1A12A

Regulator of chromosome condensation (rcc1) of human
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
401
structure length
401
Chain Sequence
KKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REGULATOR OF CHROMOSOME CONDENSATION 1
publication title The 1.7 A crystal structure of the regulator of chromosome condensation (RCC1) reveals a seven-bladed propeller.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Guanine nucleotide exchange factor
total genus 106
structure length 401
sequence length 401
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1997-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.30 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein II 1a12A00
1A12A 4O2WA 3QHYB 3KCIA 4DNWA 4NC4A 3MVDK 1I2MB 4NAAA 4L1MA 3QI0A 3OF7A 1JTDB 4DNUA 4JHPC 4DNVA 4JHNA 4D9SA 4QAMA 4NBMA
chains in the Genus database with same CATH superfamily
2VDOA 3AL9A 2H47A 3IURA 5CXCB 4ZOXA 3ULEC 4ERZA 2VDRA 5FFGA 4OZUA 4N14A 4BH6A 3MXXA 2CE8A 3OKTA 2HYEA 3EI1B 5EAMA 5TEFA 4CI1A 2J57G 3O4JA 1E8MA 4JT5C 1H2ZA 1U8CA 4NAAA 3O4GA 1XIPA 2YMUA 4J79A 3DM0A 3CIKB 2J56H 3IJ1A 4GQBB 3ZWLB 4L9OA 2AGXA 4MK0B 4L1QD 4Z7OA 5HYNB 2MTAH 5CYKA 5M5RA 5IT9g 1QFMA 3W15A 4NSXA 1YFQA 2BCJB 3PSLA 3C99A 2PM6B 3F3PA 4R7AB 5EAPA 3KCIA 3K6SA 4JXMA 4J78A 4AN1A 4CI3A 2JKXA 4FA5D 3K71A 3UKRC 1JTDB 5SXMA 3UVLA 3C9CA 5HE3B 2IUQA 3N0DA 2B4EA 2CNXA 3NVQA 4O1QD 3JZNA 2VDNA 3SN6B 4UI9R 5EM2B 4A09A 4IA9A 4A0AB 3ZDZA 3VGZA 3QHYB 5CXBB 4UM8A 4D6VA 2H9MA 4A0BB 2Z2PA 2UZYB 3SBQA 3C5MA 4J82A 4FWWA 3UVMA 1U2VC 1VYHC 3FGBA 3GREA 2AGYA 2H6QA 4ERYA 4YVDA 4MMYA 2IAAA 3L4MD 3HFQA 4LG9A 4DNUA 4X3EA 4AOWA 3CFSB 4K3JB 5FKSA 1UOQA 3VA6A 5TF2A 3RLMD 3RFHA 4D9SA 2PM9B 4E5ZB 1ERJA 1UOOA 1T2XA 2AGWA 2P9KC 3OL2B 4DNWA 2P9NC 4O3TB 4FA4D 2AQ5A 4L3GD 1YR2A 3AL8A 4AMYA 4MMZA 5FKQA 4X61B 4E54B 3SFZA 2GC7A 3OKYB 3SLED 3JRPA 5IGOA 4XYHA 2GNQA 3T3MA 2XU7A 3ORVD 5C2WB 2YB8B 3NIDA 1NEXB 5M5UA 3VI3A 5EARA 3SBRA 3DSMA 4A08A 4O02A 4QL1A 4CC9A 3IUNA 2YBAA 