4CY5A

Crystal structure of the nsl1-wds-nsl2 complex.
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
304
structure length
303
Chain Sequence
VKPNYTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTACHPTENIIASAALENDKTIKLWKSDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN WILL DIE SLOWLY
publication title Structural Analysis of the Kansl1/Wdr5/Kansl2 Complex Reveals that Wdr5 is Required for Efficient Assembly and Chromatin Targeting of the Nsl Complex.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
total genus 93
structure length 303
sequence length 304
ec nomenclature
pdb deposition date 2014-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4cy5A00
3ZWLB 3GFCA 2AGYA 2IUPA 3OL2A 5IGQA 1MG2A 5CXCB 2B5MA 1R5MA 4ZOVA 3PSCB 4E54B 3A0FA 2GNQA 1XHMA 4CI2A 3N0DA 2BCJB 2PBIB 2GC7A 4FA9D 2B4EA 3FGBA 5IT9g 3IIYA 3RN1D 5TF2A 4A08A 5I5IA 3JPXA 2PM7B 4XYHA 2HXCA 5GSAA 1N6EA 3I7KA 3SN6B 5GXIA 3JRPA 5TDHB 2B5LA 3PXWD 3IJ0A 4J86A 3HFQA 3BG0A 3F3GA 4JSXC 3UKRC 1GP2B 2EBSA 3SJLD 2YNNA 4A0BA 1NEXB 2J55H 4H5IA 4PNKB 4ERQA 4CY2A 5IC7A 4O9DA 4U7AA 3CFVA 5I5JA 4GGDA 3AFCA 4JD2C 5H1MA 5FKRA 3ULEC 3K27A 4YVDA 4L1QD 2XL3A 4A11B 3EI2A 4GQ1A 5K1CC 2BBKH 3DXMC 4Y7RA 5FKTA 4J77A 1GXRA 4GQ2P 3SFZA 4JSVC 2YMUA 2AH0A 5EMJB 2HYEA 3UVKA 4Z8LA 4A09A 4OZUA 1U4CA 1Q47A 1K8KC 5EM2B 4D0KA 4QT8A 3FRXA 3JZNA 3L4MD 4X63B 3EG6A 2CN2A 4J87A 3AL8B 4CI8A 4CC9A 4L3HD 4CY3A 4GGAA 3C75H 3N0EA 2AGLA 3EU7A 5EARA 3EI4A 4A0AB 2AGWA 2HKRA 4ZN4A 1SQJA 5FKSA 3PXTD 2GC4A 1L0QA 4CY5A 1OLZA 4GM8A 2CO0C 2YNPA 4IA9A 3EMHA 4E54A 1XKSA 3MMYA 3C99A 2AGXA 1VYHC 4I79A 5CXBB 3UKUC 2Z2PA 2O9KA 2AH1A 2OVPB 1QNIA 5EAPA 3UVNA 4PC0A 4ESGA 3I7NA 3I7OA 4CZYA 3RFGA 2QXVA 5I5MA 1SHYB 2H9NA 2CN3A 5CYKB 3MZKA 3SLED 3C9CA 3CFSB 3EI3B 4XYIA 4A2LA 3AH8B 2CE9A 2XYIA 3I7PA 4FHLA 5HQGA 3JZHA 4O1QD 4ZOZA 2TRCB 1P22A 2Z2OA 3PVUB 3I89A 4J78A 4G56B 2IUQA 2AQ5A 5EALA 3V5WB 3IJCA 4A11A 1JMXB 4IMMA 2P9NC 5HYNB 2UZYB 4TZ4A 5FXYA 1JOFA 1XIPA 3F3FA 3NVXA 2G9AA 3W15A 4D6VA 1GG2B 5TEFA 2I0SA 3SBQA 3OKYB 5EM2A 2H9PA 3P4FA 3UR4A 2H14A 3OKWA 4J79A 4FAND 1RI6A 3DSMA 3JAMg 1JMZB 4FA1D 4L3GD 2P9SC 3AL8A 1GOTB 4LG9A 2XU7A 3RN0D 1PGUA 4QL1A 4QRJA 2AGZA 3B7FA 3UVMA 5HE2B 4CZVA 3F3PA 3OTTA 3PXSD 4E5ZB 2H47A 4L9OA 5FLXg 4X60B 4MK0B 4A0AA 4U1EI 4A7JA 2MTAH 3RMZD 5KDOB 2H6KA 1TYQC 1U2VC 3L4OD 1SQ9A 2OVRB 1S4UX 5C9ZB 3MXXA 4ZOYA 2PM9B 4BL0A 5FQDA 1JJUB 5A2Qg 1A0RB 1B9XA 4O45A 1ERJA 5CXBA 2HKMA 2YBAA 3MKSB 3UVLA 1B9YA 2PM6B 2OVQB 3JZGA 4JT5C 5CXCA 4XEIC 2H9MA 2YNOA 5IGOA 3SBPA 4JSPC 3EI1B 3OKTA 1K32A 2J57G 4J82A 4CZXA 4PBYA 3DM0A 3EI3A 4LG8A 5EMLB 5AFU3 3RSEC 2QC5A 5JWZA 5C2WB 2H6NA 3CIKB 4N14A 2H9LA 2H68A 4JSNC 2OJYA 3V9FA 4HDJA 3I8EA 4LGNA 4FWWA 2W18A 2HJBA 5H14A 2HJ4A 2IWFA 3I7HA 3NVQA 5K19A 1OMWB 1PBYB 2I3TA 3VA6A 3SWSD 4AOWA 2XL2A 5THAA 4GMBA 5HE0B 1PI6A 3VGZA 3IKOA 3E0CA 2P9KC 4O3TB 2UZXB 4ERYA 2Z2NA 4J0XA 3J81g 5C2VB 3OL2B 1NR0A 3OKYA 3RLMD 2G99A 3KRWB 3BG1A 3J80g 1PEVA 4FA5D 3PSLA 4Y5RD 3RRMC 2OIZA 4BUJC 2H13A 3JROA 4ES0A 4R7AB 4GQBB 4A08B 4J73A 2OK4A 5EMMB 5HE3B 3VH0A 1MG3A 5SXMA 3I2NA 5AJAA 2IAAA 3SHFA 4E5ZA 3U4YA 1YFQA 2I0TA 4CI3A 4K3JB 3DXKC 4AEZA 2CO0A 4A2MA 1N6FA 4JXMA 4GGCA 2I3SA 2CNXA 4CY1A 2YB8B 4UI9R 5AMSA 4GM3A 5EMKB 2PM9A 3V7DB 4A0BB 2P9UC 4ERZA 1TBGA 2Q7QA 3RFHA 3SCYA 2IWKA 5IJ8E 2H3XA 3K26A 2H6QA 5H17A 4J8BA 4J8GA 3IIWA 4J0WA 4PXWA 4OWRA 3I8CA 3SMRA 2HESX 3ODTA 3SXTD 4ZOXA 2P9LC 3IJ1A 3C5MA 3KRXB 3NVNA 5FA5B 3PVWB 5GMKn 3EI2B 2B5NA 4X3EA 4O3UB 2OK6A 1MDAH 3EWEA 4JT6C 4FAVD 3EI1A 3PE7A 3SBRA 5IJ7E 1N6DA 5EAMA 4FB1D 4J84A 3UVOA 4A09B 4GZ8A 4J81A 4FA4D 2J56H 3OW8A 2I0RA 5B4WA 3JB9L 1FWXA 3AL9A 4QQEA 2CE8A 2P9PC 3MKQA 4GM9A 5CYKA 4EWRA 3GREA 2IUVA 4K3ID 4KFMB 2IURA 4PBZA 3ORVD 5FKQA 5GXHA 3SVWD 5TEEA 2P9IC 3FM0A 3EI4B 4CI1A 4PSXB 3MZLA 3BWSA 5HE1B 4BH6A 3DWLC 3I7LA 4H5JA 4X61B 4PSWB 4NSXA
