4CY5A

Crystal structure of the nsl1-wds-nsl2 complex.
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
304
structure length
303
Chain Sequence
VKPNYTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTACHPTENIIASAALENDKTIKLWKSDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords PROTEIN WILL DIE SLOWLY
publication title Structural Analysis of the Kansl1/Wdr5/Kansl2 Complex Reveals that Wdr5 is Required for Efficient Assembly and Chromatin Targeting of the Nsl Complex.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 93
structure length 303
sequence length 304
ec nomenclature
pdb deposition date 2014-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4cy5A00
4PBYA 3DM0A 3SCYA 3W15A 1MG2A 4X60B 2IWFA 2H9MA 5HE1B 3EMHA 3SVWD 3JAMg 3V9FA 4QT8A 5IJ8E 3NVNA 2P9UC 4KFMB 4J79A 1XIPA 2XU7A 4JXMA 2PM9A 4JSXC 2GC7A 2H6NA 2OK6A 4H5JA 3FGBA 5TF2A 3UVNA 4FA9D 4N14A 5K1CC 2YMUA 2B5MA 4J81A 4OWRA 2P9NC 2XYIA 3JROA 3JRPA 4G56B 2Q7QA 1FWXA 3RMZD 3J80g 2BBKH 3I7LA 1K32A 3EU7A 5H17A 4X61B 3UVKA 3UVMA 1GP2B 3NVXA 2HYEA 4GGDA 2P9LC 5CYKA 1VYHC 2I0RA 3RSEC 3PXWD 3PVUB 3EI2B 1OLZA 3GFCA 3PVWB 2H3XA 1R5MA 4J77A 2AGZA 4ZN4A 1B9XA 2H68A 4NSXA 3OKYB 3V5WB 2H9PA 3AL8A 5TEFA 3RN1D 4BUJC 3C9CA 5IGQA 2HJBA 5FLXg 4CI8A 3EWEA 5I5MA 1B9YA 2AGLA 3SBPA 4CI3A 3C99A 4A08A 2P9IC 4ERQA 4BL0A 4JT6C 4D0KA 5EM2B 4J78A 4PBZA 2O9KA 1S4UX 4A0BA 4LG8A 4GQ2P 3EI4B 3I7NA 2B4EA 2H9LA 4J73A 4IMMA 2HXCA 4J8GA 4R7AB 5C9ZB 5CXCA 3BG0A 4ERZA 3L4MD 4O3UB 2Z2OA 3MKSB 2HESX 4EWRA 4CC9A 2GC4A 5EAMA 2G99A 3EG6A 3SFZA 4FAND 4A11B 2CE9A 5EAPA 4UI9R 4AOWA 3K26A 5K19A 3OKTA 5AFU3 4QL1A 3IIYA 3DXKC 4YVDA 2HJ4A 2CN2A 3FRXA 2OVRB 2H47A 5GXIA 3V7DB 4FA4D 5C2VB 2I0TA 5I5JA 4X3EA 3B7FA 3CFVA 4U1EI 4PSXB 5FA5B 4Y7RA 3KRXB 2J57G 2Z2NA 5AJAA 2P9PC 4K3JB 3RFHA 4XEIC 2Z2PA 3N0DA 4ESGA 4A2MA 3MZLA 4CZYA 4XYIA 3U4YA 3MKQA 3DSMA 3OL2A 4CY1A 4FA1D 2W18A 5A2Qg 4CZVA 1P22A 4GGCA 2OIZA 2G9AA 4CY3A 3BG1A 2OJYA 4J0XA 2H13A 4FA5D 4E5ZB 2AQ5A 4QQEA 5I5IA 2IURA 4FB1D 5KDOB 2CNXA 2CO0A 2I0SA 2AGYA 3EI1B 3EI3B 4J8BA 3OTTA 2QXVA 3VA6A 2H6QA 5HE3B 5H1MA 3CFSB 5FQDA 1N6EA 5B4WA 1NEXB 5EM2A 4A0AA 3MZKA 3VH0A 3UVOA 3IIWA 1QNIA 4ZOYA 3MMYA 3SWSD 4JSPC 4CY2A 1TYQC 3UVLA 4O3TB 2UZXB 3IJ1A 4IA9A 4J84A 3SHFA 4QRJA 3RN0D 2J55H 1MDAH 2OK4A 5C2WB 4A09A 1RI6A 2B5NA 2IUQA 5HYNB 3OKWA 5TEEA 2BCJB 4GM9A 4O9DA 5EARA 1TBGA 3ULEC 4O1QD 4O45A 3PSLA 3I7OA 2HKRA 3N0EA 1JMZB 2OVPB 2J56H 2PM7B 4X63B 3I8EA 3PXTD 3MXXA 2IAAA 2YBAA 2XL3A 1GOTB 3DXMC 1A0RB 3I2NA 4GQBB 5CYKB 4XYHA 3RLMD 2YB8B 3GREA 3BWSA 4GQ1A 5FKTA 1MG3A 2HKMA 5IJ7E 1JOFA 4GMBA 1GXRA 3L4OD 4K3ID 4E54B 3PE7A 5SXMA 1U4CA 1PEVA 2B5LA 3FM0A 1NR0A 3ORVD 5CXBB 3SN6B 3AFCA 3IKOA 3I7HA 4ERYA 4JSVC 4OZUA 3JB9L 4A0BB 4JD2C 3RRMC 1L0QA 3OW8A 4D6VA 2CN3A 4J87A 2AGXA 2I3TA 4CI2A 1ERJA 4CZXA 1JMXB 1PI6A 5HQGA 5CXCB 3EI2A 3SJLD 2YNOA 5GSAA 4JSNC 3OKYA 5AMSA 4Z8LA 2TRCB 3ZWLB 3P4FA 2OVQB 1N6FA 4PXWA 3SBRA 4H5IA 2IUPA 4J86A 3KRWB 5GXHA 4PC0A 3DWLC 3IJ0A 4L3GD 3JZHA 4LGNA 5EMKB 5FXYA 2IUVA 3I7KA 2EBSA 3SBQA 1YFQA 3EI4A 2YNNA 3CIKB 4ZOVA 4L1QD 4AEZA 5JWZA 4HDJA 3UKUC 3J81g 3A0FA 3PXSD 3C75H 3SMRA 3F3FA 3I8CA 5HE2B 3UKRC 4FAVD 3SXTD 1SQ9A 4BH6A 4FWWA 3OL2B 4GGAA 5HE0B 3JZNA 3VGZA 1PBYB 3E0CA 2AH0A 2PM9B 5EMLB 4A11A 1SQJA 2H9NA 1PGUA 3SLED 2MTAH 1JJUB 4ZOZA 4I79A 5THAA 4TZ4A 2XL2A 4ES0A 3K27A 2CO0C 2AGWA 3UR4A 4E54A 2AH1A 1N6DA 4GM8A 4L3HD 5H14A 4L9OA 4MK0B 5IT9g 5CXBA 4CI1A 3IJCA 4CY5A 5FKSA 1GG2B 3AH8B 3I89A 4A0AB 2PBIB 4A2LA 4FHLA 3JZGA 3ODTA 1SHYB 5IC7A 1U2VC 1XKSA 3C5MA 3F3PA 3AL8B 4J82A 3JPXA 4GZ8A 3I7PA 4PSWB 3HFQA 2CE8A 3NVQA 4E5ZA 1XHMA 5FKRA 4Y5RD 5EMJB 4PNKB 2P9SC 4A08B 5IGOA 4GM3A 5TDHB 3EI1A 3EI3A 4A09B 2H6KA 2QC5A 4JT5C 5EALA 4ZOXA 2GNQA 2H14A 5EMMB 2P9KC 2I3SA 4J0WA 3F3GA 4A7JA 3PSCB 4LG9A 1Q47A 5GMKn 1OMWB 2IWKA 3AL9A 2PM6B 3RFGA 4U7AA 2YNPA 5FKQA 1K8KC 2UZYB
