1A12A

Regulator of chromosome condensation (rcc1) of human
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
401
structure length
401
Chain Sequence
KKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Guanine nucleotide exchange factor
molecule keywords REGULATOR OF CHROMOSOME CONDENSATION 1
publication title The 1.7 A crystal structure of the regulator of chromosome condensation (RCC1) reveals a seven-bladed propeller.
pubmed doi rcsb
source organism Homo sapiens
total genus 106
structure length 401
sequence length 401
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1997-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.30 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein II 1a12A00
4NC4A 1I2MB 4JHNA 4DNWA 4NBMA 3KCIA 4DNUA 4QAMA 4JHPC 4O2WA 4D9SA 3QHYB 3OF7A 1JTDB 4NAAA 4L1MA 4DNVA 3QI0A 3MVDK 1A12A
chains in the Genus database with same CATH superfamily
1PI6A 4ES0A 3CFVA 2HU5A 3IUJA 1L0QA 4X61B 5FKQA 1R5MA 4DNWA 2AGLA 3I7LA 4J87A 4A0AB 4G55A 4FWWA 2B5NA 3NIGA 4JSXC 4A0BB 2IURA 3C75H 5C2VB 3PSLA 3GD1I 5IGOA 5I5IA 4GQ1A 3RSEC 5E6RA 5FLXg 2VDLA 2XU7A 3O4GA 2H13A 4NENA 4N14A 3UVMA 5IC7A 2P9PC 3EQ9A 2H9LA 3OKYB 4J8GA 4G1EA 3EQ7A 5B4WA 5AFU3 4E54B 5GXIA 3ULEC 4K3JB 2H6QA 2P9LC 3N0DA 4A0AA 5EAPA 2AQ5A 4CY2A 5FQDA 2J55H 3RRMC 2H47A 2VDMA 4A2LA 4BCDA 2IWKA 2MTAH 2VDKA 4CY1A 1MG2A 4J81A 2IAAA 1C9IA 2XYIA 2H14A 4J0XA 4PC0A 3JAMg 4LG8A 3A0FA 3VGZA 3VI3A 3F3FA 2CE8A 4PBYA 3J81g 3EI2A 1SQJA 3IJ0A 4J84A 3JZGA 4NC4A 2OJYA 1SQ9A 5CXBA 5EMKB 3I2NA 4K3ID 3RN0D 3PSCB 5JWZA 3EQ8A 4FA1D 4CY3A 1NEXB 4XYHA 3ZDYA 4J8BA 5HDBA 4O1QD 5M5SA 2OK4A 2VDPA 1GOHA 3UVNA 4MMZA 4ZOYA 1O6GA 4WK0A 4FAND 5EMLB 5CYKB 2YNNA 4J73A 2QZPA 3DM0A 3PE7A 4IRZA 4FA9D 4WK2A 5EMJB 1A12A 1K32A 3BG0A 3PXSD 5M5UA 3B7FA 2AGXA 2BBKH 2AGZA 4WJKA 3RN1D 3UVLA 4D6VA 3K6SA 3KRXB 3I7PA 5EM2B 2OVRB 3SBPA 4I79A 2XL3A 1GOGA 4PNKB 3CFSB 4BP9A 5FKRA 2EIBA 4AX4A 3MUOA 2IWFA 4X63B 3DXKC 4ZOZA 4J77A 1O6FA 3K72A 4AOWA 4Z7NA 3V4PA 4DNVA 4ERZA 