3I7HA 2OVRB 4J84A 3IKOA 4L1MA 4O3UB 3RMZD 1JJUB 4G56B 4GQ2P 1GOTB 5HE2B 4A2MA 3EI2B 1OLZA 4DNVA 1L5GA 3I7PA 2HKRA 2H9LA 3IULA 3MKQA 1B9XA 3IIWA 2AGZA 3T3PA 2VC2A 3PVWB 5M61A 3SVWD 3IVMA 2IUPA 4G55A 3EU7A 3I7KA 3UKUC 3IJ0A 1VZ3A 3JPXA 3EQ8A 4NC4A 1PEVA 3K27A 1TYEA 1GXRA 4ZOYA 2OVQB 5IJ7E 4D0KA 2HU7A 3P4FA 2Q7QA 2VDLA 4CZYA 3MUNA 4J8GA 5K1CC 1QNIA 2H14A 2B5NA 2H68A 4A11B 5C9ZB 2YNOA 3I7LA 4Y5RD 3FCUA 3KRWB 2P9PC 5CXCA 4O45A 1A0RB 5CYKB 2OVPB 4NBMA 5H1MA 4O2WA 4BCCA 2Z2NA 4ZOZA 2XZGA 2O9KA 4UM9A 5GXIA 4GM3A 3N0EA 1XHMA 5IJ8E 3EI1A 3IIYA 2B5LA 4WJKA 4J81A 3J81g 2J55H 4CY3A 1K3IA 5B4WA 5C2VB 4LG8A 5FXYA 3FCSA 2P9IC 1K8KC 5THAA 3SWSD 2VDKA 5TDHB 2WQ8A 3U4YA 4JD2C 3GFCA 5FKTA 3V5WB 3I8CA 5HQGA 3RN0D 3V4PA 4GQ1A 4CI8A 4ZN4A 3RFGA 4GZ8A 1O6GA 4XYIA 4CI2A 3BWSA 4KFMB 2VDPA 2EIBA 4CZXA 3DWLC 2AH1A 5EM2A 4ES0A 2I0RA 2QZPA 5FFOA 2AGLA 5C86A 5CXBA 4AX4A 4A0BA 3EG6A 3VH0A 4GM9A 3MZLA 5E6RA 5IC7A 1O6FA 1L0QA 4GM8A 4Z8LA 1GOHA 4XEIC 1JMXB 2HXCA 4PC0A 4WK0A 5M5VA 4IMMA 3PE7A 3ZE0A 3IJCA 1GOGA 4PBZA 3OF7A 3SMRA 4CY1A 2CE9A 2YNNA 2P9LC 3O4HA 2G99A 2I3SA 3PXTD 3MUOA 5TEEA 2HJ4A 4GGCA 3EMHA 5HDBA 2PM9A 3V9FA 2P9UC 4GGAA 2XL2A 1H2XA 1VE7A 2BBKH 1A12A 2HU8A 4J0WA 4BP9A 3SBPA 3SXTD 1UOPA 3JB9L 3NVXA 4A2LA 1RI6A 3EI3B 2I0SA 4BUJC 5I5JA 4WK2A 3IUJA 4X60B 3MMYA 4AMZA 4BCBA 4E54A 5AJAA 3ZE1A 3I8EA 3RN1D 3OKYA 4PXWA 1M1XA 2YNPA 2TRCB 4ZOVA 4FHLA 2EIDA 2W18A 2QC5A 2CN3A 3MZKA 1TBGA 4X63B 3K26A 3EQ9A 5HE0B 5JWZA 2IWFA 5H17A 2XL3A 2Z2OA 2H6NA 3NIGA 1JOFA 1SQJA 3RRMC 2IURA 3UR4A 5AMSA 4FA1D 2PBIB 3EI4A 4L3HD 1UTCA 3I7NA 3QI0A 4G1MA 4CZVA 3CFVA 3EI2A 3B7FA 4O9DA 2BKLA 3OKWA 1OMWB 1GP2B 2QXVA 1U4CA 4FA9D 2XE4A 1Q47A 3UVNA 5M5SA 3ZE2A 2OK4A 5GMKn 2VDQA 4JSXC 2HU5A 4J86A 2OIZA 5I5IA 4CY2A 3GC3B 3IUMA 1H2WA 4PNKB 5E6SA 4H5JA 1NR0A 3KRXB 5EMLB 2UZXB 1N6FA 4H5IA 4JSPC 1I2MB 3V4VA 4QT8A 3NIFA 2QR5A 2H9NA 4QRJA 4PBYA 4A11A 1GOFA 4IRZA 1K32A 4I79A 4PSXB 2CO0A 2AH0A 4QAMA 1E8NA 2EBSA 4WK4A 3JROA 4JSVC 4A09B 4FAVD 2H6KA 5EALA 1PBYB 1PI6A 4GMBA 