1A12A

Regulator of chromosome condensation (rcc1) of human
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
401
structure length
401
Chain Sequence
KKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REGULATOR OF CHROMOSOME CONDENSATION 1
publication title The 1.7 A crystal structure of the regulator of chromosome condensation (RCC1) reveals a seven-bladed propeller.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Guanine nucleotide exchange factor
total genus 106
structure length 401
sequence length 401
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1997-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.30 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein II 1a12A00
4JHPC 4DNWA 4DNUA 3MVDK 4NBMA 3QHYB 4DNVA 3KCIA 1JTDB 4JHNA 3QI0A 4NAAA 4QAMA 1A12A 4NC4A 3OF7A 4D9SA 1I2MB 4L1MA 4O2WA
chains in the Genus database with same CATH superfamily
4OWRA 2B4EA 4Z7OA 3IJ1A 3IUNA 1E8NA 4A09A 2H9MA 4NBMA 4G56B 3JRPA 2CO0C 4FA1D 5FKRA 5CYKA 5EARA 4J84A 2XL2A 3O4IA 2H9PA 3DDUA 4LGNA 3KRXB 3BG1A 2J55H 3GD1I 4QAMA 2AGXA 2CE9A 1B9YA 3PXWD 3MKSB 3VI4A 4BUJC 5GSAA 3SMRA 3N0DA 4JXMA 4A11B 4X60B 4LG8A 4ES0A 4A08B 3N0EA 4UM9A 3I8CA 2H13A 2YMUA 4FHLA 4GMBA 4X63B 4PNKB 4A09B 4JHNA 3C5MA 4AN0A 5EAPA 5IT9g 2J57G 2I0TA 4ZOXA 5CYKB 3UVOA 5K1CC 4Z7QA 1VE6A 4L3HD 4A0BA 5M5VA 4AMYA 1OMWB 3OTTA 3MUOA 3OKWA 4AOWA 2PBIB 1R5MA 2IUVA 2P9IC 4ESGA 3F3FA 3IUMA 5HE1B 3AL8A 3RFGA 5IJ8E 3I7LA 2XYIA 4E54A 5TDHB 3IJCA 4RE5A 4O3TB 2P9KC 1L0QA 4NAAA 2VZ1A 2IWKA 5FKTA 1P22A 4AX4A 5M5SA 5GXIA 2AGYA 3JAMg 3CIKB 3I89A 4NSXA 4JHPC 4ZOZA 4A0BB 4L1QD 2OK4A 1A0RB 3OKTA 3PVWB 1GOGA 4PXWA 3SN6B 5C2VB 2I3TA 2AGZA 2AQ5A 4GGAA 5H1MA 4L3GD 2VC2A 3RSEC 3SBQA 4J82A 3SCYA 3IURA 3AFCA 1PEVA 3C99A 3DXKC 5FFOA 3ODTA 3IKOA 1A12A 3AL8B 1B9XA 4GQ2P 3OF7A 3PSLA 1RI6A 4E54B 2OVQB 1GOFA 2GC7A 4K3ID 3FGBA 3UVKA 4ZN4A 2GC4A 2QC5A 5HYNB 2P9NC 3MXXA 1QFSA 1TBGA 4O1QD 4J8GA 1K32A 5THAA 1Q47A 2G99A 3O4JA 4QRJA 5EMLB 3UKUC 2CN3A 1XHMA 3AH8B 3SHFA 