chains in the Genus database with same CATH superfamily
4PBYA 5E6RA 3DM0A 4DNWA 3SCYA 3W15A 1MG2A 4Z7NA 4X60B 2IWFA 3O4GA 2H9MA 5HE1B 4G1EA 3EMHA 3SVWD 3JAMg 3V9FA 4QT8A 3QI0A 3NVNA 5IJ8E 2P9UC 4KFMB 4J79A 1XIPA 2XU7A 4JXMA 2PM9A 2EIBA 4JSXC 2GC7A 2H6NA 2OK6A 2VDNA 4H5JA 4WJKA 3FGBA 5TF2A 3UVNA 4FA9D 4N14A 5K1CC 2YMUA 2B5MA 4J81A 3EQ8A 4OWRA 2P9NC 2XYIA 3JROA 3O4IA 3JRPA 1A12A 4G56B 2Q7QA 1FWXA 3RMZD 3K71A 3J80g 1U8CA 2BBKH 3I7LA 2BKLA 1K32A 3NIDA 3IULA 4MMXA 3EU7A 5H17A 3KCIA 4X61B 4Z7OA 3NIFA 3UVKA 3UVMA 1GP2B 3VI3A 5M5TA 3NVXA 2HYEA 4GGDA 3IUQA 2P9LC 5CYKA 1VYHC 2VDRA 2I0RA 3RSEC 3PXWD 3PVUB 3MUNA 3EI2B 1OLZA 3GFCA 3PVWB 2H3XA 1R5MA 4J77A 2AGZA 4BP9A 4ZN4A 1E8NA 5FFOA 1B9XA 2H68A 3OKYB 4NSXA 3V5WB 2H9PA 3AL8A 5TEFA 3RN1D 4BUJC 3NIGA 3C9CA 4MMZA 5IGQA 2HJBA 5FLXg 4CI8A 3EWEA 5I5MA 4NC4A 1B9YA 2AGLA 3SBPA 4CI3A 4DNUA 3C99A 4A08A 2P9IC 4ERQA 3IUNA 4BL0A 4JT6C 4D0KA 5EM2B 4J78A 4BCCA 4PBZA 2O9KA 1S4UX 4A0BA 1I2MB 4LG8A 4GQ2P 3EI4B 3I7NA 2B4EA 2H9LA 2XDWA 4J73A 4IMMA 3ZE0A 3O4HA 2HXCA 4J8GA 4R7AB 1GOHA 5M5VA 5C9ZB 5CXCA 3BG0A 4ERZA 1H2ZA 3L4MD 4O3UB 2Z2OA 3MKSB 2HESX 4EWRA 4CC9A 2EICA 2GC4A 4MMYA 4UM9A 5EAMA 2G99A 4AMZA 3ZDYA 1C9IA 3EG6A 3SFZA 4FAND 4A11B 2CE9A 5EAPA 1K3IA 1O6FA 2VC2A 4UI9R 4AOWA 3K26A 5K19A 3OKTA 5AFU3 4QL1A 3GD1I 3IIYA 1VE7A 3DXKC 3ZDZA 4YVDA 2HJ4A 3MVDK 2CN2A 3FRXA 2OVRB 1L5GA 2H47A 5GXIA 3V7DB 4FA4D 3MUOA 5C2VB 2I0TA 5I5JA 4X3EA 3B7FA 3CFVA 5HDBA 4U1EI 4PSXB 1GOFA 5FA5B 4Y7RA 3KRXB 4DNVA 2J57G 2Z2NA 5AJAA 2P9PC 4K3JB 3RFHA 4XEIC 2Z2PA 3N0DA 3O4JA 4A2MA 4ESGA 3MZLA 4CZYA 4XYIA 3U4YA 3MKQA 2VZ1A 3DSMA 3OL2A 4CY1A 4FA1D 2W18A 5A2Qg 4CZVA 1P22A 4GGCA 1M1XA 2HU7A 2OIZA 2G9AA 1UOOA 4CY3A 3BG1A 2EIDA 2OJYA 4J0XA 2H13A 2VDMA 4FA5D 4E5ZB 2AQ5A 3T3MA 4QQEA 5I5IA 2IURA 4FB1D 5KDOB 2CNXA 2CO0A 2I0SA 2VDPA 5M61A 2AGYA 3EI1B 3EI3B 1H2WA 4J8BA 3OTTA 2QXVA 3VA6A 4L1MA 2H6QA 5HE3B 5H1MA 3CFSB 5FQDA 1N6EA 4RE5A 5B4WA 3IVMA 1E5TA 1NEXB 5EM2A 1H2YA 4A0AA 3MZKA 4D9SA 3T3PA 4Z7QA 3VH0A 3UVOA 3IIWA 1QNIA 1VE6A 3IUJA 4ZOYA 3FCUA 4BP8A 3MMYA 3SWSD 4JSPC 4CY2A 1TYQC 2WQ8A 3UVLA 4O3TB 4WK0A 2UZXB 5M5UA 1TYEA 1QFMA 4NBMA 3IJ1A 4IA9A 4J84A 3SHFA 4QRJA 3RN0D 2J55H 1MDAH 2OK4A 1O6GA 4AN0A 5C2WB 4A09A 1RI6A 2B5NA 2IUQA 5HYNB 4QAMA 2HU8A 3OKWA 5TEEA 2BCJB 4GM9A 4O9DA 5EARA 1TBGA 3ULEC 4O1QD 4IRZA 4O45A 5M5RA 4AMYA 3DDUA 3PSLA 3I7OA 1C9LA 1GOGA 2HKRA 3N0EA 1JMZB 2OVPB 2VDKA 2J56H 2PM7B 3IJEA 3V4PA 1BPOA 4X63B 3I8EA 3PXTD 3MXXA 2IAAA 3DXMC 2YBAA 2XL3A 1UOPA 1GOTB 1A0RB 3I2NA 4GQBB 5CYKB 4XYHA 3RLMD 2YB8B 3GREA 3BWSA 4GQ1A 5FKTA 1H2XA 1MG3A 2HKMA 3GC3B 5IJ7E 4UM8A 1JOFA 4GMBA 1GXRA 3L4OD 4K3ID 4E54B 3PE7A 5SXMA 1U4CA 1VZ3A 3IUMA 1PEVA 2B5LA 5E6UA 3FM0A 5C86A 1NR0A 1YR2A 3ORVD 4BCBA 5CXBB 3SN6B 3AFCA 3IKOA 3I7HA 4ERYA 4JSVC 4RE6A 4OZUA 3JB9L 4A0BB 4JD2C 3RRMC 1L0QA 2HU5A 3OW8A 4D6VA 2EIEA 2CN3A 4AN1A 4J87A 2AGXA 2I3TA 4CI2A 2QR5A 1ERJA 4CZXA 1JMXB 3ZE1A 1PI6A 4NAAA 5HQGA 3VI4A 