2G9AA

Structural basis for the specific recognition of methylated histone h3 lysine 4 by the wd-40 protein wdr5
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
310
structure length
310
Chain Sequence
GPLGSTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna binding protein
molecule keywords WD-repeat protein 5
publication title Structural basis for the specific recognition of methylated histone H3 lysine 4 by the WD-40 protein WDR5
rcsb
source organism Homo sapiens
total genus 91
structure length 310
sequence length 310
ec nomenclature
pdb deposition date 2006-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2g9aA00
2CO0C 4FB1D 4J84A 3PSCB 3FRXA 4PSXB 5EMMB 2GC4A 4D0KA 3L4OD 3ODTA 5CYKA 4D6VA 4L3GD 3I89A 4PSWB 4X3EA 2AGWA 4J78A 4ERYA 5AFU3 2TRCB 5CXCA 4CZYA 5I5IA 1K32A 4XYIA 4IMMA 5HYNB 2GC7A 3U4YA 3ORVD 3PVUB 1YFQA 1B9XA 3DWLC 2EBSA 3GFCA 1GXRA 4A11A 4CY1A 2YNOA 3PSLA 3I8EA 3E0CA 1GOTB 4LG9A 1SQ9A 4A09B 4E54B 2AH0A 2IAAA 2UZYB 3SBPA 4CY3A 3OL2B 5IGQA 5TDHB 2BBKH 5TEFA 1A0RB 3J80g 1PEVA 4FAND 2Z2PA 2HESX 4JT6C 2IUPA 3VH0A 4J86A 4BH6A 4J82A 3MXXA 5TEEA 4R7AB 2AGZA 3C75H 2I3SA 2IWFA 4JSXC 1TBGA 4AOWA 4ZOZA 2HKMA 3BG1A 5EAMA 2I0TA 5AMSA 4BUJC 1PI6A 4JD2C 5CXBB 5FKQA 2B5MA 3AL9A 5C2WB 2CNXA 5GSAA 3ZWLB 1JMZB 2I3TA 4FA1D 4J8BA 3MKSB 2I0SA 1VYHC 2H6QA 2OIZA 3DXKC 4FA9D 3I7KA 1P22A 3GREA 3RLMD 3UVMA 4CC9A 4J87A 4KFMB 3BG0A 5KDOB 3JRPA 2GNQA 2IWKA 2UZXB 5GXHA 3IJCA 2PBIB 4J81A 2CN3A 3PXWD 2BCJB 4E5ZA 5C2VB 1OLZA 3F3FA 5I5MA 3SN6B 3SFZA 4ZOYA 4EWRA 2PM9B 4GM3A 2QC5A 4FHLA 1GP2B 3SMRA 3DXMC 5CYKB 5EMKB 3RRMC 4XYHA 2PM6B 3I2NA 3OKYA 2MTAH 3CFSB 3EI3A 3PE7A 3OTTA 4I79A 3I7PA 5IGOA 4CI1A 3SVWD 2O9KA 3SBQA 5FXYA 5CXCB 5B4WA 4O9DA 3AL8A 3DM0A 4HDJA 4QL1A 3K27A 4ZOVA 2IURA 4L9OA 1S4UX 4PXWA 4A0AA 4A11B 3EI4A 4QQEA 2Z2OA 1U2VC 2H9NA 5IJ8E 5FKTA 4A2LA 3OKTA 3PXSD 1ERJA 2P9KC 5GMKn 3AH8B 4FA4D 3FGBA 3I7OA 3I8CA 2YB8B 4ESGA 2H9MA 5HE0B 4ZN4A 1NR0A 2J57G 4GZ8A 4ZOXA 2YMUA 4Z8LA 3C9CA 3HFQA 5JWZA 4GGCA 1XKSA 1U4CA 2P9PC 3UVOA 4O45A 3RMZD 2YBAA 4JSNC 5EMJB 4A08A 1FWXA 3MKQA 4GMBA 4YVDA 1PGUA 3V5WB 5HE2B 2B4EA 2P9LC 2H47A 2H9LA 1GG2B 4PBYA 3I7HA 5FKSA 2H6NA 3AFCA 2J55H 3IJ0A 4QRJA 2G9AA 5EAPA 1SHYB 4X60B 4N14A 2B5NA 2OJYA 3EI1A 2H9PA 1SQJA 4CI2A 2H6KA 1OMWB 3C5MA 2YNNA 4ERZA 3SBRA 4J73A 5SXMA 1R5MA 4E5ZB 2Q7QA 2AQ5A 4GQBB 3RN0D 4FAVD 3KRWB 3DSMA 4GM9A 3F3PA 4JSVC 4CZXA 4L1QD 3EI2B 3EG6A 1XIPA 4G56B 5HQGA 3OKYB 3EI3B 5EM2A 4X63B 5EALA 2I0RA 4GGDA 4XEIC 3AL8B 5THAA 4LGNA 3RFGA 2AGXA 2CN2A 4UI9R 4CZVA 4FWWA 3VGZA 5IT9g 4ERQA 4A0AB 4PC0A 4L3HD 2HYEA 4CI3A 3JZHA 3JPXA 4GQ1A 5A2Qg 4AEZA 3OW8A 2AGLA 1PBYB 5GXIA 2W18A 5H14A 3SXTD 4PNKB 3K26A 1QNIA 4J8GA 3EWEA 5FQDA 2XU7A 4Y7RA 4GGAA 4J79A 3RSEC 3SJLD 3JZGA 1Q47A 3N0DA 5H17A 4JT5C 4TZ4A 2H3XA 2CE9A 4IA9A 3RFHA 5I5JA 2PM9A 3CIKB 3F3GA 2AH1A 4A08B 4LG8A 4O3TB 3NVNA 2CE8A 3NVXA 4CY2A 3UVKA 2AGYA 2Z2NA 4MK0B 4A0BA 2CO0A 4OZUA 4U1EI 1MDAH 3JZNA 4J77A 3MMYA 3EU7A 3UKRC 1N6DA 4H5IA 3UKUC 2OK6A 2PM7B 1JOFA 4K3JB 2P9UC 2IUQA 2XL2A 5TF2A 3P4FA 5IJ7E 2P9SC 2QXVA 3MZKA 3VA6A 5HE1B 5C9ZB 4CI8A 3EI1B 3SCYA 2HXCA 4JSPC 4A2MA 3SHFA 4X61B 3UR4A 3JB9L 4FA5D 4OWRA 3SLED 3N0EA 5FKRA 3PVWB 3W15A 2HKRA 1JJUB 2YNPA 5K19A 3IIWA 2OVPB 1K8KC 3EMHA 4E54A 4A09A 3FM0A 2OVRB 3OL2A 4JXMA 3JROA 4O1QD 4BL0A 1NEXB 3IKOA 5FA5B 5EM2B 1TYQC 5EARA 4A7JA 1N6EA 5HE3B 2B5LA 3J81g 1MG3A 2G99A 1XHMA 3I7LA 3NVQA 4J0XA 3UVNA 4K3ID 1RI6A 2P9NC 3CFVA 5CXBA 4J0WA 5K1CC 2H13A 2H68A 3V9FA 3I7NA 1N6FA 3L4MD 3OKWA 4U7AA 2HJ4A 3PXTD 4GM8A 2H14A 4QT8A 3IJ1A 2OVQB 5EMLB 3EI4B 2XL3A 4PBZA 3RN1D 3B7FA 3A0FA 5FLXg 3C99A 3V7DB 3KRXB 2XYIA 4ES0A 2IUVA 4CY5A 4NSXA 5IC7A 3ULEC 3IIYA 4H5JA 5AJAA 2HJBA 4O3UB 2OK4A 1JMXB 4Y5RD 3UVLA 3MZLA 3EI2A 2P9IC 5H1MA 1B9YA 3BWSA 2J56H 4A0BB 4GQ2P 3SWSD 3JAMg 1MG2A 1L0QA
