1A12A

Regulator of chromosome condensation (rcc1) of human
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
401
structure length
401
Chain Sequence
b'KKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REGULATOR OF CHROMOSOME CONDENSATION 1
publication title The 1.7 A crystal structure of the regulator of chromosome condensation (RCC1) reveals a seven-bladed propeller.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Guanine nucleotide exchange factor
total genus 106
structure length 401
sequence length 401
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1997-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.30 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein II 1a12A00
1I2MB 4JHNA 4DNUA 4DNWA 1A12A 3OF7A 3QHYB 4D9SA 4NC4A 3MVDK 4NBMA 4JHPC 4L1MA 4O2WA 4DNVA 3KCIA 4NAAA 4QAMA 3QI0A 1JTDB
chains in the Genus database with same CATH superfamily
4JSVC 1JV2A 1H2XA 5M5UA 1GOGA 4FA4D 4BH6A 1T2XA 5FFOA 5HDBA 3JPXA 4L3HD 4CZVA 4GQBB 4D9SA 4E5ZA 1VZ2A 2CNXA 3FM0A 3I7PA 4MMZA 3V4VA 1E5TA 3I8CA 5C9ZB 1NEXB 2CE9A 1PGUA 5C2WB 1N6DA 3C99A 5HE1B 3MUOA 4J8GA 3E0CA 1XIPA 2TRCB 3CIKB 3IIWA 3IUQA 4CI3A 3U4YA 4CZYA 3SMRA 3PXTD 4TZ4A 3FRXA 4A0AB 2EIEA 2P9LC 3PXWD 5EMJB 2I3SA 1QNIA 5TF2A 2GC4A 5TEEA 1GXRA 2CE8A 4WK0A 4AMZA 2GC7A 3VI3A 1B9YA 2G99A 3O4GA 5AJAA 2HU8A 1BPOA 2VDPA 4Y7RA 4O2WA 4WK4A 4NENA 2H3XA 3IKOA 2OJYA 2VZ3A 2P9PC 2UZYB 2AGYA 2OIZA 1B9XA 5IJ8E 3K6SA 2HU7A 4OWRA 1L0QA 5HYNB 5EMLB 1UTCA 1UOPA 4U1EI 2BBKH 2QR5A 4A11B 4WJKA 3T3MA 2VC2A 3NIGA 3MVDK 3VH0A 3EI2A 3NVXA 4BUJC 2BKLA 4BCDA 5B4WA 4GGDA 3IVMA 4FAND 5EMKB 4FB1D 3JRPA 1C9LA 5HQGA 4AMYA 1C9IA 3C5MA 2CO0A 4IMMA 4JXMA 3IULA 4J87A 3RFGA 5HE2B 2XL2A 5I5JA 3O4JA 3QHYB 5FFGA 3KRWB 3EU7A 2VDMA 3C75H 3PE7A 4IRZA 4O3TB 4CZXA 4O1QD 3SBQA 4KFMB 3ODTA 1TYQC 4QL1A 4CC9A 2HJBA 5M5SA 2CO0C 4PXWA 1QFMA 3ZWLB 3I7NA 2IWKA 3I7KA 2H9NA 3CFVA 3AH8B 3EQ8A 1U4CA 1I2MB 3W15A 2HU5A 2EICA 2VDOA 3O4HA 4O02A 2B5LA 4GGAA 4J8BA 3OW8A 2I0TA 4A2LA 4ES0A 5FKTA 