4O9DA 3RRMC 4J8BA 3SBPA 1U8CA 1N6DA 3PXTD 1ERJA 3W15A 3IUJA 1O6GA 4WK4A 3RLMD 1QFMA 4BCCA 2UZXB 4J73A 3BG0A 4PSWB 4O02A 5HE0B 1GG2B 2O9KA 2B5MA 1UOQA 1XIPA 3UVMA 4PBZA 1GOHA 2CE8A 2Z2NA 3JPXA 4L1MA 5H14A 3SXTD 1YFQA 2I0RA 3EMHA 4BP9A 2P9UC 3MZKA 3QHYB 4UM8A 1FWXA 1JTDB 3P4FA 3E0CA 2UZYB 2VDMA 4GM8A 2EICA 5EAMA 3V5WB 2I0SA 1L5GA 4ERQA 4ZOVA 3SLED 3V9FA 1UTCA 3IJEA 2IUPA 1O6FA 4IA9A 4QT8A 4E5ZB 5EMMB 3RMZD 4AMZA 4QL1A 4XYHA 5M5RA 3ULEC 3UVLA 1H2WA 4IMMA 3IVMA 2H9NA 4D6VA 3V4PA 5M61A 2XL3A 3ZDZA 4DNWA 3MUNA 4J78A 3B7FA 1XKSA 5KDOB 2OJYA 1BPOA 3I7HA 3PXSD 2XU7A 4BH6A 2VDRA 3EU7A 3U4YA 5CXBB 4CC9A 1JMZB 2HU8A 5M5TA 3UKRC 3RFHA 4J81A 4X3EA 2VDKA 4J79A 2YNNA 3IIYA 3MKQA 4FA9D 3KRWB 1PBYB 2IAAA 2AH1A 2BKLA 2H6KA 2G9AA 1H2ZA 4YVDA 1SQJA 4Z7NA 4R7AB 5SXMA 5EM2A 3HFQA 2IURA 2IWFA 1JJUB 3IIWA 2OIZA 4CI8A 1SQ9A 3JZHA 5FKSA 3IULA 1I2MB 3FCUA 5B4WA 3JZNA 1GXRA 4J87A 3EQ9A 5HE3B 3CFVA 2YNOA 4CI3A 1S4UX 3DSMA 2H9LA 1NR0A 4CZVA 2AGLA 3I7PA 3MVDK 3ZDYA 3DM0A 4AN1A 5E6SA 1OLZA 2H47A 5GXHA 3L4MD 5HQGA 3I7NA 4BCBA 3ZE1A 1U2VC 3DXMC 2OVPB 2HESX 3T3PA 3SVWD 1U4CA 2B5NA 2PM7B 4A2MA 1C9IA 5IJ7E 4ZOYA 3SFZA 3CFSB 3NVQA 4CY1A 5EM2B 3EQ8A 1QNIA 3JZGA 2AGWA 5I5IA 1TYEA 4J86A 2IUQA 4O3UB 4CY5A 5EMJB 3EQ7A 1MG3A 4J77A 4MK0B 5HE2B 1VZ2A 4BP8A 2HXCA 1UOOA 3L4OD 3SBRA 2EIEA 2CO0A 3K6SA 2QXVA 2H14A 3IJ0A 4GQ1A 5M5UA 2HU7A 4LG9A 2YNPA 4GM9A 5FFGA 3F3GA 3UR4A 4AEZA 5C9ZB 4E5ZA 3C9CA 2XZGA 3EI3A 2I3SA 1PGUA 3DWLC 2VZ3A 5IGQA 3FCSA 3ZWLB 2HYEA 2MTAH 1SHYB 4X61B 4U1EI 4O2WA 4FB1D 4H5IA 3UVNA 4Z8LA 2OK6A 3VA6A 5IGOA 3OKYB 3NVNA 4A2LA 3NIFA 4DNVA 2EIDA 3GFCA 3J81g 4EWRA 4ERZA 3MZLA 5CXBA 3A0FA 3ZDXA 1VZ3A 4JT6C 2H68A 1K3IA 2PM9A 2VDLA 4WK2A 2VDOA 4G1MA 5FXYA 1H2YA 4FAVD 4OZUA 4A7JA 5TF2A 3GREA 3K71A 1JOFA 3NIGA 4O45A 3EI3B 5EALA 4FWWA 3NIDA 4NENA 3EI1A 4G1EA 4Y7RA 1NEXB 5C86A 5CXCA 1K8KC 3KCIA 4MMYA 5E6RA 3OW8A 1E5TA 5AJAA 4GGCA 4WJKA 2H3XA 4UI9R 4CY2A 5K19A 4CZYA 2QR5A 2PM9B 5JWZA 3GC3B 4J0WA 4Y5RD 4L9OA 3EG6A 4BL0A 5AFU3 2W18A 3BWSA 5FA5B 