chains in the Genus database with same CATH superfamily
2CO0C 4FB1D 4J84A 3PSCB 3FRXA 4PSXB 5EMMB 2GC4A 4D0KA 3L4OD 3ODTA 5CYKA 1JV2A 3V4VA 4D6VA 4L3GD 3I89A 4PSWB 4X3EA 2AGWA 4J78A 4ERYA 5AFU3 1M1XA 1UTCA 2TRCB 5CXCA 4CZYA 5I5IA 2XZGA 1K32A 3ZE0A 4XYIA 4IMMA 3VI4A 5HYNB 2VDMA 2GC7A 3U4YA 3ORVD 3PVUB 1YFQA 1B9XA 3DWLC 2EBSA 3GFCA 1GXRA 1UOPA 4A11A 4CY1A 2YNOA 5C92A 5E6UA 3PSLA 4BP9A 3I8EA 4WJKA 3E0CA 1GOTB 3IUQA 4LG9A 1SQ9A 4WK2A 4A09B 4E54B 2EIEA 2AH0A 2IAAA 2UZYB 2WQ8A 3SBPA 4CY3A 3OL2B 5IGQA 5TDHB 2BBKH 5TEFA 1A0RB 3J80g 1PEVA 1VE6A 4AN0A 4FAND 2Z2PA 2HESX 4JT6C 2IUPA 3VH0A 2QR5A 4J86A 4O02A 4J82A 4BH6A 3MXXA 5TEEA 4R7AB 2AGZA 3C75H 2I3SA 2IWFA 4JSXC 1TBGA 4AOWA 4ZOZA 2HKMA 3QHYB 3BG1A 5EAMA 2VZ3A 4DNVA 2I0TA 1A12A 5M5VA 5AMSA 4RE5A 4JHNA 4BUJC 1PI6A 3IUMA 4JD2C 5CXBB 5FKQA 2B5MA 3AL9A 5C2WB 2CNXA 3IUJA 5GSAA 3ZWLB 1JMZB 2I3TA 3IULA 3IVMA 4FA1D 3NIDA 4J8BA 3MKSB 2I0SA 1VYHC 4DNUA 3ZDXA 2H6QA 2OIZA 3DXKC 4FA9D 3I7KA 1P22A 3GREA 3RLMD 5C86A 3UVMA 2HU7A 4CC9A 4J87A 2VDRA 4KFMB 3BG0A 5KDOB 3JRPA 2GNQA 1GOGA 2IWKA 1C9LA 2UZXB 5GXHA 3IJCA 2PBIB 4J81A 4D9SA 2VC2A 2CN3A 3PXWD 3KCIA 2BCJB 4E5ZA 5C2VB 1OLZA 3F3FA 5I5MA 3SN6B 4Z7OA 2QZPA 3SFZA 4ZOYA 4EWRA 2PM9B 3EQ9A 4GM3A 2QC5A 4FHLA 4AX4A 1GP2B 3SMRA 3DXMC 5CYKB 5EMKB 3RRMC 4XYHA 2PM6B 3I2NA 3OKYA 2MTAH 3CFSB 3EI3A 3PE7A 3OTTA 4I79A 3I7PA 5IGOA 4BP8A 3DDUA 4CI1A 3SVWD 3EQ7A 2O9KA 3SBQA 4BCBA 5FXYA 5CXCB 5B4WA 4O9DA 3AL8A 3DM0A 4HDJA 4QL1A 3K27A 4ZOVA 2IURA 4L9OA 1S4UX 4PXWA 4A0AA 3O4HA 5FFOA 4A11B 3O4JA 3EI4A 4QQEA 2Z2OA 1U2VC 4QAMA 2H9NA 4UM8A 5IJ8E 5FKTA 4A2LA 3OKTA 3PXSD 1ERJA 2P9KC 5GMKn 3AH8B 4FA4D 3IURA 3FGBA 3FCSA 3I7OA 3I8CA 2YB8B 4ESGA 2H9MA 4NBMA 3T3MA 5HE0B 4ZN4A 1NR0A 2J57G 3OF7A 4GZ8A 4ZOXA 2YMUA 4NAAA 4Z8LA 3C9CA 1UOQA 4MMYA 3HFQA 5JWZA 4GGCA 1E8MA 1XKSA 1U4CA 2P9PC 3UVOA 4O45A 3RMZD 2YBAA 4JSNC 5EMJB 4AMYA 4A08A 1FWXA 1L0QA 3MKQA 4GMBA 4YVDA 1PGUA 3NIFA 3V5WB 5HE2B 5M5UA 2B4EA 2P9LC 2H47A 2H9LA 1GG2B 4PBYA 3I7HA 1JTDB 1YR2A 2H6NA 5FKSA 2HU8A 3ZE1A 3AFCA 2J55H 3IJ0A 4QRJA 2G9AA 5EAPA 4AN1A 1SHYB 5M5RA 4X60B 4N14A 2B5NA 2OJYA 3EI1A 2H9PA 1SQJA 4CI2A 4NC4A 2H6KA 1OMWB 5FFGA 4L1MA 3K6SA 3C5MA 2YNNA 4ERZA 1L5GA 3SBRA 4J73A 5SXMA 1R5MA 4E5ZB 2Q7QA 2AQ5A 4GQBB 3RN0D 4FAVD 1VZ3A 3KRWB 3DSMA 4GM9A 3F3PA 4JSVC 4CZXA 4L1QD 3EI2B 2BKLA 3EG6A 4WK4A 1XIPA 4G56B 1QFMA 5HQGA 3OKYB 3EI3B 1QFSA 5EM2A 4X63B 5EALA 1VE7A 2I0RA 4GGDA 4XEIC 3AL8B 5THAA 4LGNA 5HDBA 3RFGA 3MVDK 2AGXA 2CN2A 5M5SA 4UI9R 4CZVA 4FWWA 3VGZA 5IT9g 4ERQA 4A0AB 4PC0A 4L3HD 2HYEA 4CI3A 3JZHA 3JPXA 4GQ1A 5A2Qg 4AEZA 4JHPC 2VDNA 3OW8A 4Z7QA 2AGLA 1PBYB 3NIGA 4AMZA 5GXIA 2W18A 5H14A 3SXTD 4O2WA 1BPOA 4PNKB 3EQ8A 3K26A 1QNIA 4G55A 4J8GA 3EWEA 5FQDA 2XU7A 4Y7RA 4GGAA 3GC3B 4J79A 3RSEC 3SJLD 3JZGA 1Q47A 3N0DA 1VZ2A 4JT5C 5H17A 4MMXA 4TZ4A 2H3XA 4RE6A 2CE9A 4IA9A 4BCCA 5E6RA 3RFHA 5I5JA 2PM9A 3CIKB 4IRZA 3IUNA 3F3GA 2AH1A 4A08B 4LG8A 4O3TB 3NVNA 2CE8A 3NVXA 4CY2A 1E8NA 3UVKA 2AGYA 2Z2NA 