2VDQA 3EWEA 4O3UB 3BWSA 5HE3B 4BCBA 3EI4B 2CO0A 3JRPA 3UKRC 3F3PA 2H9MA 2VZ1A 4A2MA 5C86A 4H5IA 1JV2A 1MG3A 4E5ZA 2H3XA 4IA9A 1XIPA 2BKLA 1S4UX 4GM8A 3I7HA 2CE9A 5HE0B 4GGDA 3UVKA 4TZ4A 1TBGA 5EM2A 3KRWB 2TRCB 4O2WA 5I5JA 2EIEA 4ERYA 2YNOA 2VDOA 2J56H 4PBZA 1A0RB 2IUQA 3AL8B 4Y5RD 4QL1A 3ODTA 2OVPB 3SXTD 1NR0A 4MMYA 3UVOA 4R7AB 4U7AA 3SVWD 4G1MA 3C5MA 4O3TB 4XEIC 3PXTD 1GP2B 2OVQB 2VDRA 2WQ8A 1QFSA 5FA5B 3OL2B 5HQGA 2O9KA 3ZDZA 1H2XA 3IIYA 3NIDA 4L9OA 5HYNB 2CNXA 5H1MA 3O4JA 3C99A 5EALA 1N6FA 4ESGA 1H2ZA 1BPOA 1B9YA 3EI1B 4A08B 2AH1A 2HU8A 5M5TA 4JHNA 3K26A 4GZ8A 2VZ3A 2JKXA 4LG9A 5FFGA 4FA4D 5CXCB 4A0BA 4Z8LA 3IIWA 4WK4A 1JTDB 2PM6B 4AN1A 5A2Qg 3I8EA 1TYQC 1JMXB 3V4VA 4FHLA 3OW8A 3HFQA 1U8CA 3JPXA 3OKYA 2AH0A 1PBYB 3V9FA 5E6UA 4E54A 1UOPA 5TEFA 3EU7A 3JROA 3SBQA 4JHPC 3IKOA 2H9PA 4O02A 4J79A 4KFMB 2W18A 4CC9A 2B5LA 3ZE2A 5CXCA 5IGQA 1H2YA 2HJ4A 2EICA 4JD2C 5TF2A 5KDOB 1RI6A 3JZNA 5C92A 1Q47A 3L4MD 3FM0A 1VZ3A 4AEZA 3DXMC 4L1QD 4UM9A 5FKTA 3DDUA 1SHYB 3U4YA 2P9NC 5M5RA 3UKUC 4GQBB 3ZDXA 1E8MA 2UZXB 3K71A 5EMMB 3RFHA 3SMRA 5H14A 1H2WA 2I0TA 4QT8A 3RLMD 3V7DB 3JZHA 4JT6C 3NVQA 3EMHA 3ZE1A 3IULA 5CYKA 4GM9A 2QC5A 3O4HA 1JOFA 4MK0B 2PM7B 3I7KA 1U4CA 3I7NA 1VE6A 1UTCA 3I7OA 2IUPA 5SXMA 4JSPC 3EI3B 4FB1D 5FKSA 2P9KC 1T2XA 1YFQA 1ERJA 2B5MA 2BCJB 2HXCA 4H5JA 1K3IA 2OK6A 3FCSA 3IJCA 3GFCA 5GSAA 5GMKn 4D9SA 3CIKB 3L4OD 1GXRA 1VZ2A 3AFCA 1VYHC 3OF7A 3SHFA 3BG1A 2EBSA 3UR4A 2QR5A 3GC3B 2AGWA 4OZUA 2Z2NA 4O9DA 5GXHA 3ZWLB 2AGYA 2UZYB 2H9NA 3EI4A 2HESX 2PBIB 3AH8B 3EI3A 4RE6A 3SWSD 4BP8A 4HDJA 4ERQA 3KCIA 2H6NA 5C2WB 1E8NA 3FRXA 3SN6B 4EWRA 4CI8A 3I89A 3DWLC 4OWRA 4PSWB 3PVWB 3QI0A 3FGBA 5HE2B 2CN3A 3AL8A 1E5TA 1MDAH 1N6DA 4MMXA 4X3EA 4L3GD 2IUVA 1YR2A 1JMZB 2OIZA 3MKQA 4Z7OA 1I2MB 3NIFA 4CI1A 4ZN4A 2HU7A 1PGUA 2H68A 3FCUA 4X60B 3IURA 5IJ7E 1K8KC 2CN2A 3OL2A 5H17A 1C9LA 2B4EA 3IVMA 3I8CA 3PXWD 4U1EI 2YMUA 4BH6A 4BCCA 4CZYA 4GGCA 4CI2A 5K1CC 1VE7A 3EI2B 5THAA 3IUNA 5IT9g 3MZLA 3ZE0A 3NVXA 1B9XA 2HKMA 2P9IC 3V5WB 3EG6A 