3ZE0A 3EI1B 5FKQA 3IUQA 4JT5C 4ERYA 3QI0A 4JSNC 3V7DB 4PBYA 1T2XA 5CXCB 4NC4A 2P9SC 1M1XA 3I8EA 4RE6A 3I2NA 4CZXA 5I5JA 3I7KA 4CI1A 5TEFA 3OL2A 1E8MA 5GMKn 3PSCB 5AMSA 3J80g 4I79A 3EWEA 2HJBA 3EI4A 5FQDA 5A2Qg 5TEEA 3K26A 2H6NA 4QQEA 1H2XA 3V4VA 3MMYA 2BCJB 2J56H 4D0KA 5C2WB 3PVUB 1UOPA 4HDJA 2P9LC 2GNQA 4JSVC 2HKRA 2B5LA 4GM3A 4TZ4A 4D9SA 4GQBB 3ZE2A 4N14A 4FA5D 1JMXB 3VH0A 2TRCB 3OKYA 5E6UA 2YBAA 3O4HA 3NVXA 3FRXA 4GGDA 3EI2A 3RN0D 3AL9A 2HKMA 4JSXC 5H17A 3OL2B 4DNUA 3SWSD 4J0XA 3JB9L 1VE7A 3RN1D 4A0AA 3PE7A 2HJ4A 5I5MA 4MMXA 2JKXA 3EI4B 3I7OA 3FM0A 3VI3A 2P9PC 2WQ8A 2Z2PA 4JD2C 1N6EA 2EIBA 1MG2A 4PC0A 5HDBA 2XDWA 2PM6B 2H6QA 1MDAH 2HU5A 4G55A 5FLXg 2CNXA 5IC7A 4GZ8A 4FA4D 1JV2A 4FAND 2Q7QA 2Z2OA 4MMZA 2VDQA 3VGZA 3F3PA 1C9LA 4JSPC 3T3MA 4IRZA 2QZPA 1YR2A 1PI6A 2OVRB 1GP2B 3K27A 3EI2B 4XEIC 3O4GA 4KFMB 1N6FA 3ORVD 4XYIA 3K72A 4A0AB 1TYQC 2AH0A 2YB8B 4K3JB 4WK0A 2XE4A 4PSXB 4A11A 4CI2A 2VDNA 2BBKH 2CN2A 3C75H 4A08A 4CY3A 5C92A 4BCDA 1GOTB 4U7AA 5EMKB 2VDPA 3JROA 3SJLD 1VYHC 4H5JA 2EBSA
chains in the Genus database with same CATH topology
4JHPC 4DNWA 4DNUA 3MVDK 4NBMA 3QHYB 4DNVA 3KCIA 1JTDB 4JHNA 3QI0A 4NAAA 4QAMA 1A12A 4NC4A 3OF7A 4D9SA 1I2MB 4L1MA 4O2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JHP C;  4DNW A;  4DNU A;  3MVD K;  4NBM A;  3QHY B;  4DNV A;  3KCI A;  1JTD B;  4JHN A;  3QI0 A;  4NAA A;  4QAM A;  1A12 A;  4NC4 A;  3OF7 A;  4D9S A;  1I2M B;  4L1M A;  4O2W A; 
#chains in the Genus database with same CATH topology
 4OWR A;  2B4E A;  4Z7O A;  3IJ1 A;  3IUN A;  1E8N A;  4A09 A;  2H9M A;  4NBM A;  4G56 B;  3JRP A;  2CO0 C;  4FA1 D;  5FKR A;  5CYK A;  5EAR A;  4J84 A;  2XL2 A;  3O4I A;  2H9P A;  3DDU A;  4LGN A;  3KRX B;  3BG1 A;  2J55 H;  3GD1 I;  4QAM A;  2AGX A;  2CE9 A;  1B9Y A;  3PXW D;  3MKS B;  3VI4 A;  4BUJ C;  5GSA A;  3SMR A;  3N0D A;  4JXM A;  4A11 B;  4X60 B;  4LG8 A;  4ES0 A;  4A08 B;  3N0E A;  4UM9 A;  3I8C A;  2H13 A;  2YMU A;  4FHL A;  4GMB A;  4X63 B;  4PNK B;  