3BG0A 4BCDA 4PSWB 3K72A 3O4IA 4LGNA 4FB1D 3FRXA 1N6EA 2H13A 1SQ9A 4U1EI 4K3ID 3BG1A 4FAND 3JZGA 2OJYA 5AFU3 3DXKC 2CN2A 5I5MA 5GSAA 2EIEA 4JHNA 1P22A 3FM0A 5K19A 5EMJB 3RSEC 4A7JA 1VE6A 3V7DB 3ZDYA 3F3FA 5IGQA 1C9IA 4A0AA 2VZ3A 3SHFA 1GG2B 1PGUA 4AEZA 3PVUB 5FLXg 3PXWD 3A0FA 3I89A 5FKRA 3J80g 3MVDK 2HJBA 2XYIA 3IJEA 4BL0A 2B5MA 2VZ1A 3IUQA 3SJLD 1E5TA 1SHYB 3AL8B 3EQ7A 2VDMA 1VZ2A 1FWXA 5FQDA 3JAMg 2H9PA 2CO0C 4G1EA 4Y7RA 2IWKA 5M5TA 3GD1I 2PM7B 3ODTA 3OW8A 4HDJA 4QQEA 3EWEA 3VI4A 3E0CA 1MG2A 1C9LA 2I3TA 4E5ZA 1N6DA 1MG3A 4Z7QA 4ESGA 1BPOA 2I0TA 5H14A 4JT6C 3L4OD 3DDUA 5A2Qg 3OL2A 1B9YA 2IUVA 1TYQC 1R5MA 3UVKA 3DXMC 4J73A 4A08B 2G9AA 3AH8B 3I7OA 4JSNC 4MMXA 4OWRA 5EMMB 1XKSA 2EICA 5C92A 5GXHA 4J0XA 4AN0A 3F3GA 5EMKB 3SCYA 5E6UA 4TZ4A 1JV2A 3OTTA 1MDAH 4U7AA 4RE5A 4J8BA 2OK6A 4Z7NA 4BP8A 2HKMA 3EI3A 4RE6A 1JMZB 4CY5A 4EWRA 2HESX 3AFCA 3I2NA 4NENA 2H3XA 3NVNA 3UVOA 1QFSA 3EI4B 4J77A 3JZHA 4J87A 3MKSB 4JHPC 2P9SC 3PSCB 4GGDA 5FA5B 2XDWA 1H2YA 5HE1B 3C75H 5KDOB 3PXSD 3ZDXA 4ERQA 1S4UX 2GC4A
chains in the Genus database with same CATH topology
1A12A 4O2WA 3QHYB 3KCIA 4DNWA 4NC4A 3MVDK 1I2MB 4NAAA 4L1MA 3QI0A 3OF7A 1JTDB 4DNUA 4JHPC 4DNVA 4JHNA 4D9SA 4QAMA 4NBMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A12 A;  4O2W A;  3QHY B;  3KCI A;  4DNW A;  4NC4 A;  3MVD K;  1I2M B;  4NAA A;  4L1M A;  3QI0 A;  3OF7 A;  1JTD B;  4DNU A;  4JHP C;  4DNV A;  4JHN A;  4D9S A;  4QAM A;  4NBM A; 
#chains in the Genus database with same CATH topology
 2VDO A;  3AL9 A;  2H47 A;  3IUR A;  5CXC B;  4ZOX A;  3ULE C;  4ERZ A;  2VDR A;  5FFG A;  4OZU A;  4N14 A;  4BH6 A;  3MXX A;  2CE8 A;  3OKT A;  2HYE A;  3EI1 B;  5EAM A;  5TEF A;  4CI1 A;  2J57 G;  3O4J A;  1E8M A;  4JT5 C;  1H2Z A;  1U8C A;  4NAA A;  3O4G A;  1XIP A;  2YMU A;  4J79 A;  3DM0 A;  3CIK B;  2J56 H;  3IJ1 A;  4GQB B;  3ZWL B;  4L9O A;  2AGX A;  4MK0 B;  4L1Q D;  4Z7O A;  5HYN B;  2MTA H;  5CYK A;  5M5R A;  5IT9 g;  1QFM A;  3W15 A;  4NSX A;  1YFQ A;  