1A12A

Regulator of chromosome condensation (rcc1) of human
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
401
structure length
401
Chain Sequence
KKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 1.7 A crystal structure of the regulator of chromosome condensation (RCC1) reveals a seven-bladed propeller.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Guanine nucleotide exchange factor
molecule keywords REGULATOR OF CHROMOSOME CONDENSATION 1
total genus 106
structure length 401
sequence length 401
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1997-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.30 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein II 1a12A00
3KCIA 4D9SA 1JTDB 4NBMA 3MVDK 3QHYB 1I2MB 4JHPC 4DNUA 1A12A 4NAAA 4DNWA 4DNVA 4JHNA 4QAMA 3QI0A 4NC4A 4L1MA 4O2WA 3OF7A
chains in the Genus database with same CATH superfamily
2I3TA 3DWLC 1A0RB 3VGZA 1B9XA 1QNIA 4YVDA 5SXMA 1OLZA 4QL1A 2IURA 3PSLA 4AN1A 1C9LA 2HJ4A 3VI3A 3IVMA 2OJYA 4LGNA 4J78A 1VYHC 3EI4A 3V4VA 2J57G 3F3GA 3EI4B 2Z2NA 3CFVA 2HU5A 4BCBA 4Z7OA 4G55A 4LG8A 3KRXB 5H14A 1PGUA 1O6GA 3MUOA 4O9DA 4JXMA 3OL2B 2PBIB 3E0CA 4GM8A 5FFOA 2YNPA 4A0BB 4J0XA 3EI2A 4FA4D 4FAND 2G99A 5HDBA 4K3ID 3T3PA 3UVMA 5C2WB 4A11A 4CI2A 4BP8A 5GXHA 3GREA 3NVXA 3PE7A 1MG2A 4UI9R 4WK4A 4UM8A 2O9KA 3C9CA 3DM0A 1M1XA 2H6NA 3V7DB 3O4IA 3I7OA 3QHYB 4BCCA 5EALA 4JD2C 2HJBA 4J87A 1GP2B 3I7HA 3IKOA 2H14A 5M5TA 3NIDA 3ZE0A 2AGXA 4U7AA 4WK0A 3CIKB 2HXCA 2VDKA 3C75H 3SWSD 4QAMA 3PVUB 2OK4A 3ZE2A 4RE5A 3F3FA 2OIZA 3VI4A 2XE4A 5FKSA 4A0AB 2I3SA 4A0AA 4FA5D 3OKYA 4GQ1A 3NVNA 5E6UA 2EBSA 3K27A 3I89A 4DNVA 4CZXA 4OZUA 2QC5A 1E5TA 1PI6A 2BCJB 1JJUB 2VZ3A 1UTCA 1GOGA 2OVRB 2CN2A 3EI3A 3AH8B 1UOPA 4J81A 3UVOA 5E6RA 2W18A 4BUJC 2VDLA 3RRMC 1JMXB 4L3GD 3N0EA 3FCSA 2Z2OA 5GSAA 3MZKA 2H13A 1XHMA 4XYHA 3SBQA 3ZDZA 2IUQA 1FWXA 1U2VC 1H2YA 4PXWA 2B5MA 4CI8A 4G1EA 5EARA 5HE1B 1C9IA 4PSWB 4QT8A 3EQ7A 5HE3B 4JHPC 4JSXC 3FM0A 1UOOA 1PBYB 4N14A 2VDOA 