4A09 B;  4JHN A;  3C5M A;  4AN0 A;  5EAP A;  5IT9 g;  2J57 G;  2I0T A;  4ZOX A;  5CYK B;  3UVO A;  5K1C C;  4Z7Q A;  1VE6 A;  4L3H D;  4A0B A;  5M5V A;  4AMY A;  1OMW B;  3OTT A;  3MUO A;  3OKW A;  4AOW A;  2PBI B;  1R5M A;  2IUV A;  2P9I C;  4ESG A;  3F3F A;  3IUM A;  5HE1 B;  3AL8 A;  3RFG A;  5IJ8 E;  3I7L A;  2XYI A;  4E54 A;  5TDH B;  3IJC A;  4RE5 A;  4O3T B;  2P9K C;  1L0Q A;  4NAA A;  2VZ1 A;  2IWK A;  5FKT A;  1P22 A;  4AX4 A;  5M5S A;  5GXI A;  2AGY A;  3JAM g;  3CIK B;  3I89 A;  4NSX A;  4JHP C;  4ZOZ A;  4A0B B;  4L1Q D;  2OK4 A;  1A0R B;  3OKT A;  3PVW B;  1GOG A;  4PXW A;  3SN6 B;  5C2V B;  2I3T A;  2AGZ A;  2AQ5 A;  4GGA A;  5H1M A;  4L3G D;  2VC2 A;  3RSE C;  3SBQ A;  4J82 A;  3SCY A;  3IUR A;  3AFC A;  1PEV A;  3C99 A;  3DXK C;  5FFO A;  3ODT A;  3IKO A;  1A12 A;  3AL8 B;  1B9X A;  4GQ2 P;  3OF7 A;  3PSL A;  1RI6 A;  4E54 B;  2OVQ B;  1GOF A;  2GC7 A;  4K3I D;  3FGB A;  3UVK A;  4ZN4 A;  2GC4 A;  2QC5 A;  5HYN B;  2P9N C;  3MXX A;  1QFS A;  1TBG A;  4O1Q D;  4J8G A;  1K32 A;  5THA A;  1Q47 A;  2G99 A;  3O4J A;  4QRJ A;  5EML B;  3UKU C;  2CN3 A;  1XHM A;  3AH8 B;  3SHF A;  4O9D A;  3RRM C;  4J8B A;  3SBP A;  1U8C A;  1N6D A;  3PXT D;  1ERJ A;  3W15 A;  3IUJ A;  1O6G A;  4WK4 A;  3RLM D;  1QFM A;  4BCC A;  2UZX B;  4J73 A;  3BG0 A;  4PSW B;  4O02 A;  5HE0 B;  1GG2 B;  2O9K A;  2B5M A;  1UOQ A;  1XIP A;  3UVM A;  4PBZ A;  1GOH A;  2CE8 A;  2Z2N A;  3JPX A;  4L1M A;  5H14 A;  3SXT D;  1YFQ A;  2I0R A;  3EMH A;  4BP9 A;  2P9U C;  3MZK A;  3QHY B;  4UM8 A;  1FWX A;  1JTD B;  3P4F A;  3E0C A;  2UZY B;  2VDM A;  4GM8 A;  2EIC A;  5EAM A;  3V5W B;  2I0S A;  1L5G A;  4ERQ A;  4ZOV A;  3SLE D;  3V9F A;  1UTC A;  3IJE A;  2IUP A;  1O6F A;  4IA9 A;  4QT8 A;  4E5Z B;  5EMM B;  3RMZ D;  4AMZ A;  4QL1 A;  4XYH A;  5M5R A;  3ULE C;  3UVL A;  1H2W A;  4IMM A;  3IVM A;  2H9N A;  4D6V A;  3V4P A;  5M61 A;  2XL3 A;  3ZDZ A;  4DNW A;  3MUN A;  4J78 A;  3B7F A;  1XKS A;  5KDO B;  2OJY A;  1BPO A;  3I7H