3BG0A 3GC3B 2PBIB 3SHFA 5IT9g 5CXCA 4MMYA 4H5JA 2W18A 2HJ4A 4AEZA 3T3PA 1E8MA 1U8CA 4NAAA 3GFCA 5HE0B 3ULEC 4A08A 2Z2OA 2GNQA 4QRJA 3RN0D 2OVPB 4GM8A 5M5VA 5GMKn 4J0XA 1O6GA 3ZDYA 5M5TA 3EI1B 2Z2PA 2OK6A 3IURA 2P9SC 3PVUB 4ZOXA 3I89A 4PBYA 4BCBA 2P9IC 1TBGA 3DSMA 2QC5A 4K3ID 4N14A 4DNVA 2I0SA 3V9FA 4UM8A 1GOHA 4CY2A 4IA9A 3GD1I 5H17A 3RFHA 2H6KA 2H68A 2YB8B 3SN6B 3V4PA 4ZOVA 4GQ1A 3DWLC 3NVQA 4AN0A 2J57G 1A12A 2OVQB 1JJUB 4D6VA 2YBAA 3VI4A 3ZDXA 4ZOZA 3SFZA 2CN3A 5M5RA 4L1MA 3VGZA 1R5MA 4FWWA 2HESX 3KCIA 4XYIA 5E6RA 4NSXA 3EI4A 1MG2A 3UVOA 2VDLA 4J81A 1A0RB 2B4EA 2MTAH 4A2MA 3SBPA 4J78A 4BL0A 2BCJB 2QXVA 5CXCB 1OMWB 4G55A 4G1EA 4JT5C 2OK4A 4ERZA 1XKSA 2AGWA 2IUQA 4DNUA 2XL3A 4FA9D 2H9LA 4A08B 5H14A 3K72A 4GGCA 4J79A 5TEFA 1GOTB 5FLXg 5GXHA 3MMYA 3I7HA 5K1CC 3IJ0A 4A0BB 3OKYB 2CN2A 5AFU3 4O45A 5C86A 3EQ7A 2AGLA 2P9NC 3DXMC 4A09A 3PXSD 3ZE2A 2XU7A 3EI1A 5FKRA 4L3GD 3JROA 4J73A 4CY3A 4ERQA 3OTTA 1PBYB 5EM2A 4Z7OA 4ZOYA 4PSXB 4GQ2P 4BP8A 4CI1A 3J80g 1M1XA 1YFQA 5JWZA 1OLZA 1VE6A 3FGBA 4NBMA 4XEIC 1N6EA 3F3FA 1FWXA 5IJ7E 4FA1D 4JSNC 3JZGA 4YVDA 3UKUC 4FAVD 4GM9A 4LG9A 3RMZD 3EWEA 1K3IA 5CYKA 2AH0A 1MG3A 3PSLA 3JZHA 5KDOB 2PM9A 2H9PA 3DM0A 3KRXB 3DXKC 4AX4A 1JOFA 4JSPC 3UR4A 3EI4B 1XHMA 2YNOA 3JZNA 5FXYA 1H2WA 2EBSA 2HKMA 4WK2A 2OVRB 5M61A 5I5IA 3AFCA 4JHPC 1U2VC 5A2Qg 3UVMA 3IJ1A 4J86A 1JMZB 4LG8A 4GZ8A 3K26A 2I3TA 3OL2A 4CY5A 3QI0A 2HKRA 2XDWA 4OZUA 4JD2C 3OKYA 5GSAA 5FQDA 4A0BA 3J81g 4A09B 4Z7QA 5E6UA 3RN1D 4DNWA 3MKSB 4LGNA 3IJCA 2VDNA 3O4IA 3ZDZA 4JT6C 4MK0B 3MKQA 4AN1A 3EQ9A 4ERYA 5EM2B 3SBRA 4X63B 2AH1A 4Z7NA 1ERJA 1YR2A 3JB9L 1SQ9A 4QQEA 4FHLA 1JMXB 1UOQA 4UI9R 1SHYB 3BG1A 5C92A 1K32A 4X3EA 4O3UB 3DDUA 4QT8A 1VYHC 2WQ8A 3L4MD 4BCCA 4CI2A 5CXBB 1P22A 1Q47A 2I0RA 2EIDA 2XE4A 3CFSB 4NC4A 1QFSA 4ZN4A 4RE6A 4EWRA 5IGQA 2H6NA 4XYHA 5CYKB 2Q7QA 3AL8B 5I5MA 2H13A 2PM9B 3I8EA 2H6QA 4G1MA 4PBZA 4J77A 1UOOA 3B7FA 4K3JB 4X60B 3N0EA 5EALA 1SQJA 5EAMA 3RLMD 2IURA 4J0WA 2IWFA 3I7OA 3SXTD 5GXIA 3EI3A 1L5GA 