2BCJ B;  3PSL A;  3C99 A;  2PM6 B;  3F3P A;  4R7A B;  5EAP A;  3KCI A;  3K6S A;  4JXM A;  4J78 A;  4AN1 A;  4CI3 A;  2JKX A;  4FA5 D;  3K71 A;  3UKR C;  1JTD B;  5SXM A;  3UVL A;  3C9C A;  5HE3 B;  2IUQ A;  3N0D A;  2B4E A;  2CNX A;  3NVQ A;  4O1Q D;  3JZN A;  2VDN A;  3SN6 B;  4UI9 R;  5EM2 B;  4A09 A;  4IA9 A;  4A0A B;  3ZDZ A;  3VGZ A;  3QHY B;  5CXB B;  4UM8 A;  4D6V A;  2H9M A;  4A0B B;  2Z2P A;  2UZY B;  3SBQ A;  3C5M A;  4J82 A;  4FWW A;  3UVM A;  1U2V C;  1VYH C;  3FGB A;  3GRE A;  2AGY A;  2H6Q A;  4ERY A;  4YVD A;  4MMY A;  2IAA A;  3L4M D;  3HFQ A;  4LG9 A;  4DNU A;  4X3E A;  4AOW A;  3CFS B;  4K3J B;  5FKS A;  1UOQ A;  3VA6 A;  5TF2 A;  3RLM D;  3RFH A;  4D9S A;  2PM9 B;  4E5Z B;  1ERJ A;  1UOO A;  1T2X A;  2AGW A;  2P9K C;  3OL2 B;  4DNW A;  2P9N C;  4O3T B;  4FA4 D;  2AQ5 A;  4L3G D;  1YR2 A;  3AL8 A;  4AMY A;  4MMZ A;  5FKQ A;  4X61 B;  4E54 B;  3SFZ A;  2GC7 A;  3OKY B;  3SLE D;  3JRP A;  5IGO A;  4XYH A;  2GNQ A;  3T3M A;  2XU7 A;  3ORV D;  5C2W B;  2YB8 B;  3NID A;  1NEX B;  5M5U A;  3VI3 A;  5EAR A;  3SBR A;  3DSM A;  4A08 A;  4O02 A;  4QL1 A;  4CC9 A;  3IUN A;  2YBA A;  3I7H A;  2OVR B;  4J84 A;  3IKO A;  4L1M A;  4O3U B;  3RMZ D;  1JJU B;  4G56 B;  4GQ2 P;  1GOT B;  5HE2 B;  4A2M A;  3EI2 B;  1OLZ A;  4DNV A;  1L5G A;  3I7P A;  2HKR A;  2H9L A;  3IUL A;  3MKQ A;  1B9X A;  3IIW A;  2AGZ A;  3T3P A;  2VC2 A;  3PVW B;  5M61 A;  3SVW D;  3IVM A;  2IUP A;  4G55 A;  3EU7 A;  3I7K A;  3UKU C;  3IJ0 A;  1VZ3 A;  3JPX A;  3EQ8 A;  4NC4 A;  1PEV A;  3K27 A;  1TYE A;  1GXR A;  4ZOY A;  2OVQ B;  5IJ7 E;  4D0K A;  2HU7 A;  3P4F A;  2Q7Q A;  2VDL A;  4CZY A;  3MUN A;  4J8G A;  5K1C C;  1QNI A;  2H14 A;  2B5N A;  2H68 A;  4A11 B;  5C9Z B;  2YNO A;  3I7L A;  4Y5R D;  3FCU A;  3KRW B;  2P9P C;  5CXC A;  4O45 A;  1A0R B;  5CYK B;  2OVP B;  4NBM A;  5H1M A;  4O2W A;  4BCC A;  2Z2N A;  4ZOZ A;  2XZG A;  2O9K A;  4UM9 A;  5GXI A;  4GM3 A;  3N0E A;  1XHM A;  5IJ8 E;  3EI1 A;  3IIY A;  2B5L A;  4WJK