chains in the Genus database with same CATH superfamily
3ZWLB 1A12A 3GFCA 2AGYA 2IUPA 1UOOA 3OL2A 5IGQA 1MG2A 5CXCB 2B5MA 1R5MA 4ZOVA 2XE4A 3PSCB 4E54B 3A0FA 2GNQA 1XHMA 4G1EA 3N0DA 4CI2A 2BCJB 2PBIB 2GC7A 4FA9D 2B4EA 3FGBA 4G55A 3IIYA 3RN1D 5IT9g 5TF2A 4A08A 5I5IA 3JPXA 2PM7B 2VDKA 3VI4A 2VDPA 4XYHA 2HXCA 5GSAA 1N6EA 3I7KA 3SN6B 5GXIA 3JRPA 5TDHB 2B5LA 3PXWD 1E5TA 5C86A 4BCCA 3IJ0A 4J86A 3HFQA 3BG0A 3F3GA 4JSXC 3UKRC 1GP2B 2EBSA 3IUQA 3SJLD 2YNNA 4A0BA 1NEXB 2J55H 4H5IA 1YR2A 4RE5A 4PNKB 4ERQA 2XDWA 4CY2A 5IC7A 4O9DA 1H2XA 4U7AA 1GOHA 4JHPC 3CFVA 5I5JA 2VZ1A 4GGDA 3AFCA 4JD2C 3NIDA 5H1MA 5FKRA 3DDUA 5M5VA 3ULEC 3K27A 4YVDA 1M1XA 4L1QD 2XL3A 4A11B 5M5SA 3EI2A 2HU8A 4GQ1A 1TYEA 4JHNA 2BBKH 3DXMC 5K1CC 4Y7RA 2VDMA 5FKTA 4J77A 1GXRA 4DNVA 4GQ2P 3SFZA 4JSVC 3ZE2A 2YMUA 2AH0A 5EMJB 4BCBA 2HYEA 4NENA 3UVKA 4Z8LA 4A09A 4OZUA 1E8NA 1U4CA 1Q47A 1K8KC 5EM2B 1JTDB 4D0KA 4QT8A 3FRXA 3JZNA 3L4MD 4X63B 5FFOA 3EG6A 2CN2A 4J87A 3AL8B 4WK2A 2EICA 4CI8A 4UM8A 4CC9A 4L3HD 4CY3A 4GGAA 1QFSA 4Z7QA 1U8CA 3C75H 3N0EA 2AGLA 3EU7A 5EARA 2HU5A 2VZ3A 5FFGA 4AN0A 3EI4A 4A0AB 4MMYA 2AGWA 2HKRA 4ZN4A 5E6UA 1SQJA 5FKSA 3PXTD 1QFMA 2GC4A 3QI0A 1L0QA 4CY5A 1OLZA 4GM8A 1H2WA 2CO0C 2YNPA 3K72A 4IA9A 3EMHA 4E54A 1XKSA 3MMYA 3C99A 2AGXA 1H2ZA 1VYHC 4I79A 5CXBB 4QAMA 3UKUC 2Z2PA 2O9KA 2AH1A 2OVPB 1QNIA 3IVMA 4WK0A 5EAPA 3UVNA 4PC0A 4ESGA 3I7NA 3I7OA 4CZYA 3ZDXA 2HU7A 3RFGA 2VDLA 3T3PA 2VDOA 2QXVA 5I5MA 1SHYB 4AMZA 2H9NA 2CN3A 5CYKB 3MZKA 3SLED 3C9CA 3CFSB 3EI3B 4RE6A 2VDQA 3NIGA 4NAAA 4XYIA 4A2LA 4WJKA 3AH8B 2CE9A 4AN1A 2XYIA 3I7PA 4FHLA 5HQGA 3JZHA 4O1QD 4ZOZA 2TRCB 4AX4A 1P22A 2Z2OA 3PVUB 3I89A 5E6SA 4MMZA 4J78A 1O6FA 5M5TA 4G56B 2IUQA 2AQ5A 5EALA 3V5WB 3IJCA 4A11A 4O02A 1JMXB 4IMMA 2P9NC 5HYNB 2UZYB 3NIFA 4TZ4A 5FXYA 1JOFA 2EIDA 3GD1I 1XIPA 2QR5A 3F3FA 3T3MA 3NVXA 2G9AA 3W15A 4D6VA 1GG2B 5HDBA 5TEFA 2I0SA 3O4IA 3SBQA 3OKYB 3EQ8A 5EM2A 2H9PA 3P4FA 3UR4A 2H14A 3OKWA 4J79A 4FAND 1RI6A 3DSMA 3JAMg 1JMZB 4FA1D 4L3GD 1UTCA 2P9SC 3AL8A 1GOTB 4LG9A 2XU7A 3RN0D 1PGUA 4QL1A 2JKXA 4QRJA 3GC3B 2AGZA 4DNWA 3B7FA 3UVMA 5HE2B 2QZPA 4CZVA 3KCIA 3F3PA 3OTTA 3PXSD 4E5ZB 2H47A 3EQ9A 4L9OA 5FLXg 4X60B 4MK0B 4A0AA 4U1EI 1I2MB 4A7JA 2MTAH 3RMZD 5KDOB 2H6KA 1TYQC 1U2VC 3L4OD 1SQ9A 2OVRB 4G1MA 2WQ8A 1S4UX 5C9ZB 1VZ3A 3MXXA 4ZOYA 2PM9B 4BL0A 3V4VA 5FQDA 1JJUB 3K71A 5A2Qg 1O6GA 5E6RA 1A0RB 1B9XA 4O45A 1ERJA 5CXBA 2HKMA 2YBAA 2EIEA 3MKSB 3UVLA 4NBMA 1B9YA 2PM6B 2OVQB 3JZGA 4JT5C 3ZE1A 5CXCA 4XEIC 3ZDZA 2H9MA 2YNOA 5IGOA 3ZE0A 3SBPA 4JSPC 3EI1B 2VDRA 3OKTA 4IRZA 1K32A 2J57G 4J82A 4CZXA 4PBYA 3DM0A 3EI3A 4LG8A 5EMLB 5AFU3 3RSEC 4UM9A 2QC5A 3IULA 5JWZA 3IUJA 5C2WB 2H6NA 3V4PA 3IJEA 3CIKB 4N14A 2H9LA 2H68A 4JSNC 4BP9A 2OJYA 4D9SA 3V9FA 4HDJA 3I8EA 4LGNA 4FWWA 2W18A 2HJBA 5H14A 2HJ4A 2IWFA 4BCDA 3I7HA 4NC4A 2BKLA 3NVQA 5K19A 1OMWB 1PBYB 2I3TA 3VA6A 3SWSD 3ZDYA 4AOWA 2XL2A 5THAA 2EIBA 4GMBA 5HE0B 1PI6A 3VGZA 3IKOA 3E0CA 