2G9AA

Structural basis for the specific recognition of methylated histone h3 lysine 4 by the wd-40 protein wdr5
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
310
structure length
310
Chain Sequence
GPLGSTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD-repeat protein 5
publication title Structural basis for the specific recognition of methylated histone H3 lysine 4 by the WD-40 protein WDR5
rcsb
source organism Homo sapiens
molecule tags Structural protein/dna binding protein
total genus 91
structure length 310
sequence length 310
ec nomenclature
pdb deposition date 2006-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2g9aA00
3SN6B 2P9KC 2P9LC 4BH6A 1JMXB 1A0RB 4XEIC 4ZN4A 3A0FA 4O1QD 5FKRA 3EI2B 1JMZB 4IA9A 2H6QA 3EI1A 3EWEA 4A09B 4FA9D 3JZNA 2CN3A 4CZXA 4A0AA 5TDHB 4J0XA 1TBGA 3SMRA 4GGAA 2HKRA 2Z2OA 3VGZA 3C99A 3AL8B 4HDJA 3EMHA 4PBYA 4GQ1A 2I0TA 2AGLA 4X61B 3EI2A 3GREA 4AOWA 3FRXA 4A2MA 2YNNA 5HE2B 4PC0A 3JZGA 4GZ8A 2G9AA 3DXKC 4A09A 3JPXA 3JAMg 2CNXA 2OIZA 4IMMA 5HQGA 3NVXA 2CE8A 3EI4B 3AL8A 4A2LA 5TEFA 2HJBA 4J8BA 4JT5C 1B9YA 3C9CA 1K8KC 5GSAA 4A7JA 3CIKB 5HYNB 3VA6A 2J57G 5CYKB 1U4CA 3CFVA 3PVUB 4ZOZA 1PBYB 3OKTA 4R7AB 5I5MA 2IURA 2H9NA 2W18A 5C9ZB 4K3ID 1NR0A 5AJAA 3MMYA 2H6NA 1Q47A 2AGYA 2OJYA 3P4FA 3EI4A 5FKSA 5IGQA 4PNKB 2B4EA 4Y5RD 1JJUB 4O3TB 5HE1B 4YVDA 3NVNA 5CYKA 3I89A 2Z2NA 4QT8A 5EMLB 1OLZA 3EI3B 4QL1A 3MZKA 3L4OD 1B9XA 4ZOVA 1L0QA 1JOFA 4GM3A 4FA1D 1SQ9A 2YB8B 1XIPA 3SBPA 2CO0C 3N0EA 4GM9A 4J79A 2PM7B 3BG0A 1ERJA 3PXSD 1U2VC 3I7NA 3KRXB 4J8GA 4O45A 3UVLA 4GMBA 4L3HD 3EI3A 2YNOA 4N14A 5GXIA 3PSCB 2TRCB 4BL0A 4PXWA 4J77A 5GXHA 2I3TA 3HFQA 4EWRA 3PE7A 2J56H 3ORVD 3V9FA 5K19A 4FWWA 3BWSA 3MZLA 2I3SA 5EMMB 3VH0A 3EU7A 3I8CA 3OW8A 4L9OA 4ZOXA 3B7FA 5I5JA 3RN1D 3NVQA 4U1EI 3BG1A 4CY5A 3E0CA 4J81A 4X60B 5IGOA 1QNIA 4J0WA 1GXRA 2AGZA 3AL9A 3UVOA 5EALA 3C5MA 4JD2C 3IJCA 3IIWA 1R5MA 3V7DB 3FGBA 5AMSA 5EAPA 3DSMA 5FKQA 2YMUA 2H6KA 2MTAH 4I79A 2P9SC 4PSXB 3I2NA 2OVPB 5A2Qg 2GC4A 5THAA 5TEEA 2P9NC 3C75H 3SCYA 4CI3A 1TYQC 4LG9A 3SXTD 4CI8A 5FKTA 2AGWA 3OKWA 3IKOA 2OK6A 3F3FA 4GGDA 2P9IC 4CY1A 4FA4D 4QQEA 5FXYA 2J55H 4FAVD 2UZYB 4GQ2P 2EBSA 4CY3A 2GC7A 3DWLC 4ERQA 2XYIA 3RMZD 5IC7A 4OZUA 4O3UB 4U7AA 3JB9L 3K26A 3RFGA 3ULEC 1PI6A 4LG8A 4H5JA 3UVNA 2AH0A 1NEXB 1XHMA 3OL2B 4Y7RA 3RFHA 2CO0A 5KDOB 2H68A 3MKQA 1PEVA 4PBZA 3SBQA 3SJLD 5H14A 2IWFA 4JSNC 1GOTB 3UKRC 4XYHA 5H1MA 3GFCA 3RRMC 4ZOYA 2B5MA 3RLMD 4NSXA 1FWXA 4JSXC 1MG3A 3U4YA 2XU7A 4JSVC 4D0KA 4ES0A 3I7PA 1N6DA 2O9KA 5IJ8E 4O9DA 2IAAA 3OL2A 3IJ1A 4FHLA 3F3GA 4ESGA 2PM9B 4J84A 2XL3A 4TZ4A 4A0BB 4L3GD 4ERYA 4E54B 5EMJB 4JSPC 5TF2A 5CXBB 2Z2PA 2CE9A 2HYEA 5IT9g 4A11B 2P9PC 3PVWB 3UKUC 3V5WB 2IUVA 3ZWLB 3PXTD 3MKSB 2H3XA 5HE3B 1VYHC 2PM6B 5EM2B 5FA5B 3I8EA 3SHFA 1K32A 2PM9A 2HESX 2H9LA 1MDAH 2UZXB 4A0BA 4CY2A 3SVWD 4K3JB 4E54A 3K27A 1S4UX 4Z8LA 4FB1D 5CXBA 4QRJA 3PXWD 5EARA 2AGXA 2IUQA 2H9MA 2OVQB 3IJ0A 3OKYB 4A11A 1XKSA 2Q7QA 3UR4A 1N6EA 3DM0A 4GGCA 2YBAA 2BCJB 4FA5D 3I7HA 2HKMA 5EM2A 3SLED 3J80g 3N0DA 4J86A 1MG2A 4CC9A 3AFCA 5I5IA 4CI2A 4GQBB 1P22A 3I7OA 3KRWB 2H14A 3OKYA 2H13A 3RN0D 4AEZA 2QXVA 3W15A 1GG2B 3J81g 4LGNA 4MK0B 3I7LA 4J78A 3OTTA 2AH1A 5JWZA 4J87A 4D6VA 2YNPA 5FQDA 1SHYB 2H9PA 5EAMA 1OMWB 2OVRB 2QC5A 1N6FA 2GNQA 2B5NA 4OWRA 3MXXA 2B5LA 5SXMA 1PGUA 5C2VB 3SWSD 3AH8B 5CXCB 5EMKB 4J82A 5H17A 2IWKA 2I0SA 3L4MD 4FAND 2AQ5A 2PBIB 3SFZA 5K1CC 3IIYA 4CZVA 1RI6A 2I0RA 2HXCA 3JROA 3ODTA 1GP2B 2CN2A 4A08B 3FM0A 4E5ZB 4L1QD 5IJ7E 4CI1A 4JT6C 2G99A 5FLXg 4UI9R 4G56B 5B4WA 3RSEC 3F3PA 3CFSB 5C2WB 4XYIA 3JZHA 3DXMC 5CXCA 2P9UC 4PSWB 5HE0B 4JXMA 1SQJA 4X63B 4KFMB 5AFU3 2BBKH 3EI1B 2OK4A 4BUJC 1YFQA 4ERZA 2IUPA 4GM8A 4A08A 4A0AB 2H47A 3I7KA 4E5ZA 3UVKA 2HJ4A 4J73A 3SBRA 3JRPA 4CZYA 3PSLA 3EG6A 5GMKn 4H5IA 4X3EA 2XL2A 3UVMA