4A7JA 1JTDB 3SCYA 3EG6A 5IC7A 3OF7A 2VDQA 4D0KA 3IJEA 3L4OD 1GOFA 3MUNA 3OL2B 2PM7B 3C9CA 2J56H 4J82A 4PC0A 1PI6A 2AQ5A 3PSCB 1S4UX 2VDRA 1RI6A 2YMUA 2G9AA 2P9UC 3F3PA 5FKSA 4JSXC 3SJLD 2AGZA 2YNNA 4E54A 5HE3B 2H47A 2XYIA 3NIFA 4R7AB 3JAMg 3FCUA 5EAPA 3P4FA 3MZLA 5SXMA 2IUVA 5K19A 2J55H 3I7LA 3SWSD 1N6FA 2P9KC 3OKWA 3GREA 3UVLA 4H5IA 3ZE0A 1TYEA 1E8NA 1O6FA 3BWSA 1K8KC 5CXBA 5IGOA 4E5ZB 3VA6A 2IUPA 1GG2B 1VZ3A 4Y5RD 2XZGA 2H14A 3UKRC 2QZPA 2IAAA 3AL8A 4JHNA 4L1QD 4J84A 5TDHB 1H2ZA 3NVNA 2O9KA 1GP2B 4CI8A 3AL9A 1NR0A 3I2NA 4CY1A 5E6SA 3EI3B 3IUJA 3OKTA 3PVWB 3SVWD 4I79A 4AOWA 5EMMB 4A0AA 3ZE1A 3MXXA 4FA5D 4QAMA 4PSWB 3V5WB 4O9DA 4U7AA 4X61B 3RRMC 2JKXA 3IIYA 4MMXA 5AMSA 3K71A 2Z2NA 3SLED 2HYEA 1PEVA 4PNKB 3HFQA 2PM6B 4Z8LA 4BP9A 3NIDA 2B5MA 3MZKA 5EARA 5FA5B 4ESGA 2B5NA 4GM3A 4RE5A 3EMHA 3N0DA 4UM9A 2YNPA 3A0FA 2H9MA 3IUMA 3ORVD 4GMBA 3K27A 5FKQA 3V7DB 2AGXA 2VZ1A 3FCSA 4HDJA 3RSEC 4E54B 1MDAH 4G56B 1H2YA 5H1MA 1VE7A 3IUNA 2HXCA 4A11A 2EIBA 5THAA 3UVKA 5C2VB 3EI2B 4L9OA 2VDKA 3F3GA 3UVNA 2UZXB
chains in the Genus database with same CATH topology
1I2MB 4JHNA 4DNUA 4DNWA 1A12A 3OF7A 3QHYB 4D9SA 4NC4A 3MVDK 4NBMA 4JHPC 4L1MA 4O2WA 4DNVA 3KCIA 4NAAA 4QAMA 3QI0A 1JTDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I2M B;  4JHN A;  4DNU A;  4DNW A;  1A12 A;  3OF7 A;  3QHY B;  4D9S A;  4NC4 A;  3MVD K;  4NBM A;  4JHP C;  4L1M A;  4O2W A;  4DNV A;  3KCI A;  4NAA A;  4QAM A;  3QI0 A;  1JTD B; 
#chains in the Genus database with same CATH topology
 4JSV C;  1JV2 A;  1H2X A;  5M5U A;  1GOG A;  4FA4 D;  4BH6 A;  1T2X A;  5FFO A;  5HDB A;  3JPX A;  4L3H D;  4CZV A;  4GQB B;  4D9S A;  4E5Z A;  1VZ2 A;  2CNX A;  3FM0 A;  3I7P A;  4MMZ A;  3V4V A;  1E5T A;  3I8C A;  5C9Z B;  1NEX B;  2CE9 A;  1PGU A;  5C2W B;  1N6D A;  3C99 A;  5HE1 B;  3MUO A;  4J8G A;  3E0C A;  1XIP A;  2TRC B;  3CIK B;  3IIW A;  3IUQ A;  4CI3 A;  3U4Y A;  4CZY A;  3SMR A;  3PXT D;  4TZ4 A;  3FRX A;  4A0A B;  2EIE A;  2P9L C;  3PXW D;  5EMJ B;  2I3S A;  1QNI A;  5TF2 A;  2GC4 A;  5TEE A;  1GXR A;  2CE8 A;  4WK0 A;  4AMZ A;  2GC7 A;  3VI3 A;  1B9Y A;  2G99 A;  3O4G A;  5AJA A;  2HU8 A;  1BPO A;  2VDP A;  4Y7R A;  4O2W A;  4WK4 A;  4NEN A;  2H3X A;  3IKO A;  2OJY A;  2VZ3 A;  2P9P C;  2UZY B;  2AGY A;  2OIZ A;  1B9X A;  5IJ8 E;  3K6S A;  2HU7 A;  4OWR A;  1L0Q A;  5HYN B;  5EML B;  1UTC A;  1UOP A;  4U1E I;  2BBK H;  2QR5 A;  4A11 B;  4WJK A;  3T3M A;  2VC2 A;  3NIG A;  3MVD K;  3VH0 A;  3EI2 A;  3NVX A;  4BUJ C;  2BKL A;  4BCD A;  5B4W A;  4GGD A;  3IVM A;  4FAN D;  5EMK B;  4FB1 D;  3JRP A;  1C9L A;  5HQG A;  4AMY A;  1C9I A;  3C5M A;  2CO0 A;  4IMM A;  4JXM A;  3IUL A;  4J87 A;  3RFG A;  5HE2 B;  2XL2 A;  5I5J A;  3O4J A;  3QHY B;  5FFG A;  3KRW B;  3EU7 A;  2VDM A;  3C75 H;  3PE7 A;  4IRZ A;  4O3T B;  4CZX A;  4O1Q D;  3SBQ A;  4KFM B;  3ODT A;  1TYQ C;  4QL1 A;  4CC9 A;  2HJB A;  5M5S A;  2CO0 C;  4PXW A;  1QFM A;  3ZWL B;  3I7N A;  2IWK A;  3I7K A;  2H9N A;  3CFV A;  3AH8 B;  3EQ8 A;  1U4C A;  1I2M B;  3W15 A;  2HU5 A;  2EIC A;  2VDO A;  3O4H A;  4O02 A;  2B5L A;  4GGA A;  4J8B A;  3OW8 A;  2I0T A;  4A2L A;  4ES0 A;  5FKT A;  3BG0 A;  3GC3 B;  2PBI B;  3SHF A;  5IT9 g;  5CXC A;  4MMY A;  4H5J A;  2W18 A;  2HJ4 A;  4AEZ A;  3T3P A;  1E8M A;  1U8C A;  4NAA A;  3GFC A;  5HE0 B;  3ULE C;  4A08 A;  2Z2O A;  2GNQ A;  4QRJ A;  3RN0 D;  2OVP B;  4GM8 A;  5M5V A;  5GMK n;  4J0X A;  1O6G A;  3ZDY A;  5M5T A;  3EI1 B;  2Z2P A;  2OK6 A;  3IUR A;  2P9S C;  3PVU B;  4ZOX A;  3I89 A;  4PBY A;  4BCB A;  2P9I C;  1TBG A;  3DSM A;  2QC5 A;  4K3I D;  4N14 A;  4DNV A;  2I0S A;  3V9F A;  4UM8 A;  1GOH A;  4CY2 A;  4IA9 A;  3GD1 I;  5H17 A;  3RFH A;  2H6K A;  2H68 A;  2YB8 B;  3SN6 B;  3V4P A;  4ZOV A;  4GQ1 A;  3DWL C;  3NVQ A;  4AN0 A;  2J57 G;  1A12 A;  2OVQ B;  1JJU B;  4D6V A;  2YBA A;  3VI4 A;  3ZDX A;  4ZOZ A;  3SFZ A;  2CN3 A;  5M5R A;  4L1M A;  3VGZ A;  1R5M A;  4FWW A;  2HES X;  3KCI A;  4XYI A;  5E6R A;  4NSX A;  3EI4 A;  1MG2 A;  3UVO A;  2VDL A;  4J81 A;  1A0R B;  2B4E A;  2MTA H;  4A2M A;  3SBP A;  4J78 A;  4BL0 A;  2BCJ B;  2QXV A;  5CXC B;  1OMW B;  4G55 A;  4G1E A;  4JT5 C;  2OK4 A;  4ERZ A;  1XKS A;  2AGW A;  2IUQ A;  4DNU A;  2XL3 A;  4FA9 D;  2H9L A;  4A08 B;  5H14 A;  3K72 A;  4GGC A;  4J79 A;  5TEF A;  1GOT B;  5FLX g;  5GXH A;  3MMY A;  3I7H A;  5K1C C;  3IJ0 A;  4A0B B;  3OKY B;  2CN2 A;  5AFU 3;  4O45 A;  5C86 A;  3EQ7 A;  2AGL A;  2P9N C;  3DXM C;  4A09 A;  3PXS D;  3ZE2 A;  2XU7 A;  3EI1 A;  5FKR A;  4L3G D;  3JRO A;  4J73 A;  4CY3 A;  4ERQ A;  3OTT A;  1PBY B;  5EM2 A;  4Z7O A;  4ZOY A;  4PSX B;  4GQ2 P;  4BP8 A;  4CI1 A;  3J80 g;  1M1X A;  1YFQ A;  5JWZ A;  1OLZ A;  1VE6 A;  3FGB A;  4NBM A;  4XEI C;  1N6E A;  3F3F A;  1FWX A;  5IJ7 E;  4FA1 D;  4JSN C;  3JZG A;  4YVD A;  3UKU C;  4FAV D;  4GM9 A;  4LG9 A;  3RMZ D;  3EWE A;  1K3I A;  5CYK A;  2AH0 A;  1MG3 A;  3PSL A;  3JZH A;  5KDO B;  2PM9 A;  2H9P A;  3DM0 A;  3KRX B;  3DXK C;  4AX4 A;  1JOF A;  4JSP C;  3UR4 A;  3EI4 B;  1XHM A;  2YNO A;  3JZN A;  5FXY A;  1H2W A;  2EBS A;  2HKM A;  4WK2 A;  2OVR B;  5M61 A;  5I5I A;  3AFC A;  4JHP C;  1U2V C;  5A2Q g;  3UVM A;  3IJ1 A;  4J86 A;  1JMZ B;  4LG8 A;  4GZ8 A;  3K26 A;  2I3T A;  3OL2 A;  4CY5 A;  3QI0 A;  2HKR A;  2XDW A;  4OZU A;  4JD2 C;  3OKY A;  5GSA A;  5FQD A;  4A0B A;  3J81 g;  4A09 B;  4Z7Q A;  5E6U A;  3RN1 D;  4DNW A;  3MKS B;  4LGN A;  3IJC A;  2VDN A;  3O4I A;  3ZDZ A;  4JT6 C;  4MK0 B;  3MKQ A;  4AN1 A;  3EQ9 A;  4ERY A;  5EM2 B;  3SBR A;  4X63 B;  2AH1 A;  4Z7N A;  1ERJ A;  1YR2 A;  3JB9 L;  1SQ9 A;  4QQE A;  4FHL A;  1JMX B;  1UOQ A;  4UI9 R;  1SHY B;  3BG1 A;  5C92 A;  1K32 A;  4X3E A;  4O3U B;  3DDU A;  4QT8 A;  1VYH C;  2WQ8 A;  3L4M D;  4BCC A;  4CI2 A;  5CXB B;  1P22 A;  1Q47 A;  2I0R A;  2EID A;  2XE4 A;  3CFS B;  4NC4 A;  1QFS A;  4ZN4 A;  4RE6 A;  4EWR A;  5IGQ A;  2H6N A;  4XYH A;  5CYK B;  2Q7Q A;  3AL8 B;  5I5M A;  2H13 A;  2PM9 B;  3I8E A;  2H6Q A;  4G1M A;  4PBZ A;  4J77 A;  1UOO A;  3B7F A;  