5CXBB 4O45A 3SCYA 4J0WA 5TDHB 4CZXA 4UI9R 3EI1A 4FAVD 4A08A 1JJUB 3OKTA 5FFOA 4GGAA 4J86A 2CO0C 4DNUA 1QNIA 4A09B 2XL2A 3IUMA 1UOOA 2GNQA 4J78A 2I3TA 3SFZA 3N0EA 2P9UC 2I0SA 2GC7A 4JT5C 1P22A 3NVNA 3GREA 2H6KA 1OLZA 3MVDK 3RMZD 4L3HD 4PSXB 1XKSA 4JSVC 5AJAA 4AN0A 2XDWA 3MKSB 4GM3A 3E0CA 5TEEA 3SBRA 3SLED 1L5GA 3MXXA 3PVUB 2G99A 4G56B 4CY5A 4PXWA 4QAMA 2Q7QA 4A11B 2XZGA 4A09A 2PM9B 1QFMA 3W15A 2VC2A 4QQEA 5I5MA 3F3GA 3VI4A 4FA5D 3SJLD 4L1MA 1M1XA 3T3MA 5FXYA 2HKRA 2VDNA 1GG2B 4CZVA 5AMSA 4E5ZB 3AL9A 2QXVA 2Z2PA 5M5VA 3OTTA 4ZOVA 4CI3A 1PEVA 4GMBA 3ORVD 4A11A 3K27A 3OKWA 2PM9A 4Y7RA 4YVDA 5IJ8E 1UOQA 5HE1B 4LGNA 1GOFA 4AMYA 1GOTB 1U2VC 3RFGA 3IUQA 4NSXA 2Z2OA 4NAAA 3T3PA 4J82A 3VH0A 5C9ZB 5K19A 3DSMA 3VA6A 5EAMA 2YNPA 2GC4A 4UM8A 4A7JA 1XHMA 2G9AA 2I0RA 2HYEA 2I3SA 3IJ1A 2J57G 3C9CA 3J80g 2P9SC 1OMWB 4JXMA 3MUNA 5M61A 4IMMA 4ZOXA 4NBMA 4JSNC 4AMZA 2EIDA 3IJEA 3O4IA 2HJBA 4D0KA 2YBAA 5EARA 3QHYB 2YB8B 5E6SA 4Z7QA 4RE5A 4XYIA 2XE4A 4GQ2P 3MMYA 3P4FA 4QRJA 3JB9L 1TYEA 4BL0A 4BUJC 3MZKA 1N6EA 1FWXA
chains in the Genus database with same CATH topology
4NC4A 1I2MB 4JHNA 4DNWA 4NBMA 3KCIA 4DNUA 4QAMA 4JHPC 4O2WA 4D9SA 3QHYB 3OF7A 1JTDB 4NAAA 4L1MA 4DNVA 3QI0A 3MVDK 1A12A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NC4 A;  1I2M B;  4JHN A;  4DNW A;  4NBM A;  3KCI A;  4DNU A;  4QAM A;  4JHP C;  4O2W A;  4D9S A;  3QHY B;  3OF7 A;  1JTD B;  4NAA A;  4L1M A;  4DNV A;  3QI0 A;  3MVD K;  1A12 A; 
#chains in the Genus database with same CATH topology
 1PI6 A;  4ES0 A;  3CFV A;  2HU5 A;  3IUJ A;  1L0Q A;  4X61 B;  5FKQ A;  1R5M A;  4DNW A;  2AGL A;  3I7L A;  4J87 A;  4A0A B;  4G55 A;  4FWW A;  2B5N A;  3NIG A;  4JSX C;  4A0B B;  2IUR A;  3C75 H;  5C2V B;  3PSL A;  3GD1 I;  5IGO A;  5I5I A;  4GQ1 A;  3RSE C;  5E6R A;  5FLX g;  2VDL A;  2XU7 A;  3O4G A;  2H13 A;  4NEN A;  4N14 A;  3UVM A;  5IC7 A;  2P9P C;  3EQ9 A;  2H9L A;  3OKY B;  4J8G A;  4G1E A;  3EQ7 A;  5B4W A;  5AFU 3;  4E54 B;  5GXI A;  3ULE C;  4K3J