chains in the Genus database with same CATH superfamily
3SN6B 2P9KC 2P9LC 4BH6A 1C9LA 1JMXB 1A0RB 4XEIC 3T3MA 4BP8A 4ZN4A 3A0FA 4O1QD 5FKRA 3EI2B 1JMZB 1A12A 4IA9A 2H6QA 3EI1A 3QHYB 3EWEA 4A09B 4FA9D 3JZNA 2CN3A 4CZXA 4A0AA 4D9SA 5TDHB 3ZE1A 4J0XA 1TBGA 3SMRA 1QFSA 4GGAA 2HKRA 2Z2OA 3VGZA 3C99A 4BP9A 3AL8B 4WK4A 4HDJA 3EMHA 1E8MA 2XDWA 4GQ1A 4PBYA 2I0TA 2AGLA 4X61B 3EI2A 3GREA 4AOWA 3FRXA 4A2MA 2YNNA 5HE2B 4PC0A 3JZGA 4GZ8A 4NC4A 2G9AA 4AN1A 3DXKC 4A09A 3ZDZA 3KCIA 3JPXA 3JAMg 1H2WA 2CNXA 2OIZA 3K72A 4IMMA 5HQGA 1QFMA 3NVXA 4MMXA 2CE8A 3EI4B 3AL8A 4A2LA 3ZE2A 5TEFA 2HJBA 4J8BA 3O4GA 4JT5C 1B9YA 4RE6A 3C9CA 1K8KC 5GSAA 4A7JA 3CIKB 5HYNB 2WQ8A 3VA6A 2J57G 5CYKB 1U4CA 3CFVA 3PVUB 4WJKA 4ZOZA 1PBYB 3OKTA 4R7AB 5I5MA 2IURA 2VDKA 5M5SA 1TYEA 2H9NA 2W18A 5C9ZB 3ZDYA 5C92A 4K3ID 1K3IA 1NR0A 5AJAA 5M61A 3MMYA 3IUNA 2H6NA 1Q47A 2AGYA 2OJYA 3P4FA 1VZ3A 3EI4A 5FKSA 4Z7QA 5IGQA 4PNKB 4G1MA 2B4EA 4Y5RD 1JJUB 4O3TB 5HE1B 4YVDA 3NVNA 4AMZA 5CYKA 3I89A 4Z7OA 2Z2NA 4QT8A 5EMLB 1OLZA 3EI3B 4QL1A 2JKXA 3MZKA 3L4OD 1B9XA 4ZOVA 1L0QA 1JOFA 4GM3A 4FA1D 1JTDB 1SQ9A 2YB8B 1XIPA 3SBPA 2CO0C 1VE7A 5E6RA 1H2YA 3N0EA 2BKLA 4GM9A 4J79A 2PM7B 3BG0A 4NENA 1ERJA 3PXSD 1U2VC 3I7NA 3KRXB 4J8GA 4O45A 3UVLA 1L5GA 4GMBA 4L3HD 3EI3A 5M5UA 2YNOA 4N14A 5GXIA 3PSCB 2TRCB 4BL0A 4PXWA 1GOGA 4J77A 5GXHA 1VZ2A 2I3TA 3HFQA 4EWRA 3PE7A 2J56H 3ORVD 3V9FA 3O4HA 5K19A 4FWWA 4WK2A 3BWSA 3MZLA 2I3SA 5EMMB 3VH0A 3FCSA 3NIFA 3EU7A 3I8CA 3OW8A 4L9OA 4ZOXA 3B7FA 3MVDK 5I5JA 3RN1D 3NVQA 3GC3B 4U1EI 2VDRA 3BG1A 4CY5A 2EIBA 3E0CA 4J81A 4MMYA 2QZPA 4X60B 1VE6A 5IGOA 1QNIA 4J0WA 1GXRA 3IULA 2EIEA 2AGZA 3AL9A 3UVOA 5EALA 3C5MA 4JD2C 3QI0A 3IJCA 3IIWA 1R5MA 3V7DB 3FGBA 5AMSA 4BCCA 5EAPA 3DSMA 5FKQA 4MMZA 4BCBA 2YMUA 2H6KA 2MTAH 1UOQA 4I79A 2P9SC 2EIDA 4PSXB 3EQ7A 3I2NA 2OVPB 1C9IA 5A2Qg 2GC4A 2VDPA 5THAA 5C86A 5TEEA 2P9NC 5M5VA 2VC2A 2VZ3A 3C75H 3SCYA 4CI3A 1TYQC 4LG9A 3SXTD 4CI8A 5FKTA 2AGWA 3OKWA 3IKOA 2OK6A 2XE4A 4DNVA 3F3FA 4GGDA 2P9IC 2HU7A 4BCDA 4CY1A 4QQEA 4FA4D 5FXYA 2J55H 4FAVD 3FCUA 2UZYB 3MUNA 4GQ2P 2EBSA 4CY3A 2VDLA 2VDQA 2GC7A 3DWLC 4ERQA 4O02A 2XYIA 3RMZD 5IC7A 4OZUA 4O3UB 4U7AA 3JB9L 3K26A 3RFGA 3ULEC 3GD1I 3IURA 1PI6A 4LG8A 4AN0A 4H5JA 5M5RA 3UVNA 1NEXB 2AH0A 1XHMA 3OL2B 4Y7RA 3RFHA 2CO0A 5KDOB 2H68A 4JHNA 3MKQA 1PEVA 4PBZA 3SBQA 3SJLD 5E6UA 5H14A 2IWFA 4JSNC 1GOTB 3UKRC 4XYHA 5H1MA 3GFCA 2QR5A 3RRMC 4ZOYA 1O6FA 3MUOA 2B5MA 2EICA 4UM9A 3RLMD 4NSXA 1FWXA 4JSXC 1MG3A 3U4YA 4O2WA 2XU7A 4JSVC 1GOHA 3ZDXA 4D0KA 4AX4A 3I7PA 1N6DA 2O9KA 4ES0A 5IJ8E 4O9DA 2IAAA 3OL2A 3IJ1A 4FHLA 3F3GA 4ESGA 2PM9B 1UOOA 2XL3A 4J84A 1O6GA 4TZ4A 4A0BB 4UM8A 4L3GD 4ERYA 4E54B 3NIDA 2VDMA 5EMJB 4JSPC 5TF2A 5CXBB 2Z2PA 2CE9A 3K6SA 2HYEA 3NIGA 5IT9g 4A11B 2P9PC 3PVWB 3UKUC 3V5WB 2IUVA 3ZWLB 3PXTD 4QAMA 1UOPA 3MKSB 2H3XA 5HE3B 1VYHC 2PM6B 5EM2B 1JV2A 5FA5B 3T3PA 3I8EA 3SHFA 1K32A 2XZGA 2PM9A 1YR2A 2HESX 3IVMA 3K71A 2H9LA 4RE5A 1MDAH 2UZXB 4A0BA 3OF7A 1T2XA 