5CXCB 3EI2A 3SJLD 2YNOA 5GSAA 4JSNC 3OKYA 5AMSA 3EQ9A 1UOQA 3OF7A 4JHPC 4Z8LA 2TRCB 3ZWLB 3P4FA 2OVQB 1N6FA 4PXWA 3SBRA 4H5IA 2IUPA 4J86A 4BCDA 3KRWB 5GXHA 4PC0A 5M5SA 3DWLC 3IJ0A 4L3GD 3FCSA 3JZHA 4LGNA 5EMKB 5FXYA 2IUVA 3I7KA 2EBSA 3SBQA 1YFQA 2JKXA 3EI4A 2YNNA 3CIKB 4AX4A 4ZOVA 4L1QD 4AEZA 5FFGA 3ZDXA 5JWZA 4HDJA 3UKUC 3J81g 2QZPA 3A0FA 3PXSD 3C75H 3SMRA 3F3FA 3I8CA 1JTDB 3IURA 5HE2B 3UKRC 3V4VA 4FAVD 3SXTD 1SQ9A 4BH6A 4FWWA 3OL2B 4GGAA 4WK4A 5HE0B 3JZNA 3VGZA 1PBYB 3E0CA 2AH0A 2PM9B 5EMLB 4A11A 1SQJA 2H9NA 1PGUA 1QFSA 3SLED 2MTAH 1JJUB 4ZOZA 4I79A 5E6SA 5THAA 4TZ4A 3K72A 2XL2A 4ES0A 3K27A 2CO0C 2AGWA 3UR4A 4WK2A 4E54A 2AH1A 1N6DA 4GM8A 4L3HD 5H14A 4L9OA 4MK0B 5IT9g 3QHYB 1E8MA 2XZGA 5CXBA 4CI1A 3IJCA 4CY5A 5FKSA 1GG2B 3AH8B 3I89A 2VDQA 4O02A 4A0AB 2PBIB 4A2LA 4FHLA 3JZGA 3ODTA 1SHYB 5IC7A 1U2VC 1XKSA 3C5MA 3F3PA 4NENA 1UTCA 3AL8B 4J82A 4G1MA 3JPXA 4GZ8A 3I7PA 4PSWB 3HFQA 2CE8A 3NVQA 4E5ZA 1XHMA 5FKRA 4Y5RD 3ZE2A 5EMJB 4G55A 4PNKB 3K6SA 2P9SC 4A08B 1JV2A 5IGOA 4GM3A 5TDHB 3EI1A 3EI3A 4A09B 2H6KA 2QC5A 4JT5C 5EALA 4ZOXA 2GNQA 4O2WA 2H14A 5C92A 1T2XA 5EMMB 2P9KC 2I3SA 3EQ7A 4J0WA 3F3GA 4A7JA 3PSCB 4LG9A 1Q47A 5GMKn 2VDOA 1OMWB 2IWKA 2VZ3A 3AL9A 2PM6B 4JHNA 2VDLA 4U7AA 3RFGA 1VZ2A 2YNPA 5FKQA 1K8KC 2UZYB 2XE4A
chains in the Genus database with same CATH topology
4PBYA 3DM0A 3SCYA 3W15A 1MG2A 4X60B 2IWFA 2H9MA 5HE1B 3EMHA 3SVWD 3JAMg 3V9FA 4QT8A 5IJ8E 3NVNA 2P9UC 4KFMB 4J79A 1XIPA 2XU7A 4JXMA 2PM9A 4JSXC 2GC7A 2H6NA 2OK6A 4H5JA 3FGBA 5TF2A 3UVNA 4FA9D 4N14A 5K1CC 2YMUA 2B5MA 4J81A 4OWRA 2P9NC 2XYIA 3JROA 3JRPA 4G56B 2Q7QA 1FWXA 3RMZD 3J80g 2BBKH 3I7LA 1K32A 3EU7A 5H17A 4X61B 3UVKA 3UVMA 1GP2B 3NVXA 2HYEA 4GGDA 2P9LC 5CYKA 1VYHC 2I0RA 3RSEC 3PXWD 3PVUB 3EI2B 1OLZA 3GFCA 3PVWB 2H3XA 1R5MA 4J77A 2AGZA 4ZN4A 1B9XA 2H68A 4NSXA 3OKYB 3V5WB 2H9PA 3AL8A 5TEFA 3RN1D 4BUJC 3C9CA 5IGQA 2HJBA 5FLXg 4CI8A 3EWEA 5I5MA 1B9YA 2AGLA 3SBPA 4CI3A 3C99A 4A08A 2P9IC 4ERQA 4BL0A 4JT6C 4D0KA 5EM2B 4J78A 4PBZA 2O9KA 1S4UX 4A0BA 4LG8A 4GQ2P 3EI4B 3I7NA 2B4EA 2H9LA 4J73A 4IMMA 2HXCA 4J8GA 4R7AB 5C9ZB 5CXCA 3BG0A 4ERZA 3L4MD 4O3UB 2Z2OA 3MKSB 2HESX 4EWRA 4CC9A 2GC4A 5EAMA 2G99A 3EG6A 3SFZA 4FAND 4A11B 2CE9A 5EAPA 4UI9R 4AOWA 3K26A 5K19A 3OKTA 5AFU3 4QL1A 3IIYA 3DXKC 4YVDA 2HJ4A 2CN2A 3FRXA 2OVRB 2H47A 5GXIA 3V7DB 4FA4D 5C2VB 2I0TA 5I5JA 4X3EA 3B7FA 3CFVA 4U1EI 4PSXB 5FA5B 4Y7RA 3KRXB 2J57G 2Z2NA 5AJAA 2P9PC 4K3JB 3RFHA 4XEIC 2Z2PA 3N0DA 4ESGA 4A2MA 3MZLA 4CZYA 4XYIA 3U4YA 3MKQA 3DSMA 3OL2A 4CY1A 4FA1D 2W18A 5A2Qg 4CZVA 1P22A 4GGCA 2OIZA 2G9AA 4CY3A 3BG1A 2OJYA 4J0XA 2H13A 4FA5D 4E5ZB 2AQ5A 4QQEA 5I5IA 2IURA 4FB1D 5KDOB 2CNXA 2CO0A 2I0SA 2AGYA 3EI1B 3EI3B 4J8BA 3OTTA 2QXVA 3VA6A 2H6QA 5HE3B 5H1MA 3CFSB 5FQDA 1N6EA 5B4WA 1NEXB 5EM2A 4A0AA 3MZKA 3VH0A 3UVOA 3IIWA 1QNIA 4ZOYA 3MMYA 3SWSD 4JSPC 4CY2A 1TYQC 3UVLA 4O3TB 2UZXB 3IJ1A 4IA9A 4J84A 3SHFA 4QRJA 3RN0D 2J55H 1MDAH 2OK4A 5C2WB 4A09A 1RI6A 2B5NA 2IUQA 5HYNB 3OKWA 5TEEA 2BCJB 4GM9A 4O9DA 5EARA 1TBGA 3ULEC 4O1QD 4O45A 3PSLA 3I7OA 2HKRA 3N0EA 1JMZB 2OVPB 2J56H 2PM7B 4X63B 3I8EA 3PXTD 3MXXA 2IAAA 2YBAA 2XL3A 1GOTB 3DXMC 1A0RB 3I2NA 4GQBB 5CYKB 4XYHA 3RLMD 2YB8B 3GREA 3BWSA 4GQ1A 5FKTA 1MG3A 2HKMA 5IJ7E 1JOFA 4GMBA 1GXRA 3L4OD 4K3ID 4E54B 3PE7A 5SXMA 1U4CA 1PEVA 2B5LA 3FM0A 1NR0A 3ORVD 5CXBB 3SN6B 3AFCA 3IKOA 3I7HA 4ERYA 4JSVC 4OZUA 3JB9L 4A0BB 4JD2C 3RRMC 1L0QA 3OW8A 