B;  2H6Q A;  2P9L C;  3N0D A;  4A0A A;  5EAP A;  2AQ5 A;  4CY2 A;  5FQD A;  2J55 H;  3RRM C;  2H47 A;  2VDM A;  4A2L A;  4BCD A;  2IWK A;  2MTA H;  2VDK A;  4CY1 A;  1MG2 A;  4J81 A;  2IAA A;  1C9I A;  2XYI A;  2H14 A;  4J0X A;  4PC0 A;  3JAM g;  4LG8 A;  3A0F A;  3VGZ A;  3VI3 A;  3F3F A;  2CE8 A;  4PBY A;  3J81 g;  3EI2 A;  1SQJ A;  3IJ0 A;  4J84 A;  3JZG A;  4NC4 A;  2OJY A;  1SQ9 A;  5CXB A;  5EMK B;  3I2N A;  4K3I D;  3RN0 D;  3PSC B;  5JWZ A;  3EQ8 A;  4FA1 D;  4CY3 A;  1NEX B;  4XYH A;  3ZDY A;  4J8B A;  5HDB A;  4O1Q D;  5M5S A;  2OK4 A;  2VDP A;  1GOH A;  3UVN A;  4MMZ A;  4ZOY A;  1O6G A;  4WK0 A;  4FAN D;  5EML B;  5CYK B;  2YNN A;  4J73 A;  2QZP A;  3DM0 A;  3PE7 A;  4IRZ A;  4FA9 D;  4WK2 A;  5EMJ B;  1A12 A;  1K32 A;  3BG0 A;  3PXS D;  5M5U A;  3B7F A;  2AGX A;  2BBK H;  2AGZ A;  4WJK A;  3RN1 D;  3UVL A;  4D6V A;  3K6S A;  3KRX B;  3I7P A;  5EM2 B;  2OVR B;  3SBP A;  4I79 A;  2XL3 A;  1GOG A;  4PNK B;  3CFS B;  4BP9 A;  5FKR A;  2EIB A;  4AX4 A;  3MUO A;  2IWF A;  4X63 B;  3DXK C;  4ZOZ A;  4J77 A;  1O6F A;  3K72 A;  4AOW A;  4Z7N A;  3V4P A;  4DNV A;  4ERZ A;  2VDQ A;  3EWE A;  4O3U B;  3BWS A;  5HE3 B;  4BCB A;  3EI4 B;  2CO0 A;  3JRP A;  3UKR C;  3F3P A;  2H9M A;  2VZ1 A;  4A2M A;  5C86 A;  4H5I A;  1JV2 A;  1MG3 A;  4E5Z A;  2H3X A;  4IA9 A;  1XIP A;  2BKL A;  1S4U X;  4GM8 A;  3I7H A;  2CE9 A;  5HE0 B;  4GGD A;  3UVK A;  4TZ4 A;  1TBG A;  5EM2 A;  3KRW B;  2TRC B;  4O2W A;  5I5J A;  2EIE A;  4ERY A;  2YNO A;  2VDO A;  2J56 H;  4PBZ A;  1A0R B;  2IUQ A;  3AL8 B;  4Y5R D;  4QL1 A;  3ODT A;  2OVP B;  3SXT D;  1NR0 A;  4MMY A;  3UVO A;  4R7A B;  4U7A A;  3SVW D;  4G1M A;  3C5M A;  4O3T B;  4XEI C;  3PXT D;  1GP2 B;  2OVQ B;  2VDR A;  2WQ8 A;  1QFS A;  5FA5 B;  3OL2 B;  5HQG A;  2O9K A;  3ZDZ A;  1H2X A;  3IIY A;  3NID A;  4L9O A;  5HYN B;  2CNX A;  5H1M A;  3O4J A;  3C99 A;  5EAL A;  1N6F A;  4ESG A;  1H2Z A;  1BPO A;  1B9Y A;  3EI1 B;  4A08 B;  2AH1 A;  2HU8 A;  5M5T A;  4JHN A;  3K26 