2P9KC 4O3TB 2UZXB 4ERYA 2Z2NA 4J0XA 3J81g 3FCUA 5C2VB 3OL2B 1NR0A 3OKYA 4O2WA 3RLMD 2G99A 3KRWB 3BG1A 3J80g 1PEVA 4FA5D 3PSLA 4Y5RD 3RRMC 2OIZA 4BUJC 5M5UA 1VZ2A 2H13A 2VDNA 4MMXA 3JROA 4ES0A 4R7AB 4GQBB 4A08B 4J73A 3IUNA 2OK4A 5EMMB 3IUMA 5HE3B 3VH0A 4Z7NA 1MG3A 3O4GA 5SXMA 3I2NA 5AJAA 2IAAA 3OF7A 3SHFA 4E5ZA 1VE7A 3U4YA 5M61A 1YFQA 1GOFA 2I0TA 1T2XA 4CI3A 4K3JB 3DXKC 4AEZA 3O4HA 2CO0A 4A2MA 1N6FA 5M5RA 4JXMA 4GGCA 2I3SA 2CNXA 4DNUA 4CY1A 2YB8B 4UI9R 5AMSA 4GM3A 5EMKB 2PM9A 4Z7OA 3V7DB 4A0BB 2P9UC 4ERZA 1TBGA 2Q7QA 3RFHA 3SCYA 2IWKA 5IJ8E 2H3XA 3K26A 2H6QA 5H17A 3VI3A 1BPOA 4J8BA 4J8GA 3IIWA 4J0WA 1K3IA 4PXWA 4OWRA 3I8CA 3SMRA 1C9IA 2HESX 3ODTA 1E8MA 3SXTD 4ZOXA 2P9LC 3IJ1A 3C5MA 3KRXB 3NVNA 5FA5B 3PVWB 5GMKn 3EI2B 2B5NA 4X3EA 4O3UB 3IURA 2OK6A 1MDAH 3EWEA 4JT6C 1UOQA 4FAVD 3EI1A 3PE7A 3SBRA 3EQ7A 5IJ7E 1N6DA 2VC2A 5EAMA 3MVDK 1C9LA 4FB1D 4J84A 3UVOA 4A09B 4GZ8A 1JV2A 4AMYA 4J81A 4FA4D 3QHYB 2J56H 3OW8A 1VE6A 2I0RA 5B4WA 4BP8A 3JB9L 2XZGA 1FWXA 3O4JA 3AL9A 4QQEA 2CE8A 4WK4A 3MUOA 2P9PC 3MUNA 3MKQA 4GM9A 5CYKA 4EWRA 3GREA 1L5GA 2IUVA 4K3ID 1H2YA 4KFMB 2IURA 4PBZA 3ORVD 5FKQA 1UOPA 4L1MA 5GXHA 3SVWD 5TEEA 3K6SA 1GOGA 2P9IC 3FM0A 3EI4B 4CI1A 4PSXB 3MZLA 3BWSA 5HE1B 3FCSA 4BH6A 5C92A 3DWLC 3I7LA 4H5JA 4X61B 4PSWB 4NSXA
chains in the Genus database with same CATH topology
3ZWLB 3GFCA 2AGYA 2IUPA 3OL2A 5IGQA 1MG2A 5CXCB 2B5MA 1R5MA 4ZOVA 3PSCB 4E54B 3A0FA 2GNQA 1XHMA 4CI2A 3N0DA 2BCJB 2PBIB 2GC7A 4FA9D 2B4EA 3FGBA 5IT9g 3IIYA 3RN1D 5TF2A 4A08A 5I5IA 3JPXA 2PM7B 4XYHA 2HXCA 5GSAA 1N6EA 3I7KA 3SN6B 5GXIA 3JRPA 5TDHB 2B5LA 3PXWD 3IJ0A 4J86A 3HFQA 3BG0A 3F3GA 4JSXC 3UKRC 1GP2B 2EBSA 3SJLD 2YNNA 4A0BA 1NEXB 2J55H 4H5IA 4PNKB 4ERQA 4CY2A 5IC7A 4O9DA 4U7AA 3CFVA 5I5JA 4GGDA 3AFCA 4JD2C 5H1MA 5FKRA 3ULEC 3K27A 4YVDA 4L1QD 2XL3A 4A11B 3EI2A 4GQ1A 5K1CC 2BBKH 3DXMC 4Y7RA 5FKTA 4J77A 1GXRA 4GQ2P 3SFZA 4JSVC 2YMUA 2AH0A 5EMJB 2HYEA 3UVKA 4Z8LA 4A09A 4OZUA 1U4CA 1Q47A 1K8KC 5EM2B 4D0KA 4QT8A 3FRXA 3JZNA 3L4MD 4X63B 3EG6A 2CN2A 4J87A 3AL8B 4CI8A 4CC9A 4L3HD 4CY3A 4GGAA 3C75H 3N0EA 2AGLA 3EU7A 5EARA 3EI4A 4A0AB 2AGWA 2HKRA 4ZN4A 1SQJA 5FKSA 3PXTD 2GC4A 1L0QA 4CY5A 1OLZA 4GM8A 2CO0C 2YNPA 4IA9A 3EMHA 4E54A 1XKSA 3MMYA 3C99A 2AGXA 1VYHC 4I79A 5CXBB 3UKUC 2Z2PA 2O9KA 2AH1A 2OVPB 1QNIA 5EAPA 3UVNA 4PC0A 4ESGA 3I7NA 3I7OA 4CZYA 3RFGA 2QXVA 5I5MA 1SHYB 2H9NA 2CN3A 5CYKB 3MZKA 3SLED 3C9CA 3CFSB 3EI3B 4XYIA 4A2LA 3AH8B 2CE9A 2XYIA 3I7PA 4FHLA 5HQGA 3JZHA 4O1QD 4ZOZA 2TRCB 1P22A 2Z2OA 3PVUB 3I89A 4J78A 4G56B 2IUQA 2AQ5A 5EALA 3V5WB 3IJCA 4A11A 1JMXB 4IMMA 2P9NC 5HYNB 2UZYB 4TZ4A 5FXYA 1JOFA 1XIPA 3F3FA 3NVXA 2G9AA 3W15A 4D6VA 1GG2B 5TEFA 2I0SA 3SBQA 3OKYB 5EM2A 2H9PA 3P4FA 3UR4A 2H14A 3OKWA 4J79A 4FAND 1RI6A 3DSMA 3JAMg 1JMZB 4FA1D 4L3GD 2P9SC 3AL8A 1GOTB 4LG9A 2XU7A 3RN0D 1PGUA 4QL1A 4QRJA 2AGZA 3B7FA 3UVMA 5HE2B 4CZVA 3F3PA 3OTTA 3PXSD 4E5ZB 2H47A 4L9OA 5FLXg 4X60B 4MK0B 4A0AA 4U1EI 4A7JA 2MTAH 3RMZD 5KDOB 2H6KA 1TYQC 1U2VC 3L4OD 1SQ9A 2OVRB 1S4UX 5C9ZB 3MXXA 4ZOYA 2PM9B 4BL0A 5FQDA 1JJUB 5A2Qg 1A0RB 1B9XA 4O45A 1ERJA 5CXBA 2HKMA 2YBAA 3MKSB 3UVLA 1B9YA 2PM6B 2OVQB 3JZGA 4JT5C 5CXCA 4XEIC 2H9MA 2YNOA 5IGOA 3SBPA 4JSPC 3EI1B 3OKTA 1K32A 2J57G 4J82A 4CZXA 4PBYA 3DM0A 3EI3A 4LG8A 5EMLB 5AFU3 3RSEC 2QC5A 5JWZA 5C2WB 2H6NA 3CIKB 4N14A 2H9LA 2H68A 4JSNC 2OJYA 3V9FA 4HDJA 3I8EA 4LGNA 4FWWA 2W18A 2HJBA 5H14A 2HJ4A 2IWFA 3I7HA 