4D6VA 2CN3A 4J87A 2AGXA 2I3TA 4CI2A 1ERJA 4CZXA 1JMXB 1PI6A 5HQGA 5CXCB 3EI2A 3SJLD 2YNOA 5GSAA 4JSNC 3OKYA 5AMSA 4Z8LA 2TRCB 3ZWLB 3P4FA 2OVQB 1N6FA 4PXWA 3SBRA 4H5IA 2IUPA 4J86A 3KRWB 5GXHA 4PC0A 3DWLC 3IJ0A 4L3GD 3JZHA 4LGNA 5EMKB 5FXYA 2IUVA 3I7KA 2EBSA 3SBQA 1YFQA 3EI4A 2YNNA 3CIKB 4ZOVA 4L1QD 4AEZA 5JWZA 4HDJA 3UKUC 3J81g 3A0FA 3PXSD 3C75H 3SMRA 3F3FA 3I8CA 5HE2B 3UKRC 4FAVD 3SXTD 1SQ9A 4BH6A 4FWWA 3OL2B 4GGAA 5HE0B 3JZNA 3VGZA 1PBYB 3E0CA 2AH0A 2PM9B 5EMLB 4A11A 1SQJA 2H9NA 1PGUA 3SLED 2MTAH 1JJUB 4ZOZA 4I79A 5THAA 4TZ4A 2XL2A 4ES0A 3K27A 2CO0C 2AGWA 3UR4A 4E54A 2AH1A 1N6DA 4GM8A 4L3HD 5H14A 4L9OA 4MK0B 5IT9g 5CXBA 4CI1A 3IJCA 4CY5A 5FKSA 1GG2B 3AH8B 3I89A 4A0AB 2PBIB 4A2LA 4FHLA 3JZGA 3ODTA 1SHYB 5IC7A 1U2VC 1XKSA 3C5MA 3F3PA 3AL8B 4J82A 3JPXA 4GZ8A 3I7PA 4PSWB 3HFQA 2CE8A 3NVQA 4E5ZA 1XHMA 5FKRA 4Y5RD 5EMJB 4PNKB 2P9SC 4A08B 5IGOA 4GM3A 5TDHB 3EI1A 3EI3A 4A09B 2H6KA 2QC5A 4JT5C 5EALA 4ZOXA 2GNQA 2H14A 5EMMB 2P9KC 2I3SA 4J0WA 3F3GA 4A7JA 3PSCB 4LG9A 1Q47A 5GMKn 1OMWB 2IWKA 3AL9A 2PM6B 3RFGA 4U7AA 2YNPA 5FKQA 1K8KC 2UZYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PBY A;  3DM0 A;  3SCY A;  3W15 A;  1MG2 A;  4X60 B;  2IWF A;  2H9M A;  5HE1 B;  3EMH A;  3SVW D;  3JAM g;  3V9F A;  4QT8 A;  5IJ8 E;  3NVN A;  2P9U C;  4KFM B;  4J79 A;  1XIP A;  2XU7 A;  4JXM A;  2PM9 A;  4JSX C;  2GC7 A;  2H6N A;  2OK6 A;  4H5J A;  3FGB A;  5TF2 A;  3UVN A;  4FA9 D;  4N14 A;  5K1C C;  2YMU A;  2B5M A;  4J81 A;  4OWR A;  2P9N C;  2XYI A;  3JRO A;  3JRP A;  4G56 B;  2Q7Q A;  1FWX A;  3RMZ D;  3J80 g;  2BBK H;  3I7L A;  1K32 A;  3EU7 A;  5H17 A;  4X61 B;  3UVK A;  3UVM A;  1GP2 B;  3NVX A;  2HYE A;  4GGD A;  2P9L C;  5CYK A;  1VYH C;  2I0R A;  3RSE C;  3PXW D;  3PVU B;  3EI2 B;  1OLZ A;  3GFC A;  3PVW B;  2H3X A;  1R5M A;  4J77 A;  2AGZ A;  4ZN4 A;  1B9X A;  2H68 A;  4NSX A;  3OKY B;  3V5W B;  2H9P A;  3AL8 A;  5TEF A;  3RN1 D;  4BUJ C;  3C9C A;  5IGQ A;  2HJB A;  5FLX g;  4CI8 A;  3EWE A;  5I5M A;  1B9Y A;  2AGL A;  3SBP A;  4CI3 A;  3C99 A;  4A08 A;  2P9I C;  4ERQ A;  4BL0 A;  4JT6 C;  4D0K A;  5EM2 B;  4J78 A;  4PBZ A;  2O9K A;  1S4U X;  4A0B A;  4LG8 A;  4GQ2 P;  3EI4 B;  3I7N A;  2B4E A;  2H9L A;  4J73 A;  4IMM A;  2HXC A;  4J8G A;  4R7A B;  5C9Z B;  5CXC A;  3BG0 A;  4ERZ A;  3L4M D;  4O3U B;  2Z2O A;  3MKS B;  2HES X;  4EWR A;  4CC9 A;  2GC4 A;  5EAM A;  2G99 A;  3EG6 A;  3SFZ A;  4FAN D;  4A11 B;  2CE9 A;  5EAP A;  4UI9 R;  4AOW A;  3K26 A;  5K19 A;  3OKT A;  5AFU 3;  4QL1 A;  3IIY A;  3DXK C;  4YVD A;  2HJ4 A;  2CN2 A;  3FRX A;  2OVR B;  2H47 A;  5GXI A;  3V7D B;  4FA4 D;  5C2V B;  2I0T A;  5I5J A;  4X3E A;  3B7F A;  3CFV A;  4U1E I;  4PSX B;  5FA5 B;  4Y7R A;  3KRX B;  2J57 G;  2Z2N A;  5AJA A;  2P9P C;  4K3J B;  3RFH A;  4XEI C;  2Z2P A;  3N0D A;  4ESG A;  4A2M A;  3MZL A;  4CZY A;  4XYI A;  3U4Y A;  3MKQ A;  3DSM A;  3OL2 A;  4CY1 A;  4FA1 D;  2W18 A;  5A2Q g;  4CZV A;  1P22 A;  4GGC A;  2OIZ A;  2G9A A;  4CY3 A;  3BG1 A;  2OJY A;  4J0X A;  2H13 A;  4FA5 D;  4E5Z B;  2AQ5 A;  4QQE A;  5I5I A;  2IUR A;  4FB1 D;  5KDO B;  2CNX A;  2CO0 A;  2I0S A;  2AGY A;  3EI1 B;  3EI3 B;  4J8B A;  3OTT A;  2QXV A;  3VA6 A;  2H6Q A;  5HE3 B;  5H1M A;  3CFS B;  5FQD A;  1N6E A;  5B4W A;  1NEX B;  5EM2 A;  4A0A A;  3MZK A;  3VH0 A;  3UVO A;  3IIW A;  1QNI A;  4ZOY A;  3MMY A;  3SWS D;  4JSP C;  4CY2 A;  1TYQ C;  3UVL A;  4O3T B;  2UZX B;  3IJ1 A;  4IA9 A;  4J84 A;  3SHF A;  4QRJ A;  3RN0 D;  2J55 H;  1MDA H;  2OK4 A;  5C2W B;  4A09 A;  1RI6 A;  2B5N A;  2IUQ A;  5HYN B;  3OKW A;  5TEE A;  2BCJ B;  4GM9 A;  4O9D A;  5EAR A;  1TBG A;  3ULE C;  4O1Q D;  4O45 A;  3PSL A;  3I7O A;  2HKR A;  3N0E A;  1JMZ B;  2OVP B;  2J56 H;  2PM7 B;  4X63 B;  3I8E A;  3PXT D;  3MXX A;  2IAA A;  2YBA A;  2XL3 A;  1GOT B;  3DXM C;  1A0R B;  3I2N A;  4GQB B;  5CYK B;  4XYH A;  3RLM D;  2YB8 B;  3GRE A;  3BWS A;  4GQ1 A;  5FKT A;  1MG3 A;  2HKM A;  5IJ7 E;  1JOF A;  4GMB A;  1GXR A;  3L4O D;  4K3I D;  4E54 B;  3PE7 A;  5SXM A;  1U4C A;  1PEV A;  2B5L A;  3FM0 A;  1NR0 A;  3ORV D;  5CXB B;  3SN6 B;  3AFC A;  3IKO A;  3I7H A;  4ERY A;  4JSV C;  4OZU A;  3JB9 L;  4A0B B;  4JD2 C;  3RRM C;  1L0Q A;  3OW8 A;  4D6V A;  2CN3 A;  4J87 A;  2AGX A;  2I3T A;  4CI2 A;  1ERJ A;  4CZX A;  1JMX B;  1PI6 A;  5HQG A;  5CXC B;  3EI2 A;  3SJL D;  2YNO A;  5GSA A;  4JSN C;  3OKY A;  5AMS A;  4Z8L A;  2TRC B;  3ZWL B;  3P4F A;  2OVQ B;  1N6F A;  4PXW A;  3SBR A;  4H5I A;  2IUP A;  4J86 A;  3KRW B;  5GXH A;  4PC0 A;  3DWL C;  3IJ0 A;  4L3G D;  3JZH A;  4LGN A;  5EMK B;  5FXY A;  2IUV A;  3I7K A;  2EBS A;  3SBQ A;  1YFQ A;  3EI4 A;  2YNN A;  3CIK B;  4ZOV A;  4L1Q D;  4AEZ A;  5JWZ A;  4HDJ A;  3UKU C;  3J81 g;  3A0F A;  3PXS D;  3C75 H;  3SMR A;  3F3F A;  3I8C A;  5HE2 B;  3UKR C;  4FAV D;  3SXT D;  1SQ9 A;  4BH6 A;  4FWW A;  3OL2 B;  4GGA A;  5HE0 B;  3JZN A;  3VGZ A;  1PBY B;  3E0C A;  2AH0 A;  2PM9 B;  5EML B;  4A11 A;  1SQJ A;  2H9N A;  1PGU A;  3SLE D;  2MTA H;  1JJU B;  4ZOZ A;  4I79 A;  5THA A;  4TZ4 A;  2XL2 A;  4ES0 A;  3K27 A;  2CO0 C;  2AGW A;  3UR4 A;  4E54 A;  2AH1 A;  1N6D A;  4GM8 A;  4L3H D;  5H14 A;  4L9O A;  4MK0 B;  5IT9 g;  5CXB A;  4CI1 A;  3IJC A;  4CY5 A;  5FKS A;  1GG2 B;  3AH8 B;  3I89 A;  4A0A B;  2PBI B;  4A2L A;  4FHL A;  3JZG A;  3ODT A;  1SHY B;  5IC7 A;  1U2V C;  1XKS A;  3C5M A;  3F3P A;  3AL8 B;  4J82 A;  3JPX A;  4GZ8 A;  3I7P A;  4PSW B;  3HFQ A;  2CE8 A;  3NVQ A;  4E5Z A;  1XHM A;  5FKR A;  4Y5R D;  5EMJ B;  4PNK B;  2P9S C;  4A08 B;  5IGO A;  4GM3 A;  5TDH B;  3EI1 A;  3EI3 A;  4A09 B;  2H6K A;  2QC5 A;  4JT5 C;  5EAL A;  4ZOX A;  2GNQ A;  2H14 A;  5EMM B;  2P9K C;  2I3S A;  4J0W A;  3F3G A;  4A7J A;  3PSC B;  4LG9 A;  1Q47 A;  5GMK n;  1OMW B;  2IWK A;  3AL9 A;  2PM6 B;  3RFG A;  4U7A A;  2YNP A;  5FKQ A;  1K8K C;  2UZY B; 
#chains in the Genus database with same CATH topology
 4PBY A;  5E6R A;  3DM0 A;  4DNW A;  3SCY A;  3W15 A;  1MG2 A;  4Z7N A;  4X60 B;  2IWF A;  3O4G A;  2H9M A;  5HE1 B;  4G1E A;  3EMH A;  3SVW D;  3JAM g;  3V9F A;  4QT8 A;  3QI0 A;  3NVN A;  5IJ8 E;  2P9U C;  4KFM B;  4J79 A;  1XIP A;  2XU7 A;  4JXM A;  2PM9 A;  2EIB A;  4JSX C;  2GC7 A;  2H6N A;  2OK6 A;  2VDN A;  4H5J A;  4WJK A;  3FGB A;  5TF2 A;  3UVN A;  4FA9 D;  4N14 A;  5K1C C;  2YMU A;  2B5M A;  4J81 A;  3EQ8 A;  4OWR A;  2P9N C;  2XYI A;  3JRO A;  3O4I A;  3JRP A;  1A12 A;  4G56 B;  2Q7Q A;  1FWX A;  3RMZ D;  3K71 A;  3J80 g;  1U8C A;  2BBK H;  3I7L A;  2BKL A;  1K32 A;  3NID A;  3IUL A;  4MMX A;  3EU7 A;  5H17 A;  3KCI A;  4X61 B;  4Z7O A;  3NIF A;  3UVK A;  3UVM A;  1GP2 B;  3VI3 A;  5M5T A;  3NVX A;  2HYE A;  4GGD A;  3IUQ A;  2P9L C;  5CYK A;  1VYH C;  2VDR A;  2I0R A;  3RSE C;  3PXW D;  3PVU B;  3MUN A;  3EI2 B;  1OLZ A;  3GFC A;  3PVW B;  2H3X A;  1R5M A;  4J77 A;  2AGZ A;  4BP9 A;  4ZN4 A;  1E8N A;  5FFO A;  1B9X A;  2H68 A;  3OKY B;  4NSX A;  3V5W B;  2H9P A;  3AL8 A;  5TEF A;  3RN1 D;  4BUJ C;  3NIG A;  3C9C A;  4MMZ A;  5IGQ A;  2HJB A;  5FLX g;  4CI8 A;  3EWE A;  5I5M A;  4NC4 A;  1B9Y A;  2AGL A;  3SBP A;  4CI3 A;  4DNU A;  3C99 A;  4A08 A;  2P9I C;  4ERQ A;  3IUN A;  4BL0 A;  4JT6 C;  4D0K A;  5EM2 B;  4J78 A;  4BCC A;  4PBZ A;  2O9K A;  1S4U X;  4A0B A;  1I2M B;  4LG8 A;  4GQ2 P;  3EI4 B;  3I7N A;  2B4E A;  2H9L A;  2XDW A;  4J73 A;  4IMM A;  3ZE0 A;  3O4H A;  2HXC A;  4J8G A;  4R7A B;  1GOH A;  5M5V A;  5C9Z B;  5CXC A;  3BG0 A;  4ERZ A;  1H2Z A;  3L4M D;  4O3U B;  2Z2O A;  3MKS B;  2HES X;  4EWR A;  4CC9 A;  2EIC A;  2GC4 A;  4MMY A;  4UM9 A;  5EAM A;  2G99 A;  4AMZ A;  3ZDY A;  1C9I A;  3EG6 A;  3SFZ A;  4FAN D;  4A11 B;  2CE9 A;  5EAP A;  1K3I A;  1O6F A;  2VC2 A;  4UI9 R;  4AOW A;  3K26 A;  5K19 A;  3OKT A;  5AFU 3;  4QL1 A;  3GD1 I;  3IIY A;  1VE7 A;  3DXK C;  3ZDZ A;  4YVD A;  2HJ4 A;  3MVD K;  2CN2 A;  3FRX A;  2OVR B;  1L5G A;  2H47 A;  5GXI A;  3V7D B;  4FA4 D;  3MUO A;  5C2V B;  2I0T A;  5I5J A;  4X3E A;  3B7F A;  3CFV A;  5HDB A;  4U1E I;  4PSX B;  1GOF A;  5FA5 B;  4Y7R A;  3KRX B;  4DNV A;  2J57 G;  2Z2N A;  5AJA A;  2P9P C;  4K3J B;  3RFH A;  4XEI C;  2Z2P A;  3N0D A;  3O4J A;  4A2M A;  4ESG A;  3MZL A;  4CZY A;  4XYI A;  3U4Y A;  3MKQ A;  2VZ1 A;  3DSM A;  3OL2 A;  4CY1 A;  4FA1 D;  2W18 A;  5A2Q g;  4CZV A;  1P22 A;  4GGC A;  1M1X A;  2HU7 A;  2OIZ A;  2G9A A;  1UOO A;  4CY3 A;  3BG1 A;  2EID A;  2OJY A;  4J0X A;  2H13 A;  2VDM A;  4FA5 D;  4E5Z B;  2AQ5 A;  3T3M A;  4QQE A;  5I5I A;  2IUR A;  4FB1 D;  5KDO B;  2CNX A;  2CO0 A;  2I0S A;  2VDP A;  5M61 A;  2AGY A;  3EI1 B;  3EI3 B;  1H2W A;  4J8B A;  3OTT A;  2QXV A;  3VA6 A;  4L1M A;  2H6Q A;  5HE3 B;  5H1M A;  3CFS B;  5FQD A;  1N6E A;  4RE5 A;  5B4W A;  3IVM A;  1E5T A;  1NEX B;  5EM2 A;  1H2Y A;  4A0A A;  3MZK A;  4D9S A;  3T3P A;  4Z7Q A;  3VH0 A;  3UVO A;  3IIW A;  1QNI A;  1VE6 A;  3IUJ A;  4ZOY A;  3FCU A;  4BP8 A;  3MMY A;  3SWS D;  4JSP C;  4CY2 A;  1TYQ C;  2WQ8 A;  3UVL A;  4O3T B;  4WK0 A;  2UZX B;  5M5U A;  1TYE A;  1QFM A;  4NBM A;  3IJ1 A;  4IA9 A;  4J84 A;  3SHF A;  4QRJ A;  3RN0 D;  2J55 H;  1MDA H;  2OK4 A;  1O6G A;  4AN0 A;  5C2W B;  4A09 A;  1RI6 A;  2B5N A;  2IUQ A;  5HYN B;  4QAM A;  2HU8 A;  3OKW A;  5TEE A;  2BCJ B;  4GM9 A;  4O9D A;  5EAR A;  1TBG A;  3ULE C;  4O1Q D;  4IRZ A;  4O45 A;  5M5R A;  4AMY A;  3DDU A;  3PSL A;  3I7O A;  1C9L A;  1GOG A;  2HKR A;  3N0E A;  1JMZ B;  2OVP B;  2VDK A;  2J56 H;  2PM7 B;  3IJE A;  3V4P A;  1BPO A;  4X63 B;  3I8E A;  3PXT D;  3MXX A;  2IAA A;  3DXM C;  2YBA A;  2XL3 A;  1UOP A;  1GOT B;  1A0R B;  3I2N A;  4GQB B;  5CYK B;  4XYH A;  3RLM D;  2YB8 B;  3GRE A;  3BWS A;  4GQ1 A;  5FKT A;  1H2X A;  1MG3 A;  2HKM A;  3GC3 B;  5IJ7 E;  4UM8 A;  1JOF A;  4GMB A;  1GXR A;  3L4O D;  4K3I D;  4E54 B;  3PE7 A;  5SXM A;  1U4C A;  1VZ3 A;  3IUM A;  1PEV A;  2B5L A;  5E6U A;  3FM0 A;  5C86 A;  1NR0 A;  1YR2 A;  3ORV D;  4BCB A;  5CXB B;  3SN6 B;  3AFC A;  3IKO A;  3I7H A;  4ERY A;  4JSV C;  4RE6 A;  4OZU A;  3JB9 L;  4A0B B;  4JD2 C;  3RRM C;  1L0Q A;  2HU5 A;  3OW8 A;  4D6V A;  2EIE A;  2CN3 A;  4AN1 A;  4J87 A;  2AGX A;  2I3T A;  4CI2 A;  2QR5 A;  1ERJ A;  4CZX A;  1JMX B;  3ZE1 