4CY2A 3SVWD 4K3JB 4E54A 4G1EA 3EQ9A 3K27A 3V4VA 1S4UX 4Z8LA 3O4JA 4FB1D 5CXBA 4QRJA 4L1MA 3PXWD 5EARA 3VI4A 2AGXA 2IUQA 2H9MA 2OVQB 3IJ0A 3OKYB 4A11A 1XKSA 2Q7QA 3UR4A 1N6EA 3DM0A 4GGCA 2YBAA 3O4IA 2BCJB 5E6SA 3IUMA 4FA5D 3I7HA 2HKMA 5EM2A 3SLED 3J80g 3N0DA 1E5TA 4J86A 3EQ8A 3IUJA 4AMYA 1MG2A 4CC9A 3AFCA 1GOFA 1BPOA 3DDUA 5I5IA 4CI2A 4GQBB 1P22A 3I7OA 3KRWB 2H14A 3OKYA 2H13A 4DNUA 3RN0D 4AEZA 2QXVA 3W15A 1GG2B 3VI3A 3J81g 4WK0A 4LGNA 3IUQA 4MK0B 3I7LA 4J78A 3OTTA 2AH1A 5JWZA 4NBMA 4J87A 4D6VA 4Z7NA 2YNPA 5FQDA 1SHYB 2H9PA 5EAMA 1OMWB 5M5TA 2OVRB 2VDNA 2QC5A 1N6FA 2GNQA 2B5NA 4OWRA 3MXXA 2B5LA 5SXMA 1PGUA 5C2VB 3SWSD 3AH8B 4G55A 5CXCB 5EMKB 4J82A 5H17A 2HU5A 2I0SA 2IWKA 3L4MD 2HU8A 4FAND 2AQ5A 2PBIB 2VDOA 4NAAA 3SFZA 5K1CC 3IIYA 4CZVA 1RI6A 2I0RA 2HXCA 3JROA 3ZE0A 3ODTA 1GP2B 1H2ZA 1I2MB 2CN2A 4A08B 3FM0A 4E5ZB 1U8CA 4L1QD 5IJ7E 4CI1A 4JT6C 2G99A 5FLXg 4UI9R 4G56B 5B4WA 3RSEC 3F3PA 3CFSB 5C2WB 4XYIA 3JZHA 3DXMC 5CXCA 2P9UC 4PSWB 5HE0B 4JXMA 1SQJA 4X63B 3V4PA 4JHPC 4DNWA 4KFMB 5AFU3 2BBKH 4IRZA 3EI1B 2OK4A 4BUJC 1YFQA 4ERZA 2IUPA 4GM8A 4A08A 4A0AB 1UTCA 2H47A 3I7KA 4E5ZA 3UVKA 2HJ4A 4J73A 5FFOA 3SBRA 3JRPA 5HDBA 4CZYA 3IJEA 3PSLA 3EG6A 5FFGA 5GMKn 1E8NA 4H5IA 1H2XA 1M1XA 4X3EA 2XL2A 3UVMA 2VZ1A
chains in the Genus database with same CATH topology
3SN6B 2P9KC 2P9LC 4BH6A 1JMXB 1A0RB 4XEIC 4ZN4A 3A0FA 4O1QD 5FKRA 3EI2B 1JMZB 4IA9A 2H6QA 3EI1A 3EWEA 4A09B 4FA9D 3JZNA 2CN3A 4CZXA 4A0AA 5TDHB 4J0XA 1TBGA 3SMRA 4GGAA 2HKRA 2Z2OA 3VGZA 3C99A 3AL8B 4HDJA 3EMHA 4PBYA 4GQ1A 2I0TA 2AGLA 4X61B 3EI2A 3GREA 4AOWA 3FRXA 4A2MA 2YNNA 5HE2B 4PC0A 3JZGA 4GZ8A 2G9AA 3DXKC 4A09A 3JPXA 3JAMg 2CNXA 2OIZA 4IMMA 5HQGA 3NVXA 2CE8A 3EI4B 3AL8A 4A2LA 5TEFA 2HJBA 4J8BA 4JT5C 1B9YA 3C9CA 1K8KC 5GSAA 4A7JA 3CIKB 5HYNB 3VA6A 2J57G 5CYKB 1U4CA 3CFVA 3PVUB 4ZOZA 1PBYB 3OKTA 4R7AB 5I5MA 2IURA 2H9NA 2W18A 5C9ZB 4K3ID 1NR0A 5AJAA 3MMYA 2H6NA 1Q47A 2AGYA 2OJYA 3P4FA 3EI4A 5FKSA 5IGQA 4PNKB 2B4EA 4Y5RD 1JJUB 4O3TB 5HE1B 4YVDA 3NVNA 5CYKA 3I89A 2Z2NA 4QT8A 5EMLB 1OLZA 3EI3B 4QL1A 3MZKA 3L4OD 1B9XA 4ZOVA 1L0QA 1JOFA 4GM3A 4FA1D 1SQ9A 2YB8B 1XIPA 3SBPA 2CO0C 3N0EA 4GM9A 4J79A 2PM7B 3BG0A 1ERJA 3PXSD 1U2VC 3I7NA 3KRXB 4J8GA 4O45A 3UVLA 4GMBA 4L3HD 3EI3A 2YNOA 4N14A 5GXIA 3PSCB 2TRCB 4BL0A 4PXWA 4J77A 5GXHA 2I3TA 3HFQA 4EWRA 3PE7A 2J56H 3ORVD 3V9FA 5K19A 4FWWA 3BWSA 3MZLA 2I3SA 5EMMB 3VH0A 3EU7A 3I8CA 3OW8A 4L9OA 4ZOXA 3B7FA 5I5JA 3RN1D 3NVQA 4U1EI 3BG1A 4CY5A 3E0CA 4J81A 4X60B 5IGOA 1QNIA 4J0WA 1GXRA 2AGZA 3AL9A 3UVOA 5EALA 3C5MA 4JD2C 3IJCA 3IIWA 1R5MA 3V7DB 3FGBA 5AMSA 5EAPA 3DSMA 5FKQA 2YMUA 2H6KA 2MTAH 4I79A 2P9SC 4PSXB 3I2NA 2OVPB 5A2Qg 2GC4A 5THAA 5TEEA 2P9NC 3C75H 3SCYA 4CI3A 1TYQC 4LG9A 3SXTD 4CI8A 5FKTA 2AGWA 3OKWA 3IKOA 2OK6A 3F3FA 4GGDA 2P9IC 4CY1A 4FA4D 4QQEA 5FXYA 2J55H 4FAVD 2UZYB 4GQ2P 2EBSA 4CY3A 2GC7A 3DWLC 4ERQA 2XYIA 3RMZD 5IC7A 4OZUA 4O3UB 4U7AA 3JB9L 3K26A 3RFGA 3ULEC 1PI6A 4LG8A 4H5JA 3UVNA 2AH0A 1NEXB 1XHMA 3OL2B 4Y7RA 3RFHA 2CO0A 5KDOB 2H68A 3MKQA 1PEVA 4PBZA 3SBQA 3SJLD 5H14A 2IWFA 4JSNC 1GOTB 3UKRC 4XYHA 5H1MA 3GFCA 3RRMC 4ZOYA 2B5MA 3RLMD 4NSXA 1FWXA 4JSXC 1MG3A 3U4YA 2XU7A 4JSVC 4D0KA 4ES0A 3I7PA 1N6DA 2O9KA 5IJ8E 4O9DA 2IAAA 3OL2A 3IJ1A 4FHLA 3F3GA 4ESGA 2PM9B 4J84A 2XL3A 4TZ4A 4A0BB 4L3GD 4ERYA 4E54B 5EMJB 4JSPC 5TF2A 5CXBB 2Z2PA 2CE9A 2HYEA 5IT9g 4A11B 2P9PC 3PVWB 3UKUC 3V5WB 2IUVA 3ZWLB 3PXTD 3MKSB 