4K3J B;  4X60 B;  3N0E A;  5EAL A;  1SQJ A;  5EAM A;  3RLM D;  2IUR A;  4J0W A;  2IWF A;  3I7O A;  3SXT D;  5GXI A;  3EI3 A;  1L5G A;  4A7J A;  1JTD B;  3SCY A;  3EG6 A;  5IC7 A;  3OF7 A;  2VDQ A;  4D0K A;  3IJE A;  3L4O D;  1GOF A;  3MUN A;  3OL2 B;  2PM7 B;  3C9C A;  2J56 H;  4J82 A;  4PC0 A;  1PI6 A;  2AQ5 A;  3PSC B;  1S4U X;  2VDR A;  1RI6 A;  2YMU A;  2G9A A;  2P9U C;  3F3P A;  5FKS A;  4JSX C;  3SJL D;  2AGZ A;  2YNN A;  4E54 A;  5HE3 B;  2H47 A;  2XYI A;  3NIF A;  4R7A B;  3JAM g;  3FCU A;  5EAP A;  3P4F A;  3MZL A;  5SXM A;  2IUV A;  5K19 A;  2J55 H;  3I7L A;  3SWS D;  1N6F A;  2P9K C;  3OKW A;  3GRE A;  3UVL A;  4H5I A;  3ZE0 A;  1TYE A;  1E8N A;  1O6F A;  3BWS A;  1K8K C;  5CXB A;  5IGO A;  4E5Z B;  3VA6 A;  2IUP A;  1GG2 B;  1VZ3 A;  4Y5R D;  2XZG A;  2H14 A;  3UKR C;  2QZP A;  2IAA A;  3AL8 A;  4JHN A;  4L1Q D;  4J84 A;  5TDH B;  1H2Z A;  3NVN A;  2O9K A;  1GP2 B;  4CI8 A;  3AL9 A;  1NR0 A;  3I2N A;  4CY1 A;  5E6S A;  3EI3 B;  3IUJ A;  3OKT A;  3PVW B;  3SVW D;  4I79 A;  4AOW A;  5EMM B;  4A0A A;  3ZE1 A;  3MXX A;  4FA5 D;  4QAM A;  4PSW B;  3V5W B;  4O9D A;  4U7A A;  4X61 B;  3RRM C;  2JKX A;  3IIY A;  4MMX A;  5AMS A;  3K71 A;  2Z2N A;  3SLE D;  2HYE A;  1PEV A;  4PNK B;  3HFQ A;  2PM6 B;  4Z8L A;  4BP9 A;  3NID A;  2B5M A;  3MZK A;  5EAR A;  5FA5 B;  4ESG A;  2B5N A;  4GM3 A;  4RE5 A;  3EMH A;  3N0D A;  4UM9 A;  2YNP A;  3A0F A;  2H9M A;  3IUM A;  3ORV D;  4GMB A;  3K27 A;  5FKQ A;  3V7D B;  2AGX A;  2VZ1 A;  3FCS A;  4HDJ A;  3RSE C;  4E54 B;  1MDA H;  4G56 B;  1H2Y A;  5H1M A;  1VE7 A;  3IUN A;  2HXC A;  4A11 A;  2EIB A;  5THA A;  3UVK A;  5C2V B;  3EI2 B;  4L9O A;  2VDK A;  3F3G A;  3UVN A;  2UZX B; 
#chains in the Genus database with same CATH homology
 1I2M B;  4JHN A;  4DNU A;  4DNW A;  1A12 A;  3OF7 A;  3QHY B;  4D9S A;  4NC4 A;  3MVD K;  4NBM A;  4JHP C;  4L1M A;  4O2W A;  4DNV A;  3KCI A;  4NAA A;  4QAM A;  3QI0 A;  1JTD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...