A;  3PXS D;  2XU7 A;  4BH6 A;  2VDR A;  3EU7 A;  3U4Y A;  5CXB B;  4CC9 A;  1JMZ B;  2HU8 A;  5M5T A;  3UKR C;  3RFH A;  4J81 A;  4X3E A;  2VDK A;  4J79 A;  2YNN A;  3IIY A;  3MKQ A;  4FA9 D;  3KRW B;  1PBY B;  2IAA A;  2AH1 A;  2BKL A;  2H6K A;  2G9A A;  1H2Z A;  4YVD A;  1SQJ A;  4Z7N A;  4R7A B;  5SXM A;  5EM2 A;  3HFQ A;  2IUR A;  2IWF A;  1JJU B;  3IIW A;  2OIZ A;  4CI8 A;  1SQ9 A;  3JZH A;  5FKS A;  3IUL A;  1I2M B;  3FCU A;  5B4W A;  3JZN A;  1GXR A;  4J87 A;  3EQ9 A;  5HE3 B;  3CFV A;  2YNO A;  4CI3 A;  1S4U X;  3DSM A;  2H9L A;  1NR0 A;  4CZV A;  2AGL A;  3I7P A;  3MVD K;  3ZDY A;  3DM0 A;  4AN1 A;  5E6S A;  1OLZ A;  2H47 A;  5GXH A;  3L4M D;  5HQG A;  3I7N A;  4BCB A;  3ZE1 A;  1U2V C;  3DXM C;  2OVP B;  2HES X;  3T3P A;  3SVW D;  1U4C A;  2B5N A;  2PM7 B;  4A2M A;  1C9I A;  5IJ7 E;  4ZOY A;  3SFZ A;  3CFS B;  3NVQ A;  4CY1 A;  5EM2 B;  3EQ8 A;  1QNI A;  3JZG A;  2AGW A;  5I5I A;  1TYE A;  4J86 A;  2IUQ A;  4O3U B;  4CY5 A;  5EMJ B;  3EQ7 A;  1MG3 A;  4J77 A;  4MK0 B;  5HE2 B;  1VZ2 A;  4BP8 A;  2HXC A;  1UOO A;  3L4O D;  3SBR A;  2EIE A;  2CO0 A;  3K6S A;  2QXV A;  2H14 A;  3IJ0 A;  4GQ1 A;  5M5U A;  2HU7 A;  4LG9 A;  2YNP A;  4GM9 A;  5FFG A;  3F3G A;  3UR4 A;  4AEZ A;  5C9Z B;  4E5Z A;  3C9C A;  2XZG A;  3EI3 A;  2I3S A;  1PGU A;  3DWL C;  2VZ3 A;  5IGQ A;  3FCS A;  3ZWL B;  2HYE A;  2MTA H;  1SHY B;  4X61 B;  4U1E I;  4O2W A;  4FB1 D;  4H5I A;  3UVN A;  4Z8L A;  2OK6 A;  3VA6 A;  5IGO A;  3OKY B;  3NVN A;  4A2L A;  3NIF A;  4DNV A;  2EID A;  3GFC A;  3J81 g;  4EWR A;  4ERZ A;  3MZL A;  5CXB A;  3A0F A;  3ZDX A;  1VZ3 A;  4JT6 C;  2H68 A;  1K3I A;  2PM9 A;  2VDL A;  4WK2 A;  2VDO A;  4G1M A;  5FXY A;  1H2Y A;  4FAV D;  4OZU A;  4A7J A;  5TF2 A;  3GRE A;  3K71 A;  1JOF A;  3NIG A;  4O45 A;  3EI3 B;  5EAL A;  4FWW A;  3NID A;  4NEN A;  3EI1 A;  4G1E A;  4Y7R A;  1NEX B;  5C86 A;  5CXC A;  1K8K C;  3KCI A;  4MMY A;  5E6R A;  3OW8 A;  1E5T A;  5AJA A;  4GGC A;  4WJK A;  2H3X A;  4UI9 R;  