A;  1PI6 A;  4NAA A;  5HQG A;  3VI4 A;  5CXC B;  3EI2 A;  3SJL D;  2YNO A;  5GSA A;  4JSN C;  3OKY A;  5AMS A;  3EQ9 A;  1UOQ A;  3OF7 A;  4JHP C;  4Z8L A;  2TRC B;  3ZWL B;  3P4F A;  2OVQ B;  1N6F A;  4PXW A;  3SBR A;  4H5I A;  2IUP A;  4J86 A;  4BCD A;  3KRW B;  5GXH A;  4PC0 A;  5M5S A;  3DWL C;  3IJ0 A;  4L3G D;  3FCS A;  3JZH A;  4LGN A;  5EMK B;  5FXY A;  2IUV A;  3I7K A;  2EBS A;  3SBQ A;  1YFQ A;  2JKX A;  3EI4 A;  2YNN A;  3CIK B;  4AX4 A;  4ZOV A;  4L1Q D;  4AEZ A;  5FFG A;  3ZDX A;  5JWZ A;  4HDJ A;  3UKU C;  3J81 g;  2QZP A;  3A0F A;  3PXS D;  3C75 H;  3SMR A;  3F3F A;  3I8C A;  1JTD B;  3IUR A;  5HE2 B;  3UKR C;  3V4V A;  4FAV D;  3SXT D;  1SQ9 A;  4BH6 A;  4FWW A;  3OL2 B;  4GGA A;  4WK4 A;  5HE0 B;  3JZN A;  3VGZ A;  1PBY B;  3E0C A;  2AH0 A;  2PM9 B;  5EML B;  4A11 A;  1SQJ A;  2H9N A;  1PGU A;  1QFS A;  3SLE D;  2MTA H;  1JJU B;  4ZOZ A;  4I79 A;  5E6S A;  5THA A;  4TZ4 A;  3K72 A;  2XL2 A;  4ES0 A;  3K27 A;  2CO0 C;  2AGW A;  3UR4 A;  4WK2 A;  4E54 A;  2AH1 A;  1N6D A;  4GM8 A;  4L3H D;  5H14 A;  4L9O A;  4MK0 B;  5IT9 g;  3QHY B;  1E8M A;  2XZG A;  5CXB A;  4CI1 A;  3IJC A;  4CY5 A;  5FKS A;  1GG2 B;  3AH8 B;  3I89 A;  2VDQ A;  4O02 A;  4A0A B;  2PBI B;  4A2L A;  4FHL A;  3JZG A;  3ODT A;  1SHY B;  5IC7 A;  1U2V C;  1XKS A;  3C5M A;  3F3P A;  4NEN A;  1UTC A;  3AL8 B;  4J82 A;  4G1M A;  3JPX A;  4GZ8 A;  3I7P A;  4PSW B;  3HFQ A;  2CE8 A;  3NVQ A;  4E5Z A;  1XHM A;  5FKR A;  4Y5R D;  3ZE2 A;  5EMJ B;  4G55 A;  4PNK B;  3K6S A;  2P9S C;  4A08 B;  1JV2 A;  5IGO A;  4GM3 A;  5TDH B;  3EI1 A;  3EI3 A;  4A09 B;  2H6K A;  2QC5 A;  4JT5 C;  5EAL A;  4ZOX A;  2GNQ A;  4O2W A;  2H14 A;  5C92 A;  1T2X A;  5EMM B;  2P9K C;  2I3S A;  3EQ7 A;  4J0W A;  3F3G A;  4A7J A;  3PSC B;  4LG9 A;  1Q47 A;  5GMK n;  2VDO A;  1OMW B;  2IWK A;  2VZ3 A;  3AL9 A;  2PM6 B;  4JHN A;  2VDL A;  4U7A A;  3RFG A;  1VZ2 A;  2YNP A;  5FKQ A;  1K8K C;  2UZY B;  2XE4 A; 
#chains in the Genus database with same CATH homology
 4PBY A;  3DM0 A;  3SCY A;  3W15 A;  1MG2 A;  4X60 B;  2IWF A;  2H9M A;  5HE1 B;  3EMH A;  3SVW D;  3JAM g;  3V9F A;  4QT8 A;  5IJ8 E;  3NVN A;  2P9U C;  4KFM B;  4J79 A;  1XIP A;  2XU7 A;  4JXM A;  2PM9 A;  4JSX C;  2GC7 A;  2H6N A;  2OK6 A;  4H5J A;  3FGB A;  5TF2 A;  3UVN A;  4FA9 D;  4N14 A;  5K1C C;  2YMU A;  2B5M A;  4J81 A;  4OWR A;  2P9N C;  2XYI A;  3JRO A;  3JRP A;  4G56 B;  2Q7Q A;  1FWX A;  3RMZ D;  3J80 g;  2BBK H;  3I7L A;  1K32 A;  3EU7 A;  5H17 A;  4X61 B;  3UVK A;  3UVM A;  1GP2 B;  3NVX A;  2HYE A;  4GGD A;  2P9L C;  5CYK A;  1VYH C;  2I0R A;  3RSE C;  3PXW D;  3PVU B;  3EI2 B;  1OLZ A;  3GFC A;  3PVW B;  2H3X A;  1R5M A;  4J77 A;  2AGZ A;  4ZN4 A;  1B9X A;  2H68 A;  4NSX A;  3OKY B;  3V5W B;  2H9P A;  3AL8 A;  5TEF A;  3RN1 D;  4BUJ C;  3C9C A;  5IGQ A;  2HJB A;  5FLX g;  4CI8 A;  3EWE A;  5I5M A;  1B9Y A;  2AGL A;  3SBP A;  4CI3 A;  3C99 A;  4A08 A;  2P9I C;  4ERQ A;  4BL0 A;  4JT6 C;  4D0K A;  5EM2 B;  4J78 A;  4PBZ A;  2O9K A;  1S4U X;  4A0B A;  4LG8 A;  4GQ2 P;  3EI4 B;  3I7N A;  2B4E A;  2H9L A;  4J73 A;  4IMM A;  2HXC A;  4J8G A;  4R7A B;  5C9Z B;  5CXC A;  3BG0 A;  4ERZ A;  3L4M D;  4O3U B;  2Z2O A;  3MKS B;  2HES X;  4EWR A;  4CC9 A;  2GC4 A;  5EAM A;  2G99 A;  3EG6 A;  3SFZ A;  4FAN D;  4A11 B;  2CE9 A;  5EAP A;  4UI9 R;  4AOW A;  3K26 A;  5K19 A;  3OKT A;  5AFU 