A;  4J81 A;  3J81 g;  2J55 H;  4CY3 A;  1K3I A;  5B4W A;  5C2V B;  4LG8 A;  5FXY A;  3FCS A;  2P9I C;  1K8K C;  5THA A;  3SWS D;  2VDK A;  5TDH B;  2WQ8 A;  3U4Y A;  4JD2 C;  3GFC A;  5FKT A;  3V5W B;  3I8C A;  5HQG A;  3RN0 D;  3V4P A;  4GQ1 A;  4CI8 A;  4ZN4 A;  3RFG A;  4GZ8 A;  1O6G A;  4XYI A;  4CI2 A;  3BWS A;  4KFM B;  2VDP A;  2EIB A;  4CZX A;  3DWL C;  2AH1 A;  5EM2 A;  4ES0 A;  2I0R A;  2QZP A;  5FFO A;  2AGL A;  5C86 A;  5CXB A;  4AX4 A;  4A0B A;  3EG6 A;  3VH0 A;  4GM9 A;  3MZL A;  5E6R A;  5IC7 A;  1O6F A;  1L0Q A;  4GM8 A;  4Z8L A;  1GOH A;  4XEI C;  1JMX B;  2HXC A;  4PC0 A;  4WK0 A;  5M5V A;  4IMM A;  3PE7 A;  3ZE0 A;  3IJC A;  1GOG A;  4PBZ A;  3OF7 A;  3SMR A;  4CY1 A;  2CE9 A;  2YNN A;  2P9L C;  3O4H A;  2G99 A;  2I3S A;  3PXT D;  3MUO A;  5TEE A;  2HJ4 A;  4GGC A;  3EMH A;  5HDB A;  2PM9 A;  3V9F A;  2P9U C;  4GGA A;  2XL2 A;  1H2X A;  1VE7 A;  2BBK H;  1A12 A;  2HU8 A;  4J0W A;  4BP9 A;  3SBP A;  3SXT D;  1UOP A;  3JB9 L;  3NVX A;  4A2L A;  1RI6 A;  3EI3 B;  2I0S A;  4BUJ C;  5I5J A;  4WK2 A;  3IUJ A;  4X60 B;  3MMY A;  4AMZ A;  4BCB A;  4E54 A;  5AJA A;  3ZE1 A;  3I8E A;  3RN1 D;  3OKY A;  4PXW A;  1M1X A;  2YNP A;  2TRC B;  4ZOV A;  4FHL A;  2EID A;  2W18 A;  2QC5 A;  2CN3 A;  3MZK A;  1TBG A;  4X63 B;  3K26 A;  3EQ9 A;  5HE0 B;  5JWZ A;  2IWF A;  5H17 A;  2XL3 A;  2Z2O A;  2H6N A;  3NIG A;  1JOF A;  1SQJ A;  3RRM C;  2IUR A;  3UR4 A;  5AMS A;  4FA1 D;  2PBI B;  3EI4 A;  4L3H D;  1UTC A;  3I7N A;  3QI0 A;  4G1M A;  4CZV A;  3CFV A;  3EI2 A;  3B7F A;  4O9D A;  2BKL A;  3OKW A;  1OMW B;  1GP2 B;  2QXV A;  1U4C A;  4FA9 D;  2XE4 A;  1Q47 A;  3UVN A;  5M5S A;  3ZE2 A;  2OK4 A;  5GMK n;  2VDQ A;  4JSX C;  2HU5 A;  4J86 A;  2OIZ A;  5I5I A;  4CY2 A;  3GC3 B;  3IUM A;  1H2W A;  4PNK B;  5E6S A;  4H5J A;  1NR0 A;  3KRX B;  5EML B;  2UZX B;  1N6F A;  4H5I A;  4JSP C;  1I2M B;  3V4V A;  4QT8 A;  3NIF A;  2QR5 A;  2H9N A;  4QRJ A;  4PBY A;  4A11 A;  1GOF A;  4IRZ A;  1K32 A;  4I79 A;  