3NVQA 5K19A 1OMWB 1PBYB 2I3TA 3VA6A 3SWSD 4AOWA 2XL2A 5THAA 4GMBA 5HE0B 1PI6A 3VGZA 3IKOA 3E0CA 2P9KC 4O3TB 2UZXB 4ERYA 2Z2NA 4J0XA 3J81g 5C2VB 3OL2B 1NR0A 3OKYA 3RLMD 2G99A 3KRWB 3BG1A 3J80g 1PEVA 4FA5D 3PSLA 4Y5RD 3RRMC 2OIZA 4BUJC 2H13A 3JROA 4ES0A 4R7AB 4GQBB 4A08B 4J73A 2OK4A 5EMMB 5HE3B 3VH0A 1MG3A 5SXMA 3I2NA 5AJAA 2IAAA 3SHFA 4E5ZA 3U4YA 1YFQA 2I0TA 4CI3A 4K3JB 3DXKC 4AEZA 2CO0A 4A2MA 1N6FA 4JXMA 4GGCA 2I3SA 2CNXA 4CY1A 2YB8B 4UI9R 5AMSA 4GM3A 5EMKB 2PM9A 3V7DB 4A0BB 2P9UC 4ERZA 1TBGA 2Q7QA 3RFHA 3SCYA 2IWKA 5IJ8E 2H3XA 3K26A 2H6QA 5H17A 4J8BA 4J8GA 3IIWA 4J0WA 4PXWA 4OWRA 3I8CA 3SMRA 2HESX 3ODTA 3SXTD 4ZOXA 2P9LC 3IJ1A 3C5MA 3KRXB 3NVNA 5FA5B 3PVWB 5GMKn 3EI2B 2B5NA 4X3EA 4O3UB 2OK6A 1MDAH 3EWEA 4JT6C 4FAVD 3EI1A 3PE7A 3SBRA 5IJ7E 1N6DA 5EAMA 4FB1D 4J84A 3UVOA 4A09B 4GZ8A 4J81A 4FA4D 2J56H 3OW8A 2I0RA 5B4WA 3JB9L 1FWXA 3AL9A 4QQEA 2CE8A 2P9PC 3MKQA 4GM9A 5CYKA 4EWRA 3GREA 2IUVA 4K3ID 4KFMB 2IURA 4PBZA 3ORVD 5FKQA 5GXHA 3SVWD 5TEEA 2P9IC 3FM0A 3EI4B 4CI1A 4PSXB 3MZLA 3BWSA 5HE1B 4BH6A 3DWLC 3I7LA 4H5JA 4X61B 4PSWB 4NSXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZWL B;  3GFC A;  2AGY A;  2IUP A;  3OL2 A;  5IGQ A;  1MG2 A;  5CXC B;  2B5M A;  1R5M A;  4ZOV A;  3PSC B;  4E54 B;  3A0F A;  2GNQ A;  1XHM A;  4CI2 A;  3N0D A;  2BCJ B;  2PBI B;  2GC7 A;  4FA9 D;  2B4E A;  3FGB A;  5IT9 g;  3IIY A;  3RN1 D;  5TF2 A;  4A08 A;  5I5I A;  3JPX A;  2PM7 B;  4XYH A;  2HXC A;  5GSA A;  1N6E A;  3I7K A;  3SN6 B;  5GXI A;  3JRP A;  5TDH B;  2B5L A;  3PXW D;  3IJ0 A;  4J86 A;  3HFQ A;  3BG0 A;  3F3G A;  4JSX C;  3UKR C;  1GP2 B;  2EBS A;  3SJL D;  2YNN A;  4A0B A;  1NEX B;  2J55 H;  4H5I A;  4PNK B;  4ERQ A;  4CY2 A;  5IC7 A;  4O9D A;  4U7A A;  3CFV A;  5I5J A;  4GGD A;  3AFC A;  4JD2 C;  5H1M A;  5FKR A;  3ULE C;  3K27 A;  4YVD A;  4L1Q D;  2XL3 A;  4A11 B;  3EI2 A;  4GQ1 A;  5K1C C;  2BBK H;  3DXM C;  4Y7R A;  5FKT A;  4J77 A;  1GXR A;  4GQ2 P;  3SFZ A;  4JSV C;  2YMU A;  2AH0 A;  5EMJ B;  2HYE A;  3UVK A;  4Z8L A;  4A09 A;  4OZU A;  1U4C A;  1Q47 A;  1K8K C;  5EM2 B;  4D0K A;  4QT8 A;  3FRX A;  3JZN A;  3L4M D;  4X63 B;  3EG6 A;  2CN2 A;  4J87 A;  3AL8 B;  4CI8 A;  4CC9 A;  4L3H D;  4CY3 A;  4GGA A;  3C75 H;  3N0E A;  2AGL A;  3EU7 A;  5EAR A;  3EI4 A;  4A0A B;  2AGW A;  2HKR A;  4ZN4 A;  1SQJ A;  5FKS A;  3PXT D;  2GC4 A;  1L0Q A;  4CY5 A;  1OLZ A;  4GM8 A;  2CO0 C;  2YNP A;  4IA9 A;  3EMH A;  4E54 A;  1XKS A;  3MMY A;  3C99 A;  2AGX A;  1VYH C;  4I79 A;  5CXB B;  3UKU C;  2Z2P A;  2O9K A;  2AH1 A;  2OVP B;  1QNI A;  5EAP A;  3UVN A;  4PC0 A;  4ESG A;  3I7N A;  3I7O A;  4CZY A;  3RFG A;  2QXV A;  5I5M A;  1SHY B;  2H9N A;  2CN3 A;  5CYK B;  3MZK A;  3SLE D;  3C9C A;  3CFS B;  3EI3 B;  4XYI A;  4A2L A;  3AH8 B;  2CE9 A;  2XYI A;  3I7P A;  4FHL A;  5HQG A;  3JZH A;  4O1Q D;  4ZOZ A;  2TRC B;  1P22 A;  2Z2O A;  3PVU B;  3I89 A;  4J78 A;  4G56 B;  2IUQ A;  2AQ5 A;  5EAL A;  3V5W B;  3IJC A;  4A11 A;  1JMX B;  4IMM A;  2P9N C;  5HYN B;  2UZY B;  4TZ4 A;  5FXY A;  1JOF A;  1XIP A;  3F3F A;  3NVX A;  2G9A A;  3W15 A;  4D6V A;  1GG2 B;  5TEF A;  2I0S A;  3SBQ A;  3OKY B;  5EM2 A;  2H9P A;  3P4F A;  3UR4 A;  2H14 A;  3OKW A;  4J79 A;  4FAN D;  1RI6 A;  3DSM A;  3JAM g;  1JMZ B;  4FA1 D;  4L3G D;  2P9S C;  3AL8 A;  1GOT B;  4LG9 A;  2XU7 A;  3RN0 D;  1PGU A;  4QL1 A;  4QRJ A;  2AGZ A;  3B7F A;  3UVM