3;  4QL1 A;  3IIY A;  3DXK C;  4YVD A;  2HJ4 A;  2CN2 A;  3FRX A;  2OVR B;  2H47 A;  5GXI A;  3V7D B;  4FA4 D;  5C2V B;  2I0T A;  5I5J A;  4X3E A;  3B7F A;  3CFV A;  4U1E I;  4PSX B;  5FA5 B;  4Y7R A;  3KRX B;  2J57 G;  2Z2N A;  5AJA A;  2P9P C;  4K3J B;  3RFH A;  4XEI C;  2Z2P A;  3N0D A;  4ESG A;  4A2M A;  3MZL A;  4CZY A;  4XYI A;  3U4Y A;  3MKQ A;  3DSM A;  3OL2 A;  4CY1 A;  4FA1 D;  2W18 A;  5A2Q g;  4CZV A;  1P22 A;  4GGC A;  2OIZ A;  2G9A A;  4CY3 A;  3BG1 A;  2OJY A;  4J0X A;  2H13 A;  4FA5 D;  4E5Z B;  2AQ5 A;  4QQE A;  5I5I A;  2IUR A;  4FB1 D;  5KDO B;  2CNX A;  2CO0 A;  2I0S A;  2AGY A;  3EI1 B;  3EI3 B;  4J8B A;  3OTT A;  2QXV A;  3VA6 A;  2H6Q A;  5HE3 B;  5H1M A;  3CFS B;  5FQD A;  1N6E A;  5B4W A;  1NEX B;  5EM2 A;  4A0A A;  3MZK A;  3VH0 A;  3UVO A;  3IIW A;  1QNI A;  4ZOY A;  3MMY A;  3SWS D;  4JSP C;  4CY2 A;  1TYQ C;  3UVL A;  4O3T B;  2UZX B;  3IJ1 A;  4IA9 A;  4J84 A;  3SHF A;  4QRJ A;  3RN0 D;  2J55 H;  1MDA H;  2OK4 A;  5C2W B;  4A09 A;  1RI6 A;  2B5N A;  2IUQ A;  5HYN B;  3OKW A;  5TEE A;  2BCJ B;  4GM9 A;  4O9D A;  5EAR A;  1TBG A;  3ULE C;  4O1Q D;  4O45 A;  3PSL A;  3I7O A;  2HKR A;  3N0E A;  1JMZ B;  2OVP B;  2J56 H;  2PM7 B;  4X63 B;  3I8E A;  3PXT D;  3MXX A;  2IAA A;  2YBA A;  2XL3 A;  1GOT B;  3DXM C;  1A0R B;  3I2N A;  4GQB B;  5CYK B;  4XYH A;  3RLM D;  2YB8 B;  3GRE A;  3BWS A;  4GQ1 A;  5FKT A;  1MG3 A;  2HKM A;  5IJ7 E;  1JOF A;  4GMB A;  1GXR A;  3L4O D;  4K3I D;  4E54 B;  3PE7 A;  5SXM A;  1U4C A;  1PEV A;  2B5L A;  3FM0 A;  1NR0 A;  3ORV D;  5CXB B;  3SN6 B;  3AFC A;  3IKO A;  3I7H A;  4ERY A;  4JSV C;  4OZU A;  3JB9 L;  4A0B B;  4JD2 C;  3RRM C;  1L0Q A;  3OW8 A;  4D6V A;  2CN3 A;  4J87 A;  2AGX A;  2I3T A;  4CI2 A;  1ERJ A;  4CZX A;  1JMX B;  1PI6 A;  5HQG A;  5CXC B;  3EI2 A;  3SJL D;  2YNO A;  5GSA A;  4JSN C;  3OKY A;  5AMS A;  4Z8L A;  2TRC B;  3ZWL B;  3P4F A;  2OVQ B;  1N6F A;  4PXW A;  3SBR A;  4H5I A;  2IUP A;  4J86 A;  3KRW B;  5GXH A;  4PC0 A;  3DWL C;  3IJ0 A;  4L3G D;  3JZH A;  4LGN A;  5EMK B;  5FXY A;  2IUV A;  3I7K A;  2EBS A;  3SBQ A;  1YFQ A;  3EI4 A;  2YNN A;  3CIK B;  4ZOV A;  4L1Q D;  4AEZ A;  5JWZ A;  4HDJ A;  3UKU C;  3J81 g;  3A0F A;  3PXS D;  3C75 H;  3SMR A;  3F3F A;  3I8C A;  5HE2 B;  3UKR C;  4FAV D;  3SXT D;  1SQ9 A;  4BH6 A;  4FWW A;  3OL2 B;  4GGA A;  5HE0 B;  3JZN A;  3VGZ A;  1PBY B;  3E0C A;  2AH0 A;  2PM9 B;  5EML B;  4A11 A;  1SQJ A;  2H9N A;  1PGU A;  3SLE D;  2MTA H;  1JJU B;  4ZOZ A;  4I79 A;  5THA A;  4TZ4 A;  2XL2 A;  4ES0 A;  3K27 A;  2CO0 C;  2AGW A;  3UR4 A;  4E54 A;  2AH1 A;  1N6D A;  4GM8 A;  4L3H D;  5H14 A;  4L9O A;  4MK0 B;  5IT9 g;  5CXB A;  4CI1 A;  3IJC A;  4CY5 A;  5FKS A;  1GG2 B;  3AH8 B;  3I89 A;  4A0A B;  2PBI B;  4A2L A;  4FHL A;  3JZG A;  3ODT A;  1SHY B;  5IC7 A;  1U2V C;  1XKS A;  3C5M A;  3F3P A;  3AL8 B;  4J82 A;  3JPX A;  4GZ8 A;  3I7P A;  4PSW B;  3HFQ A;  2CE8 A;  3NVQ A;  4E5Z A;  1XHM A;  5FKR A;  4Y5R D;  5EMJ B;  4PNK B;  2P9S C;  4A08 B;  5IGO A;  4GM3 A;  5TDH B;  3EI1 A;  3EI3 A;  4A09 B;  2H6K A;  2QC5 A;  4JT5 C;  5EAL A;  4ZOX A;  2GNQ A;  2H14 A;  5EMM B;  2P9K C;  2I3S A;  4J0W A;  3F3G A;  4A7J A;  3PSC B;  4LG9 A;  1Q47 A;  5GMK n;  1OMW B;  2IWK A;  3AL9 A;  2PM6 B;  3RFG A;  4U7A A;  2YNP A;  5FKQ A;  1K8K C;  2UZY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...