1A12A

Regulator of chromosome condensation (rcc1) of human
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
401
structure length
401
Chain Sequence
KKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 1.7 A crystal structure of the regulator of chromosome condensation (RCC1) reveals a seven-bladed propeller.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Guanine nucleotide exchange factor
molecule keywords REGULATOR OF CHROMOSOME CONDENSATION 1
total genus 106
structure length 401
sequence length 401
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1997-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.30 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein II 1a12A00
3MVDK 4QAMA 4DNUA 1A12A 4O2WA 4JHPC 4L1MA 1I2MB 4JHNA 3QI0A 3KCIA 4NC4A 1JTDB 4NBMA 4D9SA 4DNWA 4DNVA 3QHYB 4NAAA 3OF7A
chains in the Genus database with same CATH superfamily
1K3IA 3EU7A 5IJ7E 3I7NA 4JT6C 2BCJB 1PI6A 3V9FA 3ZDZA 5IC7A 4FA9D 4HDJA 4AEZA 3FM0A 4GMBA 3FRXA 1SHYB 3SVWD 1C9IA 3IJ1A 5CXCA 5M5SA 4PBYA 4CZYA 2B4EA 3EI2A 5TDHB 4A2LA 5HYNB 2PM7B 5IGQA 3EI4A 5M5UA 3DXMC 2P9UC 2AH1A 2QXVA 4BCBA 4DNVA 2VDOA 4CI3A 3KRXB 4A0AB 2UZYB 4Y5RD 3DXKC 2XYIA 1R5MA 2G9AA 1JOFA 4O45A 3V5WB 4A0BB 2G99A 1N6FA 1N6DA 3PSLA 4GM8A 5C9ZB 2P9KC 2OVRB 1JJUB 1SQJA 4KFMB 5K19A 5HE3B 4Z7NA 3OF7A 3EG6A 4G1EA 5EARA 4BP8A 2H9PA 2B5LA 3CIKB 2EICA 1UOPA 3AL8B 3C99A 3NVXA 1UOQA 2VDLA 3PXTD 2IWKA 1VZ2A 2UZXB 3BG1A 3PE7A 3C5MA 1VE6A 1E8NA 4J77A 3UKRC 3J80g 2XU7A 2W18A 3K6SA 2HESX 2CE8A 4LG8A 4NENA 4XEIC 5CYKB 5C2WB 3IUJA 5K1CC 5M5TA 5HE2B 2QR5A 5CYKA 2VDNA 3L4MD 1VZ3A 4GGCA 2AQ5A 4RE5A 4L3HD 4PNKB 3I7OA 3IJCA 2VDMA 3I8CA 2GNQA 4JD2C 5AFU3 1MG2A 3F3PA 2CN2A 4AMYA 3JZGA 4CI1A 2XDWA 4A08A 5FKRA 3DDUA 4YVDA 3RN0D 4ERQA 4CY2A 3RN1D 3F3GA 3ZDXA 3ZWLB 3OKWA 4PBZA 3IJ0A 3MMYA 2OVQB 1S4UX 3UVNA 4FWWA 3O4GA 3AL8A 3SHFA 4GQ1A 3T3PA 4J0WA 3SCYA 2H14A 5EMMB 5GXHA 2OK4A 5C86A 3PXWD 4IMMA 1RI6A 2IUPA 4A08B 5TF2A 4X63B 3MUOA 2HJ4A 4X60B 2WQ8A 3MZLA 