A;  5HE2 B;  4CZV A;  3F3P A;  3OTT A;  3PXS D;  4E5Z B;  2H47 A;  4L9O A;  5FLX g;  4X60 B;  4MK0 B;  4A0A A;  4U1E I;  4A7J A;  2MTA H;  3RMZ D;  5KDO B;  2H6K A;  1TYQ C;  1U2V C;  3L4O D;  1SQ9 A;  2OVR B;  1S4U X;  5C9Z B;  3MXX A;  4ZOY A;  2PM9 B;  4BL0 A;  5FQD A;  1JJU B;  5A2Q g;  1A0R B;  1B9X A;  4O45 A;  1ERJ A;  5CXB A;  2HKM A;  2YBA A;  3MKS B;  3UVL A;  1B9Y A;  2PM6 B;  2OVQ B;  3JZG A;  4JT5 C;  5CXC A;  4XEI C;  2H9M A;  2YNO A;  5IGO A;  3SBP A;  4JSP C;  3EI1 B;  3OKT A;  1K32 A;  2J57 G;  4J82 A;  4CZX A;  4PBY A;  3DM0 A;  3EI3 A;  4LG8 A;  5EML B;  5AFU 3;  3RSE C;  2QC5 A;  5JWZ A;  5C2W B;  2H6N A;  3CIK B;  4N14 A;  2H9L A;  2H68 A;  4JSN C;  2OJY A;  3V9F A;  4HDJ A;  3I8E A;  4LGN A;  4FWW A;  2W18 A;  2HJB A;  5H14 A;  2HJ4 A;  2IWF A;  3I7H A;  3NVQ A;  5K19 A;  1OMW B;  1PBY B;  2I3T A;  3VA6 A;  3SWS D;  4AOW A;  2XL2 A;  5THA A;  4GMB A;  5HE0 B;  1PI6 A;  3VGZ A;  3IKO A;  3E0C A;  2P9K C;  4O3T B;  2UZX B;  4ERY A;  2Z2N A;  4J0X A;  3J81 g;  5C2V B;  3OL2 B;  1NR0 A;  3OKY A;  3RLM D;  2G99 A;  3KRW B;  3BG1 A;  3J80 g;  1PEV A;  4FA5 D;  3PSL A;  4Y5R D;  3RRM C;  2OIZ A;  4BUJ C;  2H13 A;  3JRO A;  4ES0 A;  4R7A B;  4GQB B;  4A08 B;  4J73 A;  2OK4 A;  5EMM B;  5HE3 B;  3VH0 A;  1MG3 A;  5SXM A;  3I2N A;  5AJA A;  2IAA A;  3SHF A;  4E5Z A;  3U4Y A;  1YFQ A;  2I0T A;  4CI3 A;  4K3J B;  3DXK C;  4AEZ A;  2CO0 A;  4A2M A;  1N6F A;  4JXM A;  4GGC A;  2I3S A;  2CNX A;  4CY1 A;  2YB8 B;  4UI9 R;  5AMS A;  4GM3 A;  5EMK B;  2PM9 A;  3V7D B;  4A0B B;  2P9U C;  4ERZ A;  1TBG A;  2Q7Q A;  3RFH A;  3SCY A;  2IWK A;  5IJ8 E;  2H3X A;  3K26 A;  2H6Q A;  5H17 A;  4J8B A;  4J8G A;  3IIW A;  4J0W A;  4PXW A;  4OWR A;  3I8C A;  3SMR A;  2HES X;  3ODT A;  3SXT D;  4ZOX A;  2P9L C;  3IJ1 A;  3C5M A;  3KRX B;  3NVN A;  5FA5 B;  3PVW B;  5GMK n;  3EI2 B;  2B5N A;  4X3E A;  4O3U B;  2OK6 A;  1MDA H;  3EWE A;  4JT6 C;  4FAV D;  3EI1 A;  3PE7 A;  3SBR A;  5IJ7 E;  1N6D A;  5EAM A;  4FB1 D;  4J84 A;  3UVO A;  4A09 B;  4GZ8 A;  4J81 A;  4FA4 D;  2J56 H;  3OW8 A;  2I0R A;  5B4W A;  3JB9 L;  1FWX A;  3AL9 A;  4QQE A;  2CE8 A;  2P9P C;  3MKQ A;  4GM9 A;  5CYK A;  4EWR A;  3GRE A;  2IUV A;  4K3I D;  4KFM B;  2IUR A;  4PBZ A;  3ORV D;  5FKQ A;  5GXH A;  3SVW D;  5TEE A;  2P9I C;  3FM0 A;  3EI4 B;  4CI1 A;  4PSX B;  3MZL A;  3BWS A;  5HE1 B;  4BH6 A;  3DWL C;  3I7L A;  4H5J A;  4X61 B;  4PSW B;  4NSX A; 
#chains in the Genus database with same CATH topology
 3ZWL B;  1A12 A;  3GFC A;  2AGY A;  2IUP A;  1UOO A;  3OL2 A;  5IGQ A;  1MG2 A;  5CXC B;  2B5M A;  1R5M A;  4ZOV A;  2XE4 A;  3PSC B;  4E54 B;  3A0F A;  2GNQ A;  1XHM A;  4G1E A;  3N0D A;  4CI2 A;  2BCJ B;  2PBI B;  2GC7 A;  4FA9 D;  2B4E A;  3FGB A;  4G55 A;  3IIY A;  3RN1 D;  5IT9 g;  5TF2 A;  4A08 A;  5I5I A;  3JPX A;  2PM7 B;  2VDK A;  3VI4 A;  2VDP A;  4XYH A;  2HXC A;  5GSA A;  1N6E A;  3I7K A;  3SN6 B;  5GXI A;  3JRP A;  5TDH B;  2B5L A;  3PXW D;  1E5T A;  5C86 A;  4BCC A;  3IJ0 A;  4J86 A;  3HFQ A;  3BG0 A;  3F3G A;  4JSX C;  3UKR C;  1GP2 B;  2EBS A;  3IUQ A;  3SJL D;  2YNN A;  4A0B A;  1NEX B;  2J55 H;  4H5I A;  1YR2 A;  4RE5 A;  4PNK B;  4ERQ A;  2XDW A;  4CY2 A;  5IC7 A;  4O9D A;  1H2X A;  4U7A A;  1GOH A;  4JHP C;  3CFV A;  5I5J A;  2VZ1 A;  4GGD A;  3AFC A;  4JD2 C;  3NID A;  5H1M A;  5FKR A;  3DDU A;  5M5V A;  3ULE