2H3XA 5HE3B 1VYHC 2PM6B 5EM2B 5FA5B 3I8EA 3SHFA 1K32A 2PM9A 2HESX 2H9LA 1MDAH 2UZXB 4A0BA 4CY2A 3SVWD 4K3JB 4E54A 3K27A 1S4UX 4Z8LA 4FB1D 5CXBA 4QRJA 3PXWD 5EARA 2AGXA 2IUQA 2H9MA 2OVQB 3IJ0A 3OKYB 4A11A 1XKSA 2Q7QA 3UR4A 1N6EA 3DM0A 4GGCA 2YBAA 2BCJB 4FA5D 3I7HA 2HKMA 5EM2A 3SLED 3J80g 3N0DA 4J86A 1MG2A 4CC9A 3AFCA 5I5IA 4CI2A 4GQBB 1P22A 3I7OA 3KRWB 2H14A 3OKYA 2H13A 3RN0D 4AEZA 2QXVA 3W15A 1GG2B 3J81g 4LGNA 4MK0B 3I7LA 4J78A 3OTTA 2AH1A 5JWZA 4J87A 4D6VA 2YNPA 5FQDA 1SHYB 2H9PA 5EAMA 1OMWB 2OVRB 2QC5A 1N6FA 2GNQA 2B5NA 4OWRA 3MXXA 2B5LA 5SXMA 1PGUA 5C2VB 3SWSD 3AH8B 5CXCB 5EMKB 4J82A 5H17A 2IWKA 2I0SA 3L4MD 4FAND 2AQ5A 2PBIB 3SFZA 5K1CC 3IIYA 4CZVA 1RI6A 2I0RA 2HXCA 3JROA 3ODTA 1GP2B 2CN2A 4A08B 3FM0A 4E5ZB 4L1QD 5IJ7E 4CI1A 4JT6C 2G99A 5FLXg 4UI9R 4G56B 5B4WA 3RSEC 3F3PA 3CFSB 5C2WB 4XYIA 3JZHA 3DXMC 5CXCA 2P9UC 4PSWB 5HE0B 4JXMA 1SQJA 4X63B 4KFMB 5AFU3 2BBKH 3EI1B 2OK4A 4BUJC 1YFQA 4ERZA 2IUPA 4GM8A 4A08A 4A0AB 2H47A 3I7KA 4E5ZA 3UVKA 2HJ4A 4J73A 3SBRA 3JRPA 4CZYA 3PSLA 3EG6A 5GMKn 4H5IA 4X3EA 2XL2A 3UVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SN6 B;  2P9K C;  2P9L C;  4BH6 A;  1JMX B;  1A0R B;  4XEI C;  4ZN4 A;  3A0F A;  4O1Q D;  5FKR A;  3EI2 B;  1JMZ B;  4IA9 A;  2H6Q A;  3EI1 A;  3EWE A;  4A09 B;  4FA9 D;  3JZN A;  2CN3 A;  4CZX A;  4A0A A;  5TDH B;  4J0X A;  1TBG A;  3SMR A;  4GGA A;  2HKR A;  2Z2O A;  3VGZ A;  3C99 A;  3AL8 B;  4HDJ A;  3EMH A;  4PBY A;  4GQ1 A;  2I0T A;  2AGL A;  4X61 B;  3EI2 A;  3GRE A;  4AOW A;  3FRX A;  4A2M A;  2YNN A;  5HE2 B;  4PC0 A;  3JZG A;  4GZ8 A;  2G9A A;  3DXK C;  4A09 A;  3JPX A;  3JAM g;  2CNX A;  2OIZ A;  4IMM A;  5HQG A;  3NVX A;  2CE8 A;  3EI4 B;  3AL8 A;  4A2L A;  5TEF A;  2HJB A;  4J8B A;  4JT5 C;  1B9Y A;  3C9C A;  1K8K C;  5GSA A;  4A7J A;  3CIK B;  5HYN B;  3VA6 A;  2J57 G;  5CYK B;  1U4C A;  3CFV A;  3PVU B;  4ZOZ A;  1PBY B;  3OKT A;  4R7A B;  5I5M A;  2IUR A;  2H9N A;  2W18 A;  5C9Z B;  4K3I D;  1NR0 A;  5AJA A;  3MMY A;  2H6N A;  1Q47 A;  2AGY A;  2OJY A;  3P4F A;  3EI4 A;  5FKS A;  5IGQ A;  4PNK B;  2B4E A;  4Y5R D;  1JJU B;  4O3T B;  5HE1 B;  4YVD A;  3NVN A;  5CYK A;  3I89 A;  2Z2N A;  4QT8 A;  5EML B;  1OLZ A;  3EI3 B;  4QL1 A;  3MZK A;  3L4O D;  1B9X A;  4ZOV A;  1L0Q A;  1JOF A;  4GM3 A;  4FA1 D;  1SQ9 A;  2YB8 B;  1XIP A;  3SBP A;  2CO0 C;  3N0E A;  4GM9 A;  4J79 A;  2PM7 B;  3BG0 A;  1ERJ A;  3PXS D;  1U2V C;  3I7N A;  3KRX B;  4J8G A;  4O45 A;  3UVL A;  4GMB A;  4L3H D;  3EI3 A;  2YNO A;  4N14 A;  5GXI A;  3PSC B;  2TRC B;  4BL0 A;  4PXW A;  4J77 A;  5GXH A;  2I3T A;  3HFQ A;  4EWR A;  3PE7 A;  2J56 H;  3ORV D;  3V9F A;  5K19 A;  4FWW A;  3BWS A;  3MZL A;  2I3S A;  5EMM B;  3VH0 A;  3EU7 A;  3I8C A;  3OW8 A;  4L9O A;  4ZOX A;  3B7F A;  5I5J A;  3RN1 D;  3NVQ A;  4U1E I;  3BG1 A;  4CY5 A;  3E0C A;  4J81 A;  4X60 B;  5IGO A;  1QNI A;  4J0W A;  1GXR A;  2AGZ A;  3AL9 A;  3UVO A;  5EAL A;  3C5M A;  4JD2 C;  3IJC A;  3IIW A;  1R5M A;  3V7D B;  3FGB A;  5AMS A;  5EAP A;  3DSM A;  5FKQ A;  2YMU A;  2H6K A;  2MTA H;  4I79 A;  2P9S C;  4PSX B;  3I2N A;  2OVP B;  5A2Q g;  2GC4 A;  5THA A;  5TEE A;  2P9N C;  3C75 H;  3SCY A;  4CI3 A;  1TYQ C;  4LG9 A;  3SXT D;  4CI8 A;  5FKT A;  2AGW A;  3OKW A;  3IKO A;  2OK6 A;  3F3F A;  4GGD A;  2P9I C;  4CY1 A;  4FA4 D;  4QQE A;  5FXY A;  2J55 H;  4FAV D;  2UZY B;  4GQ2 P;  2EBS A;  4CY3 