A;  4GZ8 A;  2VZ3 A;  2JKX A;  4LG9 A;  5FFG A;  4FA4 D;  5CXC B;  4A0B A;  4Z8L A;  3IIW A;  4WK4 A;  1JTD B;  2PM6 B;  4AN1 A;  5A2Q g;  3I8E A;  1TYQ C;  1JMX B;  3V4V A;  4FHL A;  3OW8 A;  3HFQ A;  1U8C A;  3JPX A;  3OKY A;  2AH0 A;  1PBY B;  3V9F A;  5E6U A;  4E54 A;  1UOP A;  5TEF A;  3EU7 A;  3JRO A;  3SBQ A;  4JHP C;  3IKO A;  2H9P A;  4O02 A;  4J79 A;  4KFM B;  2W18 A;  4CC9 A;  2B5L A;  3ZE2 A;  5CXC A;  5IGQ A;  1H2Y A;  2HJ4 A;  2EIC A;  4JD2 C;  5TF2 A;  5KDO B;  1RI6 A;  3JZN A;  5C92 A;  1Q47 A;  3L4M D;  3FM0 A;  1VZ3 A;  4AEZ A;  3DXM C;  4L1Q D;  4UM9 A;  5FKT A;  3DDU A;  1SHY B;  3U4Y A;  2P9N C;  5M5R A;  3UKU C;  4GQB B;  3ZDX A;  1E8M A;  2UZX B;  3K71 A;  5EMM B;  3RFH A;  3SMR A;  5H14 A;  1H2W A;  2I0T A;  4QT8 A;  3RLM D;  3V7D B;  3JZH A;  4JT6 C;  3NVQ A;  3EMH A;  3ZE1 A;  3IUL A;  5CYK A;  4GM9 A;  2QC5 A;  3O4H A;  1JOF A;  4MK0 B;  2PM7 B;  3I7K A;  1U4C A;  3I7N A;  1VE6 A;  1UTC A;  3I7O A;  2IUP A;  5SXM A;  4JSP C;  3EI3 B;  4FB1 D;  5FKS A;  2P9K C;  1T2X A;  1YFQ A;  1ERJ A;  2B5M A;  2BCJ B;  2HXC A;  4H5J A;  1K3I A;  2OK6 A;  3FCS A;  3IJC A;  3GFC A;  5GSA A;  5GMK n;  4D9S A;  3CIK B;  3L4O D;  1GXR A;  1VZ2 A;  3AFC A;  1VYH C;  3OF7 A;  3SHF A;  3BG1 A;  2EBS A;  3UR4 A;  2QR5 A;  3GC3 B;  2AGW A;  4OZU A;  2Z2N A;  4O9D A;  5GXH A;  3ZWL B;  2AGY A;  2UZY B;  2H9N A;  3EI4 A;  2HES X;  2PBI B;  3AH8 B;  3EI3 A;  4RE6 A;  3SWS D;  4BP8 A;  4HDJ A;  4ERQ A;  3KCI A;  2H6N A;  5C2W B;  1E8N A;  3FRX A;  3SN6 B;  4EWR A;  4CI8 A;  3I89 A;  3DWL C;  4OWR A;  4PSW B;  3PVW B;  3QI0 A;  3FGB A;  5HE2 B;  2CN3 A;  3AL8 A;  1E5T A;  1MDA H;  1N6D A;  4MMX A;  4X3E A;  4L3G D;  2IUV A;  1YR2 A;  1JMZ B;  2OIZ A;  3MKQ A;  4Z7O A;  1I2M B;  3NIF A;  4CI1 A;  4ZN4 A;  2HU7 A;  1PGU A;  2H68 A;  3FCU A;  4X60 B;  3IUR A;  5IJ7 E;  1K8K C;  2CN2 A;  3OL2 A;  5H17 A;  1C9L A;  2B4E A;  3IVM A;  3I8C A;  3PXW D;  4U1E I;  2YMU A;  4BH6 A;  4BCC A;  4CZY A;  4GGC A;  