C;  3K27 A;  4YVD A;  1M1X A;  4L1Q D;  2XL3 A;  4A11 B;  5M5S A;  3EI2 A;  2HU8 A;  4GQ1 A;  1TYE A;  4JHN A;  2BBK H;  3DXM C;  5K1C C;  4Y7R A;  2VDM A;  5FKT A;  4J77 A;  1GXR A;  4DNV A;  4GQ2 P;  3SFZ A;  4JSV C;  3ZE2 A;  2YMU A;  2AH0 A;  5EMJ B;  4BCB A;  2HYE A;  4NEN A;  3UVK A;  4Z8L A;  4A09 A;  4OZU A;  1E8N A;  1U4C A;  1Q47 A;  1K8K C;  5EM2 B;  1JTD B;  4D0K A;  4QT8 A;  3FRX A;  3JZN A;  3L4M D;  4X63 B;  5FFO A;  3EG6 A;  2CN2 A;  4J87 A;  3AL8 B;  4WK2 A;  2EIC A;  4CI8 A;  4UM8 A;  4CC9 A;  4L3H D;  4CY3 A;  4GGA A;  1QFS A;  4Z7Q A;  1U8C A;  3C75 H;  3N0E A;  2AGL A;  3EU7 A;  5EAR A;  2HU5 A;  2VZ3 A;  5FFG A;  4AN0 A;  3EI4 A;  4A0A B;  4MMY A;  2AGW A;  2HKR A;  4ZN4 A;  5E6U A;  1SQJ A;  5FKS A;  3PXT D;  1QFM A;  2GC4 A;  3QI0 A;  1L0Q A;  4CY5 A;  1OLZ A;  4GM8 A;  1H2W A;  2CO0 C;  2YNP A;  3K72 A;  4IA9 A;  3EMH A;  4E54 A;  1XKS A;  3MMY A;  3C99 A;  2AGX A;  1H2Z A;  1VYH C;  4I79 A;  5CXB B;  4QAM A;  3UKU C;  2Z2P A;  2O9K A;  2AH1 A;  2OVP B;  1QNI A;  3IVM A;  4WK0 A;  5EAP A;  3UVN A;  4PC0 A;  4ESG A;  3I7N A;  3I7O A;  4CZY A;  3ZDX A;  2HU7 A;  3RFG A;  2VDL A;  3T3P A;  2VDO A;  2QXV A;  5I5M A;  1SHY B;  4AMZ A;  2H9N A;  2CN3 A;  5CYK B;  3MZK A;  3SLE D;  3C9C A;  3CFS B;  3EI3 B;  4RE6 A;  2VDQ A;  3NIG A;  4NAA A;  4XYI A;  4A2L A;  4WJK A;  3AH8 B;  2CE9 A;  4AN1 A;  2XYI A;  3I7P A;  4FHL A;  5HQG A;  3JZH A;  4O1Q D;  4ZOZ A;  2TRC B;  4AX4 A;  1P22 A;  2Z2O A;  3PVU B;  3I89 A;  5E6S A;  4MMZ A;  4J78 A;  1O6F A;  5M5T A;  4G56 B;  2IUQ A;  2AQ5 A;  5EAL A;  3V5W B;  3IJC A;  4A11 A;  4O02 A;  1JMX B;  4IMM A;  2P9N C;  5HYN B;  2UZY B;  3NIF A;  4TZ4 A;  5FXY A;  1JOF A;  2EID A;  3GD1 I;  1XIP A;  2QR5 A;  3F3F A;  3T3M A;  3NVX A;  2G9A A;  3W15 A;  4D6V A;  1GG2 B;  5HDB A;  5TEF A;  2I0S A;  3O4I A;  3SBQ A;  3OKY B;  3EQ8 A;  5EM2 A;  2H9P A;  3P4F A;  3UR4 A;  2H14 A;  3OKW A;  4J79 A;  4FAN D;  1RI6 A;  3DSM A;  3JAM g;  1JMZ B;  4FA1 D;  4L3G D;  1UTC A;  2P9S C;  3AL8 A;  1GOT B;  4LG9 A;  2XU7 A;  3RN0 D;  1PGU A;  4QL1 A;  2JKX A;  4QRJ A;  3GC3 B;  2AGZ A;  4DNW A;  3B7F A;  3UVM A;  5HE2 B;  2QZP A;  4CZV A;  3KCI A;  3F3P A;  3OTT A;  3PXS D;  4E5Z B;  2H47 A;  3EQ9 A;  4L9O A;  5FLX g;  4X60 B;  4MK0 B;  4A0A A;  4U1E I;  1I2M B;  4A7J A;  2MTA H;  3RMZ D;  5KDO B;  2H6K A;  1TYQ C;  1U2V C;  3L4O D;  1SQ9 A;  2OVR B;  4G1M A;  2WQ8 A;  1S4U X;  5C9Z B;  1VZ3 A;  3MXX A;  4ZOY A;  2PM9 B;  4BL0 A;  3V4V A;  5FQD A;  1JJU B;  3K71 A;  5A2Q g;  1O6G A;  5E6R A;  1A0R B;  1B9X A;  4O45 A;  1ERJ A;  5CXB A;  2HKM A;  2YBA A;  2EIE A;  3MKS B;  3UVL A;  4NBM A;  1B9Y A;  2PM6 B;  2OVQ B;  3JZG A;  4JT5 C;  3ZE1 A;  5CXC A;  4XEI C;  3ZDZ A;  2H9M A;  2YNO A;  5IGO A;  3ZE0 A;  3SBP A;  4JSP C;  3EI1 B;  2VDR A;  3OKT A;  4IRZ A;  1K32 A;  2J57 G;  4J82 A;  4CZX A;  4PBY A;  3DM0 A;  3EI3 A;  4LG8 A;  5EML B;  5AFU 3;  3RSE C;  4UM9 A;  2QC5 A;  3IUL A;  5JWZ A;  3IUJ A;  5C2W B;  2H6N A;  3V4P A;  3IJE A;  3CIK B;  4N14 A;  2H9L A;  2H68 A;  4JSN C;  4BP9 A;  2OJY A;  4D9S A;  3V9F A;  4HDJ A;  3I8E A;  4LGN A;  4FWW A;  2W18 A;  2HJB A;  5H14 A;  2HJ4 A;  2IWF A;  4BCD A;  3I7H A;  4NC4 A;  2BKL A;  3NVQ A;  5K19 A;  1OMW B;  1PBY B;  2I3T A;  3VA6 A;  3SWS D;  3ZDY A;  4AOW A;  2XL2 A;  5THA A;  2EIB A;  4GMB A;  5HE0 B;  1PI6 