A;  2GC7 A;  3DWL C;  4ERQ A;  2XYI A;  3RMZ D;  5IC7 A;  4OZU A;  4O3U B;  4U7A A;  3JB9 L;  3K26 A;  3RFG A;  3ULE C;  1PI6 A;  4LG8 A;  4H5J A;  3UVN A;  2AH0 A;  1NEX B;  1XHM A;  3OL2 B;  4Y7R A;  3RFH A;  2CO0 A;  5KDO B;  2H68 A;  3MKQ A;  1PEV A;  4PBZ A;  3SBQ A;  3SJL D;  5H14 A;  2IWF A;  4JSN C;  1GOT B;  3UKR C;  4XYH A;  5H1M A;  3GFC A;  3RRM C;  4ZOY A;  2B5M A;  3RLM D;  4NSX A;  1FWX A;  4JSX C;  1MG3 A;  3U4Y A;  2XU7 A;  4JSV C;  4D0K A;  4ES0 A;  3I7P A;  1N6D A;  2O9K A;  5IJ8 E;  4O9D A;  2IAA A;  3OL2 A;  3IJ1 A;  4FHL A;  3F3G A;  4ESG A;  2PM9 B;  4J84 A;  2XL3 A;  4TZ4 A;  4A0B B;  4L3G D;  4ERY A;  4E54 B;  5EMJ B;  4JSP C;  5TF2 A;  5CXB B;  2Z2P A;  2CE9 A;  2HYE A;  5IT9 g;  4A11 B;  2P9P C;  3PVW B;  3UKU C;  3V5W B;  2IUV A;  3ZWL B;  3PXT D;  3MKS B;  2H3X A;  5HE3 B;  1VYH C;  2PM6 B;  5EM2 B;  5FA5 B;  3I8E A;  3SHF A;  1K32 A;  2PM9 A;  2HES X;  2H9L A;  1MDA H;  2UZX B;  4A0B A;  4CY2 A;  3SVW D;  4K3J B;  4E54 A;  3K27 A;  1S4U X;  4Z8L A;  4FB1 D;  5CXB A;  4QRJ A;  3PXW D;  5EAR A;  2AGX A;  2IUQ A;  2H9M A;  2OVQ B;  3IJ0 A;  3OKY B;  4A11 A;  1XKS A;  2Q7Q A;  3UR4 A;  1N6E A;  3DM0 A;  4GGC A;  2YBA A;  2BCJ B;  4FA5 D;  3I7H A;  2HKM A;  5EM2 A;  3SLE D;  3J80 g;  3N0D A;  4J86 A;  1MG2 A;  4CC9 A;  3AFC A;  5I5I A;  4CI2 A;  4GQB B;  1P22 A;  3I7O A;  3KRW B;  2H14 A;  3OKY A;  2H13 A;  3RN0 D;  4AEZ A;  2QXV A;  3W15 A;  1GG2 B;  3J81 g;  4LGN A;  4MK0 B;  3I7L A;  4J78 A;  3OTT A;  2AH1 A;  5JWZ A;  4J87 A;  4D6V A;  2YNP A;  5FQD A;  1SHY B;  2H9P A;  5EAM A;  1OMW B;  2OVR B;  2QC5 A;  1N6F A;  2GNQ A;  2B5N A;  4OWR A;  3MXX A;  2B5L A;  5SXM A;  1PGU A;  5C2V B;  3SWS D;  3AH8 B;  5CXC B;  5EMK B;  4J82 A;  5H17 A;  2IWK A;  2I0S A;  3L4M D;  4FAN D;  2AQ5 A;  2PBI B;  3SFZ A;  5K1C C;  3IIY A;  4CZV A;  1RI6 A;  2I0R A;  2HXC A;  3JRO A;  3ODT A;  1GP2 B;  2CN2 A;  4A08 B;  3FM0 A;  4E5Z B;  4L1Q D;  5IJ7 E;  4CI1 A;  4JT6 C;  2G99 A;  5FLX g;  4UI9 R;  4G56 B;  5B4W A;  3RSE C;  3F3P A;  3CFS B;  5C2W B;  4XYI A;  3JZH A;  3DXM C;  5CXC A;  2P9U C;  4PSW B;  5HE0 B;  4JXM A;  1SQJ A;  4X63 B;  4KFM B;  5AFU 3;  2BBK H;  3EI1 B;  2OK4 A;  4BUJ C;  1YFQ A;  4ERZ A;  2IUP A;  4GM8 A;  4A08 A;  4A0A B;  2H47 A;  3I7K A;  4E5Z A;  3UVK A;  2HJ4 A;  4J73 A;  3SBR A;  3JRP A;  4CZY A;  3PSL A;  3EG6 A;  5GMK n;  4H5I A;  4X3E A;  2XL2 A;  3UVM A; 
#chains in the Genus database with same CATH topology
 3SN6 B;  2P9K C;  2P9L C;  4BH6 A;  1C9L A;  1JMX B;  1A0R B;  4XEI C;  3T3M A;  4BP8 A;  4ZN4 A;  3A0F A;  4O1Q D;  5FKR A;  3EI2 B;  1JMZ B;  1A12 A;  4IA9 A;  2H6Q A;  3EI1 A;  3QHY B;  3EWE A;  4A09 B;  4FA9 D;  3JZN A;  2CN3 A;  4CZX A;  4A0A A;  4D9S A;  5TDH B;  3ZE1 A;  4J0X A;  1TBG A;  3SMR A;  1QFS A;  4GGA A;  2HKR A;  2Z2O A;  3VGZ A;  3C99 A;  4BP9 A;  3AL8 B;  4WK4 A;  4HDJ A;  3EMH A;  1E8M A;  2XDW A;  4GQ1 A;  4PBY A;  2I0T A;  2AGL A;  4X61 B;  3EI2 A;  3GRE A;  4AOW A;  3FRX A;  4A2M A;  2YNN A;  5HE2 B;  4PC0 A;  3JZG A;  4GZ8 A;  4NC4 A;  2G9A A;  4AN1 A;  3DXK C;  4A09 A;  3ZDZ A;  3KCI A;  3JPX A;  3JAM g;  1H2W A;  2CNX A;  2OIZ A;  3K72 A;  4IMM A;  5HQG A;  1QFM A;  3NVX A;  4MMX A;  2CE8 A;  3EI4 B;  3AL8 A;  4A2L A;  3ZE2 A;  5TEF A;  2HJB A;  4J8B A;  3O4G A;  4JT5 C;  1B9Y A;  4RE6 A;  3C9C A;  1K8K C;  5GSA A;  