4CY2 A;  5K19 A;  4CZY A;  2QR5 A;  2PM9 B;  5JWZ A;  3GC3 B;  4J0W A;  4Y5R D;  4L9O A;  3EG6 A;  4BL0 A;  5AFU 3;  2W18 A;  3BWS A;  5FA5 B;  3ZE0 A;  3EI1 B;  5FKQ A;  3IUQ A;  4JT5 C;  4ERY A;  3QI0 A;  4JSN C;  3V7D B;  4PBY A;  1T2X A;  5CXC B;  4NC4 A;  2P9S C;  1M1X A;  3I8E A;  4RE6 A;  3I2N A;  4CZX A;  5I5J A;  3I7K A;  4CI1 A;  5TEF A;  3OL2 A;  1E8M A;  5GMK n;  3PSC B;  5AMS A;  3J80 g;  4I79 A;  3EWE A;  2HJB A;  3EI4 A;  5FQD A;  5A2Q g;  5TEE A;  3K26 A;  2H6N A;  4QQE A;  1H2X A;  3V4V A;  3MMY A;  2BCJ B;  2J56 H;  4D0K A;  5C2W B;  3PVU B;  1UOP A;  4HDJ A;  2P9L C;  2GNQ A;  4JSV C;  2HKR A;  2B5L A;  4GM3 A;  4TZ4 A;  4D9S A;  4GQB B;  3ZE2 A;  4N14 A;  4FA5 D;  1JMX B;  3VH0 A;  2TRC B;  3OKY A;  5E6U A;  2YBA A;  3O4H A;  3NVX A;  3FRX A;  4GGD A;  3EI2 A;  3RN0 D;  3AL9 A;  2HKM A;  4JSX C;  5H17 A;  3OL2 B;  4DNU A;  3SWS D;  4J0X A;  3JB9 L;  1VE7 A;  3RN1 D;  4A0A A;  3PE7 A;  2HJ4 A;  5I5M A;  4MMX A;  2JKX A;  3EI4 B;  3I7O A;  3FM0 A;  3VI3 A;  2P9P C;  2WQ8 A;  2Z2P A;  4JD2 C;  1N6E A;  2EIB A;  1MG2 A;  4PC0 A;  5HDB A;  2XDW A;  2PM6 B;  2H6Q A;  1MDA H;  2HU5 A;  4G55 A;  5FLX g;  2CNX A;  5IC7 A;  4GZ8 A;  4FA4 D;  1JV2 A;  4FAN D;  2Q7Q A;  2Z2O A;  4MMZ A;  2VDQ A;  3VGZ A;  3F3P A;  1C9L A;  4JSP C;  3T3M A;  4IRZ A;  2QZP A;  1YR2 A;  1PI6 A;  2OVR B;  1GP2 B;  3K27 A;  3EI2 B;  4XEI C;  3O4G A;  4KFM B;  1N6F A;  3ORV D;  4XYI A;  3K72 A;  4A0A B;  1TYQ C;  2AH0 A;  2YB8 B;  4K3J B;  4WK0 A;  2XE4 A;  4PSX B;  4A11 A;  4CI2 A;  2VDN A;  2BBK H;  2CN2 A;  3C75 H;  4A08 A;  4CY3 A;  5C92 A;  4BCD A;  1GOT B;  4U7A A;  5EMK B;  2VDP A;  3JRO A;  3SJL D;  1VYH C;  4H5J A;  2EBS A; 
#chains in the Genus database with same CATH homology
 4JHP C;  4DNW A;  4DNU A;  3MVD K;  4NBM A;  3QHY B;  4DNV A;  3KCI A;  1JTD B;  4JHN A;  3QI0 A;  4NAA A;  4QAM A;  1A12 A;  4NC4 A;  3OF7 A;  4D9S A;  1I2M B;  4L1M A;  4O2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...