4X61B 1GOGA 4LGNA 3HFQA 3I7LA 3MKQA 2H9LA 4GM9A 1MG3A 4J81A 1H2WA 3SWSD 5A2Qg 3I7PA 3UR4A 5C2VB 4X3EA 4QQEA 2CE9A 3K27A 1GOFA 3JB9L 4MK0B 4MMZA 4CZXA 3JZNA 5H1MA 3J81g 3IIWA 4Z8LA 1PBYB 2PM9B 2J56H 5CXBA 4A11B 1K32A 2PM9A 2H9MA 2H6QA 5FFOA 4AN1A 2I0SA 4O3UB 4BH6A 4CC9A 1JV2A 4ERYA 4CY3A 5JWZA 3IJEA 3N0DA 3P4FA 5EALA 4J79A 1E5TA 1PGUA 1BPOA 2IAAA 3MXXA 3SLED 5TEEA 2MTAH 2HYEA 4J0XA 4UM9A 1GXRA 1UOOA 2H68A 2HU5A 4O9DA 1YFQA 1GG2B 5I5MA 1XIPA 2Q7QA 4QAMA 3E0CA 3MUNA 5FFGA 1Q47A 4AMZA 3V7DB 2CO0C 3DSMA 4D0KA 1YR2A 2I0RA 5EM2A 4N14A 5EM2B 2B5NA 3EI2B 4CI2A 3RRMC 3JPXA 5M61A 3NVNA 4JSXC 3NVQA 3W15A 4ZOYA 4QT8A 1OLZA 4D6VA 3GREA 2H3XA 3OKYA 4CZVA 4FB1D 2AGYA 3OKYB 1XHMA 4GGDA 4BCDA 5FKTA 4EWRA 4MMXA 2AGZA 2CO0A 2AGXA 3I2NA 1VE7A 2B5MA 2YB8B 3O4IA 4J8GA 4L1QD 4GQBB 4NBMA 2I3SA 1U4CA 4DNUA 2OJYA 3RMZD 4H5JA 1FWXA 2VDPA 1NEXB 1VYHC 4PSWB 5EMKB 2H13A 4JHNA 4PXWA 3EI1A 4J86A 3JAMg 2OIZA 5E6SA 2P9PC 3DM0A 3EI1B 3IIYA 2I0TA 4JT5C 4O2WA 1JTDB 4IRZA 3DWLC 1U2VC 5GMKn 3CFSB 4GM3A 2OK6A 3I7KA 2HXCA 2Z2NA 2YNNA 3SMRA 4FA5D 5GXIA 3OL2A 2BKLA 4NSXA 3MZKA 3UKUC 4J73A 4J87A 5FKQA 3KRWB 4O1QD 4WK2A 4CY5A 4BCCA 4Z7OA 4FA4D 2Z2OA 4Y7RA 1M1XA 2VZ3A 3NIGA 4DNWA 2EIDA 2VZ1A 3GD1I 4ZOVA 5EAPA 2P9SC 3K26A 4OWRA 1MDAH 1O6FA 4AX4A 2XL2A 3VA6A 3L4OD 4A09B 5I5JA 3C75H 3UVOA 3RLMD 2I3TA 4A09A 2EIBA 3ZE0A 4K3ID 4GQ2P 3JRPA 4G55A 4U7AA 4A7JA 3B7FA 1P22A 3EI3B 3IKOA 4WK0A 2J55H 1I2MB 4FAND 3NIDA 2YBAA 4J82A 3UVMA 3SBRA 4E54B 4G1MA 2IUVA 3RSEC 4E54A 5IJ8E 3ZE1A 4A2MA 4G56B 4ES0A 1H2XA 3FCSA 4OZUA 5M5RA 5E6UA 1U8CA 3IVMA 4UM8A 3SN6B 4ZOXA 1UTCA 2CN3A 2P9LC 5SXMA 4E5ZA 1NR0A 4E5ZB 5HE0B 2P9IC 1E8MA 3AH8B 3K72A 3JZHA 3V4VA 4O02A 2H6KA 3A0FA 2QZPA 2YNPA 5IGOA 4A0BA 2Z2PA 4JSVC 4IA9A 3OTTA 5H14A 3SBQA 4XYHA 4UI9R 2J57G 2VDQA 3GFCA 5HE1B 1TYQC 4JHPC 4AOWA 3IUMA 5EMLB 2TRCB 3SBPA 1QFSA 3ZE2A 3JROA 1O6GA 2GC7A 3CFVA 3EQ8A 2XL3A 3ULEC 3I8EA 4J84A 4PC0A 2PM6B 5I5IA 1C9LA 4I79A 2OVPB 3VI3A 3ORVD 5HQGA 2P9NC 4K3JB 3KCIA 3GC3B 3EQ7A 1QFMA 2H47A 4J78A 