4A7J A;  3CIK B;  5HYN B;  2WQ8 A;  3VA6 A;  2J57 G;  5CYK B;  1U4C A;  3CFV A;  3PVU B;  4WJK A;  4ZOZ A;  1PBY B;  3OKT A;  4R7A B;  5I5M A;  2IUR A;  2VDK A;  5M5S A;  1TYE A;  2H9N A;  2W18 A;  5C9Z B;  3ZDY A;  5C92 A;  4K3I D;  1K3I A;  1NR0 A;  5AJA A;  5M61 A;  3MMY A;  3IUN A;  2H6N A;  1Q47 A;  2AGY A;  2OJY A;  3P4F A;  1VZ3 A;  3EI4 A;  5FKS A;  4Z7Q A;  5IGQ A;  4PNK B;  4G1M A;  2B4E A;  4Y5R D;  1JJU B;  4O3T B;  5HE1 B;  4YVD A;  3NVN A;  4AMZ A;  5CYK A;  3I89 A;  4Z7O A;  2Z2N A;  4QT8 A;  5EML B;  1OLZ A;  3EI3 B;  4QL1 A;  2JKX A;  3MZK A;  3L4O D;  1B9X A;  4ZOV A;  1L0Q A;  1JOF A;  4GM3 A;  4FA1 D;  1JTD B;  1SQ9 A;  2YB8 B;  1XIP A;  3SBP A;  2CO0 C;  1VE7 A;  5E6R A;  1H2Y A;  3N0E A;  2BKL A;  4GM9 A;  4J79 A;  2PM7 B;  3BG0 A;  4NEN A;  1ERJ A;  3PXS D;  1U2V C;  3I7N A;  3KRX B;  4J8G A;  4O45 A;  3UVL A;  1L5G A;  4GMB A;  4L3H D;  3EI3 A;  5M5U A;  2YNO A;  4N14 A;  5GXI A;  3PSC B;  2TRC B;  4BL0 A;  4PXW A;  1GOG A;  4J77 A;  5GXH A;  1VZ2 A;  2I3T A;  3HFQ A;  4EWR A;  3PE7 A;  2J56 H;  3ORV D;  3V9F A;  3O4H A;  5K19 A;  4FWW A;  4WK2 A;  3BWS A;  3MZL A;  2I3S A;  5EMM B;  3VH0 A;  3FCS A;  3NIF A;  3EU7 A;  3I8C A;  3OW8 A;  4L9O A;  4ZOX A;  3B7F A;  3MVD K;  5I5J A;  3RN1 D;  3NVQ A;  3GC3 B;  4U1E I;  2VDR A;  3BG1 A;  4CY5 A;  2EIB A;  3E0C A;  4J81 A;  4MMY A;  2QZP A;  4X60 B;  1VE6 A;  5IGO A;  1QNI A;  4J0W A;  1GXR A;  3IUL A;  2EIE A;  2AGZ A;  3AL9 A;  3UVO A;  5EAL A;  3C5M A;  4JD2 C;  3QI0 A;  3IJC A;  3IIW A;  1R5M A;  3V7D B;  3FGB A;  5AMS A;  4BCC A;  5EAP A;  3DSM A;  5FKQ A;  4MMZ A;  4BCB A;  2YMU A;  2H6K A;  2MTA H;  1UOQ A;  4I79 A;  2P9S C;  2EID A;  4PSX B;  3EQ7 A;  3I2N A;  2OVP B;  1C9I A;  5A2Q g;  2GC4 A;  2VDP A;  5THA A;  5C86 A;  5TEE A;  2P9N C;  5M5V A;  2VC2 A;  2VZ3 A;  3C75 H;  3SCY A;  4CI3 A;  1TYQ C;  4LG9 A;  3SXT D;  4CI8 A;  5FKT A;  2AGW A;  3OKW A;  3IKO A;  2OK6 A;  2XE4 A;  4DNV A;  3F3F A;  4GGD A;  2P9I C;  2HU7 A;  4BCD A;  4CY1 A;  4QQE A;  4FA4 D;  5FXY A;  2J55 H;  4FAV D;  3FCU A;  2UZY B;  3MUN A;  4GQ2 P;  2EBS A;  4CY3 A;  2VDL A;  2VDQ A;  2GC7 A;  3DWL C;  4ERQ A;  4O02 A;  2XYI A;  3RMZ D;  5IC7 A;  4OZU A;  4O3U B;  4U7A A;  3JB9 L;  3K26 A;  3RFG A;  3ULE C;  3GD1 I;  3IUR A;  1PI6 A;  4LG8 A;  4AN0 A;  4H5J A;  5M5R A;  3UVN A;  1NEX B;  2AH0 A;  1XHM A;  3OL2 B;  4Y7R A;  3RFH A;  2CO0 A;  5KDO B;  2H68 A;  4JHN A;  3MKQ A;  1PEV A;  4PBZ A;  3SBQ A;  3SJL D;  5E6U A;  5H14 A;  2IWF A;  4JSN C;  1GOT B;  3UKR C;  4XYH A;  5H1M A;  3GFC A;  2QR5 A;  3RRM C;  4ZOY A;  1O6F A;  3MUO A;  2B5M A;  2EIC A;  4UM9 A;  3RLM D;  4NSX A;  1FWX A;  4JSX C;  1MG3 A;  3U4Y A;  4O2W A;  2XU7 A;  4JSV C;  1GOH A;  3ZDX A;  4D0K A;  4AX4 A;  3I7P A;  1N6D A;  2O9K A;  4ES0 A;  5IJ8 E;  4O9D A;  2IAA A;  3OL2 A;  3IJ1 A;  4FHL A;  3F3G A;  4ESG A;  2PM9 B;  1UOO A;  2XL3 A;  4J84 A;  1O6G A;  4TZ4 A;  4A0B B;  4UM8 A;  4L3G D;  4ERY A;  4E54 B;  3NID A;  2VDM A;  5EMJ B;  4JSP C;  5TF2 A;  5CXB B;  2Z2P A;  2CE9 A;  3K6S A;  2HYE A;  3NIG A;  5IT9 g;  4A11 B;  2P9P C;  3PVW B;  3UKU C;  3V5W B;  2IUV A;  3ZWL B;  3PXT D;  4QAM A;  1UOP A;  3MKS B;  2H3X A;  5HE3 B;  1VYH C;  2PM6 B;  5EM2 B;  1JV2 A;  5FA5 B;  3T3P A;  3I8E A;  3SHF A;  1K32 A;  2XZG A;  2PM9 A;  1YR2 A;  2HES X;  3IVM A;  3K71 A;  2H9L