4PSX B;  2CO0 A;  2AH0 A;  4QAM A;  1E8N A;  2EBS A;  4WK4 A;  3JRO A;  4JSV C;  4A09 B;  4FAV D;  2H6K A;  5EAL A;  1PBY B;  1PI6 A;  4GMB A;  3BG0 A;  4BCD A;  4PSW B;  3K72 A;  3O4I A;  4LGN A;  4FB1 D;  3FRX A;  1N6E A;  2H13 A;  1SQ9 A;  4U1E I;  4K3I D;  3BG1 A;  4FAN D;  3JZG A;  2OJY A;  5AFU 3;  3DXK C;  2CN2 A;  5I5M A;  5GSA A;  2EIE A;  4JHN A;  1P22 A;  3FM0 A;  5K19 A;  5EMJ B;  3RSE C;  4A7J A;  1VE6 A;  3V7D B;  3ZDY A;  3F3F A;  5IGQ A;  1C9I A;  4A0A A;  2VZ3 A;  3SHF A;  1GG2 B;  1PGU A;  4AEZ A;  3PVU B;  5FLX g;  3PXW D;  3A0F A;  3I89 A;  5FKR A;  3J80 g;  3MVD K;  2HJB A;  2XYI A;  3IJE A;  4BL0 A;  2B5M A;  2VZ1 A;  3IUQ A;  3SJL D;  1E5T A;  1SHY B;  3AL8 B;  3EQ7 A;  2VDM A;  1VZ2 A;  1FWX A;  5FQD A;  3JAM g;  2H9P A;  2CO0 C;  4G1E A;  4Y7R A;  2IWK A;  5M5T A;  3GD1 I;  2PM7 B;  3ODT A;  3OW8 A;  4HDJ A;  4QQE A;  3EWE A;  3VI4 A;  3E0C A;  1MG2 A;  1C9L A;  2I3T A;  4E5Z A;  1N6D A;  1MG3 A;  4Z7Q A;  4ESG A;  1BPO A;  2I0T A;  5H14 A;  4JT6 C;  3L4O D;  3DDU A;  5A2Q g;  3OL2 A;  1B9Y A;  2IUV A;  1TYQ C;  1R5M A;  3UVK A;  3DXM C;  4J73 A;  4A08 B;  2G9A A;  3AH8 B;  3I7O A;  4JSN C;  4MMX A;  4OWR A;  5EMM B;  1XKS A;  2EIC A;  5C92 A;  5GXH A;  4J0X A;  4AN0 A;  3F3G A;  5EMK B;  3SCY A;  5E6U A;  4TZ4 A;  1JV2 A;  3OTT A;  1MDA H;  4U7A A;  4RE5 A;  4J8B A;  2OK6 A;  4Z7N A;  4BP8 A;  2HKM A;  3EI3 A;  4RE6 A;  1JMZ B;  4CY5 A;  4EWR A;  2HES X;  3AFC A;  3I2N A;  4NEN A;  2H3X A;  3NVN A;  3UVO A;  1QFS A;  3EI4 B;  4J77 A;  3JZH A;  4J87 A;  3MKS B;  4JHP C;  2P9S C;  3PSC B;  4GGD A;  5FA5 B;  2XDW A;  1H2Y A;  5HE1 B;  3C75 H;  5KDO B;  3PXS D;  3ZDX A;  4ERQ A;  1S4U X;  2GC4 A; 
#chains in the Genus database with same CATH homology
 1A12 A;  4O2W A;  3QHY B;  3KCI A;  4DNW A;  4NC4 A;  3MVD K;  1I2M B;  4NAA A;  4L1M A;  3QI0 A;  3OF7 A;  1JTD B;  4DNU A;  4JHP C;  4DNV A;  4JHN A;  4D9S A;  4QAM A;  4NBM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...