3IJEA 4PC0A 3BG0A 3IJ0A 1K32A 4FHLA 4O1QD 3P4FA 4QRJA 5CXCA 5EMJB 5C2VB 4A2MA 5I5JA 4J86A 1VE6A 4WK2A 2P9KC 3ULEC 4HDJA 5C92A 3U4YA 3UVLA 4MMYA 4CY3A 1YR2A 3I8CA 1E8NA 1SQ9A 5JWZA 4X63B 2UZYB 3DDUA 2IAAA 1MG3A 2EIEA 2YMUA 5EMMB 2XYIA 4L9OA 4J8GA 4X61B 5EMLB 4JSPC 3OF7A 4FWWA 4CY5A 2YNNA 3JRPA 1OMWB 2GC7A 3GFCA 3JZHA 4AEZA 4GGDA 1N6FA 3O4JA 4BCDA 2PM6B 2HESX 3BG1A 1SQJA 3FCUA 2EIDA 2OK6A 3IULA 3K71A 3K6SA 1XKSA 5GMKn 2J55H 4IA9A 2HKRA 4A7JA 1GXRA 2CE9A 4CY1A 4G1MA 5K1CC 4NC4A 3MKSB 2Q7QA 5TDHB 5HYNB 3SFZA 2P9IC 3K72A 1VZ3A 4R7AB 2YB8B 5THAA 3ZWLB 5H17A 4JSNC 2WQ8A 4O3TB 1R5MA 5AFU3 4PBYA 3MZLA 2HKMA 1A12A 5FXYA 2QR5A 3RN1D 4J73A 1GG2B 1U8CA 3EI1A 4D9SA 2AGYA 1H2XA 2B5NA 5CYKA 4CI3A 2OVQB 2IWFA 4NSXA 4DNUA 4J77A 4Z7NA 1JMZB 4CC9A 3IIWA 3SMRA 2XZGA 2HYEA 3OW8A 4GM9A 2H3XA 2PM9A 3J81g 2QZPA 2VDNA 4GMBA 4U1EI 4J8BA 3SVWD 1N6DA 3PVWB 3UVKA 4A08A 4GGAA 2VDQA 3FGBA 4A08B 2P9NC 4K3JB 3IUQA 3IUNA 3QI0A 4Y5RD 5IT9g 1P22A 5M61A 1BPOA 1XIPA 3SN6B 3JAMg 4ZOXA 1RI6A 1JV2A 1GOHA 2EICA 5HE2B 3PXSD 4NAAA 4ERQA 5C86A 5IJ7E 2J56H 2H9MA 2CNXA 4L3HD 4QQEA 5H1MA 3RMZD 3F3PA 5M5VA 5GXIA 5AJAA 4E54B 4L1MA 5IC7A 3CFSB 3ZDYA 4TZ4A 3VA6A 5C9ZB 3O4HA 4E54A 4A2LA 4O3UB 1L0QA 2JKXA 2H47A 3B7FA 5CXBA 2VC2A 2UZXB 2CO0A 3IUMA 4H5JA 1I2MB 5CXCB 2P9SC 3AL9A 3SLED 1VZ2A 2YNOA 4JHNA 1B9YA 3SJLD 4X60B 3AL8A 3SCYA 1NR0A 2H9PA 3A0FA 3ZE1A 4GM3A 3FRXA 5IJ8E 3NVQA 4J84A 4WJKA 1QFMA 2P9PC 1JTDB 2AH0A 2G9AA 2VDRA 2QXVA 3IUJA 2H6KA 1K3IA 4A09B 1H2ZA 2AGWA 1Q47A 4J82A 3SBPA 5TEFA 2CE8A 2HU7A 2EIBA 3J80g 3ORVD 4NENA 4O45A 5E6SA 3IIYA 4FB1D 5FA5B 5TEEA 2OVPB 2B4EA 3NIGA 1PEVA 3UKRC 2AQ5A 5IGQA 3UVNA 4G56B 4PSXB 1GOTB 1QFSA 4E5ZB 3T3MA 4ZOVA 4L1QD 5EM2B 2CO0C 3KRWB 5HE0B 5EM2A 4O2WA 2XU7A 3W15A 4CZVA 1O6FA 2AH1A 3RSEC 4OWRA 3O4GA 4CZYA 2B5LA 4UM9A 5EAMA 3L4OD 2H9NA 2YBAA 1S4UX 1VE7A 4ESGA 5FKTA 3JZGA 4Z7QA 3VH0A 3MKQA 5FKRA 2PM9B 1TYQC 3EU7A 4ZOYA 3MUNA 3EQ8A 3JZNA 4PBZA 5A2Qg 3RN0D 5TF2A 3GC3B 5M5RA 3RLMD 3C99A 1K8KC 4NBMA 3EI1B 4J0WA 3UKUC 2TRCB 