D;  1GP2 B;  2B5N A;  2H13 A;  3AFC A;  1U2V C;  3RRM C;  4J82 A;  4JXM A;  2IUV A;  5EML B;  1N6D A;  4Z7O A;  4ZOV A;  4O2W A;  5FXY A;  2H68 A;  3K71 A;  3I8E A;  4GZ8 A;  3IJE A;  3JZH A;  3EI1 A;  4RE5 A;  2IWK A;  4A0A B;  4QT8 A;  2GC7 A;  4A08 B;  3J80 g;  4H5I A;  4WK2 A;  4D9S A;  1JMZ B;  3VI4 A;  4FWW A;  1A0R B;  3AL8 A;  1N6F A;  1UOQ A;  3QI0 A;  2MTA H;  4GGC A;  2Z2P A;  3KRW B;  2B5L A;  5TDH B;  4FA5 D;  2EID A;  4JD2 C;  3OL2 B;  3C9C A;  5GXI A;  1P22 A;  2PBI B;  1TYQ C;  2GNQ A;  5FKR A;  3AL9 A;  1C9I A;  4J8B A;  4FHL A;  4XYI A;  4O3U B;  5FQD A;  4AN1 A;  4AEZ A;  2XE4 A;  5EM2 B;  5THA A;  1M1X A;  4X3E A;  3QHY B;  5IC7 A;  1I2M B;  3SMR A;  4HDJ A;  2B4E A;  3VI3 A;  1O6F A;  4O1Q D;  2W18 A;  4O9D A;  4RE6 A;  5M5R A;  3T3M A;  3MMY A;  1A12 A;  1GOG A;  1FWX A;  4G1E A;  4H5J A;  2H6N A;  3KCI A;  4PC0 A;  3F3F A;  3JRO A;  4PSW B;  1GOF A;  3I8C A;  4QRJ A;  5FLX g;  3SXT D;  3UVK A;  1GOT B;  2QR5 A;  4FB1 D;  2YNO A;  3MKS B;  5FFG A;  4GGA A;  3RN1 D;  3NVN A;  4A2L A;  2H3X A;  3T3P A;  3OKY A;  3O4H A;  3PSC B;  2Z2N A;  4NSX A;  1XKS A;  4BUJ C;  3VGZ A;  3EI2 B;  1VE7 A;  2G9A A;  3IKO A;  3BG1 A;  1YR2 A;  2CN3 A;  4JSN C;  4OZU A;  1OMW B;  1RI6 A;  2VDK A;  5CYK B;  3RN0 D;  4J78 A; 
#chains in the Genus database with same CATH homology
 2XZG A;  5M5R A;  5M5S A;  1C9I A;  5M5U A;  5M5V A;  1BPO A;  5M5T A;  1UTC A;  3GD1 I;  4G55 A;  1C9L A;  3GC3 B;  5M61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...