A;  3VGZ A;  3IKO A;  3E0C A;  2P9K C;  4O3T B;  2UZX B;  4ERY A;  2Z2N A;  4J0X A;  3J81 g;  3FCU A;  5C2V B;  3OL2 B;  1NR0 A;  3OKY A;  4O2W A;  3RLM D;  2G99 A;  3KRW B;  3BG1 A;  3J80 g;  1PEV A;  4FA5 D;  3PSL A;  4Y5R D;  3RRM C;  2OIZ A;  4BUJ C;  5M5U A;  1VZ2 A;  2H13 A;  2VDN A;  4MMX A;  3JRO A;  4ES0 A;  4R7A B;  4GQB B;  4A08 B;  4J73 A;  3IUN A;  2OK4 A;  5EMM B;  3IUM A;  5HE3 B;  3VH0 A;  4Z7N A;  1MG3 A;  3O4G A;  5SXM A;  3I2N A;  5AJA A;  2IAA A;  3OF7 A;  3SHF A;  4E5Z A;  1VE7 A;  3U4Y A;  5M61 A;  1YFQ A;  1GOF A;  2I0T A;  1T2X A;  4CI3 A;  4K3J B;  3DXK C;  4AEZ A;  3O4H A;  2CO0 A;  4A2M A;  1N6F A;  5M5R A;  4JXM A;  4GGC A;  2I3S A;  2CNX A;  4DNU A;  4CY1 A;  2YB8 B;  4UI9 R;  5AMS A;  4GM3 A;  5EMK B;  2PM9 A;  4Z7O A;  3V7D B;  4A0B B;  2P9U C;  4ERZ A;  1TBG A;  2Q7Q A;  3RFH A;  3SCY A;  2IWK A;  5IJ8 E;  2H3X A;  3K26 A;  2H6Q A;  5H17 A;  3VI3 A;  1BPO A;  4J8B A;  4J8G A;  3IIW A;  4J0W A;  1K3I A;  4PXW A;  4OWR A;  3I8C A;  3SMR A;  1C9I A;  2HES X;  3ODT A;  1E8M A;  3SXT D;  4ZOX A;  2P9L C;  3IJ1 A;  3C5M A;  3KRX B;  3NVN A;  5FA5 B;  3PVW B;  5GMK n;  3EI2 B;  2B5N A;  4X3E A;  4O3U B;  3IUR A;  2OK6 A;  1MDA H;  3EWE A;  4JT6 C;  1UOQ A;  4FAV D;  3EI1 A;  3PE7 A;  3SBR A;  3EQ7 A;  5IJ7 E;  1N6D A;  2VC2 A;  5EAM A;  3MVD K;  1C9L A;  4FB1 D;  4J84 A;  3UVO A;  4A09 B;  4GZ8 A;  1JV2 A;  4AMY A;  4J81 A;  4FA4 D;  3QHY B;  2J56 H;  3OW8 A;  1VE6 A;  2I0R A;  5B4W A;  4BP8 A;  3JB9 L;  2XZG A;  1FWX A;  3O4J A;  3AL9 A;  4QQE A;  2CE8 A;  4WK4 A;  3MUO A;  2P9P C;  3MUN A;  3MKQ A;  4GM9 A;  5CYK A;  4EWR A;  3GRE A;  1L5G A;  2IUV A;  4K3I D;  1H2Y A;  4KFM B;  2IUR A;  4PBZ A;  3ORV D;  5FKQ A;  1UOP A;  4L1M A;  5GXH A;  3SVW D;  5TEE A;  3K6S A;  1GOG A;  2P9I C;  3FM0 A;  3EI4 B;  4CI1 A;  4PSX B;  3MZL A;  3BWS A;  5HE1 B;  3FCS A;  4BH6 A;  5C92 A;  3DWL C;  3I7L A;  4H5J A;  4X61 B;  4PSW B;  4NSX A; 
#chains in the Genus database with same CATH homology
 3ZWL B;  3GFC A;  2AGY A;  2IUP A;  3OL2 A;  5IGQ A;  1MG2 A;  5CXC B;  2B5M A;  1R5M A;  4ZOV A;  3PSC B;  4E54 B;  3A0F A;  2GNQ A;  1XHM A;  4CI2 A;  3N0D A;  2BCJ B;  2PBI B;  2GC7 A;  4FA9 D;  2B4E A;  3FGB A;  5IT9 g;  3IIY A;  3RN1 D;  5TF2 A;  4A08 A;  5I5I A;  3JPX A;  2PM7 B;  4XYH A;  2HXC A;  5GSA A;  1N6E A;  3I7K A;  3SN6 B;  5GXI A;  3JRP A;  5TDH B;  2B5L A;  3PXW D;  3IJ0 A;  4J86 A;  3HFQ A;  3BG0 A;  3F3G A;  4JSX C;  3UKR C;  1GP2 B;  2EBS A;  3SJL D;  2YNN A;  4A0B A;  1NEX B;  2J55 H;  4H5I A;  4PNK B;  4ERQ A;  4CY2 A;  5IC7 A;  4O9D A;  4U7A A;  3CFV A;  5I5J A;  4GGD A;  3AFC A;  4JD2 C;  5H1M A;  5FKR A;  3ULE C;  3K27 A;  4YVD A;  4L1Q D;  2XL3 A;  4A11 B;  3EI2 A;  4GQ1 A;  5K1C C;  2BBK H;  3DXM C;  4Y7R A;  5FKT A;  4J77 A;  1GXR A;  4GQ2 P;  3SFZ A;  4JSV C;  2YMU A;  2AH0 A;  5EMJ B;  2HYE A;  3UVK A;  4Z8L A;  4A09 A;  4OZU A;  1U4C A;  1Q47 A;  1K8K C;  5EM2 B;  4D0K A;  4QT8 A;  3FRX A;  3JZN A;  3L4M D;  4X63 B;  3EG6 A;  2CN2 A;  4J87 A;  3AL8 B;  4CI8 A;  4CC9 A;  4L3H D;  4CY3 A;  4GGA A;  3C75 H;  3N0E A;  2AGL A;  3EU7 A;  5EAR A;  3EI4 A;  4A0A B;  2AGW A;  2HKR A;  4ZN4 A;  1SQJ A;  5FKS A;  3PXT D;  2GC4 A;  1L0Q A;  4CY5 A;  1OLZ A;  4GM8 A;  2CO0 C;  2YNP A;  4IA9 A;  3EMH A;  4E54 A;  1XKS A;  3MMY A;  3C99 A;  2AGX A;  1VYH C;  4I79 A;  5CXB