5CYKB 4AX4A 4EWRA 5FFGA 3OKTA 1MDAH 3OKWA 4A0BA 3MXXA 2XDWA 3RFHA 3K26A 5HQGA 4FA9D 3I7NA 1U4CA 3GD1I 3SBRA 2IUVA 4H5IA 3BWSA 3HFQA 4CI1A 5K19A 4MMZA 4KFMB 3KCIA 1H2WA 2IUPA 4Y7RA 3I7PA 2BKLA 1L5GA 4GGCA 3UR4A 3I7LA 2H68A 3I8EA 4XEIC 3IURA 4DNWA 2AGZA 2PM7B 3OL2A 4AN0A 3DXKC 4GQ2P 3JPXA 2GNQA 5CXBB 1GOFA 3EI2B 1ERJA 4Z8LA 3C5MA 2VZ1A 1NEXB 4ZN4A 4A11B 2AGLA 4ES0A 2BBKH 3V4PA 2P9LC 4XYIA 4LG9A 1TYEA 3ZDXA 3DXMC 4ZOZA 4ERZA 3NIFA 4O02A 2H9LA 5M5UA 4AOWA 2I0SA 3EWEA 3EQ9A 4X3EA 3PSCB 4CY2A 4PNKB 1E8MA 1N6EA 4AMZA 2VDPA 3IJCA 5EAPA 4JT6C 3EMHA 1SHYB 1JOFA 4RE6A 5KDOB 2Z2PA 4J79A 3PXWD 2MTAH 3DSMA 3ODTA 2H6QA 3JB9L 3AL8B 3OTTA 4BH6A 3SXTD 1YFQA 5FLXg 4I79A 4E5ZA 3OKYB 1UOQA 4IMMA 4MK0B 3N0DA 4A09A 5AMSA 3IJ1A 2VDMA 4JSVC 2XL2A 4JT5C 2XL3A 4AMYA 2P9UC 3PXTD 5FQDA 4GZ8A 4D6VA 5M5SA 3I2NA 3MVDK 4ERYA 3I7KA 3EI3B 3L4MD 5IGOA 4BL0A 4FAVD 2GC4A 5I5IA 2HU8A 1TBGA 5FKQA 4BP9A 3JROA 2I0RA 5I5MA 4GQBB 3EG6A 5EMKB 4D0KA 5B4WA 4FA1D 3RFGA 2CN3A 4IRZA 3V9FA 3MMYA 2I0TA 4MMXA 3SHFA 2IWKA 1T2XA 3V5WB 3AFCA
chains in the Genus database with same CATH topology
3KCIA 4D9SA 1JTDB 4NBMA 3MVDK 3QHYB 1I2MB 4JHPC 4DNUA 1A12A 4NAAA 4DNWA 4DNVA 4JHNA 4QAMA 3QI0A 4NC4A 4L1MA 4O2WA 3OF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KCI A;  4D9S A;  1JTD B;  4NBM A;  3MVD K;  3QHY B;  1I2M B;  4JHP C;  4DNU A;  1A12 A;  4NAA A;  4DNW A;  4DNV A;  4JHN A;  4QAM A;  3QI0 A;  4NC4 A;  4L1M A;  4O2W A;  3OF7 A; 
#chains in the Genus database with same CATH topology
 2I3T A;  3DWL C;  1A0R B;  3VGZ A;  1B9X A;  1QNI A;  4YVD A;  5SXM A;  1OLZ A;  4QL1 A;  2IUR A;  3PSL A;  4AN1 A;  1C9L A;  2HJ4 A;  3VI3 A;  3IVM A;  2OJY A;  4LGN A;  4J78 A;  1VYH C;  3EI4 A;  3V4V A;  2J57 G;  3F3G A;  3EI4 B;  2Z2N A;  3CFV A;  2HU5 A;  4BCB A;  4Z7O A;  4G55 A;  4LG8 A;  3KRX B;  5H14 A;  1PGU A;  1O6G A;  3MUO A;  4O9D A;  4JXM A;  3OL2 B;  2PBI B;  3E0C A;  4GM8 A;  5FFO A;  2YNP A;  4A0B B;  4J0X A;  3EI2 A;  4FA4 D;  4FAN D;  2G99 A;  