4MK0B 4A0BA 2CO0A 4OZUA 2VZ1A 4U1EI 1MDAH 3JZNA 4J77A 3MMYA 3EU7A 3UKRC 1O6FA 1N6DA 4H5IA 2XDWA 3UKUC 1H2ZA 2OK6A 2PM7B 1JOFA 4K3JB 4BCDA 2P9UC 1C9IA 1I2MB 2IUQA 2XL2A 5TF2A 3P4FA 5IJ7E 2P9SC 3V4PA 2QXVA 3MZKA 3VA6A 5HE1B 3ZDYA 5C9ZB 4CI8A 3EI1B 3IJEA 3SCYA 2JKXA 1H2WA 2HXCA 3O4IA 4JSPC 4A2MA 3SHFA 4X61B 3UR4A 3JB9L 4FA5D 4OWRA 2VDOA 3SLED 3N0EA 3K72A 5FKRA 4Z7NA 3PVWB 3W15A 2HKRA 2YNPA 5K19A 3IIWA 2OVPB 1GOFA 1K8KC 3EMHA 4NENA 2XE4A 3K71A 4E54A 4A09A 3FM0A 1U8CA 4MMZA 2OVRB 3OL2A 4JXMA 3JROA 4O1QD 4BL0A 4DNWA 1O6GA 1NEXB 1H2YA 2HU5A 3IKOA 5FA5B 2VDQA 5EM2B 1TYQC 2VDPA 5EARA 4A7JA 1N6EA 1TYEA 5HE3B 2B5LA 3J81g 1MG3A 2G99A 1XHMA 3I7LA 3NVQA 2VDKA 1E5TA 5M5TA 4UM9A 3O4GA 3FCUA 4J0XA 3UVNA 4K3ID 1RI6A 4G1MA 2P9NC 3CFVA 2EIBA 3QI0A 5E6SA 1UOOA 2VDLA 5CXBA 3MUNA 4J0WA 3MUOA 1H2XA 5K1CC 2H13A 2H68A 3V9FA 3I7NA 1N6FA 3L4MD 3OKWA 1K3IA 4U7AA 2HJ4A 3PXTD 4GM8A 2H14A 4QT8A 3IJ1A 2OVQB 5EMLB 3EI4B 2XL3A 4PBZA 3RN1D 3ZE2A 4G1EA 3B7FA 3A0FA 5FLXg 3C99A 3V7DB 3KRXB 2XYIA 4WK0A 4ES0A 2IUVA 4CY5A 4NSXA 3VI3A 5IC7A 3ULEC 3IIYA 5M61A 4H5JA 1T2XA 5AJAA 2HJBA 4O3UB 2OK4A 1JMXB 4Y5RD 3UVLA 3T3PA 3MZLA 3EI2A 1GOHA 2EICA 2EIDA 2P9IC 5H1MA 1B9YA 3ZDZA 3BWSA 2J56H 4A0BB 4GQ2P 3SWSD 3JAMg 1MG2A 3GD1I 1JJUB
chains in the Genus database with same CATH topology
2CO0C 4FB1D 4J84A 3PSCB 3FRXA 4PSXB 5EMMB 2GC4A 4D0KA 3L4OD 3ODTA 5CYKA 4D6VA 4L3GD 3I89A 4PSWB 4X3EA 2AGWA 4J78A 4ERYA 5AFU3 2TRCB 5CXCA 4CZYA 5I5IA 1K32A 4XYIA 4IMMA 5HYNB 2GC7A 3U4YA 3ORVD 3PVUB 1YFQA 1B9XA 3DWLC 2EBSA 3GFCA 1GXRA 4A11A 4CY1A 2YNOA 3PSLA 3I8EA 3E0CA 1GOTB 4LG9A 1SQ9A 4A09B 4E54B 2AH0A 2IAAA 2UZYB 3SBPA 4CY3A 3OL2B 5IGQA 5TDHB 2BBKH 5TEFA 1A0RB 3J80g 1PEVA 4FAND 2Z2PA 2HESX 4JT6C 2IUPA 3VH0A 4J86A 4BH6A 4J82A 3MXXA 5TEEA 4R7AB 2AGZA 3C75H 2I3SA 2IWFA 4JSXC 1TBGA 4AOWA 4ZOZA 2HKMA 3BG1A 5EAMA 2I0TA 5AMSA 4BUJC 1PI6A 4JD2C 5CXBB 5FKQA 2B5MA 3AL9A 5C2WB 2CNXA 5GSAA 3ZWLB 1JMZB 2I3TA 4FA1D 4J8BA 3MKSB 2I0SA 1VYHC 2H6QA 2OIZA 3DXKC 4FA9D 3I7KA 1P22A 3GREA 3RLMD 3UVMA 4CC9A 4J87A 4KFMB 3BG0A 5KDOB 3JRPA 2GNQA 2IWKA 2UZXB 5GXHA 3IJCA 2PBIB 4J81A 2CN3A 3PXWD 2BCJB 4E5ZA 5C2VB 1OLZA 3F3FA 5I5MA 3SN6B 3SFZA 4ZOYA 4EWRA 2PM9B 4GM3A 2QC5A 4FHLA 1GP2B 3SMRA 3DXMC 5CYKB 5EMKB 3RRMC 4XYHA 2PM6B 3I2NA 3OKYA 2MTAH 3CFSB 3EI3A 3PE7A 3OTTA 4I79A 3I7PA 5IGOA 4CI1A 3SVWD 2O9KA 3SBQA 5FXYA 5CXCB 5B4WA 4O9DA 3AL8A 3DM0A 4HDJA 4QL1A 3K27A 4ZOVA 2IURA 4L9OA 1S4UX 4PXWA 4A0AA 4A11B 3EI4A 4QQEA 2Z2OA 1U2VC 2H9NA 5IJ8E 5FKTA 4A2LA 3OKTA 3PXSD 1ERJA 2P9KC 5GMKn 3AH8B 4FA4D 3FGBA 3I7OA 3I8CA 2YB8B 4ESGA 2H9MA 5HE0B 4ZN4A 1NR0A 2J57G 4GZ8A 4ZOXA 2YMUA 4Z8LA 3C9CA 3HFQA 5JWZA 4GGCA 1XKSA 1U4CA 2P9PC 3UVOA 4O45A 3RMZD 2YBAA 4JSNC 5EMJB 4A08A 1FWXA 3MKQA 4GMBA 4YVDA 1PGUA 3V5WB 5HE2B 2B4EA 2P9LC 2H47A 2H9LA 1GG2B 4PBYA 3I7HA 5FKSA 2H6NA 3AFCA 2J55H 3IJ0A 4QRJA 2G9AA 5EAPA 1SHYB 4X60B 4N14A 2B5NA 2OJYA 3EI1A 2H9PA 1SQJA 4CI2A 2H6KA 1OMWB 3C5MA 2YNNA 4ERZA 3SBRA 4J73A 5SXMA 1R5MA 4E5ZB 2Q7QA 2AQ5A 4GQBB 3RN0D 4FAVD 3KRWB 3DSMA 4GM9A 3F3PA 4JSVC 4CZXA 4L1QD 3EI2B 3EG6A 1XIPA 4G56B 5HQGA 3OKYB 3EI3B 5EM2A 4X63B 5EALA 2I0RA 4GGDA 4XEIC 3AL8B 5THAA 4LGNA 3RFGA 2AGXA 2CN2A 4UI9R 4CZVA 4FWWA 3VGZA 5IT9g 4ERQA 4A0AB 4PC0A 4L3HD 2HYEA 4CI3A 3JZHA 3JPXA 4GQ1A 5A2Qg 4AEZA 3OW8A 2AGLA 1PBYB 5GXIA 2W18A 5H14A 3SXTD 4PNKB 3K26A 1QNIA 4J8GA 3EWEA 5FQDA 2XU7A 4Y7RA 4GGAA 4J79A 3RSEC 3SJLD 