B;  3UKU C;  2Z2P A;  2O9K A;  2AH1 A;  2OVP B;  1QNI A;  5EAP A;  3UVN A;  4PC0 A;  4ESG A;  3I7N A;  3I7O A;  4CZY A;  3RFG A;  2QXV A;  5I5M A;  1SHY B;  2H9N A;  2CN3 A;  5CYK B;  3MZK A;  3SLE D;  3C9C A;  3CFS B;  3EI3 B;  4XYI A;  4A2L A;  3AH8 B;  2CE9 A;  2XYI A;  3I7P A;  4FHL A;  5HQG A;  3JZH A;  4O1Q D;  4ZOZ A;  2TRC B;  1P22 A;  2Z2O A;  3PVU B;  3I89 A;  4J78 A;  4G56 B;  2IUQ A;  2AQ5 A;  5EAL A;  3V5W B;  3IJC A;  4A11 A;  1JMX B;  4IMM A;  2P9N C;  5HYN B;  2UZY B;  4TZ4 A;  5FXY A;  1JOF A;  1XIP A;  3F3F A;  3NVX A;  2G9A A;  3W15 A;  4D6V A;  1GG2 B;  5TEF A;  2I0S A;  3SBQ A;  3OKY B;  5EM2 A;  2H9P A;  3P4F A;  3UR4 A;  2H14 A;  3OKW A;  4J79 A;  4FAN D;  1RI6 A;  3DSM A;  3JAM g;  1JMZ B;  4FA1 D;  4L3G D;  2P9S C;  3AL8 A;  1GOT B;  4LG9 A;  2XU7 A;  3RN0 D;  1PGU A;  4QL1 A;  4QRJ A;  2AGZ A;  3B7F A;  3UVM A;  5HE2 B;  4CZV A;  3F3P A;  3OTT A;  3PXS D;  4E5Z B;  2H47 A;  4L9O A;  5FLX g;  4X60 B;  4MK0 B;  4A0A A;  4U1E I;  4A7J A;  2MTA H;  3RMZ D;  5KDO B;  2H6K A;  1TYQ C;  1U2V C;  3L4O D;  1SQ9 A;  2OVR B;  1S4U X;  5C9Z B;  3MXX A;  4ZOY A;  2PM9 B;  4BL0 A;  5FQD A;  1JJU B;  5A2Q g;  1A0R B;  1B9X A;  4O45 A;  1ERJ A;  5CXB A;  2HKM A;  2YBA A;  3MKS B;  3UVL A;  1B9Y A;  2PM6 B;  2OVQ B;  3JZG A;  4JT5 C;  5CXC A;  4XEI C;  2H9M A;  2YNO A;  5IGO A;  3SBP A;  4JSP C;  3EI1 B;  3OKT A;  1K32 A;  2J57 G;  4J82 A;  4CZX A;  4PBY A;  3DM0 A;  3EI3 A;  4LG8 A;  5EML B;  5AFU 3;  3RSE C;  2QC5 A;  5JWZ A;  5C2W B;  2H6N A;  3CIK B;  4N14 A;  2H9L A;  2H68 A;  4JSN C;  2OJY A;  3V9F A;  4HDJ A;  3I8E A;  4LGN A;  4FWW A;  2W18 A;  2HJB A;  5H14 A;  2HJ4 A;  2IWF A;  3I7H A;  3NVQ A;  5K19 A;  1OMW B;  1PBY B;  2I3T A;  3VA6 A;  3SWS D;  4AOW A;  2XL2 A;  5THA A;  4GMB A;  5HE0 B;  1PI6 A;  3VGZ A;  3IKO A;  3E0C A;  2P9K C;  4O3T B;  2UZX B;  4ERY A;  2Z2N A;  4J0X A;  3J81 g;  5C2V B;  3OL2 B;  1NR0 A;  3OKY A;  3RLM D;  2G99 A;  3KRW B;  3BG1 A;  3J80 g;  1PEV A;  4FA5 D;  3PSL A;  4Y5R D;  3RRM C;  2OIZ A;  4BUJ C;  2H13 A;  3JRO A;  4ES0 A;  4R7A B;  4GQB B;  4A08 B;  4J73 A;  2OK4 A;  5EMM B;  5HE3 B;  3VH0 A;  1MG3 A;  5SXM A;  3I2N A;  5AJA A;  2IAA A;  3SHF A;  4E5Z A;  3U4Y A;  1YFQ A;  2I0T A;  4CI3 A;  4K3J B;  3DXK C;  4AEZ A;  2CO0 A;  4A2M A;  1N6F A;  4JXM A;  4GGC A;  2I3S A;  2CNX A;  4CY1 A;  2YB8 B;  4UI9 R;  5AMS A;  4GM3 A;  5EMK B;  2PM9 A;  3V7D B;  4A0B B;  2P9U C;  4ERZ A;  1TBG A;  2Q7Q A;  3RFH A;  3SCY A;  2IWK A;  5IJ8 E;  2H3X A;  3K26 A;  2H6Q A;  5H17 A;  4J8B A;  4J8G A;  3IIW A;  4J0W A;  4PXW A;  4OWR A;  3I8C A;  3SMR A;  2HES X;  3ODT A;  3SXT D;  4ZOX A;  2P9L C;  3IJ1 A;  3C5M A;  3KRX B;  3NVN A;  5FA5 B;  3PVW B;  5GMK n;  3EI2 B;  2B5N A;  4X3E A;  4O3U B;  2OK6 A;  1MDA H;  3EWE A;  4JT6 C;  4FAV D;  3EI1 A;  3PE7 A;  3SBR A;  5IJ7 E;  1N6D A;  5EAM A;  4FB1 D;  4J84 A;  3UVO A;  4A09 B;  4GZ8 A;  4J81 A;  4FA4 D;  2J56 H;  3OW8 A;  2I0R A;  5B4W A;  3JB9 L;  1FWX A;  3AL9 A;  4QQE A;  2CE8 A;  2P9P C;  3MKQ A;  4GM9 A;  5CYK A;  4EWR A;  3GRE A;  2IUV A;  4K3I D;  4KFM B;  2IUR A;  4PBZ A;  3ORV D;  5FKQ A;  5GXH A;  3SVW D;  5TEE A;  2P9I C;  3FM0 A;  3EI4 B;  4CI1 A;  4PSX B;  3MZL A;  3BWS A;  5HE1 B;  4BH6 A;  3DWL C;  3I7L A;  4H5J A;  4X61 B;  4PSW B;  4NSX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...