5HDB A;  4K3I D;  3T3P A;  3UVM A;  5C2W B;  4A11 A;  4CI2 A;  4BP8 A;  5GXH A;  3GRE A;  3NVX A;  3PE7 A;  1MG2 A;  4UI9 R;  4WK4 A;  4UM8 A;  2O9K A;  3C9C A;  3DM0 A;  1M1X A;  2H6N A;  3V7D B;  3O4I A;  3I7O A;  3QHY B;  4BCC A;  5EAL A;  4JD2 C;  2HJB A;  4J87 A;  1GP2 B;  3I7H A;  3IKO A;  2H14 A;  5M5T A;  3NID A;  3ZE0 A;  2AGX A;  4U7A A;  4WK0 A;  3CIK B;  2HXC A;  2VDK A;  3C75 H;  3SWS D;  4QAM A;  3PVU B;  2OK4 A;  3ZE2 A;  4RE5 A;  3F3F A;  2OIZ A;  3VI4 A;  2XE4 A;  5FKS A;  4A0A B;  2I3S A;  4A0A A;  4FA5 D;  3OKY A;  4GQ1 A;  3NVN A;  5E6U A;  2EBS A;  3K27 A;  3I89 A;  4DNV A;  4CZX A;  4OZU A;  2QC5 A;  1E5T A;  1PI6 A;  2BCJ B;  1JJU B;  2VZ3 A;  1UTC A;  1GOG A;  2OVR B;  2CN2 A;  3EI3 A;  3AH8 B;  1UOP A;  4J81 A;  3UVO A;  5E6R A;  2W18 A;  4BUJ C;  2VDL A;  3RRM C;  1JMX B;  4L3G D;  3N0E A;  3FCS A;  2Z2O A;  5GSA A;  3MZK A;  2H13 A;  1XHM A;  4XYH A;  3SBQ A;  3ZDZ A;  2IUQ A;  1FWX A;  1U2V C;  1H2Y A;  4PXW A;  2B5M A;  4CI8 A;  4G1E A;  5EAR A;  5HE1 B;  1C9I A;  4PSW B;  4QT8 A;  3EQ7 A;  5HE3 B;  4JHP C;  4JSX C;  3FM0 A;  1UOO A;  1PBY B;  4N14 A;  2VDO A;  3IJE A;  4PC0 A;  3BG0 A;  3IJ0 A;  1K32 A;  4FHL A;  4O1Q D;  3P4F A;  4QRJ A;  5CXC A;  5EMJ B;  5C2V B;  4A2M A;  5I5J A;  4J86 A;  1VE6 A;  4WK2 A;  2P9K C;  3ULE C;  4HDJ A;  5C92 A;  3U4Y A;  3UVL A;  4MMY A;  4CY3 A;  1YR2 A;  3I8C A;  1E8N A;  1SQ9 A;  5JWZ A;  4X63 B;  2UZY B;  3DDU A;  2IAA A;  1MG3 A;  2EIE A;  2YMU A;  5EMM B;  2XYI A;  4L9O A;  4J8G A;  4X61 B;  5EML B;  4JSP C;  3OF7 A;  4FWW A;  4CY5 A;  2YNN A;  3JRP A;  1OMW B;  2GC7 A;  3GFC A;  3JZH A;  4AEZ A;  4GGD A;  1N6F A;  3O4J A;  4BCD A;  2PM6 B;  2HES X;  3BG1 A;  1SQJ A;  3FCU A;  2EID A;  2OK6 A;  3IUL A;  3K71 A;  3K6S A;  1XKS A;  5GMK n;  2J55 H;  4IA9 A;  2HKR A;  4A7J A;  1GXR A;  2CE9 A;  4CY1 A;  4G1M A;  5K1C C;  4NC4 A;  3MKS B;  2Q7Q A;  5TDH B;  5HYN B;  3SFZ A;  2P9I C;  3K72 A;  1VZ3 A;  4R7A B;  2YB8 B;  5THA A;  3ZWL