3JZGA 1Q47A 3N0DA 5H17A 4JT5C 4TZ4A 2H3XA 2CE9A 4IA9A 3RFHA 5I5JA 2PM9A 3CIKB 3F3GA 2AH1A 4A08B 4LG8A 4O3TB 3NVNA 2CE8A 3NVXA 4CY2A 3UVKA 2AGYA 2Z2NA 4MK0B 4A0BA 2CO0A 4OZUA 4U1EI 1MDAH 3JZNA 4J77A 3MMYA 3EU7A 3UKRC 1N6DA 4H5IA 3UKUC 2OK6A 2PM7B 1JOFA 4K3JB 2P9UC 2IUQA 2XL2A 5TF2A 3P4FA 5IJ7E 2P9SC 2QXVA 3MZKA 3VA6A 5HE1B 5C9ZB 4CI8A 3EI1B 3SCYA 2HXCA 4JSPC 4A2MA 3SHFA 4X61B 3UR4A 3JB9L 4FA5D 4OWRA 3SLED 3N0EA 5FKRA 3PVWB 3W15A 2HKRA 1JJUB 2YNPA 5K19A 3IIWA 2OVPB 1K8KC 3EMHA 4E54A 4A09A 3FM0A 2OVRB 3OL2A 4JXMA 3JROA 4O1QD 4BL0A 1NEXB 3IKOA 5FA5B 5EM2B 1TYQC 5EARA 4A7JA 1N6EA 5HE3B 2B5LA 3J81g 1MG3A 2G99A 1XHMA 3I7LA 3NVQA 4J0XA 3UVNA 4K3ID 1RI6A 2P9NC 3CFVA 5CXBA 4J0WA 5K1CC 2H13A 2H68A 3V9FA 3I7NA 1N6FA 3L4MD 3OKWA 4U7AA 2HJ4A 3PXTD 4GM8A 2H14A 4QT8A 3IJ1A 2OVQB 5EMLB 3EI4B 2XL3A 4PBZA 3RN1D 3B7FA 3A0FA 5FLXg 3C99A 3V7DB 3KRXB 2XYIA 4ES0A 2IUVA 4CY5A 4NSXA 5IC7A 3ULEC 3IIYA 4H5JA 5AJAA 2HJBA 4O3UB 2OK4A 1JMXB 4Y5RD 3UVLA 3MZLA 3EI2A 2P9IC 5H1MA 1B9YA 3BWSA 2J56H 4A0BB 4GQ2P 3SWSD 3JAMg 1MG2A 1L0QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CO0 C;  4FB1 D;  4J84 A;  3PSC B;  3FRX A;  4PSX B;  5EMM B;  2GC4 A;  4D0K A;  3L4O D;  3ODT A;  5CYK A;  4D6V A;  4L3G D;  3I89 A;  4PSW B;  4X3E A;  2AGW A;  4J78 A;  4ERY A;  5AFU 3;  2TRC B;  5CXC A;  4CZY A;  5I5I A;  1K32 A;  4XYI A;  4IMM A;  5HYN B;  2GC7 A;  3U4Y A;  3ORV D;  3PVU B;  1YFQ A;  1B9X A;  3DWL C;  2EBS A;  3GFC A;  1GXR A;  4A11 A;  4CY1 A;  2YNO A;  3PSL A;  3I8E A;  3E0C A;  1GOT B;  4LG9 A;  1SQ9 A;  4A09 B;  4E54 B;  2AH0 A;  2IAA A;  2UZY B;  3SBP A;  4CY3 A;  3OL2 B;  5IGQ A;  5TDH B;  2BBK H;  5TEF A;  1A0R B;  3J80 g;  1PEV A;  4FAN D;  2Z2P A;  2HES X;  4JT6 C;  2IUP A;  3VH0 A;  4J86 A;  4BH6 A;  4J82 A;  3MXX A;  5TEE A;  4R7A B;  2AGZ A;  3C75 H;  2I3S A;  2IWF A;  4JSX C;  1TBG A;  4AOW A;  4ZOZ A;  2HKM A;  3BG1 A;  5EAM A;  2I0T A;  5AMS A;  4BUJ C;  1PI6 A;  4JD2 C;  5CXB B;  5FKQ A;  2B5M A;  3AL9 A;  5C2W B;  2CNX A;  5GSA A;  3ZWL B;  1JMZ B;  2I3T A;  4FA1 D;  4J8B A;  3MKS B;  2I0S A;  1VYH C;  2H6Q A;  2OIZ A;  3DXK C;  4FA9 D;  3I7K A;  1P22 A;  3GRE A;  3RLM D;  3UVM A;  4CC9 A;  4J87 A;  4KFM B;  3BG0 A;  5KDO B;  3JRP A;  2GNQ A;  2IWK A;  2UZX B;  5GXH A;  3IJC A;  2PBI B;  4J81 A;  2CN3 A;  3PXW D;  2BCJ B;  4E5Z A;  5C2V B;  1OLZ A;  3F3F A;  5I5M A;  3SN6 B;  3SFZ A;  4ZOY A;  4EWR A;  2PM9 B;  4GM3 A;  2QC5 A;  4FHL A;  1GP2 B;  3SMR A;  3DXM C;  5CYK B;  5EMK B;  3RRM C;  4XYH A;  2PM6 B;  3I2N A;  3OKY A;  2MTA H;  3CFS B;  3EI3 A;  3PE7 A;  3OTT A;  4I79 A;  3I7P A;  5IGO A;  4CI1 A;  3SVW D;  2O9K A;  3SBQ A;  5FXY A;  5CXC B;  5B4W A;  4O9D A;  3AL8 A;  3DM0 A;  4HDJ A;  4QL1 A;  3K27 A;  4ZOV A;  2IUR A;  4L9O A;  1S4U X;  4PXW A;  4A0A A;  4A11 B;  3EI4 A;  4QQE A;  2Z2O A;  1U2V C;  2H9N A;  5IJ8 E;  5FKT A;  4A2L A;  3OKT A;  3PXS D;  1ERJ A;  2P9K C;  5GMK n;  3AH8 B;  4FA4 D;  3FGB A;  3I7O A;  3I8C A;  2YB8 B;  4ESG A;  2H9M A;  5HE0 B;  4ZN4 A;  1NR0 A;  2J57 G;  4GZ8 A;  4ZOX A;  2YMU A;  4Z8L A;  3C9C A;  3HFQ A;  5JWZ A;  4GGC A;  1XKS A;  1U4C A;  2P9P C;  3UVO A;  4O45 A;  3RMZ D;  2YBA A;  4JSN C;  5EMJ B;  4A08 A;  1FWX A;  3MKQ A;  4GMB A;  4YVD A;  1PGU A;  3V5W B;  5HE2 B;  2B4E A;  2P9L C;  2H47 A;  2H9L A;  1GG2 B;  4PBY A;  3I7H A;  5FKS A;  2H6N A;  3AFC A;  