A;  4RE5 A;  1MDA H;  2UZX B;  4A0B A;  3OF7 A;  1T2X A;  4CY2 A;  3SVW D;  4K3J B;  4E54 A;  4G1E A;  3EQ9 A;  3K27 A;  3V4V A;  1S4U X;  4Z8L A;  3O4J A;  4FB1 D;  5CXB A;  4QRJ A;  4L1M A;  3PXW D;  5EAR A;  3VI4 A;  2AGX A;  2IUQ A;  2H9M A;  2OVQ B;  3IJ0 A;  3OKY B;  4A11 A;  1XKS A;  2Q7Q A;  3UR4 A;  1N6E A;  3DM0 A;  4GGC A;  2YBA A;  3O4I A;  2BCJ B;  5E6S A;  3IUM A;  4FA5 D;  3I7H A;  2HKM A;  5EM2 A;  3SLE D;  3J80 g;  3N0D A;  1E5T A;  4J86 A;  3EQ8 A;  3IUJ A;  4AMY A;  1MG2 A;  4CC9 A;  3AFC A;  1GOF A;  1BPO A;  3DDU A;  5I5I A;  4CI2 A;  4GQB B;  1P22 A;  3I7O A;  3KRW B;  2H14 A;  3OKY A;  2H13 A;  4DNU A;  3RN0 D;  4AEZ A;  2QXV A;  3W15 A;  1GG2 B;  3VI3 A;  3J81 g;  4WK0 A;  4LGN A;  3IUQ A;  4MK0 B;  3I7L A;  4J78 A;  3OTT A;  2AH1 A;  5JWZ A;  4NBM A;  4J87 A;  4D6V A;  4Z7N A;  2YNP A;  5FQD A;  1SHY B;  2H9P A;  5EAM A;  1OMW B;  5M5T A;  2OVR B;  2VDN A;  2QC5 A;  1N6F A;  2GNQ A;  2B5N A;  4OWR A;  3MXX A;  2B5L A;  5SXM A;  1PGU A;  5C2V B;  3SWS D;  3AH8 B;  4G55 A;  5CXC B;  5EMK B;  4J82 A;  5H17 A;  2HU5 A;  2I0S A;  2IWK A;  3L4M D;  2HU8 A;  4FAN D;  2AQ5 A;  2PBI B;  2VDO A;  4NAA A;  3SFZ A;  5K1C C;  3IIY A;  4CZV A;  1RI6 A;  2I0R A;  2HXC A;  3JRO A;  3ZE0 A;  3ODT A;  1GP2 B;  1H2Z A;  1I2M B;  2CN2 A;  4A08 B;  3FM0 A;  4E5Z B;  1U8C A;  4L1Q D;  5IJ7 E;  4CI1 A;  4JT6 C;  2G99 A;  5FLX g;  4UI9 R;  4G56 B;  5B4W A;  3RSE C;  3F3P A;  3CFS B;  5C2W B;  4XYI A;  3JZH A;  3DXM C;  5CXC A;  2P9U C;  4PSW B;  5HE0 B;  4JXM A;  1SQJ A;  4X63 B;  3V4P A;  4JHP C;  4DNW A;  4KFM B;  5AFU 3;  2BBK H;  4IRZ A;  3EI1 B;  2OK4 A;  4BUJ C;  1YFQ A;  4ERZ A;  2IUP A;  4GM8 A;  4A08 A;  4A0A B;  1UTC A;  2H47 A;  3I7K A;  4E5Z A;  3UVK A;  2HJ4 A;  4J73 A;  5FFO A;  3SBR A;  3JRP A;  5HDB A;  4CZY A;  3IJE A;  3PSL A;  3EG6 A;  5FFG A;  5GMK n;  1E8N A;  4H5I A;  1H2X A;  1M1X A;  4X3E A;  2XL2 A;  3UVM A;  2VZ1 A; 
#chains in the Genus database with same CATH homology
 3SN6 B;  2P9K C;  2P9L C;  4BH6 A;  1JMX B;  1A0R B;  4XEI C;  4ZN4 A;  3A0F A;  4O1Q D;  5FKR A;  3EI2 B;  1JMZ B;  4IA9 A;  2H6Q A;  3EI1 A;  3EWE A;  4A09 B;  4FA9 D;  3JZN A;  2CN3 A;  4CZX A;  4A0A A;  5TDH B;  4J0X A;  1TBG A;  3SMR A;  4GGA A;  2HKR A;  2Z2O A;  3VGZ A;  3C99 A;  3AL8 B;  4HDJ A;  3EMH A;  4PBY A;  4GQ1 A;  2I0T A;  2AGL A;  4X61 B;  3EI2 A;  3GRE A;  4AOW A;  3FRX A;  4A2M A;  2YNN A;  5HE2 B;  4PC0 A;  3JZG A;  4GZ8 A;  2G9A A;  3DXK C;  4A09 A;  3JPX A;  3JAM g;  2CNX A;  2OIZ A;  4IMM A;  5HQG A;  3NVX A;  2CE8 A;  3EI4 B;  3AL8 A;  4A2L A;  5TEF A;  2HJB A;  4J8B A;  4JT5 C;  1B9Y A;  3C9C A;  1K8K C;  5GSA A;  4A7J A;  3CIK B;  5HYN B;  3VA6 A;  2J57 G;  5CYK B;  1U4C A;  3CFV A;  3PVU B;  4ZOZ A;  1PBY B;  3OKT A;  4R7A B;  5I5M A;  2IUR A;  2H9N A;  2W18 A;  5C9Z B;  4K3I D;  1NR0 A;  5AJA A;  3MMY A;  2H6N A;  1Q47 A;  2AGY A;  2OJY A;  3P4F A;  3EI4 A;  5FKS A;  5IGQ A;  4PNK B;  2B4E A;  4Y5R D;  1JJU B;  4O3T B;  5HE1 B;  4YVD A;  3NVN A;  5CYK A;  3I89 A;  2Z2N A;  4QT8 A;  5EML B;  1OLZ A;  3EI3 B;  4QL1 A;  3MZK A;  3L4O D;  1B9X A;  4ZOV A;  1L0Q A;  1JOF A;  4GM3 A;  4FA1 D;  1SQ9 A;  2YB8 B;  1XIP A;  3SBP A;  2CO0 C;  3N0E A;  4GM9 A;  4J79 A;  2PM7 B;  3BG0 A;  1ERJ A;  3PXS D;  1U2V C;  3I7N A;  3KRX B;  4J8G A;  4O45 A;  3UVL A;  4GMB A;  4L3H D;  