3RFHA 1JMXB 5THAA 5FKSA 5M5VA 5EAMA 1B9XA 2PBIB 3BWSA 3QHYB 2VDKA 3EWEA 3SJLD 3F3FA 3SFZA 2BBKH 3PVWB 1QNIA 4U1EI 4ESGA 2EIEA 1GOHA 2AGWA 3UVLA 1OMWB 1SQ9A 5B4WA 4JSPC 4L1MA 4BL0A 5FLXg 3V4PA 2IWFA 2HU8A 2GC4A 5IT9g 2H6NA 4RE6A 1TBGA 4BP9A 5HDBA 3O4JA 4L3GD 3MKSB 3I89A 2AH0A 1L0QA 4QRJA 2VDRA 3IUNA 2VC2A 4L9OA 5AJAA 4Z7QA 1B9YA 3ODTA 4BUJC 2XZGA 1GOTB 3O4HA 1ERJA 3T3MA 3IUQA 3PSCB 3K71A 1A0RB 3VGZA 3MVDK 3SXTD 3I7HA 1N6EA 4D9SA 3EMHA 3OW8A 4NAAA 4QL1A 1GP2B 2EBSA 4JXMA 3PVUB 1JMZB 4R7AB 4CI8A 4FAVD 4LG9A 2AGLA 3VI4A 4GZ8A 5CXCB 5C92A 1XKSA 5KDOB 5EMJB 2HU7A 3EQ9A 5CXBB 4A11A 5H17A 3RFGA 2IUQA 3AL9A 3AFCA 3IULA 3UVKA 1K8KC 2IURA 4FHLA 4TZ4A 2JKXA 1PEVA 4WJKA 4AN0A 2CNXA 4CY1A 4ERZA 3OL2B 2XE4A 3FCUA 4A0AA 2YNOA 3ZDYA 3PXSD 5FXYA 3VH0A 2HKRA 5FA5B 2O9KA 1A12A 4H5IA 4XYIA 3NIFA 3QI0A 4MMYA 4PSXB 4ZN4A 3OKTA 2QC5A 5TEFA 3EI4B 5GSAA 3N0EA 2HJBA 1H2ZA 3BG0A 3C9CA 4J8BA 5AMSA 1TYEA 4WK4A 4JSNC 1T2XA 1L5GA 2HKMA 2YMUA 2H9NA 1H2YA 3IURA 5FQDA 5E6RA 4NC4A 4O3TB 4GGAA 4FA1D 3U4YA 3EI3A 3FGBA 4ZOZA
chains in the Genus database with same CATH topology
3MVDK 4QAMA 4DNUA 1A12A 4O2WA 4JHPC 4L1MA 1I2MB 4JHNA 3QI0A 3KCIA 4NC4A 1JTDB 4NBMA 4D9SA 4DNWA 4DNVA 3QHYB 4NAAA 3OF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MVD K;  4QAM A;  4DNU A;  1A12 A;  4O2W A;  4JHP C;  4L1M A;  1I2M B;  4JHN A;  3QI0 A;  3KCI A;  4NC4 A;  1JTD B;  4NBM A;  4D9S A;  4DNW A;  4DNV A;  3QHY B;  4NAA A;  3OF7 A; 
#chains in the Genus database with same CATH topology
 1K3I A;  3EU7 A;  5IJ7 E;  3I7N A;  4JT6 C;  2BCJ B;  1PI6 A;  3V9F A;  3ZDZ A;  5IC7 A;  4FA9 D;  4HDJ A;  4AEZ A;  3FM0 A;  4GMB A;  3FRX A;  1SHY B;  3SVW D;  1C9I A;  3IJ1 A;  5CXC A;  5M5S A;  4PBY A;  4CZY A;  2B4E A;  3EI2 A;  5TDH B;  4A2L A;  5HYN B;  2PM7 B;  5IGQ A;  3EI4 A;  5M5U A;  3DXM C;  2P9U C;  2AH1 A;  2QXV A;  4BCB A;  4DNV A;  2VDO A;  4CI3 A;  3KRX B;  4A0A B;  2UZY B;  4Y5R D;  3DXK C;  2XYI A;  1R5M A;  2G9A A;  1JOF A;  4O45 A;  3V5W B;  