2J55 H;  3IJ0 A;  4QRJ A;  2G9A A;  5EAP A;  1SHY B;  4X60 B;  4N14 A;  2B5N A;  2OJY A;  3EI1 A;  2H9P A;  1SQJ A;  4CI2 A;  2H6K A;  1OMW B;  3C5M A;  2YNN A;  4ERZ A;  3SBR A;  4J73 A;  5SXM A;  1R5M A;  4E5Z B;  2Q7Q A;  2AQ5 A;  4GQB B;  3RN0 D;  4FAV D;  3KRW B;  3DSM A;  4GM9 A;  3F3P A;  4JSV C;  4CZX A;  4L1Q D;  3EI2 B;  3EG6 A;  1XIP A;  4G56 B;  5HQG A;  3OKY B;  3EI3 B;  5EM2 A;  4X63 B;  5EAL A;  2I0R A;  4GGD A;  4XEI C;  3AL8 B;  5THA A;  4LGN A;  3RFG A;  2AGX A;  2CN2 A;  4UI9 R;  4CZV A;  4FWW A;  3VGZ A;  5IT9 g;  4ERQ A;  4A0A B;  4PC0 A;  4L3H D;  2HYE A;  4CI3 A;  3JZH A;  3JPX A;  4GQ1 A;  5A2Q g;  4AEZ A;  3OW8 A;  2AGL A;  1PBY B;  5GXI A;  2W18 A;  5H14 A;  3SXT D;  4PNK B;  3K26 A;  1QNI A;  4J8G A;  3EWE A;  5FQD A;  2XU7 A;  4Y7R A;  4GGA A;  4J79 A;  3RSE C;  3SJL D;  3JZG A;  1Q47 A;  3N0D A;  5H17 A;  4JT5 C;  4TZ4 A;  2H3X A;  2CE9 A;  4IA9 A;  3RFH A;  5I5J A;  2PM9 A;  3CIK B;  3F3G A;  2AH1 A;  4A08 B;  4LG8 A;  4O3T B;  3NVN A;  2CE8 A;  3NVX A;  4CY2 A;  3UVK A;  2AGY A;  2Z2N A;  4MK0 B;  4A0B A;  2CO0 A;  4OZU A;  4U1E I;  1MDA H;  3JZN A;  4J77 A;  3MMY A;  3EU7 A;  3UKR C;  1N6D A;  4H5I A;  3UKU C;  2OK6 A;  2PM7 B;  1JOF A;  4K3J B;  2P9U C;  2IUQ A;  2XL2 A;  5TF2 A;  3P4F A;  5IJ7 E;  2P9S C;  2QXV A;  3MZK A;  3VA6 A;  5HE1 B;  5C9Z B;  4CI8 A;  3EI1 B;  3SCY A;  2HXC A;  4JSP C;  4A2M A;  3SHF A;  4X61 B;  3UR4 A;  3JB9 L;  4FA5 D;  4OWR A;  3SLE D;  3N0E A;  5FKR A;  3PVW B;  3W15 A;  2HKR A;  1JJU B;  2YNP A;  5K19 A;  3IIW A;  2OVP B;  1K8K C;  3EMH A;  4E54 A;  4A09 A;  3FM0 A;  2OVR B;  3OL2 A;  4JXM A;  3JRO A;  4O1Q D;  4BL0 A;  1NEX B;  3IKO A;  5FA5 B;  5EM2 B;  1TYQ C;  5EAR A;  4A7J A;  1N6E A;  5HE3 B;  2B5L A;  3J81 g;  1MG3 A;  2G99 A;  1XHM A;  3I7L A;  3NVQ A;  4J0X A;  3UVN A;  4K3I D;  1RI6 A;  2P9N C;  3CFV A;  5CXB A;  4J0W A;  5K1C C;  2H13 A;  2H68 A;  3V9F A;  3I7N A;  1N6F A;  3L4M D;  3OKW A;  4U7A A;  2HJ4 A;  3PXT D;  4GM8 A;  2H14 A;  4QT8 A;  3IJ1 A;  2OVQ B;  5EML B;  3EI4 B;  2XL3 A;  4PBZ A;  3RN1 D;  3B7F A;  3A0F A;  5FLX g;  3C99 A;  3V7D B;  3KRX B;  2XYI A;  4ES0 A;  2IUV A;  4CY5 A;  4NSX A;  5IC7 A;  3ULE C;  3IIY A;  4H5J A;  5AJA A;  2HJB A;  4O3U B;  2OK4 A;  1JMX B;  4Y5R D;  3UVL A;  3MZL A;  3EI2 A;  2P9I C;  5H1M A;  1B9Y A;  3BWS A;  2J56 H;  4A0B B;  4GQ2 P;  3SWS D;  3JAM g;  1MG2 A;  1L0Q A; 
#chains in the Genus database with same CATH topology
 2CO0 C;  4FB1 D;  4J84 A;  3PSC B;  3FRX A;  4PSX B;  5EMM B;  2GC4 A;  4D0K A;  3L4O D;  3ODT A;  5CYK A;  1JV2 A;  3V4V A;  4D6V A;  4L3G D;  3I89 A;  4PSW B;  4X3E A;  2AGW A;  4J78 A;  4ERY A;  5AFU 3;  1M1X A;  1UTC A;  2TRC B;  5CXC A;  4CZY A;  5I5I A;  2XZG A;  1K32 A;  3ZE0 A;  4XYI A;  4IMM A;  3VI4 A;  5HYN B;  2VDM A;  2GC7 A;  3U4Y A;  3ORV D;  3PVU B;  1YFQ A;  1B9X A;  3DWL C;  2EBS A;  3GFC A;  1GXR A;  1UOP A;  4A11 A;  4CY1 A;  2YNO A;  5C92 A;  5E6U A;  3PSL A;  4BP9 A;  3I8E A;  4WJK A;  3E0C A;  1GOT B;  3IUQ A;  4LG9 A;  1SQ9 A;  4WK2 A;  4A09 B;  4E54 B;  2EIE A;  2AH0 A;  2IAA A;  2UZY B;  2WQ8 A;  3SBP A;  4CY3 A;  3OL2 B;  5IGQ A;  5TDH B;  2BBK H;  5TEF A;  1A0R B;  3J80 g;  1PEV A;  1VE6 A;  4AN0 A;  4FAN D;  2Z2P A;  2HES X;  4JT6 C;  2IUP A;  3VH0 A;  2QR5 A;  4J86 A;  4O02 A;  4J82 A;  4BH6 A;  3MXX A;  5TEE A;  4R7A