B;  5H17 A;  4JSN C;  2WQ8 A;  4O3T B;  1R5M A;  5AFU 3;  4PBY A;  3MZL A;  2HKM A;  1A12 A;  5FXY A;  2QR5 A;  3RN1 D;  4J73 A;  1GG2 B;  1U8C A;  3EI1 A;  4D9S A;  2AGY A;  1H2X A;  2B5N A;  5CYK A;  4CI3 A;  2OVQ B;  2IWF A;  4NSX A;  4DNU A;  4J77 A;  4Z7N A;  1JMZ B;  4CC9 A;  3IIW A;  3SMR A;  2XZG A;  2HYE A;  3OW8 A;  4GM9 A;  2H3X A;  2PM9 A;  3J81 g;  2QZP A;  2VDN A;  4GMB A;  4U1E I;  4J8B A;  3SVW D;  1N6D A;  3PVW B;  3UVK A;  4A08 A;  4GGA A;  2VDQ A;  3FGB A;  4A08 B;  2P9N C;  4K3J B;  3IUQ A;  3IUN A;  3QI0 A;  4Y5R D;  5IT9 g;  1P22 A;  5M61 A;  1BPO A;  1XIP A;  3SN6 B;  3JAM g;  4ZOX A;  1RI6 A;  1JV2 A;  1GOH A;  2EIC A;  5HE2 B;  3PXS D;  4NAA A;  4ERQ A;  5C86 A;  5IJ7 E;  2J56 H;  2H9M A;  2CNX A;  4L3H D;  4QQE A;  5H1M A;  3RMZ D;  3F3P A;  5M5V A;  5GXI A;  5AJA A;  4E54 B;  4L1M A;  5IC7 A;  3CFS B;  3ZDY A;  4TZ4 A;  3VA6 A;  5C9Z B;  3O4H A;  4E54 A;  4A2L A;  4O3U B;  1L0Q A;  2JKX A;  2H47 A;  3B7F A;  5CXB A;  2VC2 A;  2UZX B;  2CO0 A;  3IUM A;  4H5J A;  1I2M B;  5CXC B;  2P9S C;  3AL9 A;  3SLE D;  1VZ2 A;  2YNO A;  4JHN A;  1B9Y A;  3SJL D;  4X60 B;  3AL8 A;  3SCY A;  1NR0 A;  2H9P A;  3A0F A;  3ZE1 A;  4GM3 A;  3FRX A;  5IJ8 E;  3NVQ A;  4J84 A;  4WJK A;  1QFM A;  2P9P C;  1JTD B;  2AH0 A;  2G9A A;  2VDR A;  2QXV A;  3IUJ A;  2H6K A;  1K3I A;  4A09 B;  1H2Z A;  2AGW A;  1Q47 A;  4J82 A;  3SBP A;  5TEF A;  2CE8 A;  2HU7 A;  2EIB A;  3J80 g;  3ORV D;  4NEN A;  4O45 A;  5E6S A;  3IIY A;  4FB1 D;  5FA5 B;  5TEE A;  2OVP B;  2B4E A;  3NIG A;  1PEV A;  3UKR C;  2AQ5 A;  5IGQ A;  3UVN A;  4G56 B;  4PSX B;  1GOT B;  1QFS A;  4E5Z B;  3T3M A;  4ZOV A;  4L1Q D;  5EM2 B;  2CO0 C;  3KRW B;  5HE0 B;  5EM2 A;  4O2W A;  2XU7 A;  3W15 A;  4CZV A;  1O6F A;  2AH1 A;  3RSE C;  4OWR A;  3O4G A;  4CZY A;  2B5L A;  4UM9 A;  5EAM A;  3L4O D;  2H9N A;  2YBA A;  1S4U X;  1VE7 A;  4ESG A;  5FKT A;  3JZG A;  4Z7Q A;  3VH0 A;  3MKQ A;  5FKR A;  2PM9 B;  1TYQ C;  3EU7 A;  4ZOY A;  3MUN A;  