4A0B B;  2G99 A;  1N6F A;  1N6D A;  3PSL A;  4GM8 A;  5C9Z B;  2P9K C;  2OVR B;  1JJU B;  1SQJ A;  4KFM B;  5K19 A;  5HE3 B;  4Z7N A;  3OF7 A;  3EG6 A;  4G1E A;  5EAR A;  4BP8 A;  2H9P A;  2B5L A;  3CIK B;  2EIC A;  1UOP A;  3AL8 B;  3C99 A;  3NVX A;  1UOQ A;  2VDL A;  3PXT D;  2IWK A;  1VZ2 A;  2UZX B;  3BG1 A;  3PE7 A;  3C5M A;  1VE6 A;  1E8N A;  4J77 A;  3UKR C;  3J80 g;  2XU7 A;  2W18 A;  3K6S A;  2HES X;  2CE8 A;  4LG8 A;  4NEN A;  4XEI C;  5CYK B;  5C2W B;  3IUJ A;  5K1C C;  5M5T A;  5HE2 B;  2QR5 A;  5CYK A;  2VDN A;  3L4M D;  1VZ3 A;  4GGC A;  2AQ5 A;  4RE5 A;  4L3H D;  4PNK B;  3I7O A;  3IJC A;  2VDM A;  3I8C A;  2GNQ A;  4JD2 C;  5AFU 3;  1MG2 A;  3F3P A;  2CN2 A;  4AMY A;  3JZG A;  4CI1 A;  2XDW A;  4A08 A;  5FKR A;  3DDU A;  4YVD A;  3RN0 D;  4ERQ A;  4CY2 A;  3RN1 D;  3F3G A;  3ZDX A;  3ZWL B;  3OKW A;  4PBZ A;  3IJ0 A;  3MMY A;  2OVQ B;  1S4U X;  3UVN A;  4FWW A;  3O4G A;  3AL8 A;  3SHF A;  4GQ1 A;  3T3P A;  4J0W A;  3SCY A;  2H14 A;  5EMM B;  5GXH A;  2OK4 A;  5C86 A;  3PXW D;  4IMM A;  1RI6 A;  2IUP A;  4A08 B;  5TF2 A;  4X63 B;  3MUO A;  2HJ4 A;  4X60 B;  2WQ8 A;  3MZL A;  4X61 B;  1GOG A;  4LGN A;  3HFQ A;  3I7L A;  3MKQ A;  2H9L A;  4GM9 A;  1MG3 A;  4J81 A;  1H2W A;  3SWS D;  5A2Q g;  3I7P A;  3UR4 A;  5C2V B;  4X3E A;  4QQE A;  2CE9 A;  3K27 A;  1GOF A;  3JB9 L;  4MK0 B;  4MMZ A;  4CZX A;  3JZN A;  5H1M A;  3J81 g;  3IIW A;  4Z8L A;  1PBY B;  2PM9 B;  2J56 H;  5CXB A;  4A11 B;  1K32 A;  2PM9 A;  2H9M A;  2H6Q A;  5FFO A;  4AN1 A;  2I0S A;  4O3U B;  4BH6 A;  4CC9 A;  1JV2 A;  4ERY A;  4CY3 A;  5JWZ A;  3IJE A;  3N0D A;  3P4F A;  5EAL A;  4J79 A;  1E5T A;  1PGU A;  1BPO A;  2IAA A;  3MXX A;  3SLE D;  5TEE A;  2MTA H;  2HYE A;  4J0X A;  4UM9 A;  1GXR A;  1UOO A;  2H68 A;  2HU5 A;  4O9D A;  1YFQ A;  1GG2 B;  5I5M A;  1XIP A;  2Q7Q A;  4QAM A;  3E0C A;  3MUN A;  5FFG A;  1Q47 A;  4AMZ A;  3V7D B;  2CO0 C;  3DSM A;  4D0K A;  1YR2 A;  2I0R A;  5EM2 A;  4N14 A;  5EM2 B;  2B5N A;  3EI2 