B;  2AGZ A;  3C75 H;  2I3S A;  2IWF A;  4JSX C;  1TBG A;  4AOW A;  4ZOZ A;  2HKM A;  3QHY B;  3BG1 A;  5EAM A;  2VZ3 A;  4DNV A;  2I0T A;  1A12 A;  5M5V A;  5AMS A;  4RE5 A;  4JHN A;  4BUJ C;  1PI6 A;  3IUM A;  4JD2 C;  5CXB B;  5FKQ A;  2B5M A;  3AL9 A;  5C2W B;  2CNX A;  3IUJ A;  5GSA A;  3ZWL B;  1JMZ B;  2I3T A;  3IUL A;  3IVM A;  4FA1 D;  3NID A;  4J8B A;  3MKS B;  2I0S A;  1VYH C;  4DNU A;  3ZDX A;  2H6Q A;  2OIZ A;  3DXK C;  4FA9 D;  3I7K A;  1P22 A;  3GRE A;  3RLM D;  5C86 A;  3UVM A;  2HU7 A;  4CC9 A;  4J87 A;  2VDR A;  4KFM B;  3BG0 A;  5KDO B;  3JRP A;  2GNQ A;  1GOG A;  2IWK A;  1C9L A;  2UZX B;  5GXH A;  3IJC A;  2PBI B;  4J81 A;  4D9S A;  2VC2 A;  2CN3 A;  3PXW D;  3KCI A;  2BCJ B;  4E5Z A;  5C2V B;  1OLZ A;  3F3F A;  5I5M A;  3SN6 B;  4Z7O A;  2QZP A;  3SFZ A;  4ZOY A;  4EWR A;  2PM9 B;  3EQ9 A;  4GM3 A;  2QC5 A;  4FHL A;  4AX4 A;  1GP2 B;  3SMR A;  3DXM C;  5CYK B;  5EMK B;  3RRM C;  4XYH A;  2PM6 B;  3I2N A;  3OKY A;  2MTA H;  3CFS B;  3EI3 A;  3PE7 A;  3OTT A;  4I79 A;  3I7P A;  5IGO A;  4BP8 A;  3DDU A;  4CI1 A;  3SVW D;  3EQ7 A;  2O9K A;  3SBQ A;  4BCB A;  5FXY A;  5CXC B;  5B4W A;  4O9D A;  3AL8 A;  3DM0 A;  4HDJ A;  4QL1 A;  3K27 A;  4ZOV A;  2IUR A;  4L9O A;  1S4U X;  4PXW A;  4A0A A;  3O4H A;  5FFO A;  4A11 B;  3O4J A;  3EI4 A;  4QQE A;  2Z2O A;  1U2V C;  4QAM A;  2H9N A;  4UM8 A;  5IJ8 E;  5FKT A;  4A2L A;  3OKT A;  3PXS D;  1ERJ A;  2P9K C;  5GMK n;  3AH8 B;  4FA4 D;  3IUR A;  3FGB A;  3FCS A;  3I7O A;  3I8C A;  2YB8 B;  4ESG A;  2H9M A;  4NBM A;  3T3M A;  5HE0 B;  4ZN4 A;  1NR0 A;  2J57 G;  3OF7 A;  4GZ8 A;  4ZOX A;  2YMU A;  4NAA A;  4Z8L A;  3C9C A;  1UOQ A;  4MMY A;  3HFQ A;  5JWZ A;  4GGC A;  1E8M A;  1XKS A;  1U4C A;  2P9P C;  3UVO A;  4O45 A;  3RMZ D;  2YBA A;  4JSN C;  5EMJ B;  4AMY A;  4A08 A;  1FWX A;  1L0Q A;  3MKQ A;  4GMB A;  4YVD A;  1PGU A;  3NIF A;  3V5W B;  5HE2 B;  5M5U A;  2B4E A;  2P9L C;  2H47 A;  2H9L A;  1GG2 B;  4PBY A;  3I7H A;  1JTD B;  1YR2 A;  2H6N A;  5FKS A;  2HU8 A;  3ZE1 A;  3AFC A;  2J55 H;  3IJ0 A;  4QRJ A;  2G9A A;  5EAP A;  4AN1 A;  1SHY B;  5M5R A;  4X60 B;  4N14 A;  2B5N A;  2OJY A;  3EI1 A;  2H9P A;  1SQJ A;  4CI2 A;  4NC4 A;  2H6K A;  1OMW B;  5FFG A;  4L1M A;  3K6S A;  3C5M A;  2YNN A;  4ERZ A;  1L5G A;  3SBR A;  4J73 A;  5SXM A;  1R5M A;  4E5Z B;  2Q7Q A;  2AQ5 A;  4GQB B;  3RN0 D;  4FAV D;  1VZ3 A;  3KRW B;  3DSM A;  4GM9 A;  3F3P A;  4JSV C;  4CZX A;  4L1Q D;  3EI2 B;  2BKL A;  3EG6 A;  4WK4 A;  1XIP A;  4G56 B;  1QFM A;  5HQG A;  3OKY B;  3EI3 B;  1QFS A;  5EM2 A;  4X63 B;  5EAL A;  1VE7 A;  2I0R A;  4GGD A;  4XEI C;  3AL8 B;  5THA A;  4LGN A;  5HDB A;  3RFG A;  3MVD K;  2AGX A;  2CN2 A;  5M5S A;  4UI9 R;  4CZV A;  4FWW A;  3VGZ A;  5IT9 g;  4ERQ A;  4A0A B;  4PC0 A;  4L3H D;  2HYE A;  4CI3 A;  3JZH A;  3JPX A;  4GQ1 A;  5A2Q g;  4AEZ A;  4JHP C;  2VDN A;  3OW8 A;  4Z7Q A;  2AGL A;  1PBY B;  3NIG A;  4AMZ A;  5GXI A;  2W18 A;  5H14 A;  3SXT D;  4O2W A;  1BPO A;  4PNK B;  3EQ8 A;  3K26 A;  1QNI A;  4G55 A;  4J8G A;  3EWE A;  5FQD A;  2XU7 A;  4Y7R A;  4GGA A;  3GC3 B;  4J79 A;  3RSE C;  3SJL D;  3JZG A;  1Q47 A;  3N0D A;  1VZ2 A;  4JT5 C;  5H17 A;  4MMX A;  4TZ4 A;  2H3X A;  4RE6 A;  2CE9 A;  4IA9 A;  4BCC A;  5E6R A;  3RFH A;  5I5J A;  2PM9 A;  3CIK B;  4IRZ A;  3IUN A;  3F3G A;  2AH1 A;  4A08 B;  4LG8 A;  4O3T B;  