3EQ8 A;  3JZN A;  4PBZ A;  5A2Q g;  3RN0 D;  5TF2 A;  3GC3 B;  5M5R A;  3RLM D;  3C99 A;  1K8K C;  4NBM A;  3EI1 B;  4J0W A;  3UKU C;  2TRC B;  5CYK B;  4AX4 A;  4EWR A;  5FFG A;  3OKT A;  1MDA H;  3OKW A;  4A0B A;  3MXX A;  2XDW A;  3RFH A;  3K26 A;  5HQG A;  4FA9 D;  3I7N A;  1U4C A;  3GD1 I;  3SBR A;  2IUV A;  4H5I A;  3BWS A;  3HFQ A;  4CI1 A;  5K19 A;  4MMZ A;  4KFM B;  3KCI A;  1H2W A;  2IUP A;  4Y7R A;  3I7P A;  2BKL A;  1L5G A;  4GGC A;  3UR4 A;  3I7L A;  2H68 A;  3I8E A;  4XEI C;  3IUR A;  4DNW A;  2AGZ A;  2PM7 B;  3OL2 A;  4AN0 A;  3DXK C;  4GQ2 P;  3JPX A;  2GNQ A;  5CXB B;  1GOF A;  3EI2 B;  1ERJ A;  4Z8L A;  3C5M A;  2VZ1 A;  1NEX B;  4ZN4 A;  4A11 B;  2AGL A;  4ES0 A;  2BBK H;  3V4P A;  2P9L C;  4XYI A;  4LG9 A;  1TYE A;  3ZDX A;  3DXM C;  4ZOZ A;  4ERZ A;  3NIF A;  4O02 A;  2H9L A;  5M5U A;  4AOW A;  2I0S A;  3EWE A;  3EQ9 A;  4X3E A;  3PSC B;  4CY2 A;  4PNK B;  1E8M A;  1N6E A;  4AMZ A;  2VDP A;  3IJC A;  5EAP A;  4JT6 C;  3EMH A;  1SHY B;  1JOF A;  4RE6 A;  5KDO B;  2Z2P A;  4J79 A;  3PXW D;  2MTA H;  3DSM A;  3ODT A;  2H6Q A;  3JB9 L;  3AL8 B;  3OTT A;  4BH6 A;  3SXT D;  1YFQ A;  5FLX g;  4I79 A;  4E5Z A;  3OKY B;  1UOQ A;  4IMM A;  4MK0 B;  3N0D A;  4A09 A;  5AMS A;  3IJ1 A;  2VDM A;  4JSV C;  2XL2 A;  4JT5 C;  2XL3 A;  4AMY A;  2P9U C;  3PXT D;  5FQD A;  4GZ8 A;  4D6V A;  5M5S A;  3I2N A;  3MVD K;  4ERY A;  3I7K A;  3EI3 B;  3L4M D;  5IGO A;  4BL0 A;  4FAV D;  2GC4 A;  5I5I A;  2HU8 A;  1TBG A;  5FKQ A;  4BP9 A;  3JRO A;  2I0R A;  5I5M A;  4GQB B;  3EG6 A;  5EMK B;  4D0K A;  5B4W A;  4FA1 D;  3RFG A;  2CN3 A;  4IRZ A;  3V9F A;  3MMY A;  2I0T A;  4MMX A;  3SHF A;  2IWK A;  1T2X A;  3V5W B;  3AFC A; 
#chains in the Genus database with same CATH homology
 3KCI A;  4D9S A;  1JTD B;  4NBM A;  3MVD K;  3QHY B;  1I2M B;  4JHP C;  4DNU A;  1A12 A;  4NAA A;  4DNW A;  4DNV A;  4JHN A;  4QAM A;  3QI0 A;  4NC4 A;  4L1M A;  4O2W A;  3OF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...