3EI3 A;  2YNO A;  4N14 A;  5GXI A;  3PSC B;  2TRC B;  4BL0 A;  4PXW A;  4J77 A;  5GXH A;  2I3T A;  3HFQ A;  4EWR A;  3PE7 A;  2J56 H;  3ORV D;  3V9F A;  5K19 A;  4FWW A;  3BWS A;  3MZL A;  2I3S A;  5EMM B;  3VH0 A;  3EU7 A;  3I8C A;  3OW8 A;  4L9O A;  4ZOX A;  3B7F A;  5I5J A;  3RN1 D;  3NVQ A;  4U1E I;  3BG1 A;  4CY5 A;  3E0C A;  4J81 A;  4X60 B;  5IGO A;  1QNI A;  4J0W A;  1GXR A;  2AGZ A;  3AL9 A;  3UVO A;  5EAL A;  3C5M A;  4JD2 C;  3IJC A;  3IIW A;  1R5M A;  3V7D B;  3FGB A;  5AMS A;  5EAP A;  3DSM A;  5FKQ A;  2YMU A;  2H6K A;  2MTA H;  4I79 A;  2P9S C;  4PSX B;  3I2N A;  2OVP B;  5A2Q g;  2GC4 A;  5THA A;  5TEE A;  2P9N C;  3C75 H;  3SCY A;  4CI3 A;  1TYQ C;  4LG9 A;  3SXT D;  4CI8 A;  5FKT A;  2AGW A;  3OKW A;  3IKO A;  2OK6 A;  3F3F A;  4GGD A;  2P9I C;  4CY1 A;  4FA4 D;  4QQE A;  5FXY A;  2J55 H;  4FAV D;  2UZY B;  4GQ2 P;  2EBS A;  4CY3 A;  2GC7 A;  3DWL C;  4ERQ A;  2XYI A;  3RMZ D;  5IC7 A;  4OZU A;  4O3U B;  4U7A A;  3JB9 L;  3K26 A;  3RFG A;  3ULE C;  1PI6 A;  4LG8 A;  4H5J A;  3UVN A;  2AH0 A;  1NEX B;  1XHM A;  3OL2 B;  4Y7R A;  3RFH A;  2CO0 A;  5KDO B;  2H68 A;  3MKQ A;  1PEV A;  4PBZ A;  3SBQ A;  3SJL D;  5H14 A;  2IWF A;  4JSN C;  1GOT B;  3UKR C;  4XYH A;  5H1M A;  3GFC A;  3RRM C;  4ZOY A;  2B5M A;  3RLM D;  4NSX A;  1FWX A;  4JSX C;  1MG3 A;  3U4Y A;  2XU7 A;  4JSV C;  4D0K A;  4ES0 A;  3I7P A;  1N6D A;  2O9K A;  5IJ8 E;  4O9D A;  2IAA A;  3OL2 A;  3IJ1 A;  4FHL A;  3F3G A;  4ESG A;  2PM9 B;  4J84 A;  2XL3 A;  4TZ4 A;  4A0B B;  4L3G D;  4ERY A;  4E54 B;  5EMJ B;  4JSP C;  5TF2 A;  5CXB B;  2Z2P A;  2CE9 A;  2HYE A;  5IT9 g;  4A11 B;  2P9P C;  3PVW B;  3UKU C;  3V5W B;  2IUV A;  3ZWL B;  3PXT D;  3MKS B;  2H3X A;  5HE3 B;  1VYH C;  2PM6 B;  5EM2 B;  5FA5 B;  3I8E A;  3SHF A;  1K32 A;  2PM9 A;  2HES X;  2H9L A;  1MDA H;  2UZX B;  4A0B A;  4CY2 A;  3SVW D;  4K3J B;  4E54 A;  3K27 A;  1S4U X;  4Z8L A;  4FB1 D;  5CXB A;  4QRJ A;  3PXW D;  5EAR A;  2AGX A;  2IUQ A;  2H9M A;  2OVQ B;  3IJ0 A;  3OKY B;  4A11 A;  1XKS A;  2Q7Q A;  3UR4 A;  1N6E A;  3DM0 A;  4GGC A;  2YBA A;  2BCJ B;  4FA5 D;  3I7H A;  2HKM A;  5EM2 A;  3SLE D;  3J80 g;  3N0D A;  4J86 A;  1MG2 A;  4CC9 A;  3AFC A;  5I5I A;  4CI2 A;  4GQB B;  1P22 A;  3I7O A;  3KRW B;  2H14 A;  3OKY A;  2H13 A;  3RN0 D;  4AEZ A;  2QXV A;  3W15 A;  1GG2 B;  3J81 g;  4LGN A;  4MK0 B;  3I7L A;  4J78 A;  3OTT A;  2AH1 A;  5JWZ A;  4J87 A;  4D6V A;  2YNP A;  5FQD A;  1SHY B;  2H9P A;  5EAM A;  1OMW B;  2OVR B;  2QC5 A;  1N6F A;  2GNQ A;  2B5N A;  4OWR A;  3MXX A;  2B5L A;  5SXM A;  1PGU A;  5C2V B;  3SWS D;  3AH8 B;  5CXC B;  5EMK B;  4J82 A;  5H17 A;  2IWK A;  2I0S A;  3L4M D;  4FAN D;  2AQ5 A;  2PBI B;  3SFZ A;  5K1C C;  3IIY A;  4CZV A;  1RI6 A;  2I0R A;  2HXC A;  3JRO A;  3ODT A;  1GP2 B;  2CN2 A;  4A08 B;  3FM0 A;  4E5Z B;  4L1Q D;  5IJ7 E;  4CI1 A;  4JT6 C;  2G99 A;  5FLX g;  4UI9 R;  4G56 B;  5B4W A;  3RSE C;  3F3P A;  3CFS B;  5C2W B;  4XYI A;  3JZH A;  3DXM C;  5CXC A;  2P9U C;  4PSW B;  5HE0 B;  4JXM A;  1SQJ A;  4X63 B;  4KFM B;  5AFU 3;  2BBK H;  3EI1 B;  2OK4 A;  4BUJ C;  1YFQ A;  4ERZ A;  2IUP A;  4GM8 A;  4A08 A;  4A0A B;  2H47 A;  3I7K A;  4E5Z A;  3UVK A;  2HJ4 A;  4J73 A;  3SBR A;  3JRP A;  4CZY A;  3PSL A;  3EG6 A;  5GMK n;  4H5I A;  4X3E A;  2XL2 A;  3UVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...