3NVN A;  2CE8 A;  3NVX A;  4CY2 A;  1E8N A;  3UVK A;  2AGY A;  2Z2N A;  4MK0 B;  4A0B A;  2CO0 A;  4OZU A;  2VZ1 A;  4U1E I;  1MDA H;  3JZN A;  4J77 A;  3MMY A;  3EU7 A;  3UKR C;  1O6F A;  1N6D A;  4H5I A;  2XDW A;  3UKU C;  1H2Z A;  2OK6 A;  2PM7 B;  1JOF A;  4K3J B;  4BCD A;  2P9U C;  1C9I A;  1I2M B;  2IUQ A;  2XL2 A;  5TF2 A;  3P4F A;  5IJ7 E;  2P9S C;  3V4P A;  2QXV A;  3MZK A;  3VA6 A;  5HE1 B;  3ZDY A;  5C9Z B;  4CI8 A;  3EI1 B;  3IJE A;  3SCY A;  2JKX A;  1H2W A;  2HXC A;  3O4I A;  4JSP C;  4A2M A;  3SHF A;  4X61 B;  3UR4 A;  3JB9 L;  4FA5 D;  4OWR A;  2VDO A;  3SLE D;  3N0E A;  3K72 A;  5FKR A;  4Z7N A;  3PVW B;  3W15 A;  2HKR A;  2YNP A;  5K19 A;  3IIW A;  2OVP B;  1GOF A;  1K8K C;  3EMH A;  4NEN A;  2XE4 A;  3K71 A;  4E54 A;  4A09 A;  3FM0 A;  1U8C A;  4MMZ A;  2OVR B;  3OL2 A;  4JXM A;  3JRO A;  4O1Q D;  4BL0 A;  4DNW A;  1O6G A;  1NEX B;  1H2Y A;  2HU5 A;  3IKO A;  5FA5 B;  2VDQ A;  5EM2 B;  1TYQ C;  2VDP A;  5EAR A;  4A7J A;  1N6E A;  1TYE A;  5HE3 B;  2B5L A;  3J81 g;  1MG3 A;  2G99 A;  1XHM A;  3I7L A;  3NVQ A;  2VDK A;  1E5T A;  5M5T A;  4UM9 A;  3O4G A;  3FCU A;  4J0X A;  3UVN A;  4K3I D;  1RI6 A;  4G1M A;  2P9N C;  3CFV A;  2EIB A;  3QI0 A;  5E6S A;  1UOO A;  2VDL A;  5CXB A;  3MUN A;  4J0W A;  3MUO A;  1H2X A;  5K1C C;  2H13 A;  2H68 A;  3V9F A;  3I7N A;  1N6F A;  3L4M D;  3OKW A;  1K3I A;  4U7A A;  2HJ4 A;  3PXT D;  4GM8 A;  2H14 A;  4QT8 A;  3IJ1 A;  2OVQ B;  5EML B;  3EI4 B;  2XL3 A;  4PBZ A;  3RN1 D;  3ZE2 A;  4G1E A;  3B7F A;  3A0F A;  5FLX g;  3C99 A;  3V7D B;  3KRX B;  2XYI A;  4WK0 A;  4ES0 A;  2IUV A;  4CY5 A;  4NSX A;  3VI3 A;  5IC7 A;  3ULE C;  3IIY A;  5M61 A;  4H5J A;  1T2X A;  5AJA A;  2HJB A;  4O3U B;  2OK4 A;  1JMX B;  4Y5R D;  3UVL A;  3T3P A;  3MZL A;  3EI2 A;  1GOH A;  2EIC A;  2EID A;  2P9I C;  5H1M A;  1B9Y A;  3ZDZ A;  3BWS A;  2J56 H;  4A0B B;  4GQ2 P;  3SWS D;  3JAM g;  1MG2 A;  3GD1 I;  1JJU B; 
#chains in the Genus database with same CATH homology
 2CO0 C;  4FB1 D;  4J84 A;  3PSC B;  3FRX A;  4PSX B;  5EMM B;  2GC4 A;  4D0K A;  3L4O D;  3ODT A;  5CYK A;  4D6V A;  4L3G D;  3I89 A;  4PSW B;  4X3E A;  2AGW A;  4J78 A;  4ERY A;  5AFU 3;  2TRC B;  5CXC A;  4CZY A;  5I5I A;  1K32 A;  4XYI A;  4IMM A;  5HYN B;  2GC7 A;  3U4Y A;  3ORV D;  3PVU B;  1YFQ A;  1B9X A;  3DWL C;  2EBS A;  3GFC A;  1GXR A;  4A11 A;  4CY1 A;  2YNO A;  3PSL A;  3I8E A;  3E0C A;  1GOT B;  4LG9 A;  1SQ9 A;  4A09 B;  4E54 B;  2AH0 A;  2IAA A;  2UZY B;  3SBP A;  4CY3 A;  3OL2 B;  5IGQ A;  5TDH B;  2BBK H;  5TEF A;  1A0R B;  3J80 g;  1PEV A;  4FAN D;  2Z2P A;  2HES X;  4JT6 C;  2IUP A;  3VH0 A;  4J86 A;  4BH6 A;  4J82 A;  3MXX A;  5TEE A;  4R7A B;  2AGZ A;  3C75 H;  2I3S A;  2IWF A;  4JSX C;  1TBG A;  4AOW A;  4ZOZ A;  2HKM A;  3BG1 A;  5EAM A;  2I0T A;  5AMS A;  4BUJ C;  1PI6 A;  4JD2 C;  5CXB B;  5FKQ A;  2B5M A;  3AL9 A;  5C2W B;  2CNX A;  5GSA A;  3ZWL B;  1JMZ B;  2I3T A;  4FA1 D;  4J8B A;  3MKS B;  2I0S A;  1VYH C;  2H6Q A;  2OIZ A;  3DXK C;  4FA9 D;  3I7K A;  1P22 A;  3GRE A;  3RLM D;  3UVM A;  4CC9 A;  4J87 A;  4KFM B;  3BG0 A;  5KDO B;  3JRP A;  2GNQ A;  2IWK A;  2UZX B;  5GXH A;  3IJC A;  2PBI B;  4J81 A;  2CN3 A;  3PXW D;  2BCJ B;  4E5Z A;  5C2V B;  1OLZ A;  3F3F A;  5I5M A;  3SN6 B;  3SFZ A;  4ZOY A;  4EWR A;  2PM9 B;  4GM3 A;  2QC5 A;  4FHL A;  1GP2 B;  3SMR A;  