B;  4CI2 A;  3RRM C;  3JPX A;  5M61 A;  3NVN A;  4JSX C;  3NVQ A;  3W15 A;  4ZOY A;  4QT8 A;  1OLZ A;  4D6V A;  3GRE A;  2H3X A;  3OKY A;  4CZV A;  4FB1 D;  2AGY A;  3OKY B;  1XHM A;  4GGD A;  4BCD A;  5FKT A;  4EWR A;  4MMX A;  2AGZ A;  2CO0 A;  2AGX A;  3I2N A;  1VE7 A;  2B5M A;  2YB8 B;  3O4I A;  4J8G A;  4L1Q D;  4GQB B;  4NBM A;  2I3S A;  1U4C A;  4DNU A;  2OJY A;  3RMZ D;  4H5J A;  1FWX A;  2VDP A;  1NEX B;  1VYH C;  4PSW B;  5EMK B;  2H13 A;  4JHN A;  4PXW A;  3EI1 A;  4J86 A;  3JAM g;  2OIZ A;  5E6S A;  2P9P C;  3DM0 A;  3EI1 B;  3IIY A;  2I0T A;  4JT5 C;  4O2W A;  1JTD B;  4IRZ A;  3DWL C;  1U2V C;  5GMK n;  3CFS B;  4GM3 A;  2OK6 A;  3I7K A;  2HXC A;  2Z2N A;  2YNN A;  3SMR A;  4FA5 D;  5GXI A;  3OL2 A;  2BKL A;  4NSX A;  3MZK A;  3UKU C;  4J73 A;  4J87 A;  5FKQ A;  3KRW B;  4O1Q D;  4WK2 A;  4CY5 A;  4BCC A;  4Z7O A;  4FA4 D;  2Z2O A;  4Y7R A;  1M1X A;  2VZ3 A;  3NIG A;  4DNW A;  2EID A;  2VZ1 A;  3GD1 I;  4ZOV A;  5EAP A;  2P9S C;  3K26 A;  4OWR A;  1MDA H;  1O6F A;  4AX4 A;  2XL2 A;  3VA6 A;  3L4O D;  4A09 B;  5I5J A;  3C75 H;  3UVO A;  3RLM D;  2I3T A;  4A09 A;  2EIB A;  3ZE0 A;  4K3I D;  4GQ2 P;  3JRP A;  4G55 A;  4U7A A;  4A7J A;  3B7F A;  1P22 A;  3EI3 B;  3IKO A;  4WK0 A;  2J55 H;  1I2M B;  4FAN D;  3NID A;  2YBA A;  4J82 A;  3UVM A;  3SBR A;  4E54 B;  4G1M A;  2IUV A;  3RSE C;  4E54 A;  5IJ8 E;  3ZE1 A;  4A2M A;  4G56 B;  4ES0 A;  1H2X A;  3FCS A;  4OZU A;  5M5R A;  5E6U A;  1U8C A;  3IVM A;  4UM8 A;  3SN6 B;  4ZOX A;  1UTC A;  2CN3 A;  2P9L C;  5SXM A;  4E5Z A;  1NR0 A;  4E5Z B;  5HE0 B;  2P9I C;  1E8M A;  3AH8 B;  3K72 A;  3JZH A;  3V4V A;  4O02 A;  2H6K A;  3A0F A;  2QZP A;  2YNP A;  5IGO A;  4A0B A;  2Z2P A;  4JSV C;  4IA9 A;  3OTT A;  5H14 A;  3SBQ A;  4XYH A;  4UI9 R;  2J57 G;  2VDQ A;  3GFC A;  5HE1 B;  1TYQ C;  4JHP C;  4AOW A;  3IUM A;  5EML B;  2TRC B;  3SBP A;  1QFS A;  3ZE2 A;  3JRO A;  1O6G A;  2GC7 A;  3CFV A;  3EQ8 A;  2XL3 A;  3ULE C;  3I8E A;  4J84 A;  4PC0 A;  