4CI2 A;  5K1C C;  1VE7 A;  3EI2 B;  5THA A;  3IUN A;  5IT9 g;  3MZL A;  3ZE0 A;  3NVX A;  1B9X A;  2HKM A;  2P9I C;  3V5W B;  3EG6 A;  5CXB B;  4O45 A;  3SCY A;  4J0W A;  5TDH B;  4CZX A;  4UI9 R;  3EI1 A;  4FAV D;  4A08 A;  1JJU B;  3OKT A;  5FFO A;  4GGA A;  4J86 A;  2CO0 C;  4DNU A;  1QNI A;  4A09 B;  2XL2 A;  3IUM A;  1UOO A;  2GNQ A;  4J78 A;  2I3T A;  3SFZ A;  3N0E A;  2P9U C;  2I0S A;  2GC7 A;  4JT5 C;  1P22 A;  3NVN A;  3GRE A;  2H6K A;  1OLZ A;  3MVD K;  3RMZ D;  4L3H D;  4PSX B;  1XKS A;  4JSV C;  5AJA A;  4AN0 A;  2XDW A;  3MKS B;  4GM3 A;  3E0C A;  5TEE A;  3SBR A;  3SLE D;  1L5G A;  3MXX A;  3PVU B;  2G99 A;  4G56 B;  4CY5 A;  4PXW A;  4QAM A;  2Q7Q A;  4A11 B;  2XZG A;  4A09 A;  2PM9 B;  1QFM A;  3W15 A;  2VC2 A;  4QQE A;  5I5M A;  3F3G A;  3VI4 A;  4FA5 D;  3SJL D;  4L1M A;  1M1X A;  3T3M A;  5FXY A;  2HKR A;  2VDN A;  1GG2 B;  4CZV A;  5AMS A;  4E5Z B;  3AL9 A;  2QXV A;  2Z2P A;  5M5V A;  3OTT A;  4ZOV A;  4CI3 A;  1PEV A;  4GMB A;  3ORV D;  4A11 A;  3K27 A;  3OKW A;  2PM9 A;  4Y7R A;  4YVD A;  5IJ8 E;  1UOQ A;  5HE1 B;  4LGN A;  1GOF A;  4AMY A;  1GOT B;  1U2V C;  3RFG A;  3IUQ A;  4NSX A;  2Z2O A;  4NAA A;  3T3P A;  4J82 A;  3VH0 A;  5C9Z B;  5K19 A;  3DSM A;  3VA6 A;  5EAM A;  2YNP A;  2GC4 A;  4UM8 A;  4A7J A;  1XHM A;  2G9A A;  2I0R A;  2HYE A;  2I3S A;  3IJ1 A;  2J57 G;  3C9C A;  3J80 g;  2P9S C;  1OMW B;  4JXM A;  3MUN A;  5M61 A;  4IMM A;  4ZOX A;  4NBM A;  4JSN C;  4AMZ A;  2EID A;  3IJE A;  3O4I A;  2HJB A;  4D0K A;  2YBA A;  5EAR A;  3QHY B;  2YB8 B;  5E6S A;  4Z7Q A;  4RE5 A;  4XYI A;  2XE4 A;  4GQ2 P;  3MMY A;  3P4F A;  4QRJ A;  3JB9 L;  1TYE A;  4BL0 A;  4BUJ C;  3MZK A;  1N6E A;  1FWX A; 
#chains in the Genus database with same CATH homology
 4NC4 A;  1I2M B;  4JHN A;  4DNW A;  4NBM A;  3KCI A;  4DNU A;  4QAM A;  4JHP C;  4O2W A;  4D9S A;  3QHY B;  3OF7 A;  1JTD B;  4NAA A;  4L1M A;  4DNV A;  3QI0 A;  3MVD K;  1A12 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...