3DXM C;  5CYK B;  5EMK B;  3RRM C;  4XYH A;  2PM6 B;  3I2N A;  3OKY A;  2MTA H;  3CFS B;  3EI3 A;  3PE7 A;  3OTT A;  4I79 A;  3I7P A;  5IGO A;  4CI1 A;  3SVW D;  2O9K A;  3SBQ A;  5FXY A;  5CXC B;  5B4W A;  4O9D A;  3AL8 A;  3DM0 A;  4HDJ A;  4QL1 A;  3K27 A;  4ZOV A;  2IUR A;  4L9O A;  1S4U X;  4PXW A;  4A0A A;  4A11 B;  3EI4 A;  4QQE A;  2Z2O A;  1U2V C;  2H9N A;  5IJ8 E;  5FKT A;  4A2L A;  3OKT A;  3PXS D;  1ERJ A;  2P9K C;  5GMK n;  3AH8 B;  4FA4 D;  3FGB A;  3I7O A;  3I8C A;  2YB8 B;  4ESG A;  2H9M A;  5HE0 B;  4ZN4 A;  1NR0 A;  2J57 G;  4GZ8 A;  4ZOX A;  2YMU A;  4Z8L A;  3C9C A;  3HFQ A;  5JWZ A;  4GGC A;  1XKS A;  1U4C A;  2P9P C;  3UVO A;  4O45 A;  3RMZ D;  2YBA A;  4JSN C;  5EMJ B;  4A08 A;  1FWX A;  3MKQ A;  4GMB A;  4YVD A;  1PGU A;  3V5W B;  5HE2 B;  2B4E A;  2P9L C;  2H47 A;  2H9L A;  1GG2 B;  4PBY A;  3I7H A;  5FKS A;  2H6N A;  3AFC A;  2J55 H;  3IJ0 A;  4QRJ A;  2G9A A;  5EAP A;  1SHY B;  4X60 B;  4N14 A;  2B5N A;  2OJY A;  3EI1 A;  2H9P A;  1SQJ A;  4CI2 A;  2H6K A;  1OMW B;  3C5M A;  2YNN A;  4ERZ A;  3SBR A;  4J73 A;  5SXM A;  1R5M A;  4E5Z B;  2Q7Q A;  2AQ5 A;  4GQB B;  3RN0 D;  4FAV D;  3KRW B;  3DSM A;  4GM9 A;  3F3P A;  4JSV C;  4CZX A;  4L1Q D;  3EI2 B;  3EG6 A;  1XIP A;  4G56 B;  5HQG A;  3OKY B;  3EI3 B;  5EM2 A;  4X63 B;  5EAL A;  2I0R A;  4GGD A;  4XEI C;  3AL8 B;  5THA A;  4LGN A;  3RFG A;  2AGX A;  2CN2 A;  4UI9 R;  4CZV A;  4FWW A;  3VGZ A;  5IT9 g;  4ERQ A;  4A0A B;  4PC0 A;  4L3H D;  2HYE A;  4CI3 A;  3JZH A;  3JPX A;  4GQ1 A;  5A2Q g;  4AEZ A;  3OW8 A;  2AGL A;  1PBY B;  5GXI A;  2W18 A;  5H14 A;  3SXT D;  4PNK B;  3K26 A;  1QNI A;  4J8G A;  3EWE A;  5FQD A;  2XU7 A;  4Y7R A;  4GGA A;  4J79 A;  3RSE C;  3SJL D;  3JZG A;  1Q47 A;  3N0D A;  5H17 A;  4JT5 C;  4TZ4 A;  2H3X A;  2CE9 A;  4IA9 A;  3RFH A;  5I5J A;  2PM9 A;  3CIK B;  3F3G A;  2AH1 A;  4A08 B;  4LG8 A;  4O3T B;  3NVN A;  2CE8 A;  3NVX A;  4CY2 A;  3UVK A;  2AGY A;  2Z2N A;  4MK0 B;  4A0B A;  2CO0 A;  4OZU A;  4U1E I;  1MDA H;  3JZN A;  4J77 A;  3MMY A;  3EU7 A;  3UKR C;  1N6D A;  4H5I A;  3UKU C;  2OK6 A;  2PM7 B;  1JOF A;  4K3J B;  2P9U C;  2IUQ A;  2XL2 A;  5TF2 A;  3P4F A;  5IJ7 E;  2P9S C;  2QXV A;  3MZK A;  3VA6 A;  5HE1 B;  5C9Z B;  4CI8 A;  3EI1 B;  3SCY A;  2HXC A;  4JSP C;  4A2M A;  3SHF A;  4X61 B;  3UR4 A;  3JB9 L;  4FA5 D;  4OWR A;  3SLE D;  3N0E A;  5FKR A;  3PVW B;  3W15 A;  2HKR A;  1JJU B;  2YNP A;  5K19 A;  3IIW A;  2OVP B;  1K8K C;  3EMH A;  4E54 A;  4A09 A;  3FM0 A;  2OVR B;  3OL2 A;  4JXM A;  3JRO A;  4O1Q D;  4BL0 A;  1NEX B;  3IKO A;  5FA5 B;  5EM2 B;  1TYQ C;  5EAR A;  4A7J A;  1N6E A;  5HE3 B;  2B5L A;  3J81 g;  1MG3 A;  2G99 A;  1XHM A;  3I7L A;  3NVQ A;  4J0X A;  3UVN A;  4K3I D;  1RI6 A;  2P9N C;  3CFV A;  5CXB A;  4J0W A;  5K1C C;  2H13 A;  2H68 A;  3V9F A;  3I7N A;  1N6F A;  3L4M D;  3OKW A;  4U7A A;  2HJ4 A;  3PXT D;  4GM8 A;  2H14 A;  4QT8 A;  3IJ1 A;  2OVQ B;  5EML B;  3EI4 B;  2XL3 A;  4PBZ A;  3RN1 D;  3B7F A;  3A0F A;  5FLX g;  3C99 A;  3V7D B;  3KRX B;  2XYI A;  4ES0 A;  2IUV A;  4CY5 A;  4NSX A;  5IC7 A;  3ULE C;  3IIY A;  4H5J A;  5AJA A;  2HJB A;  4O3U B;  2OK4 A;  1JMX B;  4Y5R D;  3UVL A;  3MZL A;  3EI2 A;  2P9I C;  5H1M A;  1B9Y A;  3BWS A;  2J56 H;  4A0B B;  4GQ2 P;  3SWS D;  3JAM g;  1MG2 A;  1L0Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...