2PM6 B;  5I5I A;  1C9L A;  4I79 A;  2OVP B;  3VI3 A;  3ORV D;  5HQG A;  2P9N C;  4K3J B;  3KCI A;  3GC3 B;  3EQ7 A;  1QFM A;  2H47 A;  4J78 A;  3RFH A;  1JMX B;  5THA A;  5FKS A;  5M5V A;  5EAM A;  1B9X A;  2PBI B;  3BWS A;  3QHY B;  2VDK A;  3EWE A;  3SJL D;  3F3F A;  3SFZ A;  2BBK H;  3PVW B;  1QNI A;  4U1E I;  4ESG A;  2EIE A;  1GOH A;  2AGW A;  3UVL A;  1OMW B;  1SQ9 A;  5B4W A;  4JSP C;  4L1M A;  4BL0 A;  5FLX g;  3V4P A;  2IWF A;  2HU8 A;  2GC4 A;  5IT9 g;  2H6N A;  4RE6 A;  1TBG A;  4BP9 A;  5HDB A;  3O4J A;  4L3G D;  3MKS B;  3I89 A;  2AH0 A;  1L0Q A;  4QRJ A;  2VDR A;  3IUN A;  2VC2 A;  4L9O A;  5AJA A;  4Z7Q A;  1B9Y A;  3ODT A;  4BUJ C;  2XZG A;  1GOT B;  3O4H A;  1ERJ A;  3T3M A;  3IUQ A;  3PSC B;  3K71 A;  1A0R B;  3VGZ A;  3MVD K;  3SXT D;  3I7H A;  1N6E A;  4D9S A;  3EMH A;  3OW8 A;  4NAA A;  4QL1 A;  1GP2 B;  2EBS A;  4JXM A;  3PVU B;  1JMZ B;  4R7A B;  4CI8 A;  4FAV D;  4LG9 A;  2AGL A;  3VI4 A;  4GZ8 A;  5CXC B;  5C92 A;  1XKS A;  5KDO B;  5EMJ B;  2HU7 A;  3EQ9 A;  5CXB B;  4A11 A;  5H17 A;  3RFG A;  2IUQ A;  3AL9 A;  3AFC A;  3IUL A;  3UVK A;  1K8K C;  2IUR A;  4FHL A;  4TZ4 A;  2JKX A;  1PEV A;  4WJK A;  4AN0 A;  2CNX A;  4CY1 A;  4ERZ A;  3OL2 B;  2XE4 A;  3FCU A;  4A0A A;  2YNO A;  3ZDY A;  3PXS D;  5FXY A;  3VH0 A;  2HKR A;  5FA5 B;  2O9K A;  1A12 A;  4H5I A;  4XYI A;  3NIF A;  3QI0 A;  4MMY A;  4PSX B;  4ZN4 A;  3OKT A;  2QC5 A;  5TEF A;  3EI4 B;  5GSA A;  3N0E A;  2HJB A;  1H2Z A;  3BG0 A;  3C9C A;  4J8B A;  5AMS A;  1TYE A;  4WK4 A;  4JSN C;  1T2X A;  1L5G A;  2HKM A;  2YMU A;  2H9N A;  1H2Y A;  3IUR A;  5FQD A;  5E6R A;  4NC4 A;  4O3T B;  4GGA A;  4FA1 D;  3U4Y A;  3EI3 A;  3FGB A;  4ZOZ A; 
#chains in the Genus database with same CATH homology
 3MVD K;  4QAM A;  4DNU A;  1A12 A;  4O2W A;  4JHP C;  4L1M A;  1I2M B;  4JHN A;  3QI0 A;  3KCI A;  4NC4 A;  1